4PI0A

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell) soaked in copper
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
390
structure length
390
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMVLSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLEHYGISRVYAWHLPWMAVGAAWIFFWFVRKGIITSYIRVAEGKADDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKENVTTELNGGVYKVPGRELTINVKVKNNTSQPLRLGEYTAAGLRFLNPDVFTTKPDFPDYLLADRGLSVDATPIAPGEAKEIVVKIQDARWDIERLSDLAYDTDSQIGGLLFFFSPDGKRYASEIGGPVIPKFVAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords unknown peptide
total genus 94
structure length 390
sequence length 390
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4pi0A02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 4pi0A03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4pi0A01
3RFRA 4PI0A 3CHXA 1YEWA 4PHZA 3RGBA 4PI2A 4O65A
chains in the Genus database with same CATH superfamily
1I1YB 3A0OA 1TITA 2VXVH 1UUSA 5EMYA 1O3TA 4G8EA 3PXJA 5L3BA 4U05A 3X3FL 5JDBA 1HJGA 5BPPA 3SJCC 2WVTA 3J2PA 1EJFA 3QG6B 4L4TE 4BUGA 4C47A 4BZYA 1GL4B 1YMMA 4IKIA 3AREB 5C0ND 1Q6HA 1GICA 4IBQA 1YFXA 4GQQA 4NQDA 1YN6A 1OCOC 4I5BB 4BWTA 3X1FA 1JPTL 5JH7A 3IN2A 4XMTA 2E7DA 4HUWA 2LV4A 3BH4A 4KPHL 1CWPA 5EIYB 1QJFA 3QH3A 1MG1A 3P4MA 4XAAA 5ABJA 5CJQH 3P0VL 3Q44A 4LKCB 4H13B 1RMFL 3PXLA 3J7MA 4AMKL 2ENRA 5A2LH 5A2AA 3BPLB 2IH1A 4QAMB 5DJAB 5T5NF 2RACA 1D4VB 2GZWA 4X4YB 3AXDA 5JA8B 5DUBB 2IMNA 1ET8A 2PYED 5DJ6A 2XPGB 4OX9B 5DURB 2HCZX 1R0AL 3FSWA 4K1YA 4NJ9H 1LK2B 3MV7B 3BE1L 1ZANL 4Q2ZB 2Q7AA 3NH7H 3MZHA 4XJWA 3IAYA 1EEQA 3RWDA 5B1CA 4IRJB 1EPWA 4JI4O 1ADQH 1T1YA 5I30L 1BMFG 1K7DA 1C8M3 1GR3A 4NJAL 4WFHE 1G9EA 2WAOA 4ZTOH 5FHBH 4NOBA 1RPUA 1K5MC 2CO3A 1SBEA 2HEPA 3AP5A 4I1PA 3SISA 2JDHA 3D25A 1XZ0A 1DBAH 1SQXH 3QQNA 1XGPA 4AI0A 3UPCA 1DJSA 2FHFA 4PS3A 1N8ZA 1T7WA 1OTSD 3C5ZD 5GZND 1AP2A 3EJKA 1G7HB 3BRCA 1AD0A 1WZ1H 5BZZA 3W57A 4A7KA 3C5ZB 2K6WA 4OKVB 2YEZA 4QRFA 1FV1A 5I1GL 4HPYL 1TVBA 1RZIB 1HKDA 3ZRXA 1E4XL 3NCEB 3ZFEB 5C09E 1HXS2 3BCWA 3D3VB 1GWMA 5F5CA 3IDMB 4FG6D 3SCMA 4C4BA 1XSJA 3VGAC 5C92A 2QQPA 4PA7A 2C1PA 3Q1SL 4MDJA 3CVBA 1OF4A 4HVRA 4GYBA 5BR8O 1UD5A 3BD5A 3DKHA 4ODTH 2Y6TE 4F2MB 4M6OL 5IROC 5EDSA 1ZV5A 2IUWA 1YJNV 4F15B 1AI7A 2XFXA 3UP1A 4YL9A 2Z31B 3FQ4A 4MXQC 3SJVA 1DVFC 3MCKA 5CF3A 5M95B 1U12A 1YLLA 3BTZA 2YAHA 3QRGL 1QTYT 2Y6SD 2APXA 3GTNA 3HHSA 1LO5B 4ZUSA 2LS6A 2GN3A 3FUQA 2CJTA 1ZT7B 2PPFA 3CU1A 4XQ4A 4B6ZA 3JALB 4PG9B 4HAFA 1R46A 4UVCA 3THMH 3QC5X 1OB1A 1RLWA 3GI8H 4WHYG 4GG6A 5T5LA 4NQEA 1MFUA 2ITDB 2VISB 5C6WH 4GG6E 5I8EB 2Y6FA 5IHHA 1YYLL 3GBDA 1CFTA 5HGDB 3QAZB 4Z7UA 1BVNP 1Q94A 2F8XC 3K7UA 4JRAA 3VQ1C 4W8JA 3WF0A 5C70A 4AHZA 3M7FB 2ZX7A 4GWMA 4WFHA 1MFCH 3ES4A 1I3GH 5CEZL 4L4VE 4NN6B 4GG8A 3M99B 5J9PC 4OGQC 4N8CL 1AI6A 3L3DA 1T3FB 1WBZA 4N2AA 4P00B 5DN2A 4PH8A 1XXDC 3H4HA 3QCVL 4CILA 4BQCA 5AL0A 2ATKA 1URXA 1ZBA2 1GM9A 3LF7A 5E6ID 1P6AB 3QNZB 4EUPH 5AG2A 2O8QA 4OMCA 1BHAA 1XH2A 4LLAA 1C28A 3U7YL 2LU5A 2YD4A 1SJMA 3SGKA 4LLDB 4LLMA 3DJZA 4M00A 3VVVA 3HS0B 1OSPH 1N0JA 1K73W 1UWXH 1X5JA 4QGYA 3QCUL 5DJ6B 1JXGA 3U4AA 2FDJA 1QLEB 2FH6A 4UQ2A 4H44B 1ZLUH 3TA4D 1YSCA 3SODB 3TBCA 2BOLA 4F83A 1TG8A 3ABLC 5AVTB 1PAMA 1VF6C 3UMNA 2YRZA 1KS5A 1ZBA3 2E5LB 4MNQD 3J8F3 2IOMA 2DYCA 2OQJA 3PWJA 3CZJA 5SV5A 2WNVC 2F0CA 4GRWB 5IVCA 3FDWA 3V0BA 4LKXB 5JTWA 5E7BA 4M8RA 4IYKA 3A8TA 3Q4HB 4IV1B 1WA0X 3G5WA 4MSVA 3S2AA 5TGBB 1LK3L 2BVVA 3T0EC 2QMJA 4XBPB 1KBVA 4PWIA 3JV0A 3X17A 3NGBC 1KSRA 4UQIM 4YY3B 3O1PA 1QEWB 2BCMA 1FNYA 3S5QA 2Q1FA 3QDMD 4Y2DD 4LNRA 2RJMA 4ZU7A 3UAFA 4EAEA 5LO7A 3NZHL 4PREB 3OUHA 2Q86A 5ESVA 1N34B 4YGAB 3MIHA 1GOFA 2VDKL 1G0XA 2VSKB 1AR73 4FQCH 1E5IA 4L0PB 1X5KA 1QHDA 1NDMA 1E42A 5I0DA 3NNLA 2Y36H 3OHXB 4UWQB 1GC1H 4DKFH 4NWUL 4P3DB 4QD2E 3CMEV 5E5RB 1POV0 4LSRH 3DDFA 4Q4X1 4QXHA 1QNZH 1SFPA 2PCXA 3IRPX 3N44B 3RVUC 1WZKA 3GZPA 1RZJL 3UG4A 4B7LA 5FOBB 1KGJA 3C09B 4LFBO 3LS5L 2EINB 4L2NA 4BLIA 4X9GA 4FTVD 3VMNA 5KJRL 2BSSB 4OGYH 2VDRB 4F8QA 4KJYB 1FPTL 4XNXH 4MGIE 4Z3FA 2JDYA 5T50A 3SKJE 3U9PH 4DUYB 4P46B 1M57C 4FXKA 5H8DA 3VBOA 1QUPA 2RQ8A 4EPSA 4R7XA 4MD4A 4F7CA 5FKBA 2CLVB 2WKLA 4PJBB 1MLBB 1DVQA 3W5NA 2XLGA 2O26U 4AFBA 4UZSA 4X7TA 4LXLA 4XI5C 5FLIA 3HNSH 3KWXA 3EDFA 1LUVA 5E2WH 2BFGA 3CRQA 3GK8L 1V6KA 1NPJA 2PMWB 1KDMA 3HVDA 5INDB 5LBEA 3WHUA 1I31A 1I7TA 1XCXA 4WBNB 1ZUQA 3CCVV 5EU5B 2BTOA 3PYCA 3UIYA 4D6QA 2ZONA 4MVZA 4PJGB 5F8RC 5IJ0A 3FQWB 2H26B 3HS0C 4JYBA 5A3UA 2EH8H 2DWXA 2YXVA 1RU9L 5HDBB 1P9MC 1SY6H 2O61A 3PCYA 3HZKB 4FVMA 1AR72 3PGCA 1BYOA 2CJUL 1KY6A 3GB7C 1TMF2 5FV1L 2GSMB 1RZGA 1NAMH 3PPEA 2I25N 1GP5A 4HKXB 4ZQKA 5FP8A 1BP3B 3L6FA 2B14A 3JBG3 2X87A 1EJ6A 4QRPE 2RJLA 3ELNA 4BXFA 1IKOP 1TUEB 1T21B 5KTEL 2VCMA 5D7IE 2R1WB 4S11A 5DUWA 2AAVA 5E2VH 4MVMA 3WB1A 4PA4A 4EFBA 4I48B 4AV4A 4KBZA 3PGFH 4COWA 5HHME 4UANA 5JOXA 1K5NA 4G5ZL 5HYJB 4IQPA 5DA0B 4G1MA 4HWBL 4CP9A 4HHGA 2CJUH 5F3IA 1JODA 5D1ZB 4FFZA 3JASB 1CLYH 4L37A 2WLIB 1VQ4V 4OIIH 4XBEL 4LWSB 