4PI0A

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell) soaked in copper
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
390
structure length
390
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMVLSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLEHYGISRVYAWHLPWMAVGAAWIFFWFVRKGIITSYIRVAEGKADDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKENVTTELNGGVYKVPGRELTINVKVKNNTSQPLRLGEYTAAGLRFLNPDVFTTKPDFPDYLLADRGLSVDATPIAPGEAKEIVVKIQDARWDIERLSDLAYDTDSQIGGLLFFFSPDGKRYASEIGGPVIPKFVAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords unknown peptide
total genus 94
structure length 390
sequence length 390
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4pi0A02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 4pi0A03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4pi0A01
4PI2A 3RGBA 1YEWA 4PHZA 4PI0A 4O65A 3CHXA 3RFRA
chains in the Genus database with same CATH superfamily
1VIBA 2R4SL 4QDGA 1UH4A 3BVTA 2W08A 4L8SA 3BTAA 4M8RA 1MHEB 4F8LA 1JZEA 5JXHA 2H94A 4K4KA 5FHBL 4R7VA 5LUMA 1MQ8A 5I1DB 2RR13 3OD3A 4X8CA 2ZGTA 4LGPB 3WKNA 2XQXA 4DMIA 1Q86W 2IAMD 3UC0L 3K72B 4NI3A 4W9FC 1QO3B 2K3TA 2WP3T 4G71B 3RFZB 4XETA 4QUOA 4P5KB 3RI9A 4NTWA 3MLVH 5IYBO 5F5IA 4K7JA 4CDHA 3RYIB 1B4JH 4E68A 2EILC 5ITZA 3ME0A 2GVYA 1OCOB 1A22B 3OR7A 1LMKA 4UNTA 5E2WH 4MA3A 2XQBL 3CRMA 2BY2A 3DHPA 3KJ4C 3IMMA 2Y5EA 4GRMA 1JG9A 3DROB 4WKZB 3O41B 2ZE8A 2ICEB 3GMLA 1HCYA 4RGMC 4JANA 5K9QI 1HZKA 4BR6A 3KPOA 1LE5B 5KYWB 1FYTA 3LF7A 1N8ZA 1EVUA 3K2IA 4GXVH 4AIOA 4WFGE 1TME2 2XN2A 2PZSA 3HUJA 3WTYA 2OZNA 3AMMA 3CZLA 2UU9B 2WNVA 3QDME 1MCWW 5L6YH 2FWOA 5BOJA 3D6EA 1FNHA 4H0GA 5EC2A 1TUBB 3CVIL 1FL6A 2WKGA 2CDEA 5DVLA 1FPN1 4GRWH 1BX2A 5GS0H 4ZODA 5IK4A 1FJGO 1V6LA 5BV7B 4GMTL 1QX1A 4DW2H 1ZLDA 2E7BA 5EPAA 2WLIB 3ZPYA 3CZJA 4N8PA 3Q01A 2KXLA 5BUPA 2BNUB 1SN2A 1T1XA 4A7YA 2PYLA 1AZUA 3MRDB 1OKEA 3ZKMD 1ZGLA 3SDLA 4JFPA 4YHKL 1F4XL 3F6JA 4OF0A 1JVOA 2J1SA 1AS8A 2XDVA 1QSED 2YI9A 1KYUA 1XIWC 4HJ0D 3S0PA 5IYDO 1CAVA 4E9XA 4R26L 1FC2D 2QTEA 4IEQA 3VBSA 3BP5B 3SDCA 2VWKA 3PHOB 3QBTB 4XPBH 5FF6B 1LU1A 2CLRA 4UT5A 4K0KO 1NLBL 4Z18A 3V79C 5KXBA 3RYMA 1NAML 3APOA 3FCUB 1FYTD 1FFRA 1SQ4A 5C3LD 2EVIA 2DVAA 3AKSA 4FPCA 3ZYFA 4SBVA 5F96L 4GW4A 3WBDA 4JI6O 1YYMH 2P49B 1EBOA 4LPUA 3ZZLA 3DSQA 4A2LA 1X9TA 3S5AA 3MGUA 3O3BA 4X1YB 4GW5A 3ZXLA 3FTWA 3MRHA 4XE0A 4KHPO 3E8FA 2AK4A 5F3CA 2YD9A 1QNWA 5FYIA 3OMZA 2PCPA 1G9NL 4MA7H 3CZUB 4U49A 4APXB 2FVNA 1SBSH 4OFVA 2MIZA 3EJZD 5FW6A 4R4XA 2YN3A 4HWZB 4XOGA 1IXMA 4YLBA 1QR4A 4EZJA 1LNSA 3B2MA 2YPLB 1TFPA 3GBLA 1A21A 5BRZA 3WW3A 1EPWA 1RK1B 3F62A 2OT5A 3K5NA 5EZWA 2IH1C 1SYVA 4DRXA 3HZKA 1K8AW 4G5ZL 4X6DB 4NRXB 1SQBH 2NNCA 2IADB 4I2OA 2J8UB 2YUWA 4LSSL 2FEDD 2QWOB 4N22A 1VRH2 3CVDA 4U1HA 4P14A 1G7PA 4XGZB 2G60L 3RWHB 1AOZA 1L7QA 3EFFB 4ILDA 4L2YA 2ITCA 4GH4C 5IVFA 5HGGS 4U1LB 4DP0X 1P69B 4LHJB 5ITBH 1W8EA 4KY2A 3BC9A 5DUPL 5KUKA 2P5BA 3ILQC 1O8SA 3G4SV 4UXNA 5F1OB 1YFUA 5FY4A 5DJXB 5JXAH 4YOKA 3KGTA 5HHME 2JRIA 1DYKA 4HONA 1CICC 4BYYA 4ICXA 1RZFH 2ZPKH 3ZTDC 5DAPA 3VAEA 1CD9B 1TQWA 3KPPB 4QLRA 4RGOL 3BO8B 1TMQA 1K8DA 2ZOTA 3MRRA 2P3JA 1AR81 4FZ0A 1GGIH 5DHEA 4GY4A 4X7TA 4N90D 4LGSB 2R32A 1JWMA 4YK4C 2B1IA 3AY4A 5CZVH 2OI9B 1FGVL 2QSCH 1OFSA 2WNGA 3K2UL 4FQ1L 4UZGA 2WPGA 2JELL 2F68X 3JV5A 4MD5A 4XNAA 3ST7A 4HFUL 1PP9H 3GZUC 1S5HC 4BYHA 1KKCA 3P11L 3DOSB 2EC8A 4ICWA 1OHHG 4LVOC 1ZLSL 4WSKA 2WDBA 5M0TA 3OKNB 1B4JL 5LB1A 5HYSA 2BVPA 2R9HD 2Y69B 1BLZA 4U1NA 4GWNA 5EULV 4H44C 1DCLA 4A6YB 4UTAL 4YG6A 1Z32X 2QLYA 4MA1B 3S0MA 1UM4H 1W28A 5IJDC 4RGNB 2CK3G 4M6OH 2WLNA 2A3XA 5IJBC 2Y7OA 1LJ7A 1XYPA 1NS1A 2VCOA 3R6SA 3ZRWA 1QWRA 1YA5A 4U7NA 5ECJE 1MHCA 1J8KA 1NDTA 2OUHA 2DQTH 5LNEA 4PVBA 2PW1B 4D9QE 1ZVNA 4M6ML 2VZRA 2YSTA 1NE6A 1EEUA 2LVEA 2YK1L 4N4YB 5BZDA 2UXFA 2ARWA 1N36O 3H9SD 1EQWA 5B1CA 4N90E 1IQWL 3PNWB 4TLTA 4MGSA 1D9KB 1LDSA 1TIUA 1CQYA 3FU6A 3VDBA 1J9RA 1QG3A 3CCHB 3K6FA 4FLYA 1QDOA 5SV8A 1X9RA 1U41A 1UZ8B 1Q8SA 3VU2A 4IDZA 1ND2A 2Z4TA 3FPXA 4IL7A 3POEA 5IK3B 3QUMA 3LNDA 2L9LA 1DQTA 5L9BA 2NR6C 5GALA 4FQZA 1MJUH 3Q8CA 4GT0A 1IIKA 3JALB 4UYBA 1HQRA 4BW9A 2QQKH 2WQZC 1HWHB 4K1ZA 4CCDA 2EE2A 2ZUSA 3AL6A 2XN9D 3BP4A 3VRJB 5AEAA 4JQIH 4RQPA 1GYAA 3RZCB 5D2AA 2ZNJA 3H50A 2WSKA 3QE5A 5D9SB 4N2KA 4QGTA 1UWWA 5F0LB 2B59A 4KWLA 4GIQA 5F0PB 1EGJA 3HNTH 3I50L 1HIML 3VFRA 2AEWA 3K46A 4M03A 5J9PA 1NOVA 1CDBA 1MFDH 2G3XA 3T2NH 3UEZA 3JASB 3G6JA 1KFGA 2HJFB 1BGXH 3QJUB 5FXVA 4MA8H 5GQBA 4RRPA 3GBNL 2R2HA 3FO2A 4LO5B 1WV7T 4I48A 1CCZA 1YWKA 1BZKA 4KHTL 5JR1H 1EMTL 3KXFA 3R65A 3QISA 1WAPA 2AZ2A 1AFVL 3VMNA 1ENXA 1JH5A 4TMPA 5DVOA 5TE4L 1XF3B 5JLZA 3A4UA 1KBGL 4B3NA 4AT6A 2IBZX 4HT1H 1J1LA 5J1AB 5AVPA 1R5IA 1UD8A 3LKOB 2VPVA 1WD9A 2VABA 2BSTA 1KJRA 3EHBC 1WLCA 3RWCB 3CFEB 1DFQA 5H4YA 3P6BA 4A41A 2F54D 1GS6X 1Y67A 1X4ZA 3NEOA 1OT5A 1IQWH 2DIAA 3JSSA 4PQQA 2F7IA 3I9GH 3T77B 3LQMA 2IANA 4G8FB 4PJGF 4OXSA 2YN5A 3WFDH 3WUZA 5LEJA 3OB8A 4O51B 5EXOA 3EB7A 3WQ1A 1TVBA 1PGRB 5SX4H 6TAAA 1IEHA 4FMFA 4GI6A 3JQOB 4M7LT 1DQ0A 4NENA 3X14A 3BPOC 4J12A 1SVBA 3GIZH 1TME3 