4PI0A

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell) soaked in copper
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
390
structure length
390
Chain Sequence
b'HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMVLSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLEHYGISRVYAWHLPWMAVGAAWIFFWFVRKGIITSYIRVAEGKADDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKENVTTELNGGVYKVPGRELTINVKVKNNTSQPLRLGEYTAAGLRFLNPDVFTTKPDFPDYLLADRGLSVDATPIAPGEAKEIVVKIQDARWDIERLSDLAYDTDSQIGGLLFFFSPDGKRYASEIGGPVIPKFVAGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown peptide
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 94
structure length 390
sequence length 390
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4pi0A02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 4pi0A03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4pi0A01
4O65A 4PI0A 1YEWA 3RFRA 4PHZA 3CHXA 4PI2A 3RGBA
chains in the Genus database with same CATH superfamily
3NTCL 4Z0XA 2R49A 5GW7A 3EYFA 1YIJV 4DGVH 5H9SA 2DMHA 2PWHA 3BZEB 4KKNA 2YHJA 4GPVA 3K71B 1EGJA 5FUNA 4P06A 4HSCX 1NLBL 3P3NA 2VSCA 4DVBB 3UIZA 1A1MB 2CRZA 1NBMG 3IKKA 4JO5A 1R6KA 1JPSL 4MNHB 5IBTH 3DOSA 5D2LF 5D5MA 3BT0A 3AM2A 1MW2A 5MEQB 4FTVA 3WT3A 2A5UA 1VE0A 4NPYB 3T0EE 4P2AA 5JHMA 4DR4O 1R24A 2PLTA 5KJ4A 4D69A 4ODTL 3W7UA 2C9VA 2QPDB 4XBEL 1FPN1 3P5BA 2FT6A 4N1HB 1OAJA 3SGDH 1LD9B 5EFIA 5EU6A 5EF2A 6PCYA 3CPUA 1XNDA 1NFDA 1MJ7H 5T54A 3BRCA 4I4TA 4AAPA 3H56A 5FO2A 5MI0B 4FEMA 5C2UB 5DD6B 3BQUA 4XNQB 5GS0C 3SQRA 1FZOA 5KSUA 3FU5A 4FXKA 5GISH 3JASB 3J7HA 2WANA 4HPHA 3N1PC 2EIEA 4RRPG 1F42A 3QG6A 4HEPG 3S34L 5JW5A 1AYN3 2G5UA 4UWQB 1W0VA 1UX7A 4YC2C 4U6YB 3STLA 4M3JA 3T8XB 3WJLC 5GZDA 2ILLA 4JQTA 5K9JL 1HNXO 1RZFL 3U1QA 3KG2A 3GCWA 1P1ZA 2BHYA 1GPOL 4K23H 4PEEA 5GTHZ 2AJ3A 5LBFA 2OVUA 2GQHA 1EN6A 1SDAB 4K3EL 3V4PB 4Z7AA 2EULA 2G5BA 1VZGA 3DYMA 1C9SA 4B3TO 4FLHA 3T3PB 2LR4A 3CVIH 1FO0A 1E6OL 4KGGA 1LOFC 3MLRL 2JK5C 4M5TA 43CAA 1X5FA 2DB8A 2XJQA 2GI0A 4LITA 2CPUA 1GQHA 2ZR3A 2QGNA 4Q89A 5A7PA 4S2GA 2NW3B 3R0RA 1IC4L 4Y19E 1NQDA 2LM3A 1FNYA 2HJKA 2P7TB 3U2IA 2ADQB 4JM2D 2GC0A 2VC2L 3MLYL 3NZHH 4HJUA 2OZ4A 3LHAA 3LHPH 3A7QA 3OR7C 1X7SA 2CNZA 2VR8A 1X8EA 2BOCB 3BH9A 5MEOA 4Q4X2 1CI3M 2XTJC 3L3IB 4AW4A 3N0AA 1KJ2L 1AY1H 4AGOA 3O0RH 5HHOE 1PL4A 3D0VA 2DVFA 2RJKA 3MICA 1UIJA 2WO7A 4O4JB 1UHVA 1R1CA 1RIVH 3OKEB 3NSDA 1GGIL 2J56A 3RAJL 2YMZA 4L1BA 2F8VA 4OV5A 3NAPB 3FRUB 4NJ4A 5D7IB 3RI5F 2XJKA 3WUWA 3IYLW 3LFIA 1JD9A 4ZMZA 3MC0A 4GP4B 5BVJA 4FFVC 4MJ5A 5KYYB 3ZLIA 4HIEA 1PO22 2WGXA 4HT1T 3SE4C 2EXIA 2PLV2 4W9FC 1G7LB 1X36A 2IPKB 1X82A 5GGRB 3N9LA 3MZHA 2ZEZA 4FPKA 5F8QC 5HTSA 3VSTA 4IRSD 4U1JB 2FL5B 4CCLA 3GMLA 4OLZH 3F7KA 1S3KL 1FL6B 3SIKA 4NO0A 3LZZA 1LOBA 5F5QA 4QT5A 5IHZA 5IW0A 2BIIA 2DWDB 2X4PA 2BIHA 3QQDB 3DO7A 1L5GA 1E4XI 2H1PH 4LF4B 4K8RC 5D6CA 4QT6A 5EZOL 5KYUB 4F4LA 1GGBL 1GKOA 1K12A 2WWJA 3IK2A 4R90L 2JJTA 3CDCA 2VN4A 2Y6HA 3L9DA 3LY6A 2ZUTA 3J26N 1H8SA 1SEFA 3JD4A 5F9DC 2J8UF 4X50A 3UP6A 1UZZA 3VI4E 1SOQA 2Y24A 1D7BA 2HBUA 2KYIA 4ZQKB 2A6WA 2VABB 5F89A 1A4CA 4U7SA 3S88H 2DOCA 5ISZE 4ZHQB 2R29L 4OCSL 5JLZA 1SQVH 1UD1A 1RHHB 4IEQA 2KKQA 5HY9A 2CJTA 4KY1L 1MS4A 4CCOA 3G7DA 3PDDA 1Q9WA 1QO3A 3BP5B 1MWAH 5CMAB 4Y9FA 3TZVD 4I0WB 5GONA 1QLNA 5EHDA 4CJ1A 4X6FA 4DZ8A 2DURA 3CXFA 4XAEA 5I1GL 5DJ8A 4XBNA 3F5TA 5GPRA 3LQAC 1GM7A 4KTDL 4NC0B 5LCVA 3FE5A 2YSSA 4YG3A 1BMV2 3KGTA 4J3OH 5HI4D 3E8BA 3H8NA 4LSUH 3ZE2B 4ZQTA 3ULVH 1EPWA 1W99A 5D72L 1JGVH 3BWUC 1ASJ1 4ONHA 1HH9B 1XI1A 3I3EA 1CTOA 1PJ9A 2HH0L 4NQTA 5L8JB 1AD0B 4LKFA 5H9RA 4EI5D 4IMLB 4TXVB 4P48A 1X9TA 4XVHA 2Y1YA 1CG9B 2XVLA 3GDBA 2F66C 4Z9KB 3SBQA 5B38B 1OF4A 3L1OH 1K92A 3C2UA 3OAUL 3APMA 4MCNA 3GSRA 5BV7L 5G2NA 3PCYA 5I1IL 3K5NA 3N04A 4OZIE 5GRUL 4IYHA 4YC2B 3K71A 1HJFA 3VYPA 3WDJA 5A3NA 1H3XA 5CWSA 4Z76A 1GAFH 2X5IC 2FH6A 4DVBA 3T4DA 5JOEA 4PRDB 1EMTH 4WUKH 5EP9A 3B9KC 4MNHA 3HC0B 3GKWL 3JZ7A 3UH8A 2X4RB 3L4ZA 5MEQA 1NCRC 2HEYF 4N8MA 1H8TA 3T4ZA 4NPYA 4NPLA 4LCUC 4XCAA 3RI8A 1JGLH 2X09A 3FUKA 1E4XL 3AS3A 3ZN5A 2EIDA 1MRDH 1FNLA 3DETD 2VDPH 3IJ9A 2X29A 2OR9L 4PF1A 2E74C 1D7CA 3IDIB 4KQ7A 3CLEH 3KGLA 2VN7A 1DSFL 2F8OA 4ZPIA 5AWNH 1SJEA 2WNVC 5DD6A 3FB8C 2WXFA 3LPOA 4DPBX 4WFHA 4LL1A 1GCFA 1QR4A 5DZGA 3P2BA 4YHPB 3OR7B 4MJID 4NT6B 2XTJB 4NROA 1QOOA 3JASA 4Q29A 4JQVA 5IFAL 2ZIDA 1AO7B 4B4QA 2WXPA 5JZGA 1AZCA 2HCZX 3GINA 4ZD3L 1QLRA 4Z78B 2W2IA 5I1DA 4LEBA 3EDKA 3CBKB 4M62L 3N36A 4CDQC 3WFCH 1SY6H 1UZ6E 1CC3A 2QADC 1R3IC 3KCXA 5D7SL 1RUPH 4EROA 2BMKB 2NSQA 3V4PA 1XD1A 4PJIF 5LA0A 4FPFA 1UC6A 2QQPA 2GBVA 5KVGL 1JYNA 3EOAB 5ISZD 5EPAA 4N0FB 3PXJA 4LMQE 1YPZB 1U8JB 2P5BA 2ZJCA 5T52A 2VNOA 4GNKB 4HG4K 4QKDA 3U4BH 3N40F 1BT8A 3B8SA 3FUMA 4NXNB 3LKSA 4FA8A 2BNNA 1YAIA 1WHPA 3EJQA 2PLV1 2BPA2 4BSJA 2BOCA 3CH1A 2VAJA 4Q0UA 2QSQA 5IBTL 3ACHA 1Y6KR 1OLLA 4K8RB 1CE6B 2DMBA 5FZOB 5ITZA 1KB5B 1MUJB 3BPNB 4RYDA 4R5VA 2VY0A 4O4JA 4KU1A 5GM0A 2BFUS 1X8MA 1S7TA 3NAPA 1SQ4A 2D7MA 2R9IA 5F1OB 4RAUB 4JTAB 3PP3K 4MGSA 3FLTA 1MJ7L 4YBHA 3VSQA 5TDOA 3X1NA 4FF9A 4CADB 2Q20A 5F7BA 5KYYA 