2DDQH 4O4YL 1BBT2 5E1QA 3G5XA 4JUSA 2B9VA 2COVD 3CS5A 3FO9A 3CCEV 1J48A 2XWTB 3LZFL 2N04A 3BCCH 3GSVB 4PRNA 4U1LB 3HAEG 5KR7A 3ASWA 5IP4A 1OL0A 3JVGA 1QLEL 1F15A 2GAZA 4D7SA 4G72B 1JN6B 2R69H 4INDA 1MPXA 1PNFA 4CZZA 5KS9B 3ALWA 1BK1A 1WCKA 1N6QH 1ND3C 5F3CA 5ADPL 4ODVH 1WQVT 1D5AA 3RUGF 3LPWA 3GJAA 4JCMA 1JGUH 3MLSL 1L0NH 3L3OB 4AI9A 3VLBB 4PJ7B 1HDMA 3WKYA 4ZUVA 3E3QC 4HOOA 5FZMA 3BN9D 2NDGA 3GYDA 4BGDA 4DEUA 4LNRB 1WICA 4XXPA 2CM6A 4W6WB 2N0KA 5D7JD 3ZN6A 2Q86B 3NJGA 2VISA 1I9EA 4XNYH 2Y5EA 4CDUC 3ML9A 1XGYL 3QXWA 4ODHH 2G60L 1SFHA 4GKLA 4HZLA 2J5WA 1XHXA 1FO0A 4IKKA 4JQIL 1OTUC 4TTGA 4XP1H 4ZU5A 1AP6A 1AGCB 1MJ8L 4DO0A 3E89A 1G7LB 2NY0C 3EKCA 4ZTPH 1SOSA 2Y4TA 5F1OB 4NUQA 2WUCH 4L23A 4Q4Y2 3NDYE 3HMXH 1XH3B 4BMBA 1GAXA 3EYQC 1C08A 4CCDA 4JN1L 1A7PH 4CH5A 2RCSL 4M5ZL 2EH7H 3TT1L 5L2JB 1NMBH 4BCUA 4LCIH 3GIVB 2AZ0A 2BOCB 1GTFA 4OGAD 1J1OH 3IE4A 3S48A 3NCMA 3RNQA 5EBWC 1S4IA 1KF9B 4JO2L 3WEOA 1K5MB 2R8SH 3QOPA 2XJPA 2QE3A 2FB4H 4CKVX 5LVEA 4JVPA 4X80H 3HUJF 3CZUA 2X7RB 2DM4A 3CH8A 4N3UA 2FSEB 3HCVB 4YC2C 4OI7A 2X9ZA 2LFRA 2ILMA 3K0GA 2MCG1 4HKBB 4HLTA 4OD1H 1LMKA 4X8PA 4EQ2A 1ENVA 4JI5O 1DVFD 5EQUA 1KCLA 1XIWA 5GZGA 4NQCD 4OGXL 5BV7H 2H26A 5GXBB 2RR13 3HT1A 3OKMA 2HWD2 1LO2L 5IFAH 3PNAA 1EGJA 1HAUA 1JRHH 4KNTA 1BXAA 1KC5L 5FYKU 4O4HB 2WO1A 5D8JL 5T1KA 3FU3A 3V52H 3ZZLA 4N43B 4YGBA 4MQXD 1DP0A 4MJHA 2DN7A 4BINA 3K5OA 4O2EA 4OUUB 4QMAA 1M9SA 2QSCH 1J1XH 5DD5L 1ED3A 1AXKA 3F5TA 3EBAA 1OHQA 4UYQA 3GCWA 5DPNA 5JVVA 1PYWA 2R23B 2YO3A 3D08A 4ZUWA 3UTSD 1UWEH 1R24B 1CVNA 1KQRA 1IC7L 4ZI7A 5D2LF 2YKKA 2G5BA 3TYFB 2QVMA 2FNBA 3BGFB 4KTEH 4NPYB 5GGQL 2Y06L 4OGXH 4OH2A 2NPIA 2FL5A 5LRSA 1NCDH 2UWEF 4NZ8A 4ZAKB 1RFDH 3T6VA 5HYJA 5A16B 1RUG1 1MFCL 3PHSA 5AYTA 3LD8B 4OSUL 5F8QC 1XHZA 1MJJA 3II2A 5DFVD 5I0TA 5C8WA 5FDYA 5FGCB 1QKQA 2FX9H 2B5HA 5AVSB 4JI3B 1IAIL 2VRKA 4LWSA 1SLLA 4HT1T 2B1HL 4MMXB 4BA6A 2V73A 3ZIWA 4J8RB 1Z9LA 1AO7E 2P5EB 4A2UA 5DS8A 3CRAA 5ACA1 2QTVA 4B3VA 2IBZX 3EYUH 5GGSY 4AJVA 2A6YA 3CFTA 4P5KB 1AACA 1JN6A 4TT3G 1G9NH 1MCDA 1Q9WB 1U3HD 3RKDD 1SLTA 3TWIA 3EUDA 5D1XB 5AB2A 3PG2A 3QLQA 5CGYC 5D1ZD 3N85H 3I74A 4ZMPA 1MPAL 2WVUA 4UM9A 3BZEB 3KVAA 4K8FA 2C3XA 2IDFA 2ADPA 2AQ2A 3BDYL 4I0PA 1I9RA 3TBVB 4EDXB 4UCFA 4UM9D 2QTOA 4A6OA 4R4ND 2FX9L 4ZTPL 1NCQC 1IE5A 1COV3 4ZX4A 2WXPA 4RISH 5LAXB 1ENRA 2WFF1 2PCPA 3DXAD 3NV2A 1RZ7H 1NMCB 3MRCB 3UAAA 2X0UA 4JI0B 2C1FA 2N0MA 3P3UA 1WUVA 2FJSA 4IU2A 2B9ZA 1F6AA 4JRYE 5IJKA 1M9WA 1ACZA 1FXZA 1UACL 2ZKHH 5TE6H 2YLKA 2JVUA 5CP7B 2EIMC 3LQZA 3GBMH 5BW7A 5DR5L 2J12B 5HDQL 1I1FA 5AENA 4KK5C 2BOIA 4MAZA 1CX4A 2NY0D 4PGDA 4ZO7A 1D5IH 2ORBL 2ARXA 4YDJA 4L92A 3C08L 3IFLL 1FJ1A 4E36A 1OXYA 1HJCA 4MMYB 4PJ7E 4I48A 5BQ7B 2OMUB 2RS33 1IGTB 2BCKA 2E4FA 3PAZA 3T0EE 4DZBA 2YHJA 2BNQA 1GGUA 2ZCHH 2XUWA 1UGNA 3EYVB 5D7JC 3DDGA 5HVHC 4H2CA 3SDLA 4NVPA 1WSST 2D4DA 5J6HA 5KVGE 5T55A 2R56H 3VFVB 5TSWA 4OLWH 3EOBB 2JKTM 4GAFB 4OM0L 1U95B 2X4OB 1ONQB 4P5TB 5IROA 1PTZA 1CAWB 3LA3A 4NRPA 1RUJ1 3MLRL 1AYN1 3K72B 1ND2A 4K40A 4R4XA 3JCZA 5J2UB 4H5SB 3T3PF 1CIWA 1DCSA 4G7VL 4L3CA 3RFRA 1UD8A 1F7YA 2A6ZA 3FW6A 4XWGH 4Y7OC 1DQQB 1G7JA 2ATPA 2DEWX 5ICZB 5LDUA 5KS9A 3VXSD 5HYJE 5LG6A 3AKTA 3T4AA 3WDXA 4AQ1C 3PGDA 3QZPA 3E22A 1CDJA 2NLJC 1MVUA 4AYFA 4E0RA 4XFHA 4LR4A 3WVJA 5EZJA 5IB2B 3C6LC 3W39B 4QDQA 4AMKH 4XCCH 3A2FA 1GS7A 2XQYK 4X8JA 4TRPH 3WNOA 2XRAH 1QWUA 3AT9A 3ERXA 1IJ9A 3FO2A 2H6UA 4LHUG 5KN5B 1KNOA 1NL0L 4LP4A 4LFAO 4MZUA 3T4YB 5L8KB 3ZO0A 1FOD3 3VN4A 3VI4E 5HPMA 1SY6A 4OJFH 3MGTB 3OHXA 1MVEA 3PWLB 4NO3A 2HWF1 2BW4A 5C3IA 1U8QB 4YC2B 4H0HB 1GY2A 2ZX8A 2GTWA 3DXRB 2X89A 3S2CA 1VP6A 1GW6A 2OW7A 4LOSA 1NLDH 2VABB 2X1QA 3KL3A 4WFHD 2Q10A 1L0QA 2DMKA 4WWPA 2EXWD 2JK5A 3N7LA 5BNNC 2BSSA 1SLIA 3OTOO 4JFVA 3ZHSA 1WP6A 1WTGT 4WUUD 1ND0A 5GRJH 5MP6H 2BH0A 3O2WH 4AQEB 5AZ2L 4UW3A 3AACA 3B7SA 1Y6XA 4Q6GA 1AR1D 3KJ4C 1UPIA 4Q1RA 1XPWA 2RCVA 2YD7A 2VCCA 3T2TA 3NOIA 4OLUH 4UTAH 5IQ9B 2FEDC 1K5MA 5DEFB 1PG7W 4K94C 4C57C 3WV0A 3FQTB 2OK0H 1DLHA 4L8SC 4OIIL 1M2VA 1LHUA 3LRMA 4IKLA 2ED6A 2R4RH 3OF1A 1I7TB 4YBLC 5JDSA 5HYSG 1WCDJ 4PG2C 3O6FC 5A1LA 2GCYB 1JWSA 4HK3J 4JI6O 1PM7A 4UTBL 4MJ6B 4G5ZH 1X5HA 4NKOB 4WZCA 1U8KA 3QORA 2EAEA 1ASQA 4HISA 4ONHA 3ZO9A 3AT8A 1R3IH 1MN4A 5FFGA 4FGMA 3WD5A 2WNUA 1FPN3 1W05A 2FGWH 1DQ4A 3JYCA 2XTJB 5LDSA 5FZ6A 2CMRH 4W9CC 1T20B 1OM3H 2DQFB 1R081 3JSSA 3TCXA 4QM9A 5H5NA 3R19A 1WWCA 2UUCB 4XAWL 3R4UA 3VBHC 1BQZA 1Y4WA 4RETB 1NGYB 9CGTA 5I1DA 2W0FC 3LZLA 5E1RA 1VQ7V 1UB6B 3I9GL 4RNRA 2D7NA 3CU7A 4PIBA 4PQ9A 3SBRA 4PRHA 5EO1B 3LNNA 2ZWLT 1FJ1B 4O4LA 4BU2A 3QNXA 4NPYA 5LCWL 3ARGC 1NCWH 2VW7A 2LRPA 1KJVB 4YBQD 2A9NH 4BZ4A 3H2WA 2OLDA 2PXYB 4IIZA 3O3BA 4U2ZA 2QZ3A 5FPXA 4CP9B 4YSPA 1E9PA 2F5AL 2NQCA 1Z9SA 3QR2A 4M9OA 5IBTL 2ENSA 1QQP3 2HBUA 5DHVB 3RZCC 3CCUV 5IHUL 4V1DA 1QPKA 3BQUC 3MODH 1F4HA 1P84F 3IWUA 5FS5A 4OJFL 3FO9B 4XPTH 2WUHA 1H8LA 2IPTH 4ANWA 5HYQB 2Z31D 2OCCB 3P9LA 1KBWA 3TCLA 1SQPH 4NSKA 1J3RA 1JYCA 2VCBA 4P2QB 4O9HL 4N24A 2NY7H 1H3VA 4L97A 2ZGQA 2XRAL 