2FDJA 1NGXB 3B9IA 5JJNB 4PJCA 4JFYB 5BMVA 1OAZL 3FQXB 3HEIA 5I24A 5TDOA 4ZFGL 1N33O 4OZ4A 3EYPA 4IERA 1H3WM 2CAKA 5J48A 4TQDA 3JARA 1DQMH 1G0XA 1OTUD 2WUHA 5GGVY 4LH6A 1C5IA 2DWEB 1Z2KA 2A6WA 2PQQA 1ZLUH 5T54A 1R3HB 3QZLA 4X9FA 1AF9A 4D9LH 1B35A 2CBQA 3AK1A 2ZHNA 12E8H 3AWFA 4Z5RB 2VMFA 1E42A 1CU4H 4OSUL 5F9DC 3STLB 2P4VA 5HYQB 2WLIA 3G6EV 1UTDA 3TXSA 3OG6B 3KLDA 4L8DB 5CZVL 5JOZA 3BVDB 1X9PA 4UAOC 5J13C 5IQOA 4YSCA 4W9LC 1GGIL 2CRMA 1D7BA 2X3BA 1ID5I 4BZ2A 4KI1A 5K69A 2J22A 4PS4L 4PHXA 4JMXA 3QYCA 4BQ1A 4MCZB 4N8CH 5C71A 1ZZ6A 4A67A 1RP8A 1IAIM 2YD6A 4CC4A 3QRBA 5FR3A 4M62H 4N9GB 4X5XA 4QRRA 3E2EA 3U07A 1P49A 2B9VA 1ZZ9A 2DQEH 1OOWA 2Y36L 3CDFA 3VFOA 1ZCRA 2X44D 3RKDD 3K6DA 5GKAC 1BBJA 4DB5A 4QPYA 1LO0H 3MTXA 1BV8A 1IJNA 3GMLB 1AYN3 3O14A 3V55A 2XJUA 3FT4B 1JZ8A 3MRGA 3ARRA 4QCIB 1W99A 3VQYA 1NGQL 3CH1B 1BBDH 2J8HA 1ZV9A 2FWSA 3KLKA 1JTOA 2JJSA 5SWZD 1BVKA 1I1FA 3IMRA 1QF3A 4JFQB 3WKQA 2BW4A 4KDTA 5GPRA 4KJYA 4Z7VE 4X0NA 3E89A 3D06A 3WN5A 1HW7A 4XP6H 3TFKC 2RS31 1VZGA 2Q8OA 2KDGA 3ALXA 3K48A 1CFNB 4KBZA 5FPXA 5HYQA 4ZTPL 1UD1A 2J8UE 3ILQD 4L9LA 4BZ4A 1RMFL 4W4NA 2YOCA 1NBVL 2NYYD 3Q2WA 4ABQA 1MS1A 5L4JA 4Y4YA 1UM4L 2HT3D 2WLYA 4DOHE 4I0KA 5EO0B 4PJ7B 2DEWX 5JIMA 3KPNA 4F58H 4PWHA 4FFWD 3B7MA 1EZJA 3NIGB 4QHMB 5DJ2B 2IPKB 4O4HA 3GGWB 4K55A 5D8AC 5BMFH 4HMCA 5C5UA 2CGRH 4Y1XA 3BKCH 4JDTH 5CBAA 2K6YA 1JPSH 3FQTA 2HVKA 4O02B 5JXED 4XJAA 1HN1A 3WX5A 4OHZA 1EHNA 1LR5A 1VRBA 5DVKA 1I7UA 1KEGH 4P4KC 4LF4B 3FO9B 3CMGA 5ABJB 3L45A 4N2BA 3HE6D 2KZKA 5SWZA 1Q9OB 4TNWK 2QT6A 3IC9A 1J05B 5CWSA 1AH1A 3DI3B 2AV7B 2OYMA 4E2SA 2VDRL 3RLSA 1RSOA 3W1ZA 3WFCH 4KRLB 3UYPA 3VE0A 1MZFA 3OMIB 3QRGL 3EO0B 5DHDA 4FTVD 3KEDA 5J56B 5IVNA 5FPUA 2OMVA 3V7AE 1OP3H 5DSCB 3OR6A 3C3VA 4U2YA 2X89D 4QY8A 5IM7B 4RGNC 3VB9A 2B8OT 4WFAV 4KXDA 1DQQA 1NC4D 3ZMTA 1YDPB 1VKXA 3BVCA 5DJ8B 5FOBA 1B3QA 4NUGL 4NQUA 4U3XA 1RUD2 2XT1B 1Q81W 2Y64A 4BSWB 2ARBA 2VDNB 4LOSA 3UDWA 2QQIA 3T9WA 4AYID 1LVEA 4GP4B 3EDEA 5AL8A 1LAJA 4OCYH 4UM8B 3WEXA 2HTLC 4XPHH 5DEFB 4AEFA 1ASJ1 3DETC 3GS0A 3MYJA 4Z8BA 3MFFB 3Q6FB 2X41A 1TJXA 3FN3A 4JTOA 4NQCB 4IE6A 4XP4H 1S9WB 1YITV 1ZA7A 2DEYX 2ZPKL 4OFQA 4INDA 2ZYIA 3K5RA 1GH6A 3IDGA 5IY5C 1X3DA 2AS5M 4X80H 2ZGQA 1G7IB 2YFNA 1O5DT 3BUPA 3MLRL 1IU1A 4FZEH 3TA3D 5KAQG 5K9OB 4NN0A 1SFDA 2WTOA 3K74B 3VRLF 4IKJA 1PLGL 3BOPA 4GJZA 4K3JL 1K3IA 3ZSEA 5AAWC 5KBLA 1HWWA 3MO4A 5FZDA 3VZMA 5EO9A 2K2SA 3RGVA 3QIBD 4C56A 5TDNB 3EO0A 5A3PA 1I8MA 2DYRC 3ZYBA 4XBEL 3HG1D 3ARFD 5A7QA 1YEDB 4DJMA 4KQ4L 4K23H 3M8LA 3POCA 5L3FA 4YFLF 1NC4A 3QO5A 5K9OA 4UQ3B 1Z5VA 5DGQA 1XNKA 2EH8H 4IRSD 1ONAA 2KG7A 3ZRXA 3VX1A 1GZ9A 5FZKA 4F6RA 3S3XA 4JO2H 3UJQA 4IK7A 4FLVA 3OGRA 1PJ9A 2NLJB 4FG6D 4ZPTB 4LTAA 5FUPA 3NCYP 2OL3H 4ZX4A 3T2OA 4CRPA 1A78A 1VALA 1OK8A 1NEZA 1LHZA 1QPXA 2NRDA 4NXMO 2NY2B 1WCQA 2E46A 3P0YL 4Q8BA 5H35B 3VGAC 5DUUA 1E8ZA 2QQOA 3ARDD 2NY0D 5LYJA 1OANA 4PGZA 4LCWA 4MBOA 5I9QC 2BC4B 4RAIA 1NCCH 3FT1A 2UUCO 3D33A 4V2WA 2Q1EA 4X98A 4XMXA 3ARUA 3RTQB 1XF4B 4CSPA 1ES0A 3GSWB 4DWHA 1JGUH 1TLMA 2HG5B 3LXCA 4HS3A 3U4EA 2HWB1 2AGSA 1BDYA 3ACGA 5A7WA 1SLVA 3LZLA 3V0DA 3F2ZA 3CFCH 4ODHH 3QIBB 3W7SA 4CGUB 4O4IB 2I7SA 2NMNA 3WSOA 1VFBB 4P2YA 1B4TA 3WDXA 1GNHA 4WFEA 3IDNB 1U93B 1MCOH 2E7MA 2WZPD 1MDTA 2RS33 3E8UH 3QO8A 3K8KA 3A0OA 5LBQA 4L8BB 5GGTL 2HWE3 5D1ZI 3ZE2B 1OLME 2ZKLA 2Z35B 2YMOA 4FJCC 1YQ6A 2WGNB 4A7SA 1EBAA 4IBYA 5LY1A 3LRMA 4CW1A 5CWSB 2A0LA 2VN6A 3H3KA 3U14A 1PQZA 3I56V 3DPBA 1GY1A 3QNXA 3FU7A 4LHUG 1SQ2N 4LLDB 1PNLA 2CHNA 2MQGA 1UENA 4KU7A 1MFCL 4AFMA 1VFOA 1TQCC 2QTSA 2F58H 1MIEL 3P9MB 2WP3O 4LIQE 5EIYB 1TSRA 5F3HA 4UIMB 1QAWA 2PI4A 1EO7A 1W8NA 3FE5A 4XWGH 1CE6B 2RJMA 4RISH 1WCBA 4DV5O 1V3KA 4ZDHB 5HHVL 4F2FA 1HB2A 5KVMC 1DJSA 3DJTA 1UN1A 3V4LA 3WHTA 2F5BH 3DRTB 3MREA 5B4NA 1SC5B 3CHXA 2VERN 5FUIA 3C2AL 3EYQD 3KCPA 4JUTA 5CU5A 1GGCH 2GBUA 4YO0B 1SYVB 2FECI 32C2B 4JLRA 3VFPA 1UQSB 4I77L 5EU5A 5A43C 3RWGA 5C3IA 3PMSA 3O6KL 5C9AC 3F7VC 4F6EA 4XT1C 2C1OB 4LCYA 4K73A 1EPFA 2Y0SA 1ZHLB 4QXUL 1K4DC 2JNZA 4YGCA 1A0QH 3F8UB 4HWZA 4X66O 5I6NA 4Y4HD 3ZR5A 4N2CA 1LUWA 2ZE7A 4WEUD 2J73A 4ZOCA 3CH1A 1DQIA 1HRV1 3TH2T 4LCCA 5I1JH 3NT0A 3A7QA 3EZ8A 1O5LA 1KLGB 1N59B 4QXCA 1IBDA 2VRQA 5AL0A 1W2TA 2XN0A 3OJMB 1XNRB 5GGQH 4A7QA 4ZMZA 2P8PA 3APBA 1YPZA 3NFNB 2ZP8A 3GWJA 3CPLB 4M9PA 4BH9A 5DJYB 3EGSB 3LDBA 5FUOH 3S5ZA 4JVWA 2LGQA 4H8VA 3X3FH 3EDJA 5I16B 1OF4A 2IQAA 2R27A 5DFVC 3ZHVA 3MV9B 4OLXL 3U7YH 5DEDA 3BQVA 8PAZA 5LDUA 4JI0O 1GN6A 3H1KH 2FJUB 3PHOA 4G8AC 4PG2A 4RSYA 5ANME 2YBRA 1RAMA 2QQMA 2WJSA 2GIYA 3L5XH 5FYLL 5C08D 4YFEA 1PK6B 2A70A 4LK6A 1GMGA 1BFOB 4BDVB 1A34A 3FTUA 2F54A 1JZHA 3OKOB 4JJHA 3M70A 4FXGB 2NUPB 4LCUA 4UMSA 1ZRUA 1JNLL 4RZCA 3WB2A 1KXHA 1OARL 2HTKC 5IQNA 4DAGL 1U3HB 3ETEA 1ASJ3 4NRPA 4E42A 5SV3A 4BA8A 1T0OA 4PVMA 3L6FA 4NQEA 1CGPA 3MRNA 2ZMNA 2VKXA 1FPTH 4LCWB 2JIZG 1SZNA 4NIYE 1CLZL 3WQ7A 1DU3D 2EAAA 4UFZA 1M71B 2V9QA 4UFLA 1MCKA 3VXQB 1EM1A 2C8NA 4DKEL 2JJ6A 1R092 4P08A 5IK8A 3EYFA 1KSRA 4PGCB 1UH2A 2LGWA 5C9AA 2FB5A 3LIUA 3DK2A 3NABH 3V4VL 3HBKA 4YLZA 2BSSA 2D7MA 5DUBB 3BABA 2WNWA 1SHXA 4HLTA 