1EO8H 3IU3B 3WBDA 3OLDA 1G7LA 3Q48A 2FX8H 3NN8B 2D7FA 3ZN6B 5GISL 4N2BA 3QDJB 5JUEH 3NSFA 5A2IH 3N7KA 4KRMB 3K59A 4MS8C 4U1JA 3WIHH 1QH6A 3FUOA 2FL5A 4JAUA 3S4SG 4MA3B 1SFDA 4XC3H 2AGAA 4RMVA 1NA1C 4IJ3C 5LBCA 5C9JB 1NZ6A 4P5RA 3U75A 2DWDA 4K23L 3QQDA 2D6PA 2R9AA 3OKOA 4FYRA 4HQQL 3FTVA 4PIYA 5KYUA 1JVKA 4K6BA 3CVIL 3W20A 3JAWB 1PMYA 5T3NA 2XOKG 5DVMA 1J95A 2FECI 2YA1A 2ZGMA 4ZUWA 5AW1B 2FO4B 3IFNH 3RL2B 1AR73 4XFIA 1AQ8A 3C7HA 4JI0O 4WWOA 1YECH 3ARYA 3UL4A 3GJFB 4JM2C 4XTRD 3UFIA 1JERA 1S1AA 5CLTA 2RS31 5JIDA 3M1HA 2VABA 3WL9B 3CIAA 2JH2A 3NZHL 1S3RA 2PUQT 4HUNB 3RHWF 3TYFA 1CEZA 5FO8B 2AH2A 1M9SA 2E51A 2ZUXA 4Y7OC 4BBWA 2IC2A 4Y9GA 1MLCB 3EZJB 4OCYH 4TYUA 3FXIC 1OI6A 3N0PB 1AY1L 4NJAL 3O0RL 1UZ6F 4KZDH 4IOSD 2X5IB 4W4LA 5FBJA 5CMAA 3ETBJ 5DMGD 3V5DB 3TVMD 4BOWA 4AE2A 5KVMC 5C8CC 3B9KB 4FQJH 4ZHNA 4HUXB 1RIVL 2FBOJ 1HAWA 2HN7A 1NCRB 1CR7A 2GALA 4W65A 4LCUB 5DS2A 1B0WA 3LMJH 3VXSB 1MS8A 2OZNA 3LAFA 2XOMA 5JOWA 3HBGA 3IJYB 4U33A 4GRWH 3D69A 2W59A 3VCLB 5E6SB 3LEIA 5CCHE 1B6UA 3GSXB 3MIEA 4MDIB 2NT1A 4OI8A 4IRSC 1NGZB 1AD0A 3FB8B 4UOQA 1PZUB 2GNTA 3RNQB 2FHBA 3L5IA 1V3LA 1JHNA 1UOBA 2P47B 3CVHB 1CG9A 4TLFA 1DLCA 1IGTB 1DQQA 2CRMA 4R7CA 3LKOA 4OLZL 5B38A 2P80D 2VE6A 1HB3A 1PD3A 1UXLA 2QPEB 3UESA 3STZC 4HS3B 1KCRH 5KYWB 5BR8B 2VITB 2H1PL 5I82A 3UYPB 5JR1H 2MHAA 1CAUB 4CDQB 3ARDD 4PRDA 2YPVH 3T8VA 2ADFH 3MCKB 3HC0A 1WEJH 1U3ZA 1V9PA 1UB5B 1RUH1 2X4RA 3IDCB 4O02H 1QR9A 3GMNB 2AXJA 4QRSB 1PK6C 2V33A 3O9OA 3L4YA 2E0PA 3IXTA 5IKCB 1XU1A 4O51A 1DQ1A 1UUNA 2VZUA 3H8OA 4M56A 1Z2GA 1LOFA 2HWE3 5J36A 3BH4A 1BREA 2BWCA 1H30A 3S88L 1DE4B 2O0OA 2R70A 2JXAA 2FECL 3PP4H 4MKMA 5G5DB 3QW9A 4R4XA 4IHOB 3RWDB 4HISA 4ODVH 2B9ZA 1BWMA 1Z1WA 4LA2A 1TTGA 4LCCC 5IE9A 2EACA 1XILA 1JTTA 4LOEA 1OD9A 4NNPH 1QR1B 3WP3A 4BKSC 3TZVC 4YHPA 1EK3A 4FYQA 1MWAL 4ZXKA 5CUSH 2PO6D 5D2LB 1X5GA 3PIGA 3EF7A 1AO7A 1QBAA 4PYGA 3W82A 2BNRB 5HI4C 3LE0A 3HAEA 4KUCF 4X98A 2L0DA 4Z78A 4UTAH 3JUZA 3L3GA 4QXWA 2JD9A 1RQ5A 3MJ7A 3B01A 4WNSA 4LSUL 2VLKB 3MMEA 4QHUB 3WE6B 1E5CA 1LJMA 3H1LH 3OUHA 1JGVL 4U49A 5D21A 3H3UA 2OMUA 2BMKA 4OT1H 4NHCH 1KITA 1T1WB 1RUI3 4FI9A 2VDNB 3UBHA 4EI5C 1GQPA 1RUMH 4K5OA 4FPGA 2HLFD 1X44A 2YD0A 4KMQA 3MV9D 5HHPB 2E75B 4E2SA 2A38A 5LHGA 3OUIA 4TNVF 2YD3A 4G4FA 1F9KA 4Y5TA 3H0TB 3GXUB 3L1OL 1QLEC 5SWSE 5LP6C 2PWFA 4OUUA 4X4XA 3RI5K 3VH8B 1J9QA 5A1LA 1BD2A 2UUBO 3W7XA 1F4MA 1NH2B 2EXWD 3ARTA 1EGJH 1T2QH 2F23A 3QZMA 4XVTH 3V65A 3QO7A 5DYOB 1GAFL 1AJOA 1NA1B 2UWBA 2PYED 3JWOH 4IJ3B 4JY4B 4M5YH 1EMTL 4WUKL 1WW6A 3BXNB 4R5XA 3RRQA 4KO9A 5JPMC 4DZBB 3V0BB 1CE6A 5T55A 4BXSV 5FZOA 4XHJD 1KB5A 1MUJA 1Q8MA 4PS7A 3AYCA 1JDAA 5LNGA 4MJ4A 3BTXA 1F2XK 1JGLL 2XBZA 4JO1H 3T2QA 4F1ZA 4HAKA 1MRDL 4M61A 1FV1B 2VDPL 4Q74A 2Q6WA 2X05A 5EEVA 2GIXA 1IC0A 5E03A 4JHUA 2ZXAA 3VAEA 2V4LA 2Q5BA 3AREA 4UBDD 3FX3A 1IILE 3CLEL 3CV5A 5T1KD 5F9JB 3RFRA 3D8CA 4RAUA 1IBMB 3RGVD 1HDJA 5A6ZA 4IGOA 2R51A 5FYJL 4L05A 2W9XA 4CADA 4I9WE 4NTYA 4QO1A 5AWNL 4MO3M 3K3NA 4S10A 3UYRH 4OFGA 4Q6KA 1BVKA 3IU3A 3QNZB 1K8IB 4AVKA 1ZANL 4OFVA 4NRYB 3NN8A 4OIAA 5DDJ3 2UXXA 4KBBA 4YZ3A 3QDJA 2BNQD 3I5DA 2F4LA 4MV2A 2BSKB 1F3DH 3FONB 2WUHA 3U14A 5DG1A 4AFMA 3M3QA 4AUJA 3RS6A 5C8CB 4MA3A 1IEHA 4OVEA 2DLFH 4OCLC 3MNDA 2YUXA 2YIAA 2Z31D 3GK8H 4S0HA 2EIMC 5C9JA 3BRFA 3WFCL 1SY6L 3KZ4C 2W39A 3LNEA 5ETUA 1IS5A 1RUPL 3RYFA 5ANME 4FA7B 4NIYE 1L0PA 1TUPA 1UFGA 4P9OA 1Z7S2 1X59A 1I0HA 1FO0H 1U2YA 3QJHA 4H88H 4PTUB 4WEMB 3PG2A 4NFCA 5DM6V 4FPOB 2FO4A 2MNWA 2XLLA 1MCIA 3RL2A 3FAVB 4DGUA 1SFHA 2CBOA 3D0AA 2Y1ZA 5JXED 2D3OW 4Y1ZA 3U4BL 2VXTH 4YZ1A 2KZ1B 3VWJD 1R5WB 4DESA 4HOWA 2YBGA 3KHBA 5H35B 3WL9A 3E38A 4AL9A 1B3QA 3T0EB 2EDHA 2BVQB 2PHWA 4FGMA 2N05A 4NIDA 1KEMH 4Y4KA 4BGDA 2APTA 4XCBA 1JR9A 3STZB 1O4ZA 3TF4A 3CXHK 1SQBH 1KFXL 4JV5B 1COWG 1AHMA 4A6YB 4F8QA 2EP6A 5SWZA 1OB1A 5GIRB 5IUQA 2PP7A 3I3DA 4G1EB 3V5DA 5B3JF 3UDWA 2WSKA 2LT9A 1PIFA 3ZYIB 3AAZB 4HUXA 4HJ1A 4Q9BA 4UF7C 4X5PA 4AY0A 4CS2A 5D7JC 3EJKA 2F15A 1NCRA 1HHHB 2OAAA 4LCUA 3ZYGA 1SJXA 3C12A 1A8MA 4Q1RA 1NOLA 4P5HA 3QJRB 5I8CA 2WMPA 3HN5A 4X9IA 3IJYA 2E5LO 3LEXB 2HLDG 3KM2A 1QBMH 2OXBA 1EO8L 2VZTA 1HV0A 2ADDA 3GSXA 3D4KA 4MDIA 1S9VB 1BQSA 1DANT 3FFQA 3O4LE 5D1ZI 4ELME 2RDSA 5IQNA 4EKJA 1CR9H 2FX8L 3A47A 1NGZA 4LCCB 2JKLA 5HGAB 3BHPA 2AANA 5JUEL 4BUQA 4DEWA 3RNQA 3OG4B 2RMU3 3NL1A 3TZVB 5A7NA 4G8FA 5GGSY 3WIHL 2WKKA 4Y4YA 2TSBA 4XC3L 4HK8A 3EDJA 1WITA 4JDZB 3S7EA 3NCBB 3CFCH 4HS3A 4HJ0D 3KCPA 1H6UA 2R69A 5I1JH 3ML0A 2Y36H 4P2OD 1G0DA 3UYPA 3MEPA 1RZIA 3IDYB 4LBEC 2AQSA 1VENA 4P2RE 2BU9A 3D25B 3D51A 1V10A 4GX0A 4ZS7H 4Y19B 4WI4A 3WG3A 4N25A 3MI6A 3Q2NA 3IFNL 3UCRA 3X12B 3GMNA 4BEIA 2CO2A 5AW8B 4EI5B 4U05A 5IKCA 1IS6A 4PRID 3SR2C 1D5ZB 1DQJB 3DK0A 3L9YA 4HCRA 4OHYA 5FZ9A 4I48B 1DE4A 4MQSB 5HHOB 2R2EA 1QQDA 3BVCA 1BJ1H 4YW6A 2D0GA 5G5DA 1QLEB 1S0CA 2D93A 5LP6B 3RWDA 3M46A 4DEVA 1Y74B 4JPIB 4L9LC 1MW1A 3KS0H 3TIDA 4OCYL 2PW1B 5DMGC 1HXYA 4OCWH 3TVMC 1HDKA 4OD1H 1QR1A 2ESVE 4K3DH 3D7PA 4KZDL 1QPXA 2X4SA 1EDQA 4QGYA 3SISA 3CUPB 3JWNG 4NM4H 5GGVY 2Z35B 5I71C 4YBLB 5D2LA 4FQJL 1N0LB 5JPMB 2MQ0A 4JGJA 4UUJA 