2YXHA 1TCRB 5F32A 5EEXA 1IILE 5EYPB 1A7BA 1JCHA 3D8CA 2HX7A 5EBMA 1MCCA 1NU1H 1R73A 2BFVH 1MABG 1YNTB 3JCIA 3TYJA 4HPOH 3ATGA 4Y9FA 3AZZA 4NPKA 3ME2A 5A2JH 5JZGC 2P06A 1OQEA 1G5AA 1RZJH 3IDGB 4F8LA 5I66B 3E5UA 3UGHA 2ROYA 1GOGA 3HE6B 2CDGB 1UU5A 4N9GA 3FO2B 2QDNA 3E86A 5B1KA 3I2CL 4F8OA 5IQ7L 3HRZA 1PSKH 5LGUA 4L4VB 3MBEC 2D9QB 1GRJA 4UTBH 1AJNA 3ULUL 4RWUA 1CG9A 2L7JA 2EULA 2X4QB 3IF1A 5J12C 4ZZ8A 5F96L 1DJGA 4FTVB 3W7XA 1C16B 1GYCA 3C75A 1K8DA 4GWIA 1WHOA 4JPIB 1ZDSA 2HT4D 4K8XA 4JZOA 4K7PL 1P7BA 5FHAH 3I7DA 1Q0XH 1K42A 5JA9A 3VFSB 3SDDC 2PO6A 5CP7A 1G0DA 3CZFB 3HS9A 3VRJA 5CBEB 1CZTA 3TBSA 2BY0A 1SLXA 2A7WA 3FJSA 4XCEB 5LBBA 2F66C 3RFZC 2ZAIA 1F3RB 4ODSL 3KGZA 4K2UL 1YJDC 1WBYB 2AP2A 1N1SA 5BY1A 3SO3B 3TO2A 2GK0A 3H42L 4IHBA 5GRJL 1AR4A 5IB5B 3T2NL 4YDKH 5MP6L 2FK9A 4J10A 3S8GB 3I9IA 4W65A 4XVHA 4XOEA 5IWFA 2AXGB 2RTTA 5HD8C 3POSA 1YUKB 4HAMA 4G6AD 2R0ZH 4QHMB 5ANQA 2GBVA 2JB6A 1FZJB 4R5VA 3QUMB 4NE9A 4YZ5A 4ADGA 2GB2A 4V2BA 2ZUTA 4QX5A 5AZUA 3VX1A 5BVPL 1LESA 2ZD0A 1MZZA 5DJYB 1D0GA 1GMGA 2ZXAA 4F2ME 1PEWA 3HNMA 1KY7A 3UM7A 2G60H 3II3A 5FTTC 4PV9A 2A6IA 2Y6SC 2ZP8A 1OCZB 2VRQA 4GXLA 4P8QA 3FBKA 3APFA 3THPA 4MASA 5IQOA 5JCOA 2W65B 4PYGA 2VR6A 5MEPB 5BY5A 2ATKC 3M46A 3ARED 1T20A 1UWFA 4N3TA 3CYOA 5A43C 4XOCA 4MJ5B 2WBJC 4GW4A 3EYSH 3T71A 2WNVB 1JF6A 4FFKA 1RIHL 1WISA 5A3PA 4PD4J 4Z78A 3T9WA 5DAQA 5I18H 3V79C 4PRHB 1WMXA 4FFHA 1A6UL 3S0PA 1RZJC 1OZUA 2ITEA 1BFSA 3V0VA 4ZAKA 3VDAA 4D0CB 3Q06A 2EDXA 1MRDH 4EN0A 3LSOA 4G9DA 1N7MH 3VFRA 3FTXA 4U3SB 5BRZD 4DMIA 3BE1H 1AUYA 1GN4A 3PQYE 2VLKD 2ITFA 3EOYG 3VFGL 1F00I 2PWEA 1O7SA 3T0VA 5IHBA 1KPUB 1INDH 4JTAB 1X5GA 3E2HC 3ETBJ 2K9ZA 1D3CA 2NNAB 3U0PB 2DICA 1YIPA 2WQXA 4QE9A 1VBA3 2D40A 4ASKA 1H8TA 1UA7A 2O5NA 3QXAA 2V7HB 4ORGB 1KBKA 3LYRA 4PJDF 3HG1D 4BKTC 4OCTA 1YUHA 4V11A 5IG7B 1CAXB 4XRCB 5GGVY 2YGMA 4X5PA 1B0GA 5DJZB 4SLIA 2CU5A 3CJHA 1R9FA 2J55A 4OPHA 4OJAA 3IDNB 5JHLA 3E8HA 1E8YA 2CL2A 2AXJA 2G9FA 3HFFA 3P1IA 2JKNA 3PJLA 2BXZA 3CMAV 2EC9T 4XDQA 1V6MA 4ZSOE 1IS3A 4HVOA 2B9AA 1WLEA 4JZJB 3BQUD 3WDIA 2VLMD 4F80A 3FFCA 2PHWA 4MVTA 3RGVB 3VFOA 2WANA 4FCAA 4WWKA 5L2KB 3ZDVA 2QQNL 1CZ8L 3QPKA 1VGEL 3RB5A 3DV8A 2VQFB 4YX2L 3UROR 5IQNA 2I60H 1PJ9A 4X80L 4Y4FD 3RWIA 3OUSA 4UV8A 3IZOA 1MWAH 3TBSB 1P53A 3AROA 1LEIA 3LHAA 3VRIB 4LO4B 3VSTA 1W6NB 5DC0A 1U92B 4YHHO 3L5XL 3N35A 5IW3A 1UZZA 2FE0A 5FW6A 3ABMB 2R15A 2YPKA 3VHNA 1RP9A 1Z3GL 3WHE1 3WUZA 2JJVA 2DH2A 3C3VA 4FPGA 1II4E 5EO1A 5F9JA 4Q4V2 3BAXA 4MYEA 4QPIB 2NTFA 5J9PA 4B7IA 4CU8A 1Q9LA 3JBG7 3L3HB 1S78C 3G6DL 3RNKB 1ZT1B 4UILL 1U0QA 5EU6D 4Y4KC 5BO0D 1QMJA 1RK0A 3RVXD 1NBVH 4Y22A 1A1NB 4KGGA 1HHGA 3D4CA 4ZMLA 4L5FE 3OHMB 3ASOC 3H53A 1D5XB 4ABMA 2N59A 2K4WA 3NP4A 1JGEA 4XPFL 4YWGL 3SJVE 5C86A 3GRWA 4KI5E 3QEQB 1ZVYA 4YW6A 1AC6A 3ECWA 1LOAA 2R39A 1Y7BA 3KJ6H 2HT4C 3E5QA 4ZHQA 1NCRA 2VUDA 4K5NA 3MLYL 4NWWA 3WP6A 1QLFB 1PPIA 4IBYA 4LRIA 3TN0D 3ZUCA 2YAEA 3U1SL 1WGVA 2WINB 3WYRA 1CIDA 4KK6C 3WUWA 4MJ5A 1DDTA 4DQOL 1UT9A 1ZS8B 3VD4A 2ZZJA 4CSPA 1E5BA 2IADB 3BAWA 4LLQA 1KXQA 3LDCA 1XGUB 3KE0A 3RVUD 5JW4Q 4OFVA 4O65A 3EO6A 5KN5A 1NIEA 3EFFB 1M05B 2XL7A 5CEYB 4PJGF 4RZCA 1YITV 1T7XA 2WLKA 1XL4A 3FBQA 1YC61 3H50A 4CDWC 1VBE2 4OQ8A 1KGCE 3DIFA 3MA7A 2VJ0A 3BEHA 3EYOB 1QFUL 2DIAA 4I50B 2ZGUA 1DANU 5HYSA 5F6HJ 3C7OA 3DRQB 2YPDA 2N4IA 1UKGA 1A65A 1BQLL 4K15A 4XF3A 2P45B 4QXUL 1PY9A 5D1XD 2VR9A 1H9WA 2W0PA 2ZZUT 3FTUA 4W4ZA 5CBEA 2Y64A 2DM7A 4I2XA 5FOBA 1JMZA 3GLZA 1NEZG 2KERA 4ZSOA 5F1NA 3HNBM 3ZE2E 1BZ9B 3O2DH 3IXAA 1PZ9A 1HU8A 1BPLB 3KPOB 3TO2B 2AEQL 1JF5A 3GWJA 3EHBC 5C09A 1Z2GA 4L4VD 2JG9C 2RJKA 4X62B 2NY4B 2WK2A 3L5JA 4JN1H 3UTSE 1B0GB 1I9IH 5DEZA 2R1XA 3WUDA 4XDKA 1N0NA 1EAPB 5A3TA 1ZGLM 1XB9A 2R49A 1QJU1 1CBJA 2CBPA 3ZOIA 4DPNA 5EZOH 1VBC3 4Q29A 1AGEB 1O5PA 2Q8BH 3SE9H 1UYWH 4EI5C 3RURA 5JHLH 1YXWA 3THTA 3BH8A 4NKOA 5BNOA 1J5IA 3AK2A 1M71B 2X4UA 2ZP0T 3GM8A 1LOBA 3HC2A 5BNPB 5KG9A 5LGTA 2C9XA 4MVOA 3U6RB 3C5JA 4QD2A 5BMFH 3M86A 3NIGF 1QMUA 3TA3B 4EKXA 2UY7B 5I18L 2V37A 1RP3B 3JZ7A 4KQ4L 4YXLH 3V56A 3HR5A 3L1OH 5IF0B 4HOWA 5ITFB 4AM0B 4TNGA 3CHOA 1X9TA 4PIZA 4HLZG 5BUGA 5I74C 4DR4B 2WAMA 4P2OC 2RS13 1W80A 4RMSA 1RUJ3 2ZG3A 4ZQKB 2YPKB 4IW4C 3LH9A 3BAJA 4GAGL 1KGYE 1NBYA 5FCSH 3NYKA 4W68A 1HNXO 1E9OA 3QNXB 4M6ML 4QGMA 3AXLB 4FA8A 1CLZH 3WKML 4U6YB 2WZAA 1MI5B 1PGW1 3BT2H 4XXDA 4D0CA 2DZEA 4GIQA 5A1FA 5C4WA 4NUGL 4R6ZA 1AR1C 3FU9A 3QZWB 3NJFA 3T3PE 2X1PA 5FP7A 5IOPA 2A7AA 3N1MC 5E8DL 4L8QA 2QADD 3DX0A 4LLWA 4JQIA 4WM8C 4J6RH 3HE7D 1PK6A 1AXIB 4JZJC 3QEQA 5AKRA 1MZEA 3WFCL 2C9KA 3HHRB 4IRZH 1TTUA 3MV9B 5JIDA 4GUNA 1DGWA 4R3SB 1RUOA 3Q01A 1A0QH 1JXKA 2WKOF 3QYCA 1G8WA 3A6CL 5GZCA 3QEHB 1L6XA 3C5SB 3SPHA 3BVNA 1UMHA 2RDRA 1WWBX 1M4UA 1DQML 3PWNA 3WENA 3WUWB 1RJZA 2R4SL 4HIHA 2ZWYA 4XPBL 4XMAA 4PBXA 3ULVE 2QKAA 3VBFC 4YZ1A 1OHHG 4MGSA 4JV5O 5FO8A 1PZ5B 2IF7A 3OBAA 4JJHA 2YMTA 3WSQL 4AOFA 2CE4A 4HEPG 4PG2A 4HG4J 1BK0A 5E6ZA 1SPDA 2EYSB 2Q0ZX 5TE4L 1SXZA 1UXXX 2OZJA 2GYSA 3JT2A 4TVPD 1MQKL 2J1YA 4UFZA 2NZ1A 