3IMNA 1UT1A 1J9SA 2VR3A 1ZDQA 4H20H 4O00A 1MS3A 2VCAA 3EDDA 4O9GA 4WWKC 4F3JA 3OAAG 4AVAA 4MJIE 2EIJC 4KBPA 3RT3C 3UZQA 1AAJA 1GQHA 2JIJA 5DZ9A 3VFTA 3KPLA 1QWHA 1LO2L 2ZAHA 3DVNA 7PAZA 1UHVA 2OM5A 4ZD3L 3VBSB 2WZ6A 3T8MA 3CFEA 4G9DA 5T33H 4FCHA 2BGOA 2VM9A 1RHFA 2BDNL 5EFIA 3NCJL 4TXVB 2IWFA 5F7WC 2ADFH 3L74H 3L4XA 3RTQD 2DWSA 1G9MC 3PP4H 4H25A 5E1GA 4ELMF 1D9KA 5HHOB 2XG4B 3QIWA 1CQ9A 1S2BA 1EAQA 2E5EA 3ISWA 4X9YA 5F3BA 4YHML 2UY8A 1NMAH 4ZO8A 4GBXB 2X89A 4E4DX 2R8SH 4P4RA 2W1SA 1RUJ3 3JD71 4KDTC 5EEUA 1CDIA 1KNOB 4TXWA 2IPTL 5A32B 2D5HA 1Y74B 1S7WB 5SWSA 3CJIC 1K97A 3KHQA 1BHGA 4L18A 2DWXA 3ZVXA 4WFGD 3BIWE 1K8IA 3FYIB 2G5UA 3QNFA 4W9GC 3UPCA 1I9JH 3G08A 3WVJA 4AL8H 3LD8B 4FOVA 3EOYG 2Y38A 1ZJAA 4JM2D 2B3RA 2OS7A 5LGHL 1A6ZA 1XYOA 3MLRH 3THMH 1DVFD 3JAWA 1E4XI 1YO4A 4AR2A 2J6EH 2AGAA 5AYQA 3EG9B 2V5SA 5T5FL 5LW9A 4NO0B 5IMLA 2VQ1B 1L0NH 1FFXA 2NY2C 4O9EA 2W9EH 3ZFFC 1KB5H 4Z0BH 4YFZA 4Q4X1 1GL4B 1MAMH 4FKHA 2VUAA 2F53B 3LKRB 1BVNP 2JKRM 2ZKHH 5CLXA 5TF1L 2VL5B 1FGVH 4HD5A 4FAHA 4O4IA 4UTCA 4XUTA 4X7EC 2XIBA 4LCVA 3UTQA 3FOLA 3L3KB 3D9AL 3DV6B 4BUGA 2NYKA 4QEGA 1FNGB 2DN9A 3NIDF 3VFGL 3HPLC 5F1NA 5LBBA 3CZFA 1MCNA 3NNMA 4CDQC 2ZOKB 5F89B 2XTJE 4IMKC 3BLKA 2KDYA 2VDOL 5BXFB 4ZFOL 4XMTA 1I1EA 1PYWA 2ATKC 1JCVA 3ZRWB 2QADB 1IC1A 3RVUD 1CLCA 1BZOA 1G5GA 1P7BA 4OZHB 5CCHE 3VBHA 5AB9A 4F7TA 1LGVA 1NEZB 2B20A 3IJ7A 3TBSB 5A1AA 2QZ2A 5ESAA 3KH4A 2CAZC 4GMSH 4GKNA 2V8LA 2NLJA 4NZUH 3RWHA 3LYRA 3VFNB 1JA8A 1IGOA 4GRWF 1A66A 1U6AL 3WINE 3L3DB 5CU9A 3EBIA 4JZOB 4L3EA 4R7NA 4CVWA 4D8OA 2QLVB 3JTSA 2OS2A 3BESR 1L7IH 4L1HA 4L9LB 1M5IA 5EYPB 2BOIA 2HYKA 5ISZB 3EQEA 3M7MX 2F19L 1MUJB 2JK5C 3ZX6A 1CFTA 4NC0B 4ISVA 4LBQA 3TONA 3ZFGB 4MWFB 1FH5H 2OZ4L 4JFHE 3V5KB 4FFBA 4XNMB 1CXHA 1PZ9A 2ICWB 2YXVA 3OGCA 4TVUA 43C9B 5EEXA 4M0NA 1C8M1 2R9AA 2JIXB 5TPWL 5DJZA 1FMD3 3KPRE 4HPHA 3CIHA 4HL0A 4LO4B 2GY7B 3V65A 2PCPB 3OUFA 4YAQB 4LBNA 4GMP3 1JXDA 1PZ3A 5GW7A 5DLML 1FOD3 4MO3M 4JDOA 4ZS7L 4FOQA 3BKYL 5AAWA 1ZRIA 3NZ8A 3WG7B 2AZ5A 1B3JA 4JQVA 1QH7A 3A0KA 4XF1A 3RVXC 1PX3A 1S7QA 2V17L 2Q68A 1K4CB 4MB4A 1LYQA 3ZTNH 5IMKB 3D07A 5L9DL 1A1OA 4BKTC 1A02N 1JW6A 4CYDA 4A2MA 3LPPA 4YXHH 4XXPA 3CMAV 5BY5A 1LD9A 4PRID 1JGEA 4K15A 2R1WA 3T0WA 1Z5WA 4G9FD 5I0DA 3F3HA 1CMOA 5HYJE 5F72S 5JOWA 2OJZH 5L9RA 2EP6A 3GEWB 1A2YA 2ZNIA 2UZYA 1JERA 3V0WL 1HEZA 3TIDA 1KPUB 3KQRA 4Z5RA 2QZ3A 4Z7NF 5IM7A 4V2BA 1PPJH 3NSDA 3BHBB 1OPOA 3RWDB 3RVXD 3ZHFA 4QGNA 5F7DB 3G9AB 5ICXB 3U83A 3O2VH 2XAGA 1BZDA 2FECL 5DRWA 1TJHL 1T83A 1KIRB 2P4AB 4LSRL 1KJ3L 1SMOA 4HUUA 1YXBA 2X7LA 4Y19E 3BQUA 1MZZA 4OU3A 3CLEH 2OR9H 2YSUB 3SKUD 3ARGB 1P84J 4ORFA 3MCG1 1O59A 2V7NA 1KIQB 4XDKA 1JCHA 4GKOA 4XJUA 3X3GH 4EPSA 3WUDA 4YDLC 3MU3A 4RGKA 3ZHTA 2SBAA 1WLHA 2CCVA 2WNOA 2N0MA 2MHAB 2YD5A 4NHKA 3H9AA 4F7EB 5I0WA 4YHMH 1Q8QA 5AZEL 5E6HA 1RUOA 1EN6A 3ISRA 1VRH1 1HQ4B 2F74A 1JQ0A 3RL2A 2DBIA 1O7DC 2VN3A 3TL5A 1AZZC 4F7MA 2YA1A 5CBAB 3AG4C 4ZS7H 5I1AA 1LOAA 2VNVA 1CI5A 4QX2A 2EXTA 2Z42A 3KWWA 1CAUA 4F58L 4J28A 2WQXA 3AP6A 5GISH 2VOXA 1OB1B 1ZHLA 4PTUB 2WYSA 3L3OC 1EGJL 5I74C 4RFOH 4XVSH 2ERJB 2AHYA 4PGDB 2DBNA 2A77L 2YPLD 4UFHA 5FEBA 3S34L 3VZLA 4Q0SA 5ES4B 1KTLA 2ZIMA 3EBGA 1SS3A 3KDMB 2QKIC 4G2AA 4WI9A 1GP4A 3ESPA 2VDPB 3WIIH 5E6SB 4PB0H 2X2JA 2Y06L 5EWIL 3I2DA 1HVXA 2R062 3UJOA 1KPVB 1I7RA 4DW0A 2DCKA 5DO8A 4LAJH 4XJ8A 3ICXA 1JSYA 1AZBA 2C3WA 1RJLB 4UIMA 4Y4HC 3PIGA 1IL1A 3JATB 4NO5A 1XSIA 4XBFA 1FXVA 2EYSA 4Y7OC 4HOZA 5BV7H 1SMAA 2LGNA 2IXIA 3R7QA 1SJEB 1CFSB 2Y48A 4U7OA 3FT2A 3T0EC 2BWCA 3IXAB 4EF3A 1QQP1 1G7JB 3HE7A 1CP9A 2XH6A 5T55A 1FYTB 3TA4D 3CFIC 4G43B 5KMGA 3T4YB 1UZ6F 1A3RL 1A4CA 3RIAK 5GS1A 3ON7A 4G8EA 3BDBA 4ZD3H 2EF6A 4HU2A 4LF3B 3SGIA 3IIAA 1BKZA 4QXVA 5EO1A 3AP4A 4P9IA 3FJTA 2D03L 2BGCA 1GMEA 4MA8L 2VB5A 4ZMWA 5F3GA 2E5LO 2HT4D 1B6QA 1S3KH 4HHGA 4MXQD 4WI0A 1U93A 1N32O 3H1ZA 3N1QC 3QQ3A 3WW1A 1F90L 4K7PY 4N86A 2V2XA 3NDYE 2XCMC 4JZJC 4LWSA 2R1BA 2GTZA 3N5AA 3NJGA 4JKLA 2YEQA 3PWJB 4IEZA 3B6SB 5L7OA 4JYAO 1V7MH 1JFHA 4HWBA 2FD6L 1SBEA 4AYDC 4UT6H 4O2EB 4GXLA 1JMXA 1R3HA 4JV5O 2JI1A 3QEQB 4WCEV 2VLLA 4B29A 4QKXB 2GB2A 4U3SA 5CZXC 2X4OB 5IOKA 2J6EL 4PJ7F 4HJUA 1AHKA 4MBRA 3V0VB 3M1BB 4PRDB 2VMEA 3Q43A 3LZRA 5K7PA 1SXNA 1QFWH 2X87A 3EH5B 2A9HA 2CA4A 4B3TO 4OBSA 2XOKG 4HZ3A 1WPXA 1ZZBA 4XVOA 1OTSD 3D4GA 4C7UA 4KRPC 2R16A 3MPBA 1ZTXH 5LBVA 2O57A 1N2RA 1PD1A 5CA0A 3MLYL 2J57A 2X2HA 3MUGB 3M3IA 1T3FB 1I8IB 3DHMA 3TAYA 3APQA 4DF9A 1U3HD 4X7CC 4I3RH 1SDAB 5CGMA 3WIIL 4XO3A 1V5JA 5GHWL 1VAKA 4B7IA 2ENRA 1L0PA 2AMGA 1QGLA 1FE8L 2VMIA 5JPNA 4GEJA 3ZHNA 4DPRA 3RWCA 3BMWA 3NCJH 4TSVA 2APBA 4ODVL 1Z9OA 1G86A 1SFYA 2XG5A 1JMKC 1AFVH 2ORBL 2R56H 4NXSA 4Y1UA 1EMTH 3VUAA 5KX5B 2BVQB 4MSWC 3T6VA 1AX0A 5MEQA 5DMKA 3KWVA 4G42B 5C6TH 4DP5X 5MI0C 1FI2A 3HUJE 1NYWA 4CDWB 5IT2L 1W72A 3OC8A 3OSKA 3KVQA 4LNVA 2R0WH 4LLQA 4BZ1H 4PV9A 4F7KA 1HW5A 4FNLL 1WHOA 4LF6B 4L4VB 4BZYA 1V6IA 3D0SA 4XPFH 4MYPA 5F8PA 1G9NC 4IEXA 3ARZA 4P2RD 3DHUA 3WJMA 3VG9B 4OD2B 1DHKB 3AG2B 2ZYSA 3NYKA 1ZEAL 5CA1B 2APWA 2DYSC 2B9BA 3CIAA 3JBG2 3CVHH 3HMWH 4FDWA 4Y4HB 4OIFA 1PO23 