1NANH 3Q0HA 4FLSA 4A67A 2Z8VC 3ROOB 2WQRA 4EB6A 4DV1O 2CLVA 1LEGB 2BNRA 4P5KB 5F3FA 4AIZA 3JV4B 3LMJL 3MYJB 3JT2A 3BO8B 5AC93 1NH6A 3R8BB 3ARBD 2XZZA 2D4FA 1NLDH 1UM4H 2HHHB 5IWLA 2VLKA 1PX4A 3WE6A 2WSVA 4RS5C 3V56A 3CFDB 4XNUH 3UT5B 2CCLA 4AQYO 1FZJB 2R4RL 2DJSA 3VRJB 1YO4A 5JCOA 5CF3A 5IV2A 1CDUA 3F6LA 2HX7A 3CQFA 4IBVA 4O4HB 1KOAA 3VD9A 1IBZA 1MA1A 4Y5YC 3NNMA 1XEUA 1ZREA 3WDVA 1QBZA 4KBPA 4EWDA 3PPEA 1KIPB 4JGSA 2ZUSA 5FW7A 2B4CC 5IT9N 4L8BA 4TLUA 1VRBA 3F7YA 4F20A 5A2JH 3BIKA 3O1RA 3LDDA 3VH8A 3QF7A 3WX5A 2GN3A 1KCRL 3L9JT 3ARDC 5JR1L 1GJUA 4IOIB 5DYOA 3VI4B 1J18A 2EIMB 4JY4A 3Q44A 2YPVL 4X5XB 3E8HA 3I54A 2ADFL 2LW7A 4NN5C 3O41B 3APOA 1WEJL 3QJVB 4OLXH 5D8JH 3TNMA 4DZBA 4G2AA 1WTGT 3MKKA 3V0BA 4O02L 2EDMA 4BHUI 5ISZB 1DGLA 1YI9A 2J7MA 3WCYA 3CN2A 5DJ6B 4OFPA 3SZKC 2QLVB 4IERA 4ZFOL 1FV1A 2VT0A 4X6CE 4ZFQA 2Q0OC 4LFAB 4P46C 3TPKA 1BVVA 4V2CB 3BB6A 3BP7B 4G7VH 5DC9B 1VRSA 2ZWKA 5LGUA 5F9JA 3FB7C 1XH2A 4NXMB 3PP4L 5ABAA 5DHDA 4NUJA 3VGAC 3ZVVA 1ZRRA 1DJWA 2WNWA 1DF4A 4ODVL 5LMUB 3AP6A 3HR9A 1N70A 4KWJA 1XGUA 1H0DB 3FSWA 1BG9A 4LPUA 4PJCE 2Z42A 3ZBHA 1N34O 1YVWA 1DJYA 2PO6C 3EOTH 3QEGH 1M6OB 4NGHH 4NNPL 3PTRB 2HMID 4W9HC 1W2AX 4HIIA 3V4UH 1JPGB 1IDSA 4MVSA 3LD8B 5CUSL 4NRYA 2ZTNA 5D1QE 3EADA 1WO2A 3KQRA 5AALA 2BSKA 5LGTA 4M8UA 1MJUH 4FM0A 4P2RD 5ERLA 3ATGA 5KHGA 4XBMA 1ZV2A 5JH7B 3VXMD 1C5HA 4NC2B 4UTAL 1NGPH 4WBBA 3L9EA 3SMHA 5I0SA 5D7JB 4GW1B 2Y5TB 1FC2D 1R5IA 5C3SA 4X64B 2FQEA 4RHV3 4OT1L 3NRQA 2VTFA 4NHCL 4K3JL 1J5EO 2HLFC 3V4PH 4G82A 2HSIA 4JFEE 2ZGUA 1RUML 3BAJA 4OI7A 1ULVA 4OZIB 1NG0A 2X3AA 2B1OA 5IQMA 3LDKA 3C75A 2CV6A 3MI8A 5LNDA 2C0ZA 5DRWB 2EXWC 2FZ1A 4IEOA 3K72A 5I6MA 3D34A 5H35A 4QWNA 3OAYK 1YDPB 1M71B 4HXBH 1EGJL 4XVTL 4B95C 5HYEA 2BVQA 3T0EA 4BM8A 3GZAA 4EV0A 1HP8A 2I25N 3JWOL 3QRBA 1F3DJ 4KDTA 4M5YL 4XHJC 1DLFL 5T1MB 3UTQB 4DFHA 1B4LA 1LWRA 4KITB 1DZQA 2ZM6B 4AVCA 1OUXA 1NCHA 4A6YA 5LBBA 4YVWA 2QSVA 5GIRA 1N33O 3JTSB 4JO1L 1HL4A 1I1AD 3TT1H 5I76B 4UBDC 2JDPA 3ZYIA 2B3IA 3VO0A 1YAZA 2OLDA 3RZZA 1FS0G 2HKHL 3FH8A 1MFCH 1I5ZA 3QSKB 1HHHA 3EUDA 3MRNB 2OA2A 3EOBB 5GRVK 2QPUA 2AGJH 1FYTE 3GRBA 4PJ9C 4J42A 2WO4A 4TL5A 2EJ7A 4N86A 1K5NA 5J7CC 1ZTEA 3US0A 2P34A 5E94A 4GKSA 5AYTA 1FYHB 3LEXA 3DJ9A 4N5ED 5GSVB 1JVLA 3B8YA 3SO5A 3UYRL 3N40P 4AGGA 1S9VA 2RJMA 4L9LB 3X3FH 3ACIA 2WZR2 3O1MA 4H8QA 4LCCA 4MA8H 5DCCA 3AS2A 3TVMB 4XXCA 4YX2L 3UC2A 1MS1A 1G9HA 4FP3A 1YMHA 4EF3A 3GXPA 5T5PA 3S57A 2Z31C 3SPCA 2QZQA 2UXVA 4RSYA 1CFQB 4A7VA 4A3ZA 5HDQH 1JNHB 2DLFL 4JDZA 3GK8L 2G9HA 4KROD 1T83C 1E9QB 3GHBH 4TVPH 1JPST 4LIQE 1W0WB 1SXSA 1MCHA 4RS5B 3NFNB 4NM8H 4WENB 3CFNA 2CGNA 1FO0L 4H88L 4IBYA 4Y19A 3WENA 3FU3A 5EWSA 5I6LA 2JWYA 2C4XA 4FFTA 1VIBA 1DVZA 3B9DA 3X12A 4R97C 5ICZA 4U3JB 1CD3G 4EI5A 2CYFA 5FKBA 3VWJC 1QCEA 2RCVA 3GPSA 2WYFA 1D5ZA 1ZLEA 2VXTL 4Y5YB 5ICXA 1DQJA 4YZFF 1F02I 3GVMA 4CAGA 5C0DB 1H8HG 1BXHA 3J7LA 1TNMA 1HESA 4I48A 5H6RA 4Q4EA 5EBLC 5HHOA 2DQ0A 5INCB 3TWYA 3WS6A 1UUSA 1JZ8A 4H13C 4JFXB 4QJFB 3DX0A 3KKYA 1F6LL 1BQHG 3MBWB 1KEML 4JTNA 2GFBB 4JPIA 1VQLV 4FM1A 2DM7A 1U58A 2MJWA 3DC5A 2GVYA 2PW1A 1KELH 5LYJB 3LKRB 3N50A 4MWFB 2HWF1 4X6DF 1K5MC 1WWWX 4D7SA 3B43A 3H7YA 4MZRA 2OP4H 1ZXQA 5FP4A 1N0LA 4NN5B 5JPMA 3W7SA 3PQYE 4TNVK 2PETA 3VGBA 3ROOA 4DOHE 3FO0H 3H2PA 1BEV2 4P5KA 1LEGA 4AIEA 4JFED 3ZMNA 5FYSA 3MYJA 3BO8A 3PWPE 2AZUA 2V2TB 3AVSA 4P46B 2OMTA 1KWGA 3WNKA 4XYXA 3CFDA 5EULV 1QBML 1XB6A 2XKPA 4XUPA 3VGAB 2YFUA 4LLDB 1TJGH 1PZCA 1JGUH 5F7DB 1BOGB 5FZ3A 4X6BA 3QE5A 2LABA 1CR9L 1KJRA 4WW2C 5FYJU 4YVSA 5JOZA 1OGSA 4FTBA 4O4HA 3C87A 2PO6B 3VD2A 3LV3B 2A3YA 1K5JA 3IT8A 5L3CA 4JFFE 5GS0H 4J6RH 1MEC2 1XZ0B 4IBLT 2OTPA 4HJ0C 2R7EB 1VQNV 4P2OC 4FLXA 3ATEA 4DP0X 3IEAA 2QTSA 3BSHA 1UZGA 5I1JL 1FKAO 2BNUB 2Y36L 5I0VA 4QQLA 2KA3A 2CRYA 4IOIA 3II2A 4HMEA 3PGCA 2WZ0A 4XVOA 3FBYA 3ZHNA 4X5XA 4ZS7L 3O41A 1V55B 4OXSA 4I89A 1FYTD 3L5WB 4PJIA 4P3WA 5ISZA 4WCEV 5C0FB 2F8IA 5IB3B 4L1LA 3IBOA 4P5TA 3TN0A 2NP0A 4IJTA 2FBEA 2EDFA 1NAKH 3CVBA 3WW4A 4XC9A 3BP7A 4HVQA 4NVPA 1AR93 2BP0B 3TXSA 2ADGB 2M83A 4K5LA 9CGTA 1QWUA 4CKVX 3IWZA 1T3FA 4CBCA 4K94H 5LWYH 4OD1L 2BNMA 4C90A 4K3DL 1M6OA 4JI2B 4PBWD 2WCPA 4F8LA 3PMSA 1JPGA 4NM4L 1R17A 4JDVB 4DKFH 3LD8A 1JYIA 5IDJA 1P5UA 4QKTA 3GZUC 2ITCC 3P4MB 2OSWA 3J80N 1HHIB 1M90W 1UD8A 4Z1PA 5IJDC 4WJ5B 3ARBC 4HDIB 3ZKQD 5EXOA 3HAEH 5L9VA 5JW4Q 5LA6B 2WJ7A 4J3XA 1DVYA 1PLAA 4B4RA 1IBKB 1FZKB 1NLDL 1UM4L 3LQZB 1G1XB 4JJOA 4QJ3B 5D7JA 1XMOO 4XNUL 3TL5A 3KV5A 4P9LA 2HT4D 2YC0A 3QISA 2B42B 4PJ9B 1OQ1A 3CHXA 1R19A 3ZGIA 1BXXA 3C6SB 5EH1A 2JG9C 3WD5A 4X7SH 2CR3A 4GQ9H 1BSIA 4LLVB 3SD2A 4AFCA 3OGGA 4OZIA 4UQ2B 5H94A 4BINA 1N32B 1FFNB 4HWEH 2MEJB 5FECB 1U5IA 1I3GH 1A9VA 1AR62 2QVMA 4Y16C 2R0ZH 4QQPA 5HJGA 2EIJC 1T0MA 4NXKA 5IZ7A 5JAXA 4C47A 2IDTA 4AI8A 1YLLA 1SQFA 5EC2C 2NMSA 4ABMA 4XO4A 3ATBA 4MVTA 3PQYD 3KBPA 2XWRA 5JLVA 3UTQA 2AACA 4K8ZA 5JUVA 1JS4A 2VM9A 1KCUH 4OLXL 4R26H 1ETB1 3VFOA 5D8JL 1XNKA 4L99A 2DJMA 3CSGA 4XMTA 2YYOA 5E88A 4BWOA 3LNIA 5AB2A 1KB5H 4AI9A 4DK6A 4BXVA 5I76A 3KH4A 3MLUH 3VI3F 3WUDA 4FOQA 4HGWA 4OZGF 5C0AE 3CNAA 3B2MA 2RS13 5IAVA 4R97B 