4FFIA 1IVTA 3O9WC 1I5PA 1I3VA 1MLCB 1BOYA 3RHWK 4HG4K 2QQLL 2CDEA 4MRBA 4WUUB 5FZ7A 4K23H 1A66A 3ZXEA 1EVTC 3K3QA 3POFA 1W3XA 3FN9A 4XMLL 1WFNA 3TAYA 3X14A 3IMMA 1UM6H 1XV8A 2J57A 4RGMC 1NCDL 5EC2C 1HDJA 1MCOL 3S35H 4QKDA 1XBFA 1L6PA 1KB9F 2X29A 2QVFB 2UZYA 5IMLB 1IQWL 4N8PA 1ZBE3 1ZHBA 4TL4A 1E2ZA 1C08B 1NUGA 2L6LA 2F54D 2VR4A 4GMSH 1CAVB 1N67A 1QPXA 2WZ6A 3BFOA 4NZTH 4L8CA 1VPOL 4GRMA 4XX1E 3BP6B 2YBSA 3PP4L 1LOCA 4PDLA 1I4FB 2E9WA 4MJID 1TME2 2CY6A 2VUAA 3BUBA 3TBWB 4DP2X 3AB0B 5I75C 1A1NA 1QI5A 4WTZG 3LS4L 3SBWC 1O59A 4G82A 2DM2A 1C1FA 3CL1A 2VL5B 3FB8A 4YUEL 3ZBMA 4NZJA 3WLWC 3FB6C 4GRLB 4PJ5E 5TTRA 2OSLB 3MRIA 3CHQA 4M48H 4LOUD 1N0XL 4TSCL 5ICYB 5KJ7E 3TNPB 3VG0H 3BMVA 4TWKA 1K6QL 4BXSV 3CF6E 1NCGA 4JCKA 3E1F1 1QOSA 4OCRH 1A78A 4MADA 2EVIA 3HC4L 1W8WA 4PVBA 3QDHA 4YLZA 1R5VA 2YPVH 4P2ZA 4IRJC 1S4CA 4QPGB 1F11B 4P5TC 5T1KB 2J1KA 1KBHA 2HTLC 2JJUA 3NFNA 4RMWA 4WEBH 3GSQA 3ARYA 3B9VA 3O3DB 4PRID 4PGCB 2Q8OA 4Q6IB 3B9DA 5I17A 3POEA 2XQXA 4AIZB 1DUYA 4LOUC 5L4IA 3FT1A 1ITBB 5KA6A 3OR7A 3VQ2C 2EVGA 4IV3C 1AOZA 2Q1EA 4X4ME 4RQPA 1G9MH 2OL3B 1OHFA 1JNLL 1NI8A 2ZUQB 3AITA 4JRFA 3O4LA 5I1LA 4LF8B 5IB3A 3C7FA 4LCCA 4QHUA 2NUPB 3H8UA 5A1AA 1U42A 1BQRA 1X4YA 5SWSD 4X6CE 2X6UA 3ES1A 3LH8A 5G05L 4X6BB 2V2TA 2XN9E 1MIMH 1PL0A 2MK3A 1VZHA 1XX9C 1FE8L 1NCTA 3ZQ9A 4QX3A 3VWKD 4WWID 4KO9A 4QLRA 4MCZB 4AENA 4UF0A 1GPOH 3C6SB 3LKPB 3EBRA 1C8M2 2C2AA 2GY7B 1R3LB 3U30C 1NICA 2MEJB 3WLBB 5EF3A 2WLQA 3N27A 3HPJB 3HN8A 2Y6KA 4WK0B 4LITA 5BV7C 1AGDA 4LNUB 1C5CH 3FT3B 4FYSA 5MERA 5DRNA 5IHZB 1ZA6A 1EZLA 1S7XB 3TLRA 2VXQL 3CLFH 1LNUA 5FM8A 3R7QA 2I9TA 4XUTA 2E46A 4N6RB 3PFQA 3NRPA 4KHXH 1HNGA 4JFTA 4OV6F 4DN4H 4OI0A 2QQUA 1L9RA 3H9HA 4YR6B 3T8XA 1R091 5LWYL 2CU9A 5E8OB 3IVKA 1H8EG 1AZNA 2K70A 4JG1H 5IEHB 2WWOA 1PZ5A 1HIXA 2VTXJ 3OG6B 4WV1A 4GFXA 4TUYA 1BM7A 1PL4A 3X2QC 1HSBB 4MJIB 3EJRA 3ORJA 2VXRA 1FUNA 3RGVA 3T3PB 3VFOB 3V2AR 1E79G 4XHJC 3DVNA 1FZOB 3R65A 2Y0OA 2X41A 2IC1A 2KDGA 4X7FC 1ILUA 3NVCA 1Y9GA 5FNVB 4ADIA 1H2MA 2Q6AA 1S0VA 3IJSB 1IL1A 3OXSA 5E4EC 2K2SA 25C8H 1L9MA 5A2BA 2R0HA 1HCFX 2AJZB 1AJPA 3CVHA 4DFHA 1AI4A 5JIHA 2HSIA 3D50A 4NC2B 4XGZB 3UEZA 3K3NA 1KTLB 1NKDA 3L8QA 3CHPA 4A42A 4YJ3A 4R5TA 3I2CH 5F9JB 4JREC 3JAWB 2VC2B 3WEAA 1YNLH 1PL3A 3GMRA 3HTLX 2BRTA 1AR81 3EO1A 1Q9LB 3GMLA 5SWZA 2ZYHA 4XN4A 2LQRA 4JFUA 2RR3A 3AB0A 3UESA 2BFVL 4JQVC 4ABWA 2XR4A 4JFPA 2V2WB 1SY6L 2O6EA 2H0PA 4BCXA 3UV9A 4QM8A 1OSZA 3HD8B 1ORSA 3MXWH 3CTTA 1ZK5A 2FWSA 1OGTA 1F90L 4WRLA 2CA4A 2W47A 1M4KA 1K34A 5MEND 4HH9A 3N9LA 4IGQA 4ZHQB 3HKEB 3PY9A 1NCRB 3ZX7A 1GMEA 2NYZA 3VBSA 4A41A 3BO8B 3COOA 5HJGA 4DCQA 3FTWA 2LW8A 5FYJU 4GD4A 3KG5A 1FT9A 4JPRA 4YHMH 1YYMH 4HHAA 3HMYA 4PELA 4EI0A 1W8ZA 3U1QA 1DQJB 4OI1A 3UGEA 2R0ZL 1S5IH 2UXTA 4RDQG 5D7IF 1G8MA 3UTQB 1XBLA 4KTYA 3BISA 1JG9A 5ICXB 3O0LA 2D2CC 3IPFA 2BVQB 3V7AE 5A3WA 5DEGB 4E4SA 1YF2A 4I01A 1OAUH 4HV8B 3VB8A 4X8JB 1YWKA 3OGGA 5FQ0B 3SKJH 4FHJA 5FO7A 1ZYBA 5J11C 5CR8A 5E70A 4ETYA 3RN4A 4R7DB 3ZYHA 4I50A 4L3FA 3A0RA 1DE4A 1QKZH 1DBBL 1U8OA 2XXFA 1SQBH 1BJ8A 2FWUA 3B3IB 4I7ZC 2EDNA 4XPAL 2J1UA 1PG7X 2QEJA 4N0YL 4YVWC 2WCGA 1UYWL 3LHPH 3IGAA 5I1CH 1RUE2 3WR0A 2HHHB 2P8PB 5GS3A 1GGTA 1ZA3A 2BIIA 3EO0B 4M1GH 2R16A 3WCRA 1T1WB 3GZQA 5JYLA 3OHXC 1QRNA 4JFEB 5CINH 1ZD6A 5BZDA 1W9FA 2QQMA 3OZ9L 1KTDA 4CEWA 5F1NB 2JK5B 1HHKA 1ZHBB 1LHOA 1LODA 1N3QA 5HCFA 3N42B 5AW5B 3GC3A 5JZGA 3JD0A 3OD0A 5J8OA 1EGJH 1UJTA 2BDNH 2DS4A 3A6BL 1BVP1 4DP4X 3HKDB 4Q4X3 2R1XB 4A7ZA 1GYWA 2FR4A 1S3RA 2A9HA 2DWEB 1QJU3 5FF6A 4N86A 5JJEB 5GS0D 4Q5OA 1OGSA 5E99L 2O5XH 2W60A 5JOWA 5IEHA 2ZEWA 1ZZ7A 3MJ7A 2YD3A 3JWDL 4CUAA 1I8KB 5AVPA 2NW3A 3O2WL 1IZJA 4CE8A 3RGBA 1OGAD 4BM7A 4TUOA 2PLV1 4RX4D 4G8GD 4AYUA 3VGHA 3H0TA 5C3PA 5FGBA 2HT2D 4Y9EA 4PJDA 2XZZA 3O3AA 3SN6N 3WFEL 2N74A 1BLIA 3VTMA 3GHBH 5IYZA 4PJBF 3H3LA 2UY7A 2CDFB 3C9NB 1K3IA 2WQAA 4XTRD 3QCUH 4XCYA 3O6FA 3A21A 5DEJA 3S37H 3TZVC 3JV6B 1S7UA 2ICWA 4FXGC 4WI5A 1M7IB 5IOKA 1HI6B 1TZHB 2HJKB 1MFBL 1QRND 3MNDA 4JHVA 4YLQT 5GS1A 2JQZA 2BHZA 3QNYB 5CD3A 2BVOA 4CU6A 3PIGA 4Y2NA 3UC0H 2EE2A 2QDVA 4L9BA 4JPVH 5LMUB 1QLRB 1UYXA 2IDTA 4FYTA 2A9AA 1S7RB 3DJSA 4YO0A 5I2IB 2E7QA 5CFCA 1PVC2 4G7YL 1JOJA 1D2SA 2XT1B 1DFBL 2AK1H 4MB4A 5EF0A 5I1LB 5L0QB 5E6IA 3FXIC 2V4VA 1BQHG 4O4LB 1FYJA 5CEZH 3RYRA 1GZCA 2Z1KA 1L8DA 3ETBF 2R2HA 5B7FA 2ICWI 1ZRDA 2HPOA 1S78D 5LBSA 1AR5A 3MRBB 3M07A 4KKRA 1RHI3 4XWOC 2EXYD 2ZEYA 4LA3A 4EEQA 1GZHA 4U0RB 3POJA 5J06A 2IH8A 2NCEA 3QUXC 2Z5UA 2VYRE 4RFRB 4X6DE 1D5MB 3MRNA 3KV9A 1T4KB 3LNDA 2JCWA 1KJMB 3N40F 3U14A 4C56B 4LCWA 1ZA6B 2WNOA 1I75A 4IYHA 1MFMA 4X99B 5B4MD 2UVEA 5PAZA 1JZ7A 4PV1B 2E47A 1OZTG 2OR7A 2I85A 1DL7H 3W9AA 3WLWD 2A99A 4Z7QE 2DQUH 4ZT1A 1PG7H 1GZ9A 1G6VK 2IBZH 3DUSB 4I4TB 1TPXB 1GRWA 3U10A 4M8QB 4NERA 3CVCA 1SZTA 2IXKA 3QIWC 5ICXA 1FLRL 4PDMA 2J1TA 1M9NA 1NEPA 5APAA 4B1MA 4EN3D 1ZX3A 4AQ2A 3MV11 3NZSA 3WFVA 1RUE1 2JTYA 4JQTA 3M45A 5I0UA 3ILQC 4Y5TA 2YC0A 5IWLC 3B8MA 4RMRA 4NM8L 3Q2WA 3H3UA 5E6HA 4ELKA 2MJWA 2N56A 3SJVD 