2HJLB 4XBNA 4QXTB 3BWAA 4IGGA 1P4RA 2ZDIA 1F41A 2YPVL 3PS6A 3GI9L 3CKHA 3ULVD 2ZACA 4IRZH 5LXTA 2HFFA 5D6DA 4YX2L 3WIFA 4CEYB 1DBJH 5C07B 2YAMA 2ES3A 4COUA 2CAUA 2J4WL 3EJJX 3QAZC 2DI8A 1RUPH 2VLKA 1U92A 5G5DA 4FPYA 3VBUC 4Y1AA 2XV2A 5BV6A 3VN4A 4NZDA 5BVJA 2NTSP 1AI5A 1QOTA 2JSFA 2ZX4A 1ZAUA 2VQTA 4AJVA 1RFDH 4LLVB 3FMGA 4K7PH 3A6BH 3JCZA 2PHFA 3VXUA 5FCCA 3MRHB 4LLMB 4CVZA 1H6FA 1VF5B 1VFUA 1SXZA 1FT9A 5GRJH 4GRLC 1PS3A 2UUDK 1Z5LB 2AJYH 1W9YA 4BOWA 4YXHL 2OJZL 1NM9A 1XQNA 2ED8A 4I89A 3AABA 5CUSH 5BJTB 1IC4L 1E9QB 2O61B 3WD5H 2CLRB 2QSVA 2HBUA 4QQ2A 3RYPA 4NOBA 1OSEA 3K6NA 5JIUA 3N9GL 4WF7A 3IXTA 1UD3A 2BYVE 3I6KB 4JRXA 1VB4A 2HFEC 1G9NH 4U05A 5GTIZ 3UXFA 3NA9L 2ZXWB 2CGPA 1JGDB 4MX7A 3U6RA 5F6HI 1FNEB 1KBKA 2BHUA 3VFVA 2FK9A 1KIUA 4IV3C 5DXDA 3CVHA 1DF4A 4W4OA 3RILA 1KGXA 3B56A 1YRZA 4WFFE 1E27A 5DJ8A 5C0AA 2J7LA 4AC2A 3BJLA 5JOFB 2YUEA 4LITA 2KLRA 4FQPA 3TV3L 1RIUH 2H2SD 2XWDA 5K0UA 4JL2A 5DMYA 1S7XB 1KZYA 1XB6A 5FB8A 2F8XC 2FO8A 1WLWA 4V2VA 2JIGA 4OCYL 1QJU2 2BHZA 2ZGLA 3Q9QA 1JHNA 4B7EA 3CFKB 4KTYA 2A7AA 3HRZC 1FZMB 4R7LA 4U33A 3OWRA 5AW9B 3VD5A 2O30A 1J9CT 3ATBA 3QXAA 4BQBA 1W8TA 3OGSA 5JLVA 4KY1H 4NROA 2K1MA 1PKXA 1AR1B 1ZS8A 1S5JA 1U3JA 4QDQA 1FFQA 4HUMB 4NLHA 4UINH 2ICEA 5INCA 5DD0L 1Q1JL 3H9VA 4GRMB 4MCZA 4OF6A 5HDBB 3A67H 3SQOL 3T8XB 3RIFF 3GMQA 4PA3A 4RSUA 2EKJA 2XPYA 2XA8L 1BXUA 2QELA 3VTMA 4CP0A 4NN7B 4NRZB 2BNQE 5FBJA 5LRSA 3ARPA 3VXSB 5FXCH 4GKXA 4AHYA 3ARFB 2NTFB 5MHSD 2BP8B 3T1HO 4U1HB 2IXHA 1Z7JA 4OYUA 5HCAA 1PMHX 1ZKAA 2GTWA 2QFRA 2VDRH 2P5EA 4IKNA 3STLA 3ZYPA 5CKQA 2JKTM 5DJAA 3B4SA 2X88A 3DPDA 5FLUA 4YY3O 5GJSL 3R7RA 1HRI3 2DUQA 2L7UA 2V7HB 2CHDA 3H9HB 4XX1G 1DTUA 2WWSA 2VISB 3LEIA 4FI9A 2JK5B 3UTTD 1XH3B 4PR5A 4CVXA 3GMNB 2NR6D 1BEV1 2PXYC 1BEV2 1JAEA 4YMPA 4LE8A 4YXKL 4KWJA 4RRPM 5F2WA 1UGKA 3CZKA 3PWUA 4M61A 5AQ0A 1EDHA 1PNCA 4OZ4B 3ZKXB 2UY6B 5CCJA 2OQ6A 5KXEA 1AZNA 2YMXH 4R2GB 3PGFH 5GRZA 4BFIB 3P1IA 1V10A 3EO9L 3HAEG 4BIZA 3GJEB 3DMMC 1J5EO 3TYFB 4X1YA 1WK0A 1WW5A 2RS13 3MJ7A 4JDZA 2AW2A 2R56L 4R7XA 3TYGL 4BH7B 4MD4A 1CJPA 1D5BB 1SLTA 3H0OA 3I9PA 2Z7WA 3DC5A 3ZO0B 3KPSD 4UAPA 4JFFA 3LS4H 4MAYD 3PWPA 2XSKA 5E4AA 5HP5A 3JTBA 3OCPA 2LHAA 1AL22 4KXZI 3PUHA 2ZJCA 4QX7A 1NCIA 2IXCA 5KS9B 1AO7A 3RYCB 2O6CA 2Q7YA 2VWEE 4MJHA 3Q9OA 2J7MA 1P4BH 4N25A 5LASA 5DHYB 2EVHA 4W8JA 3VBRC 1H2LA 3WNKA 4L37A 3CVBA 1RPRA 4YQXL 5E5LA 5CLWA 1ZSPA 3AMQA 1F58H 3MD0A 3MBXL 4ZG1A 5T33L 4MRCA 1CDJA 2CY6A 3M88A 5GGSB 4IEVA 1U8MA 1O6UA 1U5IA 2QWPB 1HSAB 1PLGH 3MN8A 3K3WA 1QTSA 4XTRC 4GUQA 4TVPE 4LAQL 5JPMC 3VQXA 1JOYA 4DN4L 2Y6GA 4COWA 4RMQA 2VDRB 1E2ZA 4LPWA 3TT1H 4AQEB 4CBCA 1Z0HA 1E5HA 4NHLA 4GKJB 2H3XC 4KKAC 3SJVB 5JTWA 1K5WA 2IJIA 4FKKA 1H8NA 3PWLA 1EZUA 2WLZA 2HJFA 3H85A 2RJZA 4K5MA 1SN5A 4N26A 5ADOH 1VESA 3W9EA 2FWOB 4TNEA 3FFDA 4EOWL 2YA0A 1L0QA 2OMWB 4YHLH 4MMYB 4Q7DA 3GJFH 4AYMC 3E6FB 2ZCEA 4NTXA 1JF5A 2FJFA 4Y16B 3FUOA 3RZLA 1DGSA 2CO7B 1FP5A 4HAMA 4N68A 5GRJL 3ULUC 5FQ0A 3D12B 4MZUA 3EGDB 1TTFA 2ZNWA 5IATA 4E36A 5I5MA 1VQ8V 4ANVA 4OHXA 4MT8A 3VNZA 2OCCC 3DUSB 5F7NC 3JALA 1AQHA 2VMDA 1CLZH 3H8UA 1M05A 3JXSA 4GB31 5J12B 2FO4A 1TVGA 1FO0L 3TB0A 3TN91 1QBML 2IMNA 4L2NA 1IARB 2X4RA 1BQZA 3C08H 4YR6B 3SQBA 3ZMVA 5CN3A 4I0WB 4UV4L 5EF3A 2Y4UA 4ASKA 3FYEB 1I8AA 2BHFA 1HXYA 3IFOA 5FUZL 3VFSB 1G0YR 2AJXH 1PNFA 3HT2A 4HG6B 2BOCB 2AC0A 1CE1H 1K85A 2P47B 1RLBA 3K4ZA 3N9OA 1AOHA 2XY2A 4V33A 1EX0A 1UMIA 2DQGL 1AHSA 3UO3A 4PDMA 4AEDB 4COVA 5FA4B 4OLXH 3U7YL 5I5IA 1S8DB 4PJCE 2Z7UA 4DNLA 4HJGA 3SPJA 1KBVA 4KUZL 2CTRA 1MHCB 4MVBC 3F7VB 3VFSA 3VJ6B 5EZOH 3OBZA 4ASLA 4YVSC 1IAKA 3AZXA 4YR6A 3JAKB 3HWJA 2AEQH 4EZLA 5CCKH 2WS93 4YW5A 4PJ7E 4C47A 2Z1KA 4KJWC 5EJZB 4OKVB 2ITCC 3RYHB 3PWVB 4X5WB 2D73A 1UH3A 2IWKA 5D6CB 3SGKA 3V52H 2DCTA 3LKQB 4BHPA 3IKWA 4S2SA 1J7VR 4P07A 1BMGA 3GUFA 3MJ9L 3VHRA 4XUOA 3C5SB 5T1DH 3N2KA 3FQRA 1R0AL 4GQQA 2WWUA 4ZFGH 2VXSL 3P77A 5CR1A 3D18A 1KT2B 4LDOB 4LPLA 1E3FA 3SYCA 1RMFH 4GLRI 4GS7C 3QXDB 4XXWC 3C5ZD 4E4EA 3GIZL 3RWFB 4RMVA 4GAJH 2ZS6B 1AY1L 5A33B 1TZIB 1OH3A 1JWMB 4X6CE 2DW4A 1LEIB 3D34A 3TF7C 5FTTC 1REFA 3IJ4A 5I1LB 5E23A 2DLTA 5B3SC 1WTLA 4QRPE 1R47A 3RUGA 3NCYS 2PTTA 4V1DD 4YDKH 2NY6B 4JUSA 4EN3B 1L7TL 4PJ8C 1A7QH 1TVKB 2HLFD 4UAHA 4YEFA 1QCEA 3SPIA 5DQJB 2A74B 4IRZA 3S7EA 4H0IA 3NNFA 5JW4Q 5F6IC 1OGSA 5I1HH 5EUOF 3LEXA 5I93A 2ODIA 4CN6A 1CTMA 5IWAO 4G6AD 5D1XD 1ZX5A 1TVHA 2QDOA 2QWQB 4YWGH 3OGJA 2AH2A 4IOSA 3UTPE 1AR2A 2Y72A 3Q4HB 3LTVA 3HTLX 4J3OH 1VBA1 4NUMA 4R8WL 1MA1A 4YZ4A 2YKKA 4Z7QF 4DP1X 3ZDWA 1H1AA 1R3KA 2YFOA 1EPZA 1OAXH 1K4DB 1EAJA 3MDPA 3MLXH 1SEFA 4HBNA 1JPFA 5KSBE 4AEMA 3FTSA 5GSVA 3T0EE 3V95A 4NLAA 2OX5B 5ICZA 3CF6E 3QIWD 3LKJA 4FQIH 1P84F 5GIRA 5T8IA 1BJ1H 4ZPVA 1I3UA 4Q4W2 4DZGA 1JIBA 5IJKC 3C2UA 2ZGPA 2OSLA 3MRJB 4JFDB 4PRDA 3EADA 3S35H 3RHWK 3NSJA 5GRUH 5E2UH 4BQ9A 4GH4A 2EUVA 1D2OA 2VJXA 2EDBA 3BI9X 5JQHC 1DQML 1ETZB 3U0TA 3V56A 4YHOH 2PF6A 5LNGA 1EXHA 1PEWA 3X1BA 1NCRC 1MHHA 1HI6B 3T1FB 3VOUA 3KCXA 2GI7A 2VE1A 3B2VH 5C0ND 1CI3M 2CNAA 5GLWA 4XXWA 1EXGA 1YG9A 2E7DA 5SWZE 4XPAH 5FPOA 2K6ZA 1AD0A 5FYVA 1ECZA 3ENEA 