4G7VL 2GBOA 3UACA 3MRNA 4HZLB 3VWJB 3EOBA 2Y33A 3GSVA 4DOUA 2QKAA 2OUHA 3NCYS 4YFLF 5B1AB 1VJSA 4ILDA 4JMXA 4AIOA 4JFFD 2P46B 2ZXEB 4NZTH 5EBLB 2EABA 3EOTL 4C54A 4H13B 3QEGL 4WZ9A 4NGHL 5AOKA 1ND2C 1NZCA 2NYKA 4L9LA 1YHFA 4QPKA 2IVIB 2N74A 5FZ8A 3LOWA 1MJUL 3WDHA 3JWNE 1W06A 2VVDA 1PL3A 3CHSA 1YMME 2RMKB 3LIHA 4U6HB 2FWSA 4NHUB 2B15A 3NK4A 4LBLA 4HZ1A 1ZIAA 1E9QA 1A21A 3HS8A 1WD9A 4MB3A 4H0LC 5TDPA 3LQAH 4N0RA 1EZVY 3V4PL 5CGYD 1SLXA 5FMBA 1JVOA 3NFNA 4TRPH 4HALA 5SWSB 4XF3A 3BKCH 2WK2A 4U2AA 4YR6B 2HP8A 4A37A 1XE0A 2QDNA 5CN0A 4D0CA 1IAMA 2A3XA 4GH4C 4U3JA 2A6DA 1BBJB 4CSTA 3POIA 3OKYA 2WC2A 2KLSA 5IK8A 3OV6A 4MZ2A 2PPFA 4CXXA 2BW5A 2JB5H 4AE0A 4GO8A 4HXBL 5TE7L 5HCAA 3PV7A 3DVFA 2LLNA 1RMFH 4P2OB 3I2GA 2R0WH 3A5VA 3MBWA 3P54A 3PP3H 4U1SB 1EUTA 1UATA 1ND3B 3A22A 1GXEA 4LOSA 5FZCA 2X12A 4HHGA 2VR7A 3T1HO 3OD3A 1CDIA 4MWFA 3P32A 4TWKA 1I1AC 1JF1A 3QORD 4J4PD 5I5JA 1RUD3 2DUPA 4A66A 4OCTA 3WU1A 5AVAA 3TT1L 1TQBC 2WW8A 4Y5XA 4AL8L 3O0WA 4URTA 3VFNB 5KANG 2ZDIC 1MFCL 3FU9A 3SHSA 2EVFA 4PJEE 5HDOA 1K4CC 1QZ1A 1GN2A 4LAJH 5CEHA 2AGJL 4NIAA 3FFDB 1CFBA 3T6WA 4BZ2H 2V2TA 4BMEA 3Q2LA 4P46A 2CSPA 2Z6FA 4HEME 5GZOA 1R083 1G9CA 4PP2B 3QQXA 4ZX5A 1BQRA 3KL3A 1MG1A 3FKUS 4OI1A 2E7TA 4YMPA 1HXS3 3BN6A 3RTLA 1UJ3C 4LLDA 5F7DA 1BOGA 5FY0A 3X3FL 3BYWA 2W6JG 4MA8L 2V4AA 4DKAA 3DPBA 1CLYH 4R3SA 4KUMA 2H0EA 2Y3AA 1ZTXE 3CX5K 1EBAA 1ED3B 3QRLA 5LGJB 1LODA 3WLBA 2CU5A 3CVHH 5ANMB 1XZ0A 2ZGRA 1T03H 2BXZA 2R7EA 3IS1X 4V2BA 2ITCB 4KROC 1D5RA 4XCEA 3ZKND 5HDQL 1R9FA 2LP7A 4XVUD 5FZDA 1ORQB 3Q9QA 3HKFA 1EVUA 3U4EB 2BNUA 4HNAA 2HVKC 2R69H 3CDZA 3GHBL 4TVPL 2DYRC 1JWMB 3ENEA 1AJKA 2JFCA 4PJHE 5C0AD 4NM8L 1RSOB 2GIYA 4AZ8A 4HSJA 4FAHA 1SLLA 2AZAA 3G5WA 4X8AA 3L5WA 2GT9A 2JRIA 1UYWH 3BMVA 5DK0B 3TESA 3O0XA 1JHKH 3SKOB 5C0FA 5IB3A 1WUZA 2GHZA 3UO1L 1PKOA 4LE4A 3MIFA 3VD0A 1FNGB 4WW1B 5CA1B 4KBZA 4HCRH 3F62A 2XWZA 2KZKA 1FGNH 3LN9A 4V1DA 4Y16B 3BGAA 2ADGA 2EIJB 3SKJE 3L7EB 4Y2NA 3V7AG 2EVIA 1HAUA 4QKNA 4JDVA 2OP4L 4JHZA 3NCWA 4OCRH 4PWFA 2WS92 3AUWB 2XL7A 3P4MA 3RY5A 4PWGA 3N85H 3OLGA 3FO0L 3URFA 2NXZD 4ENED 1VACB 4HDIA 4WJ5A 5BRPA 1W9XA 3O4LB 4ELMB 5H9PA 5LA6A 1I9JH 2EXTA 3WB1A 3AY2A 3LRGA 1MS9A 5HPOA 4QEGA 3QS3A 1QU0A 1R1ZA 4IUGA 2PFWA 4PDRA 1PNCA 4HCIA 4IBQA 1PF3A 2OYMA 4PJ9A 4YNYA 1LUVA 4BQYA 2BIPA 3K2UH 3C6SA 1JGUL 4UV9A 5FYCA 4RRPA 4HEPA 3AJYA 1A6UH 4WI0B 2MW2B 4UQ2A 1HL5A 4LB8A 2YK1L 3IDAA 2PYLA 2OCJA 1ND2B 4XIOA 3G9AB 5GS0L 1FFNA 3HJEA 2CGZA 1VFOA 4CC5A 2LVCA 4J6RL 4WHTB 4WI6A 4XFGA 3L17A 4P2RB 1NIAA 5KZCB 3K46A 2FLRT 5FM5M 2DQFB 1AGFB 2E6PA 3KW7A 3LPGA 1E8XA 3GUTB 1XXNA 3DGGA 2XWXA 3B5TA 1W8ZA 1TUBA 1OAQH 1KTBA 1URZA 2Y4UA 2AHYA 1BAGA 5IK3B 1N47A 5E4IA 3O65A 4H0LB 1UKTA 3H53A 3NJFA 1ZLUK 3QIWD 5F7YC 3VD1A 1W8EA 2VDOH 5C8WA 5DEZA 2QJVA 2XBO3 5FXCH 4A7GA 1NE6A 4FQZA 1VBE3 2VQFB 1NAKL 3WLWD 2IDUA 1CVNA 2Z3FA 2EYRB 2ESVB 2WXHA 5F97E 2D43A 4J27A 4GH4B 4Q4W1 4HZLA 3QLQA 5BVPH 1IT9H 3F6JA 2B0SH 5EEXA 3A21A 3UTSD 4X80H 5CLWA 3FDWA 5SV5A 3D8MA 1ZSPA 1O9WA 4K94L 2EJ1A 5LWYL 5FM5O 5I0TA 1YLBB 3VDCA 1TZ8A 1XMEB 2V37A 2QLYA 4KDVA 4CDUA 4DKFL 1H1AA 3EYOA 4FI7A 5C07D 1TF4A 1IBLB 3VXOB 5BJTA 3CZEA 1I8IB 3HN3A 4N2GA 1I7FA 3S3WA 4YHMH 3REVB 2XUWA 3HMWH 2H32A 5J3UA 4XO3A 5HHVH 3IFXA 1TQBB 2JKRM 1JDCA 4U6HA 1ZRUA 4GAAA 4FIPC 1SLVA 5E2WH 3X3GH 3PIQA 5FCSH 2GNMA 1TQTA 4JKPH 3S36H 1K4CB 3CSTA 3LEGA 3KR3H 3PF2A 4E9RA 4CMMB 4OPHA 4EZLA 3N91A 3A6BH 5SWSA 4HKOA 2N3JA 4CDXC 4X7SL 3TBCA 3NW4A 4GQ9L 1CF8L 3V0JA 4JI5B 3TM6A 1POV3 4CYDA 1QMJA 3S4SB 4AG4A 3MV11 5C7XH 1UJ3B 5DEGB 1U30A 3O3UN 1O5LA 4HWEL 3ZRSA 1BBJA 2FDJA 2AEOA 4XF1A 1I3GL 1H2MA 4J23A 1EXUB 5H9CA 2R0ZL 2ZYIA 1HE7A 1CDYA 4LKXA 2XT9A 4F6RB 3D3QA 3DV4A 3DPRA 1J8RA 4DVRH 1HLCA 2IJKA 4WSGA 3HR6A 1JU4A 2AP2A 4NFBA 4GX2A 2X88A 4HKZA 4X6CB 1N26A 1ND3A 2QDRA 4BU2A 4ASUG 1QSZA 1KCUL 4R26L 2HVKB 3L2LA 1FJGB 5T1LD 2Q76A 1C8M2 3NQKA 5ICYB 4A6YH 2YKLH 1XTMA 4HG4J 1KB5L 1N3QA 4CN6A 1ZVYA 1XL6A 3FUFA 1UOGA 1DJHA 3MLUL 3I2IA 4I9WA 2DLTA 1XF2B 4PJCB 1BGXH 1E8ZA 1WB8A 3PPSA 1LU1A 3WDYA 5DF0A 3QIBB 1J86A 3OL2A 5D1QB 1OP3K 4NZTL 3IMNA 1ENQA 1JYTA 1AMYA 2XBTA 4KNCA 1JPXA 3CTTA 4IGPA 4MVRA 3EAKA 3OTOO 1YYCA 4OZHF 5IW6B 1EH9A 1P4IH 1LO5B 2XG3A 1ED3A 1FG9C 2A0LC 2Q0ZX 5ANMA 1YEJH 4PWIA 2FMLA 4UMGA 2Q86B 1VP6A 4JFEB 4A7SA 1KJLA 5PAZA 4RMSA 2LGNA 1Q38A 1ORQA 4HVRA 4BZ1A 2FQDA 2BFVH 1E8WA 3L16A 4JG5A 5CGYC 2ISDA 5EMYA 1QQP1 3LQAL 3P1IA 3S0PA 1RSOA 1GMGA 2A4ZA 4R50A 3FC8A 1WP7A 3BKCL 4NZFA 4TRPL 5FBZA 1OSZB 1ZLSH 2BWIA 3AFLA 2OMWB 3GMQB 3RUGE 4F3FB 2OTWA 1W9WA 1ZKAA 2R23B 3SKOA 5D7KE 2C34A 4YDKH 3T3YA 3SGKA 3W21A 1PD0A 3VG0H 4WW1A 5B4XA 1DEEB 4NQDD 4GS7C 4H2CA 2E46A 2JB5L 4JQRA 1OOPA 1B0IA 3ALXA 4LO6B 4MASA 4Q8LA 3PHAA 1VJ2A 3FCTB 3RWCA 3I9GL 4Y16A 4AVAA 1RMFL 4E9YA 5I0YA 1QLEH 2R0WL 5C70A 1RVF3 4J4PC 3UTZB 2XGXA 1WMDA 2ZHLA 1YI2V 3L7EA 2CH7B 1ETZA 1B9KA 3OGCB 4LO4B 2YKKA 4HCFA 4D7YA 2YI9A 1BQ5A 5DC0A 4QHPA 2XIIA 3SHRA 2IAMC 4UCTA 1E2WA 3H6JA 3VD5A 4W9IC 1JPEA 1VACA 4GO9A 3HMXA 3VGIA 1HHGA 3WJJC 4BRVA 1BF5A 3O4LA 1H3WM 1U97A 2EDLA 4APXB 3FO2B 2VJ8A 3FOLA 3MO1B 4GXFA 4BZ2L 3BCWA 3PUQA 