1ANUA 4JK0D 1B0RA 4XP4H 3S3WA 5DHYB 5FPOA 4GB31 5IVVA 3IFNL 1HH6A 2B4CL 3AQYA 2B3RA 4U6HA 4J7JA 2UY6A 3B9EA 4XNMA 1QCEA 2FQGA 1JOPA 4JI2O 1OCZC 1RY7B 2XPGA 4X5XA 1LB2A 1N70A 1RJLA 4PRHE 2XWJA 3QULA 3ABKB 4FQQA 4ZPTB 2O14A 1MELA 2F1MA 4GG6F 1TZOA 3FAVA 2R7EB 4X5WA 4EN2A 2DM3A 2XY2A 3QAQA 4L9DA 2DF3A 4JI1B 1RSOB 1YEGL 2NQDA 1DCEA 4P2QD 2G9HA 2P5WA 2WXHA 2BJML 3FONB 4HANA 3P9WB 3KW7A 2A73A 1NWPA 1CPYA 2HUHA 2APFA 5AUMA 1EPZA 2PCFA 2FHBA 1YPZF 5ALCL 2HB0A 5L8JB 5AD0A 1JD9A 1U0AA 3FT2A 3TIEA 3R6SA 3HZVB 1USZA 4IOIA 4YVUA 3FB7A 3OTTA 4EN3A 4DR3O 1N33B 1XGPB 5FHBL 4ZTOL 1C57A 2DCJA 2J2ZA 1ZIAA 2P7TA 3EJJX 4PGZA 3VFTB 4UAPA 4XEZA 3OTFA 5JMOA 3BPZA 2OTLV 3B5TA 2AJUL 1KYOK 4JY4A 1PVHA 4J7ZA 3EYUL 3I84A 3O3UN 1X33A 2TSBA 5EOQL 5C0EB 4AQ8C 4PJDB 1QFHA 1YEKH 4X65O 4YDIH 3VG9C 2WWMD 5D96B 5F3EA 4U33A 4XP5H 3QS2A 3AJYA 4GW5A 4F7TB 4U1GB 5JHDE 1MQTC 1U8MA 4WFFD 1PZ7A 3CBKB 1N5AB 3ES6B 4KO5A 3ICXA 2AKRB 3OGCA 1PO11 2PTTB 3VBFA 1ZSDA 4HOMA 2HZHA 1CT8A 1AF9A 1TNMA 1N2RA 2XHKA 3UYOD 3F2LA 1UM5L 2HG0A 4P9HL 2G9ZA 2NMNA 4R2GD 4Y4KA 4LLVB 1W8OA 2G1MA 1SC5B 4MGQA 1RSYA 1ML0A 2BIHA 3ROUA 1LO5A 1E90A 2WBJA 1EHXA 3RWRD 3POBA 4KXAA 2V2TB 2ETWA 2V0AA 2P6HA 3FMGA 1XREA 3CRRA 3LH2L 3AMQA 1RCYA 4FQ4A 4PJCE 1T5KA 3KBHE 3T1WA 3CHXA 3K71A 2F1BA 2H6BA 5JPNB 2CK2A 4Q4W3 5BV6A 4LDOB 2HFFA 2XIBA 2OCCC 5I8EA 5FY1A 5EUKB 1QY4A 5F6KA 1QFUH 1AR1B 4BKLA 1E8ZA 4JCLA 3QPQC 1XDCA 1NC4D 1G9FA 3IDEA 5A7SA 1Y07A 4ALAH 3EOTH 3CCMV 1KZQA 4OLZL 2FIRT 1EQWA 2NNAA 3TWYA 3VFPB 3U0PA 3ILFA 5K0UC 4MBOA 3NFPA 1XF3B 4BW9A 2TRYA 2BBVA 2JGDA 4CVXA 1HQLA 4NQDD 5C6PB 4GAGH 1DQKA 1LLAA 3LB6D 3X1BA 1IX2A 4DOHB 4AVTA 1YUHB 3D30A 1K4DC 3HKZA 4C58B 3OEAA 3UTZB 1J59A 1SJEA 5EZWA 5FX3A 2UY9A 2C1OA 5T1LB 5TK2A 4JKPL 5F1IB 1JD7A 3FB8C 1S9XA 4N2CA 2WPGA 4E42A 3UZVB 4GH4B 1NGPL 2BZCA 4IYIA 5E4IA 1XE7A 4TV9A 4FMTA 4ZO8A 5GGTH 2VXJA 4Y33A 2WIIB 3ZFEC 3N55A 2VNGA 5F96H 1T7VA 1AROP 2VDNH 2YI9A 3HJEA 3OKLB 4LJHA 5IVFA 2AJVH 1O6SA 2DYPB 4ONFH 1MS3A 1JVOA 3VTTA 2BE3A 1VPHA 4JI0O 3RZJA 5IGXH 1EMTH 3WKQA 2ICWB 3D85D 4AE0A 4DGVH 1JWMA 5ISZD 4D0QA 1H3PH 3NCCB 2PA7A 2YN5A 1D9KA 1TYEB 3D3VD 3Q2CA 4UUJA 4YJZL 1FGVH 4H25A 5DHXB 4A2GA 1K4CA 1M7XA 3ULVD 2AW9A 2R1YB 4JVUA 4H1LH 1WA1X 3SGDH 3UIZA 4BSJA 5AVAA 2EEXA 3OPZH 4IDZA 4L29B 4W6XA 4N0CD 1J1XL 3UQ8A 3N1QC 5CZXC 2R70A 4E2LA 2NY2B 4MX7A 2YFUA 4HC1A 5TDPA 4IEPA 1V05A 3ZIYA 4DGWC 1E5SA 1RK0B 3NESA 4ATTA 4F5CE 5JUEH 4OQ9A 1PVC1 5E6UB 3H3PL 1IRAY 1GAFH 3PNRB 4PV8A 1M3JA 1IAMA 2WYFA 5FV3A 3K1KC 1X5YA 2EE0A 3WDJA 1MZ5A 5GONA 4HH9B 1EZJA 1CPNA 2RMU1 2DUQA 4WI0A 3INAA 4PQQA 1RXFA 2YARA 5DVNA 5FFOC 4NKMB 2CHHA 4P9ML 3QE5A 2GC2A 3L4WA 5DRZB 4C91A 1XNQO 1QSEE 3WMQA 4JFHE 4HIJA 1F42A 3MV9E 5A6IA 2ZHKA 1L5GA 2VZOA 4PJ8B 1V6LA 2Z2SB 4EUPA 1CT8B 2ZAGA 1H8VA 2BIOA 2Z91B 2F5BH 3T1MA 3WY2A 5JXHA 4UT5A 2H32H 2NR6C 1ES0B 1GP4A 3MREA 3PWUA 1EGJL 3I2HA 1V6NA 4KQ0A 3WFDL 3WJLC 2WZR2 2IOIA 4OFQA 1YJWV 2Z0AA 4RAIA 3OLEA 4OZGF 4CMMA 2JDNA 3NQHA 2GJZA 5BRQA 1UOBA 5F0MB 3GUTA 2IH1B 2ZYSA 3DXAA 5CEYA 1CGSL 5GGVH 1KGIA 5CINL 2O5YH 1LGBA 1V00A 5HGBB 2F74A 3KPRE 1H8HG 3QUYA 1CJYA 4BSVB 1FATA 3L4CA 1BZKA 3OY8A 2FMDA 4QT5A 1W0PA 1P7KB 3DX8B 1KDKA 1QRNB 5BZDB 1U3YA 1KEXA 3RX7A 4IE6A 3IGFA 4MG2A 3S3XA 3CFJB 1RHHA 4PRPE 3DCQA 4Y1YA 2JRIA 1OTTC 1PD0A 3CVIL 4NQEE 1ZEAH 4UQEA 4YXHL 2JJ2G 5HCHA 5J2TB 1D6VH 2XWBA 4AK2A 3FSOA 1RUKH 4HFUL 4BJLA 5E9NA 4ZW3A 4XHBA 4JM2F 1BQ5A 3D39B 3LNFA 2BNMA 4Z8FL 2PXYC 4AGLA 3S30A 3L71H 4E8CA 2ADGB 1IV8A 1MIEL 4LF4O 2UVFA 3I2KA 2VZVA 2Q4PA 2GFBA 4TM9A 3X11B 4HNAA 2E6JA 4JC1A 5C0DA 4MVRA 3CFNA 5SWSE 2E7AA 1N8ZB 3WIIL 3VFTA 2VERN 4PJ9A 3LEYL 5J12B 1OQDA 1MCNA 5E03A 2JDZA 1E3ZA 3CMOH 4HPYH 3HBGA 1OP4A 4WHTB 5E2UL 4GMTH 3SKOA 3VMPA 5FUNA 1URIA 3U9UB 4YHNB 1CFVL 1W0WB 4JFFD 4BFIA 5I71B 2W3JA 1I1CA 4MQ7A 3UTSB 3IC7A 5GS2D 2IC2A 3CFMA 4R7NA 1HQRA 1LENA 4ZMQA 1G1YA 4ZW5A 1M1KW 3EIFA 3EXAA 3TA3A 2H0BA 2KS0A 2YD0A 1G6RB 3MXVL 3O2DA 1A2YB 1GZWB 3GXUA 1MJ7L 5J0BA 5HGAB 3NJXA 1WLDA 2XETA 4B4QA 2VS0A 1KN4L 2F7QA 3HNTL 4KROD 1FKAO 3NQKA 3TNQA 2YMXH 5AW8B 2ZIOA 1AKPA 1UF2C 1JV5B 2BP6A 2R32A 4GKXA 4AXOA 3S34L 5KHIA 1UA6H 4UZGA 1O9WA 1CAUA 3O4LD 3WF2A 3JB8A 5EN2B 4APQA 4B9IA 5L6YH 4QX0A 3D06A 4EKWA 3CIAA 1LD9A 3V5DB 4OM0H 3FTGA 4Y7MA 2GC0A 3OE7G 5ECGA 3BUDA 3ZE0B 1WW4A 1TZIA 2F7PA 3B7TA 5EIIA 2JKBA 3WXPA 4GBXC 4TV8A 1UB5B 3FYIB 3X1EA 4B95C 4UNIA 1PEZA 4Y2OA 4EQ3A 4CS2A 4LLWB 2NXZB 3EFFK 2ZEXA 1EVUA 1W39A 1YI2V 3ARXA 2MCAA 2FT6A 2Y1AA 2Q3ZA 4U6XA 2OJZL 5A33A 1HRV3 5JORB 1BXVA 3E6FA 2APTA 1KGWA 3SQOH 1Z0HA 4AJ0A 4XBGA 3LDKA 1HT6A 1S46A 2X42A 3PMSA 3ISRA 5H2FZ 1ADQA 3HNSL 4PCSA 3ZLIA 2XTJC 3KS0J 3DSFL 5D55A 3V0AB 1MIEH 1BMZA 1AMXA 2H0VA 1GYVA 4DN4L 2ATKB 2X12A 3BW9A 3UTTA 5LNDA 5FGCE 1SBDA 1I8AA 5H4ZA 1FNHA 1OM9A 5BMFL 3UTTE 3I59B 4KHTH 2UV3A 4F9PA 3N40P 3L2MA 1MAKA 4RSUA 4LGPB 4M6AA 3BVVA 2NW2A 4F7EB 5IVBA 2H9GB 5I5JA 3VCLB 3PUCA 1GGCL 4TVPH 5J11B 3KGTA 1E4KC 5DZFA 5CFDB 3O1OA 4IEOA 1NH2B 2F4LA 4HLEA 5DZNA 1B3IA 5TF1H 5IVJA 2DWYA 2UUBO 3QG7H 5J1TC 