3V0FA 2ZKOA 4FLQA 5J4MA 1V3LA 3KHOA 2DWDB 1HNWB 4JPVH 1DYPA 4HT1T 4DRRA 4HEPA 3AACA 4PM1A 4EEEA 1VR3A 1NH2B 2NY3B 3MLWL 2VN4A 1KWGA 1Q9LA 2C9SA 4MJ5B 5HI3C 2CU9A 4KFMA 1QSEE 4GAYB 1ZLWK 4H8QA 2XAHA 2DD8L 2BSKB 3FUMA 3GMQB 5JIHA 3AC0A 3QBQA 3AU0A 5JDBA 3C7OA 1UCXA 1MW0A 2FB4L 4JFPB 2Y5TB 2P34A 4LLFA 3ORJA 4HC1H 1TEYA 4KWUA 3BVUA 4KMTH 4Y1TA 5FQ0B 1AXTL 1D5IH 4KJQD 2BNUA 4LA3A 4NOTA 2Z91B 5I0XA 3GDBA 2BVBA 3HCVB 4OH2A 1DGLA 5EUOB 1MVEA 1PGW1 4FL4B 2XJVA 5FYBA 3WS6A 1CPYA 2VDNH 3GI8H 1NCRA 1PNMA 4LSQH 4M6NH 4JI2O 4YYOA 4LU5H 1BX2B 2H1PL 3SNMA 2E75C 3AVSA 1EZVX 2A79B 3U79A 2H7WA 1JPGB 1AHMA 3MIEA 2UZPA 1R3KC 3LE0A 2BS71 5KVFL 5CGTA 1J59A 2AKRA 3VFGH 4QKBA 4P2CG 1J5CA 3JTTA 2AYHA 1N70A 4KK8D 1TSHA 5DEGA 4ZYKA 3KDMA 1S78D 1EEZA 4P2QB 2G2NA 2Z91A 5F3IA 3CCMV 4UCOA 4FYTA 1WW6A 2XX1A 2E86A 3ZM8A 1MZEA 1JGDA 4MX7B 4PH8A 1MWAB 5LDSA 3ZFEB 1QSFB 4PTUA 2YD7A 1CGVA 1TEFA 2CK0H 4XTRD 5K1NA 1E7VA 4D0BA 3EXLA 4HLZH 5IP4A 2ID4A 1LGCA 2EADA 4QPGC 2D2OA 4YWAA 4C56E 1E30A 1TJGL 4H1LG 1FIGH 4JRYE 2RMNA 5E16A 1BT8A 4BWWA 2JI3A 4JRWA 3F65A 5FK7A 1T6VN 2F7OA 5KR7A 3CSXA 3G5ZB 4QNPF 3QO1B 2QPEB 4TWKA 4K3UA 2OTJV 2NR6A 3D2TA 2YKLH 1O3QA 3K0DA 3KM2A 3PNRB 3RTLA 4U1KA 1UEMA 4N8VB 5D1QC 3PXJA 3V0AB 1BFVH 4WTQA 5JORA 3TYFA 1I82A 1M6UA 3U0TB 4H8PA 2CIKB 1L0XA 1U8JB 3H7BA 4IT5A 1ORSA 1S1AA 3BGAA 3W9DA 2FKXA 5E6ZA 4WHCA 1NGZA 3U75A 4D3CL 3FU9A 3ISYA 3B77A 1NDMB 2L0DA 2F93B 3CX5K 4RGNE 1EANA 3WSQH 3P3PA 5FPRA 3FUEA 2ZF8A 5FLJA 5F7DA 4BFJA 3WS6C 1ZV2A 2VCMA 1RMU1 4KKQA 5FYKE 1Y6MR 4QB6A 1A7PL 4JI2B 2DU1A 1ADQA 4F8OA 4OZFA 3LXUX 1FXHA 1BLNA 3BWAB 1D5RA 3HI6L 3SY6A 3RKDC 1HKDA 1GN2A 1AQKL 4ZU7A 5BQDA 3BAYA 2JDYA 3OPTA 2COVD 2AANA 1LGNA 3KNBB 2WC7A 3VH8A 4ERSL 5IB5A 4PA9A 2OV0A 3Q4HA 3IU4H 2X53A 3P02A 1OPMA 1V7NL 1T1ZB 2X5IB 1F4YL 4Q6IB 2AZUA 2GBOA 1KC5H 2CUAA 5FECB 4OGXL 1OLMA 1WMDA 3VD4A 4ZHQB 2XZCH 4FLZA 2WTPA 4E9QA 3MBEA 1T22A 4HHAB 2F19H 2VQFB 1G1XB 5C6PB 1ONQB 1A8DA 3ZN0A 1MSPA 3KT4A 2YOAA 2GJJA 3VRIB 1HDMB 5GSRA 1ZVSB 3CWBH 1VBE3 1JI1A 3PLQA 5KX5A 1I1AA 2YUXA 5EF2A 2YEZB 5EJ1B 4AFDA 2W47A 4O2CB 5F7AA 2OW7A 3TF4A 2DKSA 3WEBA 5GONB 1COV1 2ZXGA 4YHKH 2KERA 3KPSA 3UTSA 2ARCA 1UD2A 1OCCB 2F5AH 5AOZA 2ADJB 3ULVF 5LHGA 2N56A 4LL1A 2HWC1 4EKWA 4X1KB 3C6LB 3QXDA 5CJ8A 1DBBH 1OP9A 4ZY9A 4CDWC 3MW3A 4O2AB 3P77B 2CO6B 4PBWD 5AALA 3F7RA 2APTA 2I26N 4XVUC 1PAMA 5C0IA 4RZKA 2A7WA 4XMWA 3G67A 3RSJA 1BWWA 1I8IA 1JWUA 4B9IA 2C9AA 3T30A 1S2EA 2GY5A 4DZ8A 4R7NB 4U0RB 2R063 5F7KC 5D6CA 5FUCE 3IS1X 4MXVA 1MFEH 2VW6A 3CFBB 4MAZA 1OP5H 1S7VB 1WVZA 3U1SL 1BD2D 2BSRA 5FX3A 1ND2C 1KTBA 1TZGL 4TSCL 2H41A 1BSMA 3A23A 3BP7B 5ABAA 1EA9C 3VI3B 3U0WH 1TMF1 3T2PA 5F5AA 3VBHB 4IM8A 4DGVH 2C9QA 4P3WA 4OM0H 4MYEA 2VXQH 3F7VA 1AI7A 3TIEB 4Y2OA 3CAFA 4ONGH 2FYUH 4YIQA 1DN0A 1R3LA 1MVUB 2GFBA 1HYSC 1WD3A 1SM3L 4XTPA 1I1AB 2QMJA 5AFAA 2ZOKA 2YC2A 3GZAA 3TYJA 3UV9A 4ZUSA 1YMHA 5F6HJ 3VRIA 3QARA 1AR83 1U5YA 4KO9A 4M6NL 2Y6LA 4D6SA 5IHRA 1QR9A 3CPUA 2JEMA 1GKEA 3I2GA 3QUXC 3WU2Z 3SODB 4CC4C 3WZ1A 3EHBB 1XO8A 2JJTC 4OJEH 4EMZA 2IOMA 5L2KA 3Q8EA 1YQCA 1AR92 4UIKH 3OW2U 1G9MH 3WJJA 3B5HA 1TYRA 1U58A 2CCLA 2MKLC 3CC2V 2YHGA 2GSIA 3GPSA 3O6KH 5CBFA 3RIAF 1AZCA 2VVDA 1HZHH 3JWNC 5LN8A 4AM0A 2R072 4JFZL 1A8JH 3DF0A 5DT1H 3VXOB 1IB5A 2XUWA 2J2ZA 4M6MH 4PG2C 3NRUA 3FO0L 1X33A 3RRQA 1I7TB 3DGCR 3H3PH 2QL1A 4HZLA 4BINA 2Q3AA 3N9LA 1A6WL 1CPNA 2UU8A 3C5ZA 2RS53 1AR63 3DK0A 4XWGL 4NIIA 3I9GL 2ARXA 3X13A 2NNUA 5BW7C 1D9KD 3N06B 4RVBA 2JJUA 5F71A 4LLWB 4W9KC 2V73A 4IGOA 1WGOA 4NQEE 3LD8A 4P2OB 1Q82W 4G7YL 5JO5B 1DVTA 4N0CC 4L0PB 5IW6B 5KTEL 2PN5A 1REDA 1H30A 4ACPA 5SWSD 1D6EA 5FZIA 3L81A 4KOCA 1XILA 2RCSH 3IDIA 3RZCC 3QORB 1KPVA 1TENA 3W2DL 3G5WA 1HHKA 1WW7A 1QJX1 4JPIB 1A0QL 4RMRA 4A7GA 1W90A 1PJWA 1JE6A 1FHGA 4NTYA 1T0MB 2NN4A 2DJVA 2BOLA 3AEIA 2YD4A 2QVMA 4KTEL 4N8VA 1KDIA 2WCSA 4Z7UB 3TJHD 5DDHA 2WBJD 3PWNA 3TN0A 1IKQA 4RSVA 1BQRA 2F18A 5E1IA 5I66A 5IWAB 5KSAB 2XVLA 1QFWM 4XJ9A 3BPOB 5JHDB 1JYCA 4MB5A 1KS5A 4NM4H 1T66D 4OJDH 4K1YA 2ET1A 3KMHA 4LQRA 3S30A 2MHFA 1H3PH 1IBYA 4YUEL 1AO7B 3JZYA 4ABMA 1YTFB 2YAFA 1Q1PA 5HGAA 4LK7A 2R70A 1MWAA 5B1JC 2H0BA 4U36A 4WUKL 1S9KC 3LSDA 1BZ8A 2F58L 4B08A 1UACL 2ADIA 1BM3L 3FAXA 4WHTB 2C9RA 3B00A 4JV5B 5IQ9B 1KFAL 4UOJA 5FYJL 3JTTB 1EHLL 1JTZX 2MOGA 3EO1A 2DMKA 3ROOA 3TNNA 4L05A 2AKRB 2VBBA 3T09A 5SWSE 2MKWA 5CEXA 2R15A 3LSUA 4HUKB 1DBKL 2UY6A 4JN1L 2OQ7A 4NPKA 4N23A 3B94A 2X2YA 4ZFZA 3W20A 4XI5C 3C8DA 4NQEB 2RDSA 3C5ZC 3DX8A 4S1DC 3GDCA 4AV0A 3GMNA 3AFLA 3ZTCC 2IXQA 1BW8A 2VE6B 4HIHA 3UTOA 3E35A 2NNXA 3HNSL 1KECA 5IGXL 1WC7A 3O3DB 3SIKA 5AYUL 2X40A 3BTZA 4NZTH 2G30A 5DG1A 5FK9A 4P5TB 3D05A 1P53A 4ZO6A 4Q52A 3TNMA 3WP4A 2D0FA 1HESA 1Q6HA 4GYBA 4QHUA 3ATFA 3PAZA 1AGCB 1YFWA 1HILB 4I87A 2A0LC 2RDQA 5B1AB 3NFPA 3HR5B 3A6CH 3GMOA 4CCEA 5AVUB 4FM0A 1FCCA 1FVEB 1KBHA 5JA9A 2HFGH 4YHYC 4ABVA 2DQHL 1O6SB 2F7PA 2ZUTA 1SUJA 5EO1B 2BUKA 1I53A 4UT9H 2XWXA 1UKGA 4JI3O 1A7RL 3S7IA 1WC7B 2CGYA 1R4XA 2HKHH 3QDMD 4KTDH 2E31A 1OZTG 1LULA 4DV6B 3AQZA 1VBC2 3N1MC 1B4RA 2ADGA 1HX0A 1N3NB 2MCPH 4U1SB 2P6HA 3OKLB 1ICTA 1B35C 1NL0L 2EKSA 