1CF1A 3O6FB 4NO5A 3BKJL 1GKEA 3QFDB 4GKKO 1VQ8V 3RP1A 2WV3A 2B1GA 4ABVA 4OHZA 1F23A 3QXUA 4AGVA 2X2JA 2WLZA 4PPTA 4TUOB 4W9KC 1KLUB 3OBRA 5HV4A 2NYYD 4FLYA 3KYMB 1CLYL 3WO4C 1OW0A 4Y5VB 4Z5RB 3LRMA 3A6CH 4GX5A 1BYPA 3CK0H 3FTYA 4WHTA 2MNUA 2ZCZA 3ZKNC 3CVHL 3NDYE 4XVUC 3O0VA 1T03L 2DN7A 4BH9A 5IM7B 4XX1E 4XTRC 4BH8A 2C3WA 2DQFA 2P43B 1LO2H 5B1JA 3DKWA 3ZU8A 5AVYB 3GUTA 2R69L 2UUDH 5BRQA 2ARHA 1BSMA 4L9DA 1A78A 4HLJA 2LQRA 1R1A1 3A67L 2IBZY 1IFRA 2NY3D 2ZAIA 1UYWL 4BH7B 2PR4H 4MZ3A 2JEXA 1JHKL 3ZSSA 3IFOB 1Y7VA 1KV7A 5F5IA 3L1GA 2FX9H 2O6CA 1IBYA 5EZJB 3PWUB 5KN5A 4OGZA 2P5EA 1JZHA 3CDGB 1XMWA 2ESVA 2EYRA 3AKSA 4YM0A 4AW7A 3IU4H 3JWNC 1FGNL 4JW3A 5LZ6A 5FKPB 5F70A 1MCLA 3QUYD 1NGXB 5L9RA 3PQYB 3SDXF 3TEYA 5BNOC 3O9WA 2AVFA 2H94A 4NB7A 1DF0A 5FYUA 1Q72H 5AOJA 4H8HA 1MFMA 4AI0A 4L8QA 2Z1PA 1AQKH 1AR1D 2VDMB 3PWPB 3PLQA 1XNQO 2DH2A 2NXZC 4U7MA 4ENEC 4MOAA 1Q9OA 2AEIT 4P9XA 3N85L 1J59A 4DR1O 5IVEA 3MRBB 3REVA 3RUGF 1ENRA 1KGJA 1OZ0A 1OF2B 4N7UA 4B1MA 1OD7A 2IIJA 2ZXQA 2CTQA 2HWD1 4RFRB 1I9JL 5E51A 3R66A 1HXMA 2AKRB 2ZDIA 5D7KD 3MW3A 5LGHH 3MA7A 4ODUB 4CVZB 1K4CA 4JFFB 2HT3D 3X2QB 2OUJA 4OMDA 3OG6B 4CMMA 3K2UL 4DQOH 4XDJA 4AUUA 1I9RA 3WD5H 5KAIZ 1A6UL 2LLGA 2HTKD 3HVDA 4LPWA 3CQPA 4OFYD 5E1GA 5I6NA 1MCOH 4I0BA 5CFCC 3RWGB 3S4SA 5K5YA 3T1WA 1UJ3A 4TNGA 3LOIA 2B5HA 4RIRB 5LAXB 5C33A 4BE5A 1DK1A 3BUTA 3VBFA 3IJ8A 1QZNA 2VAAB 2ZCKH 3NV2A 3VXPB 4FPCA 4UI9L 1B0RB 2YD7A 4PSRA 4IEPA 1W8TA 1A34A 1IBDA 4OZFG 1QR8A 3K6SB 3S30A 3WEAA 4AFAA 4J41A 3CMEV 1AI1H 1OAQL 1GGYA 1OPOA 1B09A 4XETA 5IVFA 1RKRA 1HRV2 1XFPA 1XF5B 2GV9A 2I7OA 2OT7A 5ICYA 1P53A 4RMBA 1JHJA 3PAZA 2BY2A 2VDOL 3A4AA 3LSOB 2Q87A 5KVFH 3WLWC 3A4FA 1P7QD 5IESH 1FDLH 2L4OA 1ZBE3 4Y9CA 5T50A 2W0PA 3UZEA 1H2LA 4PJCA 2D3RA 1UOFA 4P9GA 1ONQA 4AHCA 2OTLV 5F88B 1Z3GH 5FYKH 5C92A 3ECWA 1W6QA 4MD0A 3QIBA 1IT9L 4TQPA 5BVPL 4CXWA 2B0SL 3T71A 5D1QA 1B90A 4GS7B 2PPAA 2K6WA 3GHEH 4X80L 3T6XA 5A16A 3ZEDA 4LXFA 5A40E 1KXTB 4O2CB 1X5LA 1YA5A 3LZPA 2YFZA 4DK3A 4TQIA 1MDAA 2J20A 3HZYA 3QXDB 3U2SA 4BD4A 4AGPA 3RL1B 3DECA 3V7AE 3FFCB 5IW6A 1XMQB 2AEQL 1LO5A 5EU4A 2HEPA 3LZFH 5HXMA 3ARRA 4KI5M 1RUE3 3KH3A 4YHML 5EDXA 2Q86A 3HMWL 4F8TA 1N1VA 1BVZA 5IVBA 4PP1C 2IAMB 5HHVL 1SETA 1URFA 2XRAH 1CD9B 2VNCA 1PS3A 3GZPA 2XAJA 4UIKH 2B08A 1KKCA 2QKIC 2WQSA 1XL4A 3CCHA 5DUJA 5E2WL 5AVVB 3X3GL 4BZYA 5B1BB 4JKPL 3S36L 3IGKA 3R1GH 3KR3L 3N44F 3L4VA 4DERA 1EDHA 3A6BL 4BLIA 1SERA 1OSZA 3FCSB 2IO5A 3GMQA 2DUQA 4JI6B 5C7XL 1KPVB 2R23A 2XWDA 5F3BB 4MGQA 1ET7A 3RZCD 1A6ZA 4M93C 5T3XE 1S0BA 1IFGA 3FL7A 4H26A 3UJJH 3JYCA 1DEEA 4UNVA 2Y72A 2W1NA 1TTCA 2Y06H 3BPCB 4KKLD 4DVRL 4YSUA 1CAXB 2ZCLH 3HNSH 1RC6A 4EQ3A 2Y34A 1DVFA 2XTSA 1U41A 4HFUH 2QPSA 4B3MO 1IKNC 5C0AB 1JTOA 2DWTA 4AKQA 1A65A 2E56A 4L4JA 1CAVB 2MH4A 2R1WB 3OGCA 4I1RA 4A6YL 3H9ZA 2UZIH 1MFAH 1G87A 2K1EA 1B2WH 1PVC2 1U8OB 4CBPA 5I8TA 4PMFA 5BOZG 3HN1A 1BGXL 2HP4A 2UUCB 4LPYA 1T6WA 4IEFA 4CA9A 2B16A 3AMPA 3LB9A 5IYBO 4XN8A 4APXA 3FO2A 3UGGA 3CXHJ 4Y8AA 3O6FA 3HJ0A 2KKWA 3RN4A 1OGAE 2PTTB 1U33A 1R46A 1VQKV 1YMMB 4TUOA 3WZ1A 4EN8B 1KLUA 1JNNH 1YY8B 3MRIB 2GTQA 2ZMNA 3KYMA 2R042 1P4IL 4IEZA 3UJQA 1N64H 2K0RA 4Y5VA 4Z5RA 1HQ4A 1PLBA 5IVZB 3H0OA 3PL0A 2F58H 4MJ2A 5T1DH 4CCCA 3QUZA 1LP9E 3U48A 3S7IA 1YEJL 4YXWG 2NXZB 4N5UA 5IM7A 1VGEH 4WBNA 3N1GC 1F3JA 5L7XH 2O6EA 5T3ZE 2BFVL 4GA9A 1XF4B 4BWUA 1OKOA 1SZBA 1GBGA 5E9DE 2OKXA 1Z6JT 4R9AA 4QD2A 4HMCA 2JQZA 3DHPA 4YH6A 1Q6HA 1Z5WA 3E6CC 1ZLSL 4DO0A 3KPRE 4XUTA 5FGSA 5K0UC 1QUNA 2TAAA 4BH7A 4LHNA 4EWAA 4NERA 3OLEA 1M4UA 1C08B 3IFOA 1KU9A 2B5IC 4YDKL 2Q8BH 1SFPA 1NCIA 3PWUA 3VG0L 1HOEA 1B04A 4D6QA 2PI4A 2HYXA 5EO9B 2WXJA 1AUYA 4QWWD 1IVLA 4UZUA 4QX5A 1Q6UA 3PE9A 1OL0A 2OPCA 1N3PA 1P1VA 3USUB 5IHRA 1QLEL 1NGXA 4WEBH 2GI7A 2K45A 3PQYA 2P3IA 2BOBB 1G9AA 5DURB 1SLTA 3HOGA 4C0HA 4PJEB 4P2CG 2XYBA 2FHFA 4P9YA 4MTOA 1CVSC 3P3SA 3AXHA 3PWPA 5B3NA 1GWMA 2DUOA 4YEFA 3JTTB 4D8MA 4UCSA 4HETA 5F3GA 3MRBA 2VZSA 4ZPVA 1DBJH 4IQHA 3VI3A 2XTAA 5ANQA 2X10A 2JQMA 4DINB 1OT2A 4OZGA 2LUWA 3KNBA 4OZ4A 2AC0A 4PBPA 5EJ1B 4UQIM 5T3XD 4ODUA 4CVZA 2PCYA 4ZX4A 4A45A 1N0XH 2NYYC 1RJZA 3AEIA 5F3IA 1IKQA 1NTKH 4DUWA 3P4NA 2KZWA 2NUPB 4ODWA 4OKDA 4C8XA 1YUKB 3K2MC 3RWGA 3TBSA 3TN91 4PLNA 3A6CL 3CK0L 1SF9A 4QGLA 4RIRA 1Z32X 1G7HB 3ZYBA 4PJHB 4PDWB 2VAAA 1BQUA 1C16B 3MKGA 3VXPA 3S37H 1ZAUA 3W39B 5KVDE 2QFRA 3JB8A 2BIQA 3DMMD 1VMGA 1F97A 1LO2L 3MRLB 3OJDA 4FQPA 3V6OE 2A0LA 3TC9A 3UZVB 1D2SA 3C6EA 4G11A 4HIJB 5PCYA 3P2TA 2XJUA 2MCMA 5APAA 5GRJH 3G3LA 2VCAA 4JS7A 2NY3C 2BX5A 4EN0A 4GB32 3E1F1 2AXGB 2RV9A 1AANA 1GO3F 2EE2A 1XF5A 4M7LT 1XNBA 3S3PA 2PR4L 1UT9A 2EO9A 3LSOA 2QJDA 1MRCH 3JXSA 4AQSA 2CKNA 2FX9L 5CBEA 4IEUA 5K9QG 1POV0 4LHLA 4UZSA 3SDYH 2Q8CA 1ETA1 5DJDB 3LNMB 4MTXA 3DGEA 3QUYC 5F88A 2NZ9A 4M93B 3IU4L 3H50A 4DV3O 4OFKA 1JMUB 4AMXA 4XBGB 1LP9F 3PNWB 3P30A 4NAOA 2QELA 4LORA 1V05A 1KXTA 2ZWNA 4HC1A 4O2CA 2D7TH 1Q72L 4G71B 2ITDB 3JV6B 5EU7C 1AQKL 4J4PA 5T1LB 2J5WA 5T3ZD 2ZKOA 3WNLA 3FFCA 5E8AA 3ROUA 4LMQI 4ZMWA 1NE4A 2PAEA 4UQDA 5E9DD 1REIA 3LIUA 3V4VB 1AI5A 4DEPB 1DSWA 1SNRA 3N9QA 5LB6A 2L7JA 2EALA 5J57B 