1XXNA 4DKTA 2ZCKH 5T5PA 3EH4B 2VMFA 4NT6B 4UOW0 1YTFD 1MQKH 4K7FA 2DMXA 2NM1A 3VFMB 1VMJA 3VXRE 3BFQG 2MEV2 3FONA 1UU6A 1YY9D 2HT3D 5C3SA 1SQFA 4HJ1A 1KECA 1JHLL 1NLBL 2XWBB 4U6VL 5D70L 3FSVA 3O0XA 1E28B 4K4KA 3BI3A 4IXLA 3V9FA 4ZS3A 2CWRA 2D7OA 3KDMB 5DFVC 5DMKB 4XAWH 1ZPLA 3ESVF 1WAPA 1P8JA 1X8MA 4FPYA 4GSDL 3VHPA 1QEWA 3P2DA 5D1QD 4X4MA 4ZUWB 3RVHA 5EZLA 1C12B 4ODWB 5C0GA 3EJZD 4PDVA 2RE9A 1OLZA 2G4GA 4P9OA 4DO2A 4Q0UA 1MNUL 2HFGL 1CURA 5T8IA 4J42A 1FORL 3DGDA 5DWUH 1XF2A 3ZKMC 3NCWA 4RSVA 5BNNB 3MBEB 3SYQA 4HZ1A 4OLXH 1CE6A 5BV7B 4LF9O 4NKMA 2H6CA 4DV1O 5HY9B 4KTEL 3VXQB 4H55A 3K9SA 1N5AA 4F33A 2SBAA 2YROA 5FYTA 3C60A 2WFPA 4X98B 5DUML 2VNRA 4R6UA 2PTTA 3OOXA 4GKYA 2ZCLL 3NJJA 3TM6A 4X6QB 3EDKA 1VBA2 1R5VB 5AW9B 4A7GF 1CBVL 1J5OL 1DDHA 5HGAA 2OUJA 5DD5H 5A6XA 4KHPB 1RZ8B 1NR1A 3CVHH 4A6SA 1HL8A 5E1AB 2LU4A 3SDAD 3WD5L 1R3JC 4B4RA 4P46A 5EULV 2VLJA 5LN4A 4Z5RA 3VD0A 2JXMA 3G5YB 4GKNB 2H1LM 2QKIC 2VD7A 3KJ6L 3HN1A 4FQ1H 2VULA 4WQOA 2YIBD 4N90A 3UTPD 3UZQB 2Q76B 3X12B 1SYSB 2EIZB 2IPTL 5HJBA 2NY1B 1AKJA 2X7LB 4PTUB 4BK5A 3WU2Z 4YHKL 4NDMB 4O02H 3D4GA 5EIIB 2VJXA 3GLAA 2F58L 3NCFB 5C8CC 1XMQB 5GGTA 3AVSA 1DLFL 2MWCA 4M7KH 4Q97A 8PAZA 1IBMO 2XZCL 2ZWKA 4GMP3 4Z2AA 1IFGA 1T66D 5EEWA 2ZIMA 5ILTL 4N8UA 1G4YB 1Q9OB 4R0LC 4N2DA 1KYOF 1X5LA 3FCTB 4WFGD 5LQBH 1MEC1 5L4MA 3GALA 4P9GA 1DVFA 3MNVA 1JZEA 5T54A 2ERJB 5KS9E 1KQSU 1OV9A 1NGPH 2OR9H 2W9DL 1LNUB 4XT1C 2NXZD 5DSCA 5FM4A 5KBKA 4N2MA 2VNCA 1QPPA 1XGZA 1UPSA 2ZBJA 4HBCH 2BTQA 4ESKA 5JR1L 2UZXA 4YSDA 5KOVC 5AFEA 4BUQA 4POZD 4FS0A 2ZP9A 1EBPA 4N9OB 3KPNB 4N2OA 4CSSA 5HBBA 1SJHA 4AQYO 2VOTA 3MRKA 3CBNA 3KZ8A 2DWTA 2VNOA 4XC9A 3T0EA 4AFCA 4W9LC 5F7UA 1KYOJ 2XZQL 5GGSA 1UASA 2WZPA 3RWHB 3RILA 5HHMB 4QU1A 5CS7A 1XR9B 4FFBB 3MCLL 3GXDA 4R96A 1EHKB 4Z7VA 4DV5O 5BVPH 1XR8B 4LKEA 4Q9BA 4YIOA 4CCKA 1KIUB 1XMWA 5D7IB 3WNMA 1RJCA 2JEMA 5FYUA 3I6KA 3F12A 5KZCB 3G5XB 1UXZA 3BPCA 5FLUA 3MLVL 1M6OA 1VQMV 3W11C 3U7WL 1OARH 3ZSKA 5K4LA 2XL9A 3GIZH 4QHZA 3ULUE 2ZUSA 3ISWA 3UJTL 3MYXA 4ZX6A 3QHTC 1WZMA 3UK9A 2VUCA 2DJVA 2A6VA 1HWYA 3NCYS 5FKAA 5HHXH 4MNGA 4HXCA 3N0AA 4K2UH 1FH5L 4CVWA 2IXQB 4F7PA 3OD4A 3ZZ1A 4EZHA 1J1TA 5KVEL 3QVNA 3J07A 4CDUA 1OZ0A 1PG7L 2DL2A 4FXKC 4RFOL 3PURA 2VMJA 2HMIC 3I9AA 3MUZ1 5IKCB 4UQDA 2R061 4NRQA 4KMQA 4ISRA 1MAML 4KMTH 5DXWA 4G8EB 1VF7A 3K04A 3KYNB 3N42F 4ZFZA 4CC6A 2HYMA 4OMDA 4JGYA 1NX9A 4PJBE 1J0HA 3S36X 3HT2A 1PMYA 4BZ1L 1XSOA 5EZPA 3VDBA 3AREA 2HH9A 1G7MB 3MCYA 2YU2A 1BJ1J 4Q9RL 2XICA 1AYOA 5CFCC 3FUJA 4P2QE 4XMXA 5ALBH 3AXHA 2EC9U 4FHKA 3SCMC 4OGZA 1HB3A 4JZ2A 2AEWA 2AK4E 3K2KA 1BQHB 4FNQA 1EAH2 2BWCA 4HUNB 2AK4A 4OCNC 5F7AA 4P9JA 4FYQA 1LE5B 4Z5RB 1Q7YW 4OFIA 4CDXB 1ZPUA 3H1LH 2BVQA 5ETUB 2GUOA 3HNYM 3T1CA 2AJYL 2GIYA 4GQZA 3NSCA 3VSQA 1YI9A 2GALA 3KZ4C 3AWFA 4GJZA 3F7QA 1RC6A 1CGTA 1KB5A 4KI5C 3VBRA 4JDTL 3ZN1A 5CM1A 3VD2A 4FQXD 2JDMA 2FSEA 5DJ2B 3OKOB 4K3DH 2WJ5A 3JUUA 4EIBA 5I91A 5I1AB 2D3JA 5B8CB 1KLUA 3O41B 4JO1L 1ZIBA 4I0XB 3O0RH 6PAZA 1IC1A 2DD8H 1QYGH 5AOJA 4WGKA 1EZVH 1RHHB 1KIPA 4GAJL 4AI8A 5DT1H 5EEUA 1DQ6A 2B4CH 2FYUH 4JAAA 2VO5A 4H7LA 5D7LA 1BMGA 3ZXJA 2D6NA 3OGSA 1F2QA 2NTSP 3IGAC 2IFRA 2K9PA 2TRHA 3QIWA 2GDSA 3TWCH 2EIDA 4G71B 3ESUF 1GANA 3FPYA 3C7EA 1CGPA 2PABA 1WD4A 3VXUB 2WZEA 4DO6A 2ADGA 4K3JH 1FMD3 5I8TA 1Y74A 1L0XA 4N8VB 4AH2A 5KXCA 3VW3L 3F7PC 3ARDC 3MBWB 1R64A 2EYRB 1KJ3H 1OM3L 3WDTA 4NQSB 4PUBL 2ILLA 1QA9A 2WNGA 5JOFA 4FLZA 2WLLA 2CE6A 2PGGA 3AS2A 1PO12 1HSAB 3QISA 4WM8B 4AYSA 4CP0A 4HSCX 5FUZL 3NP3A 1US6A 3RL2A 4DR2B 2BNRE 4Q20A 5F0JB 1Z7S1 1WMEA 5EHDA 4LBEC 3QDGB 4NHLA 4YIPA 3C5ZA 3PDDA 3O12A 3BSZH 2OYPA 2ENJA 3TEYA 3MAQA 3PUHA 1KB9K 2FL4A 3AQDA 1JHNA 2HFEA 1S9YB 1Y43B 3RJQB 3T1HB 2LHAA 1A9EA 3K0YA 1KEGH 4U7SA 1UURA 2Z3YA 2BM3A 5FFLA 2MNWA 2FHCA 3Q1EA 4NOFA 1DBBH 5JIIA 2AS5M 2ZJSH 1VBE1 4HFWB 4LSSH 2XAQA 4NQDE 2AV7B 3TCLB 3UG5A 5IHLB 2QSVA 4XTMA 3VKFC 4JREB 2DL9A 5CA6A 3LXAA 2DI8A 1SMOA 5GRVL 1J1OL 3STZA 5DC9B 4IIJB 1H2KA 1S7RA 1DO5A 1C5DA 2X2UA 4JE4B 2EDQA 4FJYA 4JHAH 2LFEA 2IXQA 1QI3A 4GEIA 3PRZA 4F7PB 2ITCC 5FMDA 5AC92 2KKWA 2A9DA 4N7IA 3T65B 1A32A 4ONGH 2YY1A 2X3AA 2Y7MA 3V0AC 1M57B 3RWEA 4GG6B 4HK0A 3B94A 5FZ3A 3MRBA 4DGYH 1BLNB 1FG9C 2QKDA 2CM5A 3IRCA 2WTRB 4QEGA 3WTVA 1SN0A 5F44A 2VZPA 4ALAL 4E9LA 3HEIA 1F6AB 5T3XH 1HXMB 1SACA 3FCSA 2Q2EB 4UI9L 4Y1ZA 4JN2A 4S1QH 1ZRCA 5BS0E 4O2AA 1QU7A 3APOA 3OKEB 2NXZC 4LBQA 4PF1A 1KXTA 2X09A 2VSMB 3RWFA 1ZE3C 3BKYH 3IN9A 3LEVH 3DOSA 1ULVA 4AYMC 1SQVH 2ENYA 3D4YA 5DGRA 2BJSA 2YS4A 3RU8L 4H14A 5B66Z 4XDPA 3FZ3A 3RZGA 1ACXA 3M3CA 4PGDB 3PABB 5I19H 3NAPC 5A2KH 4MYWB 4DERA 2WO7A 3GI9H 1TQWA 3RVTC 1W2KT 5D21A 3S34H 1R47A 5ETUA 2DWSA 3C3SA 4YHPB 2VWJA 4YN3A 2YRBA 2IPKA 3T0EB 2OXHA 4P3WA 3FX3A 1RYYA 5D8AA 2W59A 4JI3O 1A6TB 3D18B 1NM9A 4P23D 2UU9O 1GS8A 1IGCH 4RMTA 4QJ4B 2ZGRA 5EIBC 5C71A 1HV0A 3WQBA 4M1GL 1OGAE 5IY5B 4HCFA 3HZMA 3FH5A 4R8WL 2RJ2A 4N68A 5B1JC 1AR62 1VADB 3K3OA 5CGYD 3BPCB 2P49B 1ND2B 4WUKH 1F1AA 1BD2E 5C09D 3MIBA 2I07B 5EBLA 1P2CA 3CDZA 4G5AA 