2Y24A 4YHPA 4HCGA 4OI1A 3HMXL 4JHWL 3ZFEC 3MMEB 3G71V 2P5PA 2VN5A 3PUCA 2JECA 1QI3A 5TE7L 3MOAH 3KD4A 4PLKD 4WNSA 1PNGA 5GS0C 1Z9SA 1CZSA 1ET7A 3BP6A 2VNCA 3QHTC 1FCGA 1ZOXA 2C1OA 4NQVA 3U4AA 5FO8A 5ACA2 4N0FB 4WJG3 4D8MA 4XPGL 5IFAL 5KBNC 3BYYA 1N5AB 4E9RA 2C0ZA 2WQRA 1ZV5A 1FFTB 1YJ9V 5IIEA 5L8LB 4Y89A 1Y1DA 3ARBC 2ZGMA 3FHQA 3QUYD 3JV6A 3U46A 4GXUN 1SMVA 4UOQA 4E9YA 1CZ8L 3GSNB 1RINA 1QLNA 2DQFB 3BLPX 3L08A 2D3SA 3WF4A 5IVXA 1XSJA 4PJHF 4CDGC 4ETQA 5F2VO 3PAYA 5EZYA 1AGFA 3GMMB 4PD4J 1J5DA 4X7DC 1JS9A 4U3HA 4BHUA 4NXNO 3I2FA 2AMUA 3CG8A 3FUDA 2XRAH 4UDTB 2X6VA 1D7PM 2NZ9C 5F7BA 2YUZA 4U31A 3GJAA 3VKFC 3GTTA 2UUAO 4X7SH 1C8M2 1W0PA 4PIYA 2YU2A 2WY3B 4W9EC 3ZE1E 4BKLB 4C58B 2ZGSA 1A32A 2BWDA 3QG7L 4DGIL 3FOLB 1GSKA 4NXMB 3L3KA 3X1FA 5AVXB 3VXRD 2ZKXA 4R7DB 2FJGB 4TT3G 4IIJA 3MRCB 3P2BA 2DH2A 4KXBA 4QO1B 1E28B 5AKRA 3WG1A 3O1RA 3FRUA 3PG2A 2EO1A 5FPZA 5ICUA 2Q8AL 1KCVH 4I7ZB 3GXDA 4B3RO 4NBYB 4CGTA 5HYJA 3QO7A 4UU9A 1FG2A 4LLUA 5AVWB 4XFAA 4BFGA 3VXNB 3S2CA 1JTTA 4ENZA 4GRWB 3GINA 1H4HA 4WWOA 4G6KH 3IAPA 4DGUA 1QBBA 3LAGA 1INQA 1NLBH 2J1TA 2DD8H 2J8UF 4JI1B 3KCWA 4XP9H 1UL9A 5C0CE 5C8CA 5CISA 5BS0A 4R0LB 5IYZA 3VG0H 1FYJA 1AZVA 1R24A 3DKHA 1UD6A 2ENYA 3C6SA 3TXAA 1YJLA 4FFFA 4X9QA 4NHCH 4QTFA 2Q10A 4QPIC 4E8CA 3PP4L 1TZOA 2CGRL 3B8YA 4YNIA 3DXRA 1YUKB 2WWNA 3VKMA 4Z1MG 1DEDA 2IG2L 2OTWB 2BDNH 1DO5A 2YUAA 4HBCL 4OZFG 3QPQD 1Q6UA 5FLVA 3PJYA 3B8NA 3DUUA 4G70B 3U0WL 3PDQA 3E6CC 4X5LA 3GNML 3B2UC 1HHGA 4YE0A 2A6YA 3PUSA 4LOTA 4QB2A 1RP9A 2PYED 4HKJA 5K33A 3BUYB 4Z7OE 1KN2L 3ABMC 1FF5A 3ASOB 2GG1A 4XVTH 3H7JA 3TIEA 1GUIA 2Q6WB 1ZEAH 3H0TB 5IHWA 1Y76A 2D7FA 2XBO2 2PPCA 5T1LA 4YGBA 5E1QA 2X1WL 4CDUB 5HVWA 1GYWA 2WVVA 3BP7A 5L2KD 1BQ0A 5EZIH 4BSVB 2XXGA 3ZFGA 1J11A 3D85B 3TBBA 2YD8A 3LZFL 2P52A 2LLLA 3JUUA 1UYWH 1Q7YW 3SDDA 4RR3A 1BQHA 4EB6B 5EU6E 1ZDSA 5FP7A 5KSBF 1RGSA 5J3HC 5KYXB 1XIWB 5E9AA 2NQCA 2XYCA 2NQYA 4FFYA 3ZS8C 1T6BX 2B1HH 2W0KA 3FH7A 1SLCA 3GZQA 4X6FA 1COV2 4R9CA 3VWJC 2LW3A 5K9KA 1NANH 1R1A1 1ZE3H 2JTDA 1ZY9A 3QWRA 4UCTA 1MSWD 2KMWA 1UWGH 2GUYA 1RZGB 4UT9A 2D40A 1OT4A 4HEPG 4IGBD 4TL4A 4UW4A 1MPAH 4ADIA 3T3MF 5EU4B 2H2PC 2PYEE 3BD3A 1HYSD 4FRWA 4D8PA 4MGTA 1WYJA 5I30H 2UZIH 5EUOE 1D5AA 3AP7A 2X1OA 5CZXD 2NXYC 3MA9L 3FQWA 1W8FA 2JS3A 3PV6A 3AKTA 3U6XA 1GC1L 4JQXC 4YDZA 5D7LA 3V8CA 5JPNC 1VBC1 4PJ5E 4AENA 2KUTA 4DNYA 1JPSL 4LLUB 3VSTA 1AY1H 2H1LM 3FQNB 4YVUA 4G80A 5D1QE 1QSFD 3OPZA 1BF2A 1ZIBA 4WEBH 3MBWA 1X44A 4FPFA 3RL1B 4KKBC 5DYFA 3VSQA 3PU7A 2VZ1A 4OR1A 1CAXA 2Q8CA 2FDKA 1I9RA 4R4FH 3F7YB 4Q0XL 1FVCB 1PZAA 1W05A 2FCVA 1KEML 1GJIA 4AUYA 3AROA 4QGLA 1OAZH 4LFBO 5GRUL 1NVPD 3LKSB 5AKTA 4BH7A 4N28A 4CILA 2NZ1A 5TH2B 1UW8A 4IOFD 1RUE1 5JH7B 1EHAA 1AYM2 5LA0A 5TDPA 3GTVA 5C0JA 2PYEB 5ADPL 3RFZC 3V6OE 4Q4Y2 1JV5A 2HVKB 3AXLA 4LCCB 4HPYH 5HYFA 5A2KH 4BQ8A 4OCSH 2YD3A 1K5NB 4KUZH 4UV7L 5ELIA 5CM1A 4HW6A 5IZ7A 2KYIA 4AE0A 1PZSA 3ES6B 4DP6X 4XF0A 2EEFA 1V9U3 1QHTA 4DXTA 1EAPB 2LE9A 4CVXB 2FCTA 1DQKA 2FCUA 3MROA 5AZUA 5JOYA 5A3WA 4UB0L 5BNNB 4QGMA 1UQSA 5EU5B 1GANA 3BSZL 5FY9A 2MQCA 1KPRA 2WT0A 5EU6B 4PUBH 1QLEH 3U36A 3J7MA 1SVZA 4WO4D 2AJSL 3BPCB 1O7SA 3AAZB 4UUJC 1AGDA 2WNUB 1WCDJ 4YJ3B 1Z6JT 3WN5B 4DEPB 1JHJA 3L2YA 4NUBA 4ZDHA 2G2PA 5H9CA 1X8EA 1NLDH 4I3SL 3RKPA 3TWYA 1BG1A 1EZVY 3NWKA 2AJVL 4ORGA 3QDHA 3KF5A 5FYTA 3H01A 3CLWA 1GR7A 2OIIA 4IYKA 1B90A 4JPQA 5K9JH 2EKSB 4W1TA 1MXGA 1BIIA 1YPZF 2F8OA 4CJ0A 1CU4L 1ERNA 3F01A 3S36X 4CCJA 2H3KA 5DD3H 3CUPB 4GG6E 2ATAA 2GP5A 4LBEB 5I18H 2PNDA 3KV6A 2EZ0C 4JTDB 4B3SO 1GMIA 1ORQB 2XFGB 3NZHL 2Q76A 4CTEA 4EEQA 2C9KA 4QX1A 1H3TA 1BE3H 4MB1A 1MCLA 3IVKA 4AVVA 4K94H 3VXQA 1AI6A 2B9AA 3CFJB 3QJFA 1IPSA 5DWUH 2CE6A 4BQ3A 1JPGA 2Z4FA 1AROP 4U7SA 4MD0B 5I1IL 5J6HA 2DLGA 4I88A 4KP4A 1G9DA 1AGCA 3WDTA 1GQGA 4H1LB 2LW7A 2EAEA 4F7PB 3THPA 5D2NB 3KBFA 3TEWA 3U37A 4PJ9C 2H32H 4XRCB 5D7JC 5DA4A 3VZKA 2P06A 1GWKA 1E1QG 2BWQA 4XDQA 1OAYL 1EAH1 4WTWA 1ETB1 2PTUA 1RUQL 1A7NL 3MGOA 3ZKXC 1HHJA 1HEZB 4OQTH 4B9CA 1RP3B 4GO8A 5HSFA 1C9SA 2HEWF 5KSUB 4CP1A 3GMRB 3AG7A 4PY8J 1T89C 4D69A 4JO4L 1Z9MA 5T5NF 3FO0H 3I6KA 4JRXB 2APVA 1AP2B 3KPMB 3AITA 5DJ6A 1D0GA 2E32A 5BZXA 2F6BA 4AEIL 2XKOA 2FIKA 1Y4MA 4KDVA 4HJTA 2R071 4L1SA 4ZKTB 1T21A 1UATA 4IE7A 4JHUA 3HNVL 3O2DA 1I3RB 2QQLH 4YH6A 1BCCH 1R3IC 3NKGA 1VAHA 4ZS6D 2DI7A 3RDIA 4DUZO 1LNUA 2IWGB 4E27A 5JQGB 4EBQH 4C55A 1QBLH 4LBEA 4PYGA 2DBLL 4WHTA 1RUMH 2YKLL 1C5HA 1JXKA 2W81C 4HH9A 4MB3A 3WLWD 1X82A 3IGLA 3S3WA 2AEIT 4FLRA 4HX1A 5LBEA 4O4LA 4NKDA 1BCXA 3ME2A 2JIXA 2XQRA 1IDSA 1TEIA 4KV5F 5T3XD 3ZHRA 3V5KA 1OTTD 4FG4A 4L2LA 2QKIA 3HNTL 3LVEA 4PREB 4X50A 1ZPUA 1EAH3 3MDJA 4I18A 2GC2A 3E0GA 3N85H 3CJHB 2UU9O 2MOQA 3H42L 5L4IA 4XH2A 3RBSA 4LC1A 3W11D 4IRJC 2RJLA 3F58L 5ETUB 3JTSB 3SKVA 3RPIB 1PL0A 5CBEA 3NJXA 3B37A 1JR9A 2V9RA 1JRHL 4BCUA 1BS3A 3O6FB 4YG3A 4XMZA 3IDIB 1UOLA 4J3BA 5GZFA 3HC2A 1FJ1A 3PABB 4KV5E 3X2QB 2WHVA 1T6WA 4FNTA 1M57C 3IJYB 5JHLL 3BGMB 4JY5L 4P5HA 1AXTH 2GALA 3NNJA 3P32A 5ACLA 3NW4A 5F89A 2AVFA 1B6UA 2VW7A 1AGEB 5BZWB 3TFBA 1SLAA 4X8NA 5ESVA 1KCSL 1JUHA 1AC6A 5F1NB 4C8DA 2PTTB 