2H32H 2IAMA 2WAQA 5EIYB 1IIKA 2BRQA 3IDBB 2E27H 5E95B 1DHKB 5LGHL 2IPTH 4GIAA 4FXTA 4Q2ZB 2KG7B 2W1WA 2HTKC 4F15C 3CDFA 4DQOL 3NJLA 3WD5L 1XNRO 5E1AC 1KYUA 1N1YA 1VBD2 4NOFA 2EDJA 4H7MA 4JRYE 1MCOL 3DX1A 1KPVA 2AK4E 4AG4H 4LR4A 1OT4A 5F3BA 4YSEA 5FFOC 3ZM8A 1EV12 2ZOEB 2ZCKL 1AYN2 4DUZB 2VGLM 3D0LB 2X6AA 4ABQA 1MCPH 2D3VA 4O2AA 3BPCA 5F6HI 1KNOA 1E28B 2BSRA 4GLRI 4TVSa 1D5MB 2BWAA 3E8GA 4LESA 1CAXA 3BUPA 4AHZA 4X1KB 5DVNA 1AI1L 2B20A 4KL1A 1WYJA 2HZHA 4PTTB 4MAUL 3TS8A 2R041 3H3PH 1CAVA 2R1WA 4BV1A 3OHMB 4CJ0A 1T7VA 1OTSD 3ZT6A 3GNEA 4QJ5B 5M95B 2RHEA 5IESL 1FDLL 1U8OA 4Z7QE 1XREA 2VOXA 4S2FA 1Z7JA 1SPDA 5K0UB 3S37X 3BCDA 1X9QA 4LFCB 1BQHB 3WJMA 2B5IB 1Z3GL 3I3MA 3GZOA 3X1FA 5FYKL 1ZL8A 1BYOA 2H1LM 3AZVA 1HQNA 2FWUA 3B3IA 3EHKA 1AHWC 3GHEL 2DWRA 2PTTA 1S2BA 1UWGH 1E79G 1U8IB 2E9BA 4N1CA 3GMMB 2D2CC 5AG2A 1YMMA 4X2UA 3VM7A 4ZUSB 1A6VH 5DJYA 3MRIA 3ZDYF 3ULUF 4E4HA 2VMGA 3HNMA 3HKZA 3VBOB 3LZFL 5D8AC 3WEXA 5IVZA 1N4CA 3QJZA 1HH6B 2L3BA 4DR5B 1PIV3 3DURB 1KV3A 3MUZ1 2XRAL 4UIKL 5JYLA 4GKJO 2EIKB 2XN0A 3LQMA 1MW3A 5F6HJ 3W57A 3VNYA 5E8DH 4BZ1H 1XF4A 3WQBA 4IDLA 1PNFA 2EXYD 4FJYA 3R1GL 4HPYH 4LRIC 4ZAKB 3ZSMA 4MCYA 5A7OA 5FPXA 3HQUA 3MGUA 5LQBH 3FTGA 2HJLA 4WVVA 2KL6A 3D0SA 1JGDB 4UNIA 3GWJA 5DZFA 3FZUD 4U1KB 3BP4B 2WO2B 4XWOD 15C8H 4FQLH 4XNYH 3TBWB 3VG9C 4KKLC 1SESA 2FD6H 5IQ9A 1P6WA 3PAVA 4P05A 4X66O 1KFUL 2Q67A 2ZE6A 3ARZA 2Y06L 5EO9A 1C5CL 2ZCLL 3HNSL 4O4IA 1PD6A 3PHMA 2X3CA 3GZEA 2Y0PA 1L9QA 2A9BA 4HFUL 5GRVL 1G6RB 4XJ8A 3G5XB 2X3BA 2PXYD 2BOBA 1CFTB 2FEJA 4XCCH 3ZZ1A 3ABKC 4HP5A 2DJUA 4PJEA 3CE1A 1XE7A 5EC1C 3OLIA 2NY3B 2UZIL 2XX1A 1MFAL 2GUOA 4IBTA 2FR4B 1B2WL 3NPSC 3UMNA 3JTTA 3LKQB 1CPUA 5FNVB 1IGOA 4JI3O 4G8EA 1ZHLA 1E27B 1XHXA 4U4BA 4C4BA 2KSDA 2XPZA 4LKEA 4A7KA 3HMXH 4PRNB 1J5HA 1OH3A 5L9BA 1L9TA 1EANA 3K3WA 3IPEA 4JRYD 5I1AA 1C1LA 4EZHA 1WS7A 4WFEE 1OT5A 1UFUA 4GB31 1B0GA 3QUYB 5K93A 3VA2C 2PHDA 1L9NA 4WRLA 2Q7YB 3OYWB 5IP4A 2ZOOA 4LA3A 4W81A 3VZNA 3F83A 1H6FA 3IMVA 2WC7A 1JNNL 2WXOA 3UAEA 4F33A 1UMZA 2E9JA 2AW2A 2OW7A 2D7PA 1OVSA 4ADJA 1N64L 1WZLA 2F58L 5T1DL 4PDWA 3GQFA 3ZL4H 1C16A 2I07B 3W39A 1VGEL 2V3DA 3H1IH 3RUGB 1GSMA 5L7XL 3A23A 1ZK9A 1QOKA 1G43A 1OBNA 3UZVA 2NR6A 3CRAA 4JE0A 1JZ6A 1SC5B 3Q01A 4HS8H 2CDGA 4HIJA 4J7RA 1TMQA 2R83A 1KBWA 1VADB 5EEWA 4QRQB 1CXLA 4AQ6A 2AXGA 2FWOB 1QSFD 3L5HA 3M45A 1UNBA 3ES1A 4Q4X3 1DDTA 1J9TA 4F15B 1QTSA 4QWWC 2Q8BL 3ARGD 4XF0A 3ISWA 1BX2B 4AQEB 1FVCA 3VFPB 1B6DA 4I0KA 4OCMC 4HYOA 2OM5A 1HWGB 1IBFA 5KMGB 3E35A 2AZ0A 2XY2A 5FKAA 3ZIYA 4QM8A 2OCFD 2ZKXA 4CL7A 3JWDH 3I49A 1Y76B 5J2TB 3PNWA 5KUKA 4WEBL 2NX5E 2Y0SA 3RJRA 5EZLB 5CISA 2ADYA 1FN4A 1R3KA 1R33A 2ZNXA 1N68A 1PO23 2ITDA 5EPMA 5FZ0A 2X9XA 3MFAA 4HWUA 2IQAB 3W9AA 1IKNA 3JALB 1EV11 4LCIH 3SPGA 1AYN1 1M57C 4A2DA 1ICTA 2CBTA 2Z4QB 2HEWF 2WGNB 2HG0A 3V4VA 2AEZA 3UO3A 2ZGLA 3BH8B 4MX3A 3D85D 3OEEG 1DBJL 4XMZA 3VYNA 1UD5A 2XNDG 4PSPA 4D0DA 2D6LX 4G9DA 4CVXB 4LO7A 5K4LA 1GRJA 3IMRA 4OF8A 5CZVH 1DHKA 3PWLB 2ADPA 1OANA 2TSAA 3CN3A 3IMTA 4Q2ZA 4IOFD 1T6GC 1ZWIA 5CLYA 1N0XL 1KP2A 5BPPA 1AHWB 2WBKA 1I9RH 4PJ8B 4B9YA 3HRZA 4MNQE 2DCZA 1KZQA 4WNQB 3FMGA 3G5ZB 2D2CB 3WNMA 1PM9A 1XDTT 1CXIA 2FRGP 1XB8A 4OZHA 1ZLUH 4ANKA 1PPIA 3DMMC 1ZZ8A 4Q1PA 3S37L 3D0LA 1W6NB 2YAFA 4XDLA 5BQ7A 5D8AB 1YRKA 5I8SA 1NEZA 1E28A 5IYZB 4GW4B 5A9GA 2ZP8A 5ACA2 5DJXA 1SRYA 5GRJL 5IW1B 3I75A 5H2BB 4XB3A 4KH9A 4KKCD 1I8UA 1W0NA 4TUJB 4NP4H 5JHBA 4QYOB 3UO2A 3JSNA 1IO4C 2ENQA 2QQUA 4N8VG 2P8PB 4WFED 3WTSA 1ALYA 4JG1H 2HWC2 5IVYA 1YC7A 1MRCL 3V2AR 3WN6A 2Z79A 4MMXB 4MH0E 1W2BU 3KCCA 3SDYL 4GD4A 5K0UA 3RYHB 2YS4A 3D3IA 1OC1A 1NDGB 1BQHA 5IQ7H 1NY72 5LRSA 4OZOA 4QGNA 1VQ9V 3MGTB 3ZHKA 2OIEA 3HOBA 4O2FB 4QHBA 3BKMH 3NJJA 1TA8A 1ZLZA 4A38A 3QWRA 1I1EA 1FXVA 4KTYA 2WLLB 2NR5A 3OAAG 4FFHA 2Y69B 1U8IA 2G75B 3HCVB 5FM4A 2D7TL 5BO1H 3GMMA 1M93A 4ZUSA 3B7MA 1ZS2A 1JFFB 2F53E 3PXHA 2VJXA 3G7TA 4JZJC 3ABKB 5EC1B 4JZNB 3INUH 3U6XA 3DURA 1HW5A 3GGWA 5HDBE 1T5EA 3NPSB 5AG8A 4XCNA 4G9SB 2E27L 2IPTL 4IDZA 3CWBH 3UGXA 1XH0A 1KT2A 1OXYA 1FLRH 1L0NH 2CDFA 3MOAH 3B5GA 4ZAKA 5DLLA 2JLPA 3UAJD 1ZX3A 1UX6A 1EERB 2VZRA 4AEJA 2DM4A 3IMSA 3M1BB 4LF9O 2VDQB 5AOIA 2JXMA 1JGDA 5FPIA 2FCTA 3MRRB 2H6PA 2YGOA 1A7OH 3PNRB 1RJLB 4AG4L 4FG2A 3GZKA 2NX5D 3TBWA 5F7EH 3FPYA 3MV7E 3CEWA 2UXTA 3QI9D 2AK1H 2GDFA 1MCPL 4HYTB 2EYSB 2VQ1B 4Z7NF 5KHKA 5AUMB 5MEPB 4ZNCD 5JMRA 5KBFA 3JBG3 1OF3A 2WJSA 4HMZA 1NDTA 3G5XA 3U6RA 5DJZB 4PGDB 1PDKB 4JY6B 1K7DA 1OTSC 2IMMA 1CFTA 4LEOB 3H3PL 1OP3H 4IGBD 1WLDA 2IV8A 4YXLH 5DN6G 1JUFB 4Y1TA 2FTAA 1A9EB 3DSFH 5FFGA 2FR4A 4ZNEE 3LKQA 3VTTA 1RLWA 4EMZA 4H8UA 4P2YA 3BUYB 4N2LA 1DBKH 3GDCA 2XKOA 2Z93B 4JFQB 4MNQD 2WVVA 3BIAX 4LUKA 1XH3B 4XMXA 5FIXA 5DZPA 1KFGA 4XN2A 4E0RB 2IJIA 2RMNA 5AB1A 5D5QA 2UZXB 1UWGL 3V6OC 1Q0EA 3RDTD 5AG9A 3BP6A 4N85A 3W38A 5D4HA 1A6VL 1JN6B 4PLOB 3LEVH 1EBPA 3APCA 3AXIA 5EU6B 1NFAA 1W0OA 2GNDA 4KJQD 1E5IA 3KGRA 5GGQH 5DABA 4LCWE 5B1KA 4WJG3 4ZX6A 2WZEA 3K5MA 2DQHH 2RCSH 4LIQH 4NOBA 3EGDB 2I07A 1M57B 3B5LB 5DS8A 3EFDH 1EM1A 1AIFA 4N2MA 3RUGA 2EXYC 4YGVB 5CAYB 2D31B 4P14A 1SMVA 4MXVE 3CP1A 2IXQA 