2HPTA 1NLRA 4CA9A 1DLBA 4DV0B 1Y76B 4X6CF 1W2BU 1UL9A 3WGUB 1OK8A 1VRH3 1P7QA 3T4AB 1PZCA 1GCFA 3JWOL 3Q4HA 4H88L 4Y5XA 3C09C 4L2YA 5CSZA 4IV1A 1PKOA 4TQFA 4ISVB 2VMHA 4LKXA 4CDWB 3ZKMD 2EYRA 1IT9H 4JR9L 5SV4A 1KPRB 3N3HA 4MOAA 5C0GB 3O45B 4Z78B 3BLBA 1BXXA 4KUCD 1QQP1 4PBOA 1GQHA 3ZRWA 2FDIA 5D71L 3ZKQD 1G7QB 1FG2A 4OCXL 1AQHA 3MLXL 4LO6B 3WJLA 2F54A 3FU7B 4NIKB 1NA1C 4CMHC 1V5JA 3FB7C 4S10A 3AXEA 1YFYA 3R06A 4XCFH 4HFSA 4MRCA 2A1WL 4NYKA 4K9EL 3OWEA 4XMUA 4XNYL 1ZZ8A 3OLDA 2PF6A 3S97C 3L7FA 5C6TL 2AXFA 1HDKA 3SHSA 4LASL 3ARPA 5DK0B 3VXPB 2J8UB 1R1CA 5EEZA 1BVOA 3LN9A 3VGDA 3OG4B 3QR0A 1DTUA 2P5BA 3NKTA 2WWKT 1SHSA 1ROWA 2F7OA 1LP9A 5CN0A 2W9EH 2OR9L 3BZFB 1OFNA 2WWUA 4FM2A 5H37G 1JOBA 1N68A 1KD7A 1YMME 1A8JH 4FFYH 2DQ6A 4G1EA 1F6FB 1RPRA 1SYSA 2EIZA 2ZKWA 1GM7A 3AP7A 4PHXA 1E4KA 5E95B 5INCA 4M7JH 4M7KL 4QRBA 3NNMA 3H1MA 3TPUB 2WXJA 4AKPA 1CIYA 4LOTA 1OKOA 5HVGB 1EEUA 3BH9B 2VMCA 4GSQA 4XN7A 4YXKL 3BRFA 5EUKA 4QMEA 2D0FA 1HXMA 3IETA 5C3TA 4G4FA 1V6OA 1RQ5A 5SWQB 3EXUA 1GAFL 3QFJD 4NHKA 2J25A 3QS3A 2Y6GA 1J87A 3EJUA 4NZRL 4MXWA 2WWMC 2BOBC 1JK8A 2R72A 1JPSL 2QSCL 3US0A 5HJ3A 1N18A 2JB4A 5JQIB 3MBWA 3MV8D 4FHBD 4LLYA 4X89A 3C5XA 1FNFA 3ULVF 4MVBD 4NRZB 4RZKA 4UW4A 5B5EZ 4GMSL 1L9PA 4LUKA 4QQOA 4R90H 5FW8A 5LXTB 2H32A 4EIUA 1R34A 2AQRA 1ULDA 4AV0A 3FTZA 3ZTCC 2IFFL 3LOWA 5C0CE 5LZ6A 5D8AB 3RNKA 4IJ3C 3KHBA 1ZT1A 4G1MB 2Y0SA 1MQ8A 4G42B 3KYOB 3NJMA 4NO2A 4X4XA 1HRI1 1YCIA 4CDQA 5FXXA 3WL9B 2W6JG 4GZRB 2YEVA 2QWRB 1FL3B 1UXSB 3HI1A 4AHXA 2X4NB 1D7DA 1EX0A 3RMXA 2WLIA 5DDJ1 3GMPB 3P30H 1NGQL 4XN5A 2DQJH 2VLRE 4FQ2H 1M7DA 1B09A 4F7ZA 1B35C 3ZTNL 1H6FA 5ISZA 1J8HD 3VDDA 3H2QA 2QQLA 4QLWA 1L0LH 4GO8A 4QT6A 1BZ7B 4M6NL 3SPIA 1OCRB 3KPPA 3JWDH 2FMLA 4N0FA 5FYLD 4FLHA 3VO0A 4D94A 1AYN3 3ETTA 4QRQB 5BS0A 2EINC 4WO4B 4HSQA 2IIJA 1H15B 4Y19E 2R4SH 1IBKB 5D7JA 1ZRFA 1NTKH 3TIDA 3NA9L 5TF1L 3ILQD 2QWOB 1QNZL 2E4TA 1Q9KA 5IK5A 4OLZH 1H9DA 4Y5VC 2D6PA 2JE7A 3RJRA 2JEXA 1BX2B 4ONFL 1MWAB 1NOLA 2X4QA 3IF1B 3KPRA 3MU3A 4G6ML 1GSMA 5F7LB 1U97A 4AVBA 1ZSHA 2K8MA 3M3QA 2J88L 1JYWA 3JQXA 3FCSB 5CU9A 1CYWA 3R0NA 5FLVA 1CMOA 2G75B 5LBSH 4B53A 1TEIA 3RZZA 1G7LA 2IBZY 2LTNA 3H42B 4YUEH 5F2FA 4JFDE 1A47A 4RDQF 4JPKH 4PDWC 4RHV3 3PVNA 4AGGA 3LPOA 2A7BA 3NFSH 4FULA 4L8BB 3TGXA 1SEQH 2WA3A 4YHYC 1A1OB 2CRMA 3ALXA 2UYLB 3PABA 4M1CC 3UACA 1OW0C 2G4IA 2Z9TA 3QUXD 5B3JE 3SBPA 1BVKA 1Q43A 1SFDA 5E5LA 1B6QA 5GRVK 3V4VH 1LO2H 2W81C 3FE5A 3N41B 4I9WD 1PNGA 1IAOA 4RSYA 4MA8H 1GGIH 5K9JL 1WDAA 3POGA 2Z92B 3ZE2F 2VC2H 2NQYA 2DDQL 5FUPA 2IDCA 4QWWC 3QDME 5CWSB 3S35L 2XMLA 1QYGL 4J3OD 4K3UA 3N43F 2NLRA 4AG4L 4K21A 4XI5D 5HGGS 1HXYB 1CDIA 1X3DA 3GSNL 3PF2A 4QRPB 2FO1A 1UX7A 4Z7OE 2E27H 2XSKA 1RUMH 3KH3A 1W6OA 2GNTA 1YDPA 3HI5H 3QUYC 4X2UA 1DO6A 1JWUB 5C2BL 4JDOA 3QUXB 3IMBA 2OMTA 2GU9A 3WNPA 2SEBA 1MSPA 2AEZA 2Y4SA 3ZTEA 4AMWA 5FO9B 4KU1A 3ARTA 2RVAA 3H3BC 3UDWA 2XUMA 3WW4A 3FMGH 4E4DX 3INUH 2FLBT 1CI3M 1K8IA 2BY2A 4O2EB 4F9PC 3DC6A 3ZSMA 4DW2H 1UXWB 3RT3C 1XMQO 3KLLA 4XO4A 5DO2C 4JFOB 4HNAB 1MCRA 5CIPH 4AZ8B 1BYPA 1IC5H 5KVGH 4JQIH 4CTEA 4K3AA 4Z76A 4M9PA 4XJUA 5IJ9B 2V3DA 2DLGA 5HHVH 3QI9B 1NIDA 1AP2B 2HFTA 4B3SB 1PMHX 4A38A 1YPZA 2CBMA 2EAAA 1NIFA 3NNGA 4L11A 2XZCH 4DV5B 5E5UB 1IM3B 3BKMH 3F58L 3LD8A 2R51A 2P3KA 1L6ZA 5TDOB 2XAFA 4Q8BA 5FYJH 3BY6A 2CR3A 2WO4A 4JFWA 2CRIA 3MRRB 3L7FB 4KC3B 2APSA 5DZVA 4P9IA 3CPWU 5IFJA 1RK7A 4YFZA 1SQGA 2BY3A 3NACL 1E27B 1JZHA 2VITA 1MFDH 4QPIC 3EMRA 1EAOA 5CAZA 2W0FA 4MDJB 4OD3H 2Q8EA 5CEHA 4NXKA 3FQXB 3O4OB 4JYAB 2V7HA 4GSUA 4N8VG 1YC7A 1LP9B 4Z3TA 2MQ3A 1GK9A 4JDZA 4P5KA 1IKQA 1MNGA 3JAKA 3K4ZA 2UZIL 2Z31A 1AR61 1HRV2 3CVHL 3OMIB 2DLEA 1E4WH 4I0PB 4P59H 4P2AA 2DWEC 4APQB 4UM9B 5LL6Y 3APBA 3I55V 4HGMA 4K71B 1RPQA 5FEBA 4J41A 4AYBA 4KQ4H 3DPDA 1QR8A 4GQ9L 5AW3B 3MCLH 2WQZC 1FO0L 1LO0L 2VXQH 2B8MA 1NT2B 3FFCB 1O3SA 1IBMB 3U9WA 1KXQE 1UB5A 3C60C 4S0HA 1K45A 3T4HB 2JENA 1L4IA 4GH7B 1UZYA 4CSZA 1NSNH 1X9RA 4NO0D 4WUUA 4PJAA 5CLWA 3IJ8A 5IUCA 2ZGLA 2LU3A 1KULA 1MG2C 4MTMA 2X9YA 3EBIA 4MNQA 3LQZB 5HDLA 1ULOA 1YN6B 1VFBA 2BHUA 4LBAA 4NQCE 5LCVA 2ZUVA 5I1JL 1JK8B 2YC4A 4YHLH 1S77D 3WX5A 1HNXB 1BOGB 3LOBA 4CVZB 1WA8A 1QNMA 4HXAH 2P5PA 2RQ6A 4GG8B 5B38A 3GCXA 3WG4A 1PF3A 1ZTXL 2F08A 4YHPA 5LXVA 4XPVA 4NIDA 4ZMZA 3H01A 1CDHA 3VQLA 4AEJA 2UYAA 5J48A 3OLGA 2GSYA 4B3MB 5BOPA 4FI7A 3SH5A 3VG9B 4ZMXA 5JVDB 5LGYA 3L7EA 2CO7B 5I6LA 4DV1B 1DQ2A 1ASJ3 3VFWA 3BOVA 5HHQA 1NDTA 4KUZL 2N3JA 4F7EA 4YXWG 4TWTA 1UXSA 3HI1B 1HXYA 4QRPA 4PU2A 4WO4D 1KCVL 3LZOA 3TN92 1DQ5A 3B77A 1XGQB 1YDPB 1RFDL 3GEFA 4ZMAT 3MGOB 3SCFA 1KLGB 2P9RA 4KL1A 3B2UC 1NVPD 4AQ6A 4TSCH 2IG2L 2ZAHA 4G6KH 4GXFA 1JZ5A 2FGZA 2V6HA 1ZJBA 4F1SA 5IROD 2P5OA 3QORC 4U1HA 3KCYA 4L3CB 4NQUA 1F11A 2VQFO 1VQ6V 3D7PA 2A6KB 4M61A 4YMPA 1GUIA 4DUZO 2PPAA 3VJ6B 1XRUA 1KPRA 4IM8A 1K8IB 1I3RB 4JPVL 5BRPA 4I89A 1RUG3 2QPSA 1JZ8A 5EZJB 4FPFA 5CG9A 1DUYB 5H37A 2XVKA 5H4YA 3MRGB 1E3XA 3G6EV 3GRBA 3O4LE 3GSNB 4NZUL 3WS3A 3O4LB 3S37L 5BV7L 3ETQA 2Y7SA 1WZAA 3NEOA 2XTLA 