1EEQA 1J10A 1CLOL 3EH3B 3G5XA 1LDPL 3R06B 5E9DE 3U4BL 1W16A 4YXLL 1JZ4A 1NXD1 3IWVA 3K81A 1VLNA 5GJ6A 3II3A 4NZUL 4K5PA 4NN6B 5T3XE 4MUVA 1Q72H 4KZCA 1P7KA 3PVBB 2O14A 2VL5A 1F4YH 1QHPA 5HHXH 1IO4C 4B4QA 2DVFA 1TPXC 2XKPA 2RE9A 2BY1A 3L16A 5C07D 5SWQA 3F5WC 5FL7G 4ODUB 1F11B 2AENA 4LSPH 4PDWC 5LK5A 2QDWA 4JGYB 1BBT1 2TUNA 5D21A 3ZMSA 5D2LF 2P5EE 4M1GL 3TC9A 1J3PA 4L5FE 2D2CB 5EDXA 3VXPB 3K6OA 3SE9H 2ZX3A 5ABJA 1LWRA 2H2PD 3OLEA 3K57A 3GSXA 3QIUB 3NJYA 2JDUA 3NP3A 3WU1A 4LKCB 5B8CA 1OALA 1GC1C 4JQIA 4YBLB 5FZ4A 3W59A 4A6SA 4YIQB 1ZE3C 3T1YB 2FMLA 3UJTH 1MS9A 5F21B 2VBDA 4I4TB 3RA7L 1CGXA 4JY6A 1W3VA 4X4KA 3SCMA 1S7WA 1CBJA 5DD3L 5SWSB 3NFSH 3UJIL 1A9BB 3PREA 3QULB 5J3UA 1K72A 2Y34A 2K70A 3LEKA 1C5CL 4JFOB 3RWEB 2F4PA 4Z3GA 4JFFE 3EOAB 1LOCA 4RR3B 4ZMXA 2VT0A 4TVSa 2PW2A 2AR6A 4BH8A 3PUQA 4JRYD 4CMMA 4R8WH 4XBGA 5FYJH 3B1UA 4NKGB 2DMCA 2W88A 4WWPA 1AO7E 4EZMA 4ARXA 1J1OL 2JCCF 4IMKA 5EOCH 3RGVB 3ABLB 3B9DA 4G8GD 3SDDD 4RS5A 1XCQB 4JB9H 1DF0A 1I08A 4FMVA 5HCFA 1OF0A 1U4EA 1WFJA 2P22C 1XHHA 2FATH 1IEBB 5HDBE 3IDBB 3C09C 1GN4A 2QPSA 1J8HB 4UB0H 3Q2NA 15C8L 3HHMA 4YUEH 4AMXA 2QQWA 3FU8A 3GS4A 2YC4A 5JIDA 4AK3A 3CVHL 1SEBB 3HMWL 4CKVX 4EAEA 3UPRB 5FZOA 2OCJA 3UG4A 1X5FA 1CGSH 1X6LA 1G7JA 1LXMA 1IT9L 3LH2L 2HRLA 3K06A 4J6RL 4K7FB 5J3HD 1EUTA 4MYWB 1FATA 4QT5A 4M5ZL 3OJDA 5AB1A 3IJYA 2W6JG 1KXQA 3SC7X 1I1AD 3FB5B 4J23A 3LEVH 5FZ3A 1YQVL 2ED6A 3C6SB 3SGKC 2ZX2A 2GJ6A 1SHSA 1BQHG 5TF0A 2VXTL 4NGHH 2ICWI 5E2VH 4PBXA 1HSBB 4LHUA 1RUML 5D5MB 3LDRA 3MRKA 1YDPA 4Y2NA 2AABH 5EBMB 5EK0A 1MY7A 1JZ6A 3T04D 2V4DA 4DY3A 3GF8A 1PY4A 1FLRH 1YLBB 4Y4KB 4ZZ5A 1MFBH 1A6AA 4G83A 1B35B 2D3RA 5IUQA 2XWBB 4ZXBD 3B2UD 4G8GA 4WM8B 1G5AA 3QJRB 1OB1A 3WE6A 3WEOA 1IC4H 2GJPA 1QU0A 4RO2A 5IBTH 5JJEB 2DLFL 4ZUUB 3H8XA 2YBRB 4I13B 3OLGA 1XSQA 4UM9D 3WFEH 1GHFL 4J3OD 1NFIA 3FAWA 5A6XA 2IQAB 2M6YA 3E22B 2XZZA 3PHSA 4YHYB 1AR82 1H8TB 4H13B 5LA6A 1M7XA 2I32A 3QHZH 5F9AC 5HY9A 2PETA 3TBWA 1GZWB 5LBSL 5IR1B 3N42B 3SDXE 2JCWA 1AUYA 3O3BB 5ANHA 4Z7AA 3KR3H 3LQZA 4PJEA 4EDXA 3FUHA 4HYTB 3KYNB 1KLGA 3L4YA 4YE4H 4CCKA 3AUWB 3DYMA 2FGZA 3UOAB 1LILA 1V8HA 4RQEA 1NTZH 5I1EH 1FOD1 3AL5A 1HOEA 3SKOB 1IVTA 1QJX3 2Y7MA 1AMYA 2ZUXA 4XCCH 43CAB 3IM0A 4X6CF 3W0WE 1JZIA 2ZP0T 4J3OC 4IXLA 5D93C 1RUE2 2HWZL 3CBNA 4ZUTA 2VABB 1XH3A 4PR5B 4PJ7A 1IG0A 1LOFC 4MMXA 2DYPD 3ET9F 5K0UC 1A6AB 4C91A 2HKFL 2W59A 4HCIA 3MRDA 4IGBC 3OTTA 3B7YA 3H3UA 3NIFF 3ZRFC 4OHYA 1KP2A 4G6AC 1OSPL 2V37A 5D1XC 2VMCA 5A7BA 2K45A 3TESA 3LAFA 4YDIH 1JU3A 3M4FA 5DEGB 4LNRB 2BP8A 5I6PA 1VSCA 3FB8A 3OX8A 1AQ8A 4H1LA 3ZSTA 2Y23A 2X8KA 5JIAA 1WAAA 2NQDA 2R1WB 3QUKA 1CE6A 2CGZA 3LNHA 4ODWA 4Y4FB 5F7LB 5I2IA 1J5OH 1NG0A 1QLFA 2Q8DA 5EC2B 3INAA 4DV4B 4X6CA 4UQDA 3GWKC 3B8SA 4N87A 1VGKA 3T65A 2G9HA 4N5ED 2QV2A 1E4XH 2AJSH 4TLGA 2XJKA 1IBGH 3OSVA 3OKLA 4QHZA 1E79G 4X6QB 4Z78A 3ZKYA 4WVMB 3HCVA 1ECYA 3VACA 1NCGA 2HKXA 2EH7L 1OAUL 3QXAB 1PHMA 4I0XA 3QFJA 4UTBA 2QZQA 4GQ9L 3CCQV 1JVLA 2BNRA 3WNIA 3UKNA 1QWUA 3O9WD 5BR8B 1UM6L 1V0AA 1O6SA 3MGAA 5MERB 4C1WA 3OT7A 2WCPA 1UT2A 1HHIB 1P4LA 4ZAKC 2ADFL 4RFNC 4QTIL 1Q8PA 1ZBA2 2C2AA 1NGPH 2XX0A 3SE3C 2XA3A 3ZYIB 4FK5C 1MCEA 1YTFD 1BREA 3ZPDA 2IGTA 4BH8B 1MUJA 3MHSC 4Z8FH 5KHHA 3HMYA 3LS4L 4FFIA 1RMU2 3PU8A 1DBNA 3RWEA 2J1EA 3L54A 5CKNA 2V72A 1KCWA 2V3EA 5IJ9B 1QIQA 5C92A 1NTKH 5JVDA 4Q6GA 3VFNA 3S37L 5KSBA 2FBRA 3E3QC 2XPZA 1UOBA 1S0CA 1PO13 3Q8AA 5KLVH 2YBSA 3NVCA 2C3GA 4KL1A 3DVGB 3E80A 2P45B 4K3DH 5JYMA 4IV3A 2VTXA 5E1HB 4U4BA 4FA7B 4DS0A 5GS1C 3ZSJA 4EWAA 4PP2A 2XTSA 2YMXL 4NUJB 2DIEA 1NSNH 4BZ2L 5KHGA 3OGGA 3HAEB 3F95A 5H6RA 2R041 3ARWA 1HRV2 3GXTA 4TUKH 4OQ8A 3OEEG 4LOUD 2EXWD 5BXFA 4M3KB 5FM5M 2AXJA 4M4RA 2NPLX 3PFQA 1U2HA 1YY8A 3SGJC 4P9WA 2ZWYA 1KJ2L 4CU7A 4JI0B 4B95C 5DJCA 4BFFA 1RM1B 1FRGH 1SXCA 4CMHB 4WU5A 5FUZH 3S97C 3WLWC 2B0SL 1E5UI 4FNQA 2BIOA 3VGHA 3T0DA 4F9LA 3VFMB 1MG2C 5DZEA 1CE1L 1O75A 2WXGA 4KKAD 5DAWA 3WY3A 4X8XA 4N9OB 1JL8A 2F66C 2R29L 3L73H 1ITBB 4DPBX 3CRQA 2GJZA 4J1UA 3NCXA 2JCCA 3ZCCA 1T2XA 5IJ0B 2E3VA 4RMWA 5JHDA 2BVOA 3Q1SH 5CR8A 2D7PA 3P3RA 6FABL 4HNAA 4L87A 5HI5D 2X9XA 3QR0A 4CNIB 2E6QA 1G43A 1DGWA 3T2TA 5LGTA 3ZVVA 3WFEL 4EI6A 5JMOC 2O93L 5DS8A 3GXUA 3ZMOA 1THAA 1IM3A 3KXFB 3WMPA 5BPXA 3LZFH 3VXUD 4FQHA 2H6CA 2DLFH 3NK3A 3RUGB 5F9JA 3DGTA 4QD2E 4XVHA 1PZCA 4DETA 3AZWA 2XJPA 3WEMA 5C0BE 4AI1A 3K75B 3MW4A 1R3IH 5FO9B 3M8OL 4KVNH 4TQEL 4OHWA 5JWPA 4M7ZB 3QEQD 2ZTNA 4YHIA 5H37H 3S3CB 4XAKE 1BVLB 1F6AB 2DWYA 2BH0A 5DEZA 4XVTL 4BSWA 4B7KA 3E38A 1A7RH 2WXIA 4AIZB 2FJHA 3WGVB 3EYSL 4M7KH 4NUQA 3KLHD 2PI5A 4YRDA 4TUJA 5DMKB 4GBXA 3BY6A 3CSFA 5D7SL 5EEWA 4JE4B 4PJ0Z 5KYXA 1F4WL 2VECA 4DVRH 3HQUA 3DXAD 2DQ6A 4EI6B 3AKPA 4FLOA 3TO4B 2XG4A 3QIWB 2ZJSL 1UZGA 5FWJA 3M6DA 1J0IA 4OY9A 4I18B 5EEVA 5FKPB 1AYN2 4TYSA 4AJ0A 3BIKB 2Q7GA 2YXYA 5JW3L 3DGGB 1TNRA 3VQVA 1IT9H 1GYVA 2W07B 3LH2H 5JUEL 1FBIL 1CAWA 4L4JA 4GFTB 4XBPA 5AW8B 4JRYA 5T1MB 1LTEA 2DTMH 4F37K 4UNUA 4Z23A 4JG0L 3WKMH 3ABKB 1W0OA 1UT9A 3BUYA 4PYHA 4XCFL 3D3AA 4BRJA 4OLLA 2OYPA 5F39A 5DJCB 2WYTA 3LZNA 1GA2A 5HDQH 1YZBA 4NXNB 4H2AA 4OTXH 1WP8A 