4BZ1L 1PZBA 5E8DL 3AP7A 4L92A 2UWEE 4HPYL 1WMXA 1VADA 1QMUA 2X7LB 4FJZA 4QRQA 3O7OA 3FZUC 5LQBL 2DVGA 2FWOA 3CX5J 2NMNA 4XWOC 2H0PA 2VBBA 1KTDB 1T4WA 3M2MA 2Z9TA 2Z7YA 3MUJA 2WLIB 3BD5A 4OFYA 4X9QA 3MX0A 4KRNA 4A1RA 1KQRA 4FQLL 4XNYL 1YIPA 1XCQA 2FD6L 2WP3O 1Y6NR 3RPIB 4XAWH 1SQGA 3C60D 1BX2A 4TN9A 4AQEA 4WF7A 4F7CB 4FI8A 5IQOA 1FFRA 3TASA 4ELKB 5L2KD 1BMWA 3QJQB 4G3YC 5KMGA 4BIUA 1H19A 2F53D 3DMMB 4YFDB 4QHNA 1KYOF 2PXYC 2E59A 4ZUUB 1LR5A 1MDTA 1TTBA 4PM1A 4YDVB 1Y76A 5J2TA 4C57C 5A2KH 2ATAA 4DR7B 2RM23 3NEOA 5EZLA 3VFUB 1FCCA 4XCCL 3VSUA 4X65O 5EOTA 1CTNA 3KF3A 2B9AA 2JLLA 3OBAA 2IQAA 3JALA 4J7JA 2VDMH 3MRKB 2HG5C 4KKQA 1SDWA 1W2NA 4JDOA 3WR0A 5F6LB 1OGAB 3I2CH 5JIIA 1XF1A 3B9AA 3N41B 2VOKA 3BH8A 2CSGA 4OCNC 1BZWA 5T5NG 2VMIA 5MERA 3HMXL 1D0GA 4U1MB 3FYIB 2YSTA 2XG4B 4X9YA 5B7FA 5J11C 3WS3A 3BI3A 4N2OA 4TSVA 1OIOA 4MSWA 3ZDWA 3PWLA 1UXMA 4NHMA 3MV7D 5AFAA 3T77A 1NCCH 1LP9B 2JCWA 4ZO6A 1F00I 4K8XA 2NDFA 3S98A 2ATPB 2B9VA 3EQEA 1AHWA 4HWBA 5KWRA 3CLFH 4PJ8A 5F7HA 5BNPC 3O1PA 4WNQA 3H8UA 4H33A 2ARXA 3ZFEC 3D52A 2ICES 4B9PA 1KIUB 4OPAA 3ZL4L 3EXLA 3DROA 3EJUA 4X9HA 3ZE1F 4JZJB 3QDGD 1OGTB 1W6NA 3KPRB 4YGAB 1IX9A 5D8AA 1SUHA 1SCSA 5ANNA 4CEYC 2R0FA 2CRIA 5IYZA 2BBVA 4GW4A 4JJ5A 4HS8L 5FMOS 3FU0A 2P06A 3GMOB 3IM0A 3IWUA 2F74A 4IM8A 2NDGA 3O1TA 3RVWC 2DIAA 4I0PC 4NRXA 1NCQC 4LRIA 3ARGC 3U9UA 2ZOUA 1FRGL 4LLWB 1QSVA 1EZSA 5E8OB 4OU3A 3TJPA 4MMXA 3SBWC 1KTJA 1NBQA 2F54E 3RYHA 4JZOA 4U1HA 4XPTH 1NDGA 5JWPA 1OP4A 1WP6A 2IDSA 1AYM2 4DR2O 1F5JA 1OSEA 4Q5OA 4EN3A 4G6JL 4I88A 5C0CE 1IG3A 1F6AA 2QVKA 5JOXA 3JWDL 4IK7A 4LCWD 5DMJB 4NUBA 2NPIA 4GWJA 1F3RB 3P30H 3VVWA 5KVEE 5FTTC 3V6FB 4OGAD 2G75A 2XQ0A 3HCVA 1QNYA 2FEDD 4HC1H 4N9IA 2JTYA 2AJZB 5HJ3B 1AIZA 3CPLB 3TA3D 1JFFA 3JD1A 3JSLA 1I85C 1P5VB 1W2TA 1AGCB 4LCIL 3T6ZA 3VB8A 2GAUA 2VBDA 3BVVA 5LN4A 2EH8H 2F7OA 4YM3A 2IVFC 3TTSA 5HYSG 3M3CA 1CFSB 2GABA 2J8HA 1YXBA 5CR1A 3RWEB 2F4VO 3Q9PA 3RYIB 5CZVL 3CZKA 4QRPE 1RFDH 5IVXE 5EEYA 1YUDA 4I02A 2BRTA 3WG1A 2CK0H 1NC4B 2G9FA 4G8GE 1I9RL 3CWGA 5F39A 2XNAB 2JGUA 1K4DC 2EICA 3IE9A 1QWNA 3I50H 2XUMA 4QRUB 1E4JA 4N6RA 2CE4A 1F8TH 1RJLA 4JI7O 4W6WB 5AZEH 3RPKA 4AQAA 2O1QA 4BQ2A 1J8HA 4IIJB 3BD4A 2OCCB 3GS4A 3US1A 4LHQB 4ZW5A 1D7PM 3SN6N 2VQ1A 1YC8A 3CGTA 1YEHH 5AUMA 5MEPA 3K9AA 1AQDB 1FNSH 4GI8A 4OIIH 2WT1A 3SCMD 2VQ0A 4XILA 4KKCC 1AFVH 1T4KB 4QDQA 1AR63 1U3HB 5E7BA 3RWKX 2FZ2A 2X5PA 3UO8B 4PGDA 1PDKA 3MXWH 4JY6A 4UW6A 4NP4L 4LEOA 1CGVA 5C0EB 4N3UA 1TXKA 3GM0A 5A7EA 2I5YH 4O58H 5DHYB 1K9TA 1JUFA 4N4YB 4JG1L 1UY2A 2VE1A 1E4WH 2NQ3A 4PBDA 2C6SA 2DTSA 1WQVT 1OM3H 1YJNV 1A9EA 4Y1SA 5I6KA 3X29B 1BCIA 1PZ5A 1J05B 4R4ND 5HVFB 1QQP2 3BUYA 2YV8A 4L4TA 5E9NA 2EDTA 2WINB 5IQ7L 2Z93A 4JFQA 5AEAA 3T3ME 1UXZA 1XH3A 1AP2B 5BXZA 3BKML 2VXRA 3N2GB 4JUTA 4E0RA 4MA7H 2Z4FA 2DKMA 3FJTA 3RTQD 5BO1L 3HKEA 4MDJB 3WNNA 5KXCA 2KMWA 4PJ5A 4R7NB 3FJSA 5CFDC 4PLOA 5JDJA 5J89A 2J57A 1DO5A 3DKHA 3PL6D 1NUFA 4L37B 3Q2VA 4AVHA 5IREA 3WTWA 3UKNA 3INUL 4PG2C 1RITA 4M43H 2DVAA 2EAAA 4N23A 3G71V 5DAQA 4F8PA 2HG5B 3EGDA 5TISZ 5JIUA 2W0KA 3QTCA 1IAKA 3HPNA 4KU8A 4JRYB 2D31A 1BVLB 3B2XA 4U31A 5J0BA 2YIBD 3T6QC 3UAJC 1PNGA 2AK4B 1EBOA 4N90E 3RA7H 3MRJB 5J11B 1FLRL 3B77A 3GD1C 2F54D 2BVPB 3MOAL 4H8WH 4YPGA 3PVOA 2X7LA 3KYAA 2MFNA 1RPOA 5KYXB 2VMFA 1KTDA 4K5PA 3AMMA 2J1VA 2WLIA 3ZRWB 4A7QA 1A7OL 1OLME 4FC3E 5F7EL 2HWE1 1X9LA 3RPIA 4GUNA 3D2UD 2DCYA 3R0NA 3NCEB 3S3SA 4F7CA 3ZHVA 2BP5M 3KYNB 4U7KA 1X7QB 2O6PA 4ZUUA 4XEZA 1MCCA 4BJLA 1WG3A 4HFWB 4HOMA 1AJNA 2LGQA 4IGBC 1XBDA 4Z7QB 1QVFU 4CEYB 2Y2WA 3HI6H 4QCIA 3EH5B 3VFUA 4YXLL 5FZLA 3HLAB 1ECZA 2NTSP 3C7FA 3OXSB 4QRPD 2OIIA 1QW8A 5H37G 5BO0D 5FP7A 3TOJA 2E7BA 2H2PC 3DSFL 3MRKA 1M1XB 3GMRB 2JX9A 4I0PB 5CSZB 1OGAA 2ZT9C 4K35A 3ARGB 2K8MA 1RK1B 4G8GD 3UG4A 1UIKA 1N9PA 1XGYH 4KRPD 4U1MA 5IVNA 4H55A 3AK0A 1XSQA 1UOVA 4Z1MG 4WK2B 1ZEAH 1BPLB 5ENWB 3RDTC 4G42A 4NKOB 1GLHA 1RLBA 1IGCH 2D7OA 3EHBD 4WU5B 1LP9A 5DJCB 4DNLA 1RUI1 3FT3B 4JKLA 4PWEA 2VLRE 4O2BB 2ATPA 1L8DA 3FHAA 3FO9B 4KJQC 4HD9A 3FBQA 3LEVL 1XYPA 4PJBF 5C3TA 1Z7S3 2BWDA 5GGQL 2NZIA 3VQMA 5IEKB 3L3HB 5FZKA 4HBNA 4QNPF 4LIQL 2DQHL 1KIUA 3BGMB 1IS3A 1KEXA 3KV4A 3PJQA 3GT6A 3NBNA 3D85B 5J6GB 1JZ5A 5JZ7C 4JZJA 5C9AA 1OGTA 2WOBA 3N2KA 4Q6GA 3WG7C 1ETJA 3KPRA 5J56B 1G8WA 1V6JA 1YYNA 1ZJBA 1G9FA 2OT5A 4BQBA 3ZRXA 4BAYA 1CD0A 1FPTH 2I26N 3BZ4B 3Q7JA 4GMTH 4WV1A 4Y9EA 1B35A 3MCLH 4IV1A 4O9EA 4QDSA 2WFF2 4YQXH 3SYCA 4UI2A 3I8TA 4LLAA 4AFDA 2DS4A 3AK2A 1L0YA 2LLLA 3NV3A 1SXBA 2CTPA 1X4YA 2ZPXA 3C60C 3RU8H 5GXBB 1EJFA 1HFUA 3BZDA 3R18A 4LLWA 5CP7A 1NGQH 5E8OA 4OZFB 4XAWL 1K4DB 2XR4A 4PQ9A 4WFGD 4CU7A 4FABH 2FK9A 2OJEB 4E4DX 2MQCA 1J1XH 1G4MA 1WT5C 1VSCA 4WHDA 2XV6B 3KXFE 1ZVFA 1I7ZB 1NXD1 4RX4D 4DXWA 1JXGA 4ERSH 4EQVA 4B3SB 3PY9A 1KGWA 2CO6A 2H9GB 4XPBH 1D6VH 3VZKA 5KSVB 2OMNA 4OY9A 2Z5UA 5HJ3A 3CPLA 2DQDH 3TGXA 5DDJ1 4Y88A 4M5SA 1P5VA 2VDML 1AGCA 3KYOB 4CS4A 3HLKA 3JQXA 3I2CL 4RGNE 3OG2A 3R19A 3V4VH 2EIZB 2HRGA 1VAKA 4TNEA 3DF0A 4UV7H 1CFSA 1MLBA 5C08E 3RBSA 4CU8A 3VD4A 1OURA 3RWEA 1IQWH 3PWVB 3RYIA 4XNDA 3IPVA 3RNSA 1MCBA 2AXFB 2ZACA 3RX7A 