5F7HA 1I7UB 2VDKB 4B1MA 5HXMA 2Z92B 3CQFA 3X11A 1AJPA 5HGHB 1P1ZA 3ERXA 1JFQH 1D4VB 3E2HB 3TVMB 3N36A 2JE9A 2GSYA 1MVFA 4V1DB 1VMJA 3CFDB 4UF7C 4JFDE 2LAAA 4PRHE 4Y19B 1OOAA 2XKNB 3GT6A 4GBXD 3UBXI 4JN2A 3W38A 3GYRA 1G1KA 3FQUA 1OT1A 4M7LL 1SQMA 5JMOA 4Z7OF 1S9YA 3HS0B 4OF3A 4GMP1 2ILLA 4XXAA 2JDZA 3I5DA 3OTOO 1NFDA 2GKIA 5BZZA 3T3PB 4JVAA 5HYJD 5I28A 2YPVH 4KK6D 4DEWA 2DTYA 1H3PL 2VH9A 3BWUF 1I1CA 3O8XC 2RQ6A 1OQ1A 2V2XB 3QEUA 3ZSLA 5FO7B 3DVIA 1E0OB 3MNWB 1ZK9A 3WNMA 1R3LC 1EFXD 1XBLA 1N7MH 2VC2B 2CH8A 3CNKA 1RUF2 3HNYM 1XH0A 3SDYH 1GGUA 4GBXC 2QKAA 5KANG 1BVKB 4XE5B 2ADPA 1MCHA 3VMPA 2ID5A 1NWOA 3ZHUA 5A2IH 4QOKE 3LQAC 3VFWB 4KI5F 1IS5A 1K8DB 4ZQKB 2N59A 4O2CA 7FABH 1ULDA 4CU8A 4AAPA 2FH6A 4JYYA 3KZIZ 2YRPA 4QPGB 3KCYA 2P90A 1ORQA 3F12B 5ESVB 4EVNA 3ARGD 3HZYB 1ZVSA 4U6XB 2R69L 5IQMA 2ZCHL 1UQXA 3LZPA 3J7LA 3SSGA 3OG2A 2VL4A 1IBMO 4N9GA 2WZAA 1FYUA 2EJRA 1A4KA 1FG9C 1NUNB 2XWRA 5KBDA 2X0VA 4KRMB 1FL3A 1GWMA 3UTSE 3KPSE 5T3ZE 1A14H 1DQDH 3MYZA 2GDFA 1RIVH 3GKWL 4K5NA 3RY4A 5GZOD 1D4M3 2E6JA 5ALCH 1L7IL 1EZSA 5C7ZA 4AXOA 2XV3A 2J5LB 3RW0A 1GS7A 3GSNA 3LEGA 3QD6A 3RGBA 4TV9A 4DV7O 1S77D 1RSYA 1PSKL 1V27A 2WXOA 3BPCA 3PWPB 4XX5A 1MEC3 5ISZE 2O0OA 3UL2A 4CDXA 1QUNB 3U36B 5G04L 3FFQA 1CD0A 1QO3A 2NY5L 2XXMB 3IMVA 1QRNE 2B42B 4UFKA 5FYKL 5AAPA 2D43A 1XX9C 4L29A 3DRTA 5DK0A 2RG4A 5JMCA 1TOXA 1XU1A 4HIIB 2H5UA 3D25B 4NQVB 1VAVA 2HFGL 4XUNA 2HWB3 2R29H 1PZ8A 3MV9D 4KOBA 2CKBL 2X1PA 4LVEA 2AF2A 5FYJU 2YIBD 4M8UA 4GMP0 3KWWB 1U3HC 3BRFA 1CAUB 2IO5A 4XIOA 1U97A 3HUJF 4XCYB 5C7XL 1U8JA 3H7BB 3T4AA 3ZEDA 3DX2A 3H1JH 4J6GA 5I0YA 1XGRB 4K8RB 3UKMA 5GZGA 5JORB 1L9MA 2AJYL 4ODBD 5E99H 5B7FA 1M1XA 1U8LA 1RUD3 4ISRA 5JQGA 2A2QT 1N64L 3J27A 2K78A 3OXRA 5FGRA 5CUSL 8CGTA 1UZZA 3TBWB 1H3VA 1ZL8B 1PKOA 3QO1A 5T1KD 4LO7A 3G5ZA 5L2KE 2F1AA 1N47A 2WMPA 4U6HB 1VGEL 4WY7H 3WIHA 3WAKA 3Q05A 3PGCA 4KWKA 3GMOB 1CL7L 4PRPA 5D7LD 2ZOOA 3DXTA 2FYYA 4JJ5B 4Q29A 3QUXA 1IVLA 1RZ7L 4K3DL 3HZMA 3B9KB 3QW9A 2BP0B 1O9ZA 1QSFA 3IK2A 4JI5B 4Y9EA 3WJJC 2OMXA 4AT6B 1S0EA 1CO1A 3CLPA 4O58H 4MXWA 2HEYF 5J36A 4KK8C 4AEIH 4BZ1A 2VDPL 2E74B 2ESVA 3AS0A 5ID1B 1AXKA 2FAUA 1FRGL 4QYOA 2FL5A 3PMEA 2UY7A 4TYUA 4D8PB 1KIPB 1USQA 1FZMA 4ZOEA 1HEHC 1NMBH 4Q0VA 2LTNA 4ZFZB 3CCUV 1I4FA 4AGVA 4XOEA 1KEXA 1F3DH 2WAAA 4WV1A 4AQTA 3HJEA 3CQPA 2OMZB 3ZE2F 1D5XB 3S5LB 3WFZA 1WP6A 2CWSA 2R0WL 5TE4H 1N0JA 2P4KA 4NN5B 5E1AC 3OMAB 3PRZA 4C4KT 2ODHA 4GB33 3TN93 4EB6A 2HLFC 1EAOA 3OBRA 2PWGA 1R1BA 4FQXA 4JANB 1FNEA 3GSUB 3KWXA 4HXAL 5HHOE 1ZTMA 2NMOA 4BK8A 1PG7W 5DHVH 3RVTC 1X6NA 1KJMA 4PJ8B 3BE1L 3OPUA 4PW3A 5AYTA 2WLHA 1L9RA 4ZSOA 4QIWF 4J1XA 1DVFC 1HH9B 5E2TL 4ZAKD 3WIHL 2R30A 3S36H 1RD6A 4YJ3A 4R97B 2Q8BH 1ZZ8A 3PDGA 2E9GA 4BAYA 1Z9NA 2A5UA 2R23A 3M07A 1DVFB 4HWEH 5A2BA 5JMRA 3OEAA 2V7QG 4EN9B 4HKJB 2Y7QA 3WXVH 3K77A 3PQYE 3S3PA 5CS7A 2HPOA 1H5BA 4Q20A 5CHNA 2ET7A 1FVDB 4PJGA 1UZ6E 1I31A 2M8XA 4HK9A 2W0FB 4JFZH 4DKTA 4HLZG 5BOPA 1F4AA 3POJA 2A6DA 4YHNB 5F32A 1EK3A 1NCQA 5HVHB 3ES4A 4G2KA 2EEXA 5E1AB 5LXGH 2P1BA 4PRAB 5CKMA 3QIBC 3LZZA 2WUCH 5J57B 4Y3OA 4N8CL 4UIKL 5JXGA 1K73W 2K4WA 4PLOB 1OM3L 5I15H 5FOJB 3NKTA 2JGDA 2NY4B 1KN4H 3HHSA 1QBMH 2DOCA 5F88B 5HHOD 5A1FA 4UQ2A 1D6VH 5KWRA 1RZKC 5AW4B 4PGBB 1DQVA 2DICA 2BFVL 1IAOB 2MMXA 2WQVA 1E40A 1DDHA 3DOSA 3E9UA 1UFIA 3ETBF 3G5VA 1GCFA 1ASJ2 4LKSA 3WEZA 4DV6O 2B5UA 4LCIL 1NJIW 5B3JF 4ONGL 3UCRA 1RUG1 2J1VA 5LMUO 2ADEA 2F9BT 1WSST 2QM4A 3A4FA 2FD6H 1PDKA 2ITDA 4UMGA 2E6VA 4NPRA 2BNQB 1J18A 3TA3B 4OLVH 4R3SA 3WV0A 2AZ0A 1NFKA 1MW1A 1CR7A 3AKQA 2JKNA 1OCZB 1UA7A 3PL6C 1NCOA 3G9VA 4WEMB 2C3HA 4NCC2 2Z4QB 1VBD1 1VFAB 4XZ4A 4C57C 4B3EA 4WV8A 5DLMH 3B8MA 3FMGL 1NKDA 5EZLA 3AKRA 5A7PA 4NVPA 1EEYA 1XL6A 3PV6B 2WINA 3GPEA 3TPUB 1CX1A 1KD1W 4FFKA 1TVKA 1JN6A 1A1NB 2AV1A 1WEJL 3NRFA 5CD3B 3BYWA 2OCCB 1KXVA 3A67L 4PMFA 3IEAA 4EN8B 3MCKA 3AS3A 1IXBA 5B21A 1SRDA 1XC6A 1DN0B 1R3LB 2UWEB 1ZANL 3QHFH 3OBAA 4GX2A 1DJXA 1T1WB 2QVKA 3C5XA 3QH3A 3WW2A 4ONOA 4YQXH 1DSFL 2VM4A 4HU8A 2ETWA 1WCUA 4RQPC 1NUFA 4K8RC 5KA5A 3CSGA 3CDGA 3IETA 1C4RA 1EJ8A 3O6FA 4M02A 1AP6A 2BINA 3KPNB 5FYJD 2NX5D 2CNYA 3LPWA 1H5BC 3C60C 3T08A 2CHXA 3THCA 5I6XB 4QJFB 1O3TA 5FAXA 2WT2A 1T4KB 1LLAA 1W8OA 1WH0A 4E2LA 2CDGA 3GXFA 3MNMA 3WS3A 2EALA 2XFXA 2H3NB 3EJUA 4NRXA 2HAZA 5K5YA 1DZQA 4N20A 4L8CA 2IXLA 2VZPA 4FTVB 2FQDA 3MHHC 3BD4A 5E95B 5JPMB 5D1ZC 2YMZA 2Y2YA 1YECL 3NACH 4OB5H 3IDXL 5MP6L 2QFPA 3PVOA 1U33A 3SO3B 1F4HA 2VAUA 1DBML 1CVNA 1PLCA 4O2BA 3M1BA 1WBYB 4NNXB 5CGBA 3UYOD 5BS0D 1S9VA 3FNKA 2MNUA 2VO8A 2HJDA 1P5VA 4G1MB 1IE4A 2Z8SA 4PJFF 3ULUE 3JBG7 2JDAA 2C7UA 5GXBB 2EXJA 3NNGA 3H8RA 3HS9A 4GW5B 2DW5A 1JHTB 4MQ7B 2NUTA 3MDSA 3D3VB 5IQLA 1C5DA 2O5ZH 3P0GB 5CEZH 1I1YB 3PPEA 2CXKA 1MIMH 3S35X 1ZREA 4WBNB 1Q0XH 3N41F 4QHNB 2MQ3A 1VBB1 1CXLA 1XCWA 2VNOA 1JZFA 1S7TA 4FHBD 4NIGA 4Q6IA 5CJ5A 4PJFA 2HBTA 3BP5A 4JO8A 4YIOA 3SDCB 3KPMA 3MV7D 3BFWA 3NPSC 3EYOB 1LEKA 3D51A 5CCGE 1BVVA 3T71A 3UCQA 5GTHZ 1KXVC 3SE9L 4DZBB 4EROA 1UMZA 3NV1A 1RURL 5IMMB 3LDEA 3ZIMA 4GKKO 1FXZA 1IVSA 4KO7A 1QBLL 2NUPA 3JCUZ 1IBLB 4QGYA 2XR4A 5FP8A 5FNVA 2D3LA