3SDDD 1P2CB 4LQ1A 2ZS6B 3SE9H 1G7YA 1NCCL 1FVEB 4PJFF 1OM9A 2QM7A 1NC4A 5CJOH 3I55V 5CCKH 3IFLH 4JQIA 3ZZSA 1RV6X 4GT0A 5I1EH 3CLFL 2P5WE 3N42B 4GSUA 3V6OA 5IBLD 3CJXA 4N2EA 5F8PA 3GSQB 1ZHNB 3FMGH 4K21A 1USZA 4D9RE 2LTNA 3OEHG 4OJYA 5CFDB 2B59B 5BZDB 3T0XA 4JI4O 4IIJA 3ULVE 4AYBA 4HUMB 1T04A 4AI2A 3ET9F 2D03H 1AQDA 1BJMA 3UPCA 5B8CC 1Q5OA 2N4IA 4GFXA 5C0GB 4E9SA 4GSQA 1T4KA 2QZ5A 2VMDA 4F2ME 1CN1A 2XHNA 4Z7WF 1U3HA 3S5QA 4ARYA 3UNPA 2XJRA 2PHLA 3GBWA 4KJPC 4NDMA 1D9KD 3F12A 1AZDA 2EKJA 2OZ6A 4JPSA 5DHYA 3TO4D 4X89A 5FK8A 4LEJA 4XXWC 5DFVC 5LAPA 3MJ6A 2P28B 5CYYA 5ABJC 2NX5B 2AV7B 4XPTL 2HPOA 4U7OA 2AJSL 2RA1A 1E5UI 5DEFA 1RZPA 4H40A 5D7HA 1W6WA 2V2XB 4AOCA 5CKAA 1BYNA 4OGAC 2CJUH 3N2GA 2PTVA 3MZGB 4FX5A 3B2EE 4UANA 4WZCA 3VXNA 3P30L 4JFHE 2YG0A 3QD6A 3TA3C 3ATAA 1JJUA 2CGPA 4HC1L 1WZXA 1AXSB 4MXQD 4JDNA 4IGBB 3L95B 2C2AA 2RQ6A 4PD4F 4R7NA 4KTGA 1ZGLP 2HKFH 2SLIA 6CGTA 3EZ8A 2RMU1 4LAQH 1J1LA 2EH8L 4CKQA 1NBVH 4PS4H 1K45A 1U8LA 2N1TE 3PJLA 5LHHA 3JT0A 2J1WA 2A73B 2PCFB 3ZXAC 1KULA 5LATA 3ULAB 3HNYM 1S78D 5D55A 4MNQB 1V9U3 4AEHH 2OMYA 4W4NA 5K39B 1NCBH 5A2QN 5IB2B 4IE4A 1KYOK 1RFDL 5LY2A 2AK4A 2V1DA 4GULA 2QWOB 3QIUB 2CK0L 4EN9B 1AHKA 2BVPA 2PHFA 5IHUH 4F9LA 3RDTB 4MQ7A 5JQ6H 5CD5D 2UXNA 1P6AB 1LHZA 3WXVH 5KYXA 3KXFD 4LHJB 3D48R 3QH6A 4JG9A 1T0NA 1DEDA 1M5IA 3L71H 3I50L 4NS0A 3EO6A 3POYA 1F8TL 4YUEH 2H8PC 1EHNA 5FF6B 2NLJC 5AZEL 2Q1ZB 5GLWA 4HT1H 2L04A 1U8HB 1G9EA 4IRJA 3FQRB 1WJ3A 4Z0BH 3SCMC 4ACPA 1NLRA 1YEHL 3KYNA 4ZOLB 3RX5A 1X7QA 1FNSL 3MAQA 3LS4H 4OIIL 3GRGA 1Y43B 5FK7A 1FVDB 1AFVL 4BQ9A 1TFPA 3MIHA 2WWWA 3AL5A 4RGND 2LFEA 3WG7B 1G9MC 1G6RH 1TZIB 3W56A 1BCXA 2R072 3MXWL 1V0AA 1NAMB 3RZHA 5C08D 1LK2B 2R39A 4XX5A 1FZMB 2I5YL 3HLAA 3BDYH 4O58L 2KM2A 3PDQA 3OXSA 4IW3A 1E4WL 3QUGA 2Z34A 4R4NC 3P3YA 1OM3L 1YIFA 1H15B 2Y60A 2B7YA 1M1XA 3FKSG 4Z18A 1QJZA 4I0PA 5CSZA 1MHEA 2NY6D 1IM9B 1Z3RA 2A9CA 4Y1AD 3H1YA 4Q0PA 3C60B 1RK1A 1Z5YD 3DXAE 1I1YB 4D8OA 1A22B 2P5WD 3COOA 2Y6KA 3ZVXA 5AC91 4PBVC 5INDB 4KXDA 4ZS2A 2F53B 4X42A 5HP5A 5K59E 3CC7V 3RTQC 2JDNA 1UQSB 3VKOA 4MA7L 4RA3A 4NKOA 4J3OD 5DJCA 3N1MC 3ULVD 5HI3C 4WU5A 1ZZ9A 2NCMA 1QP1A 2D5HA 1RUNA 5F2WA 3EG9B 3FT3A 5HDBB 3FO9A 1TIUA 3PL6C 3U2JA 2J72A 4LF3B 2PPEA 2GC4C 2HT2D 2BHZA 4Y4HD 5IEKA 3W37A 2LW8A 1E9OA 1AS7A 5IYYA 4M43L 3BGMA 4AQ8C 3CKHA 1CUOA 4XQDA 5E16A 4GXUN 1C8QA 5J6GA 2JDYA 5BV7C 5DQJA 3P11H 3PFQA 3LN4B 2ZGNA 3WGUB 1Y6XA 4U6TA 3VJ6B 2OMZB 2EKSB 3RA7L 4DW2H 1LE5B 1RIRA 4H8WL 3LZQA 3MV7B 4DP1X 3BWAA 5C3RA 4U3CA 3AS0A 4MTFA 2Q7GA 1U4EA 2I7SA 3HG1E 2QTOA 2YAMA 3DI2B 1HNGA 5JJEB 4G6AD 1P9MC 1Q9KB 3LS5H 4KMLB 4JFHD 1ZDSA 2VDKB 4GP5B 4R4ZA 3MDJA 3T1MA 2ERJB 4PY8I 3DBXB 5DHEA 2GJRA 3T2MA 3E8FA 1AGEB 1USQA 2WWMD 2OJEA 2X53A 4ONFH 1MSWD 3J8F3 2WYSA 4ZJ9A 1HOCB 1JDDA 2X70B 1FGVH 3ZRCC 3HI6L 3NRUA 2H9GA 3IETA 4RMTA 1HSAB 5B8CB 1ZZ6A 3KPPB 3WAJA 3DGCR 2BINA 3GSUB 5KSVA 5T5NF 3TEWA 4FPLA 1IAII 3LPWA 5JW4N 1CD1B 3NCJH 1OCCC 2YZ8A 3RVVD 4MDRA 1VDGA 3KYOA 1BMGA 4X62B 4XF9A 4KRPC 4BWTA 5E00A 2WZR3 3JXAA 2BV4A 4CEWB 3PUIA 2EIZA 4YE4H 2WUBH 2DWXA 2HFTA 1F4YH 1XGYL 1F86A 2J88H 5TSWA 5ABJB 4LKSA 3PWVA 2E7LC 3AKPA 3EHBC 3O12A 2V9TA 2QV2A 1ZEAL 5JI9A 2YXLA 1SEBB 4LCWB 4JYAB 1IGCL 1FVEA 1WGOA 4BFBD 2R062 4HS6A 1NJIW 1TJIH 3LVEA 5KC5A 1S7SB 5KXBA 4J8RB 1T1XB 4HWBH 2EH7L 3EO0B 3QC5X 3TA3B 2AYHA 4S1SL 4ZOEA 3GSQA 2XOTA 4U36A 2YWZA 2AREA 2UWEB 3CZFB 1VR3A 5CFDA 2B59A 5BZDA 3RW0A 3SGIA 4C0BA 4G8AC 4QOKD 1A4KB 4XNQA 4PY8J 1QACA 4Y0GA 3B56A 2AS5M 5FO7B 4NUMA 4E8CA 4MS2A 1WFOA 4PG2A 1CFNB 3UAFA 4W50A 5C0GA 4QKFA 1FPTL 4QM9A 1A3ZA 3ZX7A 3PGDB 4GMTL 4YSCA 4KHPB 1VAVA 1FQ9C 3MCLL 4RWYH 4HHWA 4YQXL 5A6XA 4ARXA 5K59F 4M03A 1RZGA 5K9KA 1WWBX 4FFBB 2WTOA 4JR9H 3U4XA 2EO7A 4X7TB 2VR5A 4JFOB 3RU8L 5I30H 1NGQL 1NWOA 2W6IG 2EDNA 3IMBA 1DQKA 4X6EB 2B5UA 2AV7A 4KWUA 1V6KA 3VBUA 4FABL 3Q05A 1RZ8B 2H8PB 4G8IB 1J1XL 1BEV3 2L35A 4HAMA 3MD0A 2NLJB 4N0UE 3RVUD 4Z3GA 3VQWA 3SCMB 4PA4A 4ERSL 4KKZA 5HVHB 4XPBL 1D6VL 1TO5A 3T1CA 4Y26A 1AXSA 3L95A 1AOHA 2DQDL 3MROA 1VBC3 1CXHA 1H5BC 3O4OC 2PAMA 2DMKA 3CFQA 2JNZA 2ZOKB 4EDXB 4FT8A 4JPVH 1RI8A 4DW0A 1OEZW 3QQ9D 3V4VL 5M94B 4FXGC 3PGFH 4NXNO 1MZZA 2A73A 2A9DA 4J3BA 4UV7L 3SZ6A 3ZDXE 1MEC3 3SDDC 3T65B 1LHWA 1IQWL 4FEIA 2QQVA 1DUZB 4N26A 1ZA4A 2KD7A 5IB2A 3VL8A 3ZXFA 4FPEA 1JZ2A 1DCLA 5LASA 5F5CA 3SE9L 3NJNA 4XOBA 3I74A 3QIUA 5CJOL 5AW9B 4BWWA 2Q7HA 5IBLC 2EZ0D 5CCKL 1EZJA 3IFLL 1Q0YH 3RTQB 5I1EL 1GAXA 1KMGA 3AZWA 1SLBA 1BLIA 4GKNB 4V33A 4XMAA 2VDQH 2X4NA 3BLBA 3FMGL 4X9BA 5DR5H 3IN0A 2Q68A 3PL6B 5FF6A 4PW4A 3SEPA 1HWHB 3VW3H 3DIFB 2D8KA 1U8HA 3QEHA 1SLIA 4PJXE 2D03L 2IJJA 2FHCA 3FT4B 2LV4A 3TCLB 5ABZA 4ZOLA 5J9PB 1JMXA 2BK8A 1FVDA 4N7IA 2X9YA 1WV7T 4K15A 1D9KC 4PRPE 4L3ED 3GC3A 2BM3A 2R2CA 2F54B 4YBQC 1NAMA 3HR0A 4YLBA 3J4UH 1HL9A 3IM1A 3O45B 3FF8A 3GJAA 3T1YB 1UWFA 2X6MA 1XF3B 2ZCHL 3N27A 5C0CB 2BSSB 3H2WA 4EFEA 4KKBD 3VGEA 1XNAA 2Q8OA 2HTLD 1XR9A 4UMSA 1IM9A 1D0HA 1H6YA 3VBOA 1F11B 4JGNA 4O4LB 3C60A 4P23C 3OY8B 4RGKA 3DXUA 2A75A 4V1PA 5D7LA 1KGUA 5A2FA 3D06A 4XW3A 4HSQA 3WW2A 3D18B 1KENH 2F53A 1FFXB 1NICA 4F6EA 1S8DA 2CJUL