5IB3B 3DIFB 4HUVA 3W11D 5HPMB 5AALA 1YPZB 3OZLA 5LKNA 1YMHA 4D9QD 1GYAA 3T4YA 2L35A 3SYAA 3I3BA 1HJFA 1XF2B 1BEV2 4TUKH 4TF4A 3D0VB 5DRWB 3BABA 2CKBH 1BXUA 5F7EH 4YE4L 1VFAB 4E2OA 5DTFB 1J9QA 1UWGL 2BWDA 3P11L 3WIFA 3BIBX 4MXVA 2JLPA 3V8OA 4DNYA 1KWKA 5LA6B 1FL6A 2JKWA 1X7SA 3OLIA 3SKJL 3B3QE 5LBFA 2IZWA 4UDTA 4HL0A 1UA6L 2G5UA 1GIGH 3C8DA 1RL1A 1YJDH 4NC0B 5C09B 3H9SA 3CNAA 3VZNA 1FX5A 3WF4A 4KXBA 1I9JL 2BIQA 4CW1B 5EBMC 3WO3B 1JPXA 5TE7H 2KG7B 2XKOA 1OSEA 2E3VA 3QG7L 4IGBB 2XNDG 5E1AC 1JVLA 2BSTA 3ARDA 4KFZC 4MA3B 5HYIA 3Q05A 4JFXA 5LGKA 3VSVA 4DKDC 1Z3RA 1AE6H 4IOSD 4HN0A 1BGXH 2JD9A 2DCYA 3OXRA 4B1LA 2NSQA 1ACYH 3PVEA 4MJ6A 5FMBA 3VHRA 3QO7A 1BW8A 2VDOH 4FDWA 4RYDA 1UQSA 5AVWB 1WZ1L 1EXHA 4FAGA 2YXWA 4RAHA 5MHSD 4NQCB 2W0KA 1EEZB 1F4YL 3BVTA 2E76B 4PB0H 1EPFA 2VG9A 4WM7C 5CMUA 3L3GA 3B9KA 3CVHB 5GGRA 3UPRA 1XE8A 4Y4YA 2V8MA 1V9U3 5B4NA 4DP0X 3U46A 1W6MB 4E9WA 2VNVA 1WBZB 1NBYB 2VCOA 3GNMH 1AHSA 2P3JA 4RHV1 1UXWA 1UWWA 5HYJD 3DVGA 2FZ2A 3KH4A 1U8NA 1VQKV 4YDKL 3SDAC 4I3SH 4L9LC 4TULL 2Y7OA 4XWOD 2FJHB 2OWOA 3SQBA 3F2ZA 2NT0A 4DR2O 3LIZA 4NO2B 4ODSH 3ZX1A 3BUTA 3CDGA 2WKOA 2D3NA 4NC1C 2AENA 1S6NA 3QZWA 3S36L 4UCOA 1PFCA 1NGWB 1SQ2N 1TLMA 1QUNB 2IOOA 1WV7T 1KTJA 3MMEB 4HJIA 4LSUH 1SLAA 4B4PA 4ZXBA 1E9PB 1S8DA 4M8UA 5DGQA 4BZ2A 2XX0A 2LU7A 4YHZL 1HL9A 4ZPVA 1S55A 4QGLA 5FGSA 2P5WD 5HI3D 4AUJA 3G6AB 4P2QA 1HEJC 4D3WA 5D5QA 2VOXA 3EO9L 4PWGA 1BQKA 1UATA 4RQFA 3CGTA 4FD0A 4N0FB 4YH6A 3AL6A 4CPBA 2C9PA 3CLEH 2EILB 2GUZB 4KK9D 2C4FT 4KNSA 4OZFH 3TYGL 4D9RD 4CVUA 1NE4A 2H1XA 1RJZB 3A4EA 4ZMOA 3BP5B 2CLRA 4MCYA 1N19A 4OW6A 3G9AB 4PJAE 4Q52A 3BIWE 3M8LA 2EIJC 2ZE8A 2YPLD 3CXDH 5E8AA 1MHPL 2E63A 2QELA 4LO5B 4A7VA 3NSFA 4D2NA 2JG9A 2OIEA 3AS0A 5HJDA 1JL8A 5DVKA 3E6DA 1LO3H 4XXWA 1FVCA 4NM8H 1DE4B 3B3IA 3EZ8A 4Y4RA 3D8MA 2VO8A 1QBZA 3HQUA 2OTJV 2QT6A 1HN0A 2ADIB 2X4SA 3OKYA 2OJEB 5CJ8A 5E56A 2I7SA 1B6UA 4JPIA 5C7XH 2NMOA 1T1WA 4W70A 4KJQC 4I09A 3HG1E 3NG5A 1QVOB 4PJFB 1QASA 3FC8A 4S2FA 3RZCD 1B4JL 4YY3O 2A9NL 5F93C 4X66B 1T3FA 3QORD 5AAPA 1C5BL 2OMXA 2A3TA 2OMBA 1A8ZA 4RMUA 1GIGL 4FXKB 3OFNG 3G5VA 4Z7OB 2D6MA 2AXGA 2YUVA 2FR4B 3MV7D 4N8CH 3X13B 4Y16D 4AVKA 4BQ5A 3QDMB 3OPZA 5JVDA 2A71A 4XFCA 2FEEI 2AACA 2D44A 5HHQB 3H2PA 1K8AW 4N25A 3LQAH 4R4BB 4H37A 1HCZA 5B38G 4LO8A 3QJHB 5CCKH 4H0IA 4OZGB 3I56V 3E6HA 4A68A 4RRPG 1HHJB 2DQMA 4K8ZA 5D7LB 4RHV2 1QOKA 4QYOA 3VWJA 3N3EA 3C6LB 4WJG3 3G04A 2NCMA 5LBVA 3RHWF 2NLJB 3LKQA 2GC1A 1SBSL 2DQHH 4MAYC 1T04B 2HLFD 1IBLO 2P4VA 4GW4B 2UXVA 3N7KA 1F58L 1NCCL 1WG3A 3PP4H 1FPN2 2H41A 4AMXA 1SCSA 1V3KA 3RYKA 1HIMH 4J7KA 1FVDB 2ESVD 4KX8A 4N2KA 1CQYA 3TBTB 2M83A 2HLEB 3TH2T 3CN1A 4G2KA 1RP8A 2KUTA 4LF3B 1PPJH 5IK3B 3TWCL 3X3FH 3IT8D 1J5HA 3NPSC 2Y7LA 3V9CA 4B50A 2WKGA 3ME0B 4FNLH 1A8DA 1BECA 4R9BA 5IVXB 3V0VB 3MMEA 4XMWA 2DBIA 4MQTB 4K6BA 3RY5A 3INOA 3MRRA 1PIV1 4LRNL 2BSDA 4X65B 5H9PA 1S7VB 3BVDB 2AC1A 5JXJA 2XVBA 5DVLA 2HWE1 4FTBA 3JASA 1O6VA 1R3LA 1HOEA 4L37B 4LPVA 2LVEA 5D7LE 3WIFB 4ALAC 3PU8A 3VA2C 4XF1A 1A9EB 1KPUA 4EBQL 3V7AG 1P1VA 1QHPA 5CP3A 3B69A 3UBXA 4I1RA 4MGYE 2EJRA 2EEFA 5L2KD 1G4RA 2WUBL 4M5SA 1T03L 1XNDA 1AJQA 1LUWA 1A8MA 1NJ9B 1H8TB 4U3JA 4P4KB 4WM7B 4AFAA 4J3OG 1XCTA 3CJHB 1X9QA 3O6LH 5EWIH 5KW9H 4K0KB 4TQHA 1DVZA 2QQKA 4K94H 1N59A 4H26A 4LKSA 2IH3A 4A6YH 2ZJSL 4DR4O 2E7HA 2JG9B 4AL8L 5C0CB 4J11A 1F8TH 4W9FC 4H88H 3GGWA 3QO1B 4JZJA 1ZLEA 2VQ0A 1KC8W 1JFQH 1NSNL 3CN3A 1IPSA 2W08A 5ESAA 3H0OA 1DDLA 5GTIZ 1NCAH 1QXRA 5LAXA 3SDCB 4JI2B 2FX7L 3FU0A 5E8NB 4FA7B 3DYPA 1ULEA 4Q4V1 2YDEA 5FPLA 3NJZA 3OAUL 2VIRB 4P9WA 3GBGA 3TN0C 2HG5C 4LVHB 1QJX2 1E4XI 1R6KA 2OJEA 3P0GB 1SDWA 4M01A 5KX5A 2A0LD 3WMPA 1W9WA 2AQ1A 3SBQA 2RD0A 5B38B 2H4EA 4CGTA 5B39A 3BGAA 3I3DA 1BEV1 1W6MA 2MOQA 5BXXA 4JFZH 2FDKA 1OAQH 5L2JA 2WBKA 5I5RA 4P23B 2A73B 5JNYA 1LHVA 4EN6B 1GSKA 4JQVA 4TXWA 3REWA 4QPKA 2GHZA 4I85A 5I1IL 3KMHA 1QQDB 3DC5A 2UXBO 2OX5A 1UH2A 3CE1A 4OCWH 3P3NA 1ESOA 4UF7C 5DUPL 5EA0H 2DDUA 1SUJA 4AT6B 3SR2C 4HD5A 1HHGB 4EN3B 1NGWA 1JS4A 1V10A 5JHMA 4MGKE 3Q8BA 3HCVA 3P4LA 4GAJH 2BNRD 4CXWA 3POHA 3EYVA 5DD1L 3I50L 4BHUI 2OYQA 3SMHA 1TDQA 2C34A 5D5PA 1KLGA 3WKNA 1JBCA 2EC8A 2YQGA 1TQ5A 2IVJA 2Z79A 3TTSA 5F5IA 3ZZQA 1ZSPA 1VADA 5LRRA 2Q87A 2EEDA 1GY1A 1U95A 1FFPB 1YYNA 2ZX6A 1A6ZB 3H85A 4X6EB 5D9SB 2RM23 1U91A 4IRJD 2RS51 4NQVA 2XBO3 3KM1A 4JV5B 1HILB 4M61B 3IMVA 1S9VB 2HVKC 2FWLB 3HG0A 3JWDC 4OF6A 5T1DL 1VJSA 2FECL 1EANA 4XILA 4G80B 4OT1H 2AHZA 12E8L 1HCVA 1N2RB 7PAZA 4IHJA 2FIKA 3FQNA 5LMUO 4FE9A 3CFQA 2HLEA 3R0MA 1RUPL 3BZDA 2G5BB 4ZS6C 2LGQA 5D1ZC 2FNWA 2ETEA 5ABZA 3F5WB 1FG2B 4UFIA 1OOPB 1YMHB 4NN5B 1Z0MA 1CD9B 1TJGH 3QQ4B 4TS6A 4MS8C 2O1QA 2WZPP 5IVYA 5I16A 2GNDA 2IW5A 1B35A 3CCHA 4TTDC 3I2OA 3D2UA 1O4TA 2LW1A 4IBSA 4WF7A 2L4OA 1AGCA 1NA1A 4F58H 4WHDA 2UX7A 4OZHB 2XXGA 1C8QA 1JFFB 1DGRA 2ZDIA 4C4UA 3MFCA 4URTA 1PK6C 4DIXA 2YBRB 3KV5A 1P5VA 3HUJE 4LP5A 5HHNA 3GBWA 4S2HA 4UV9A 2FUTA 3V0WL 4PRBA 4HS3B 1XF3A 4FIPC 3FK3A 2XJUA 2EF6A 3U11A 3HN5A 3G67A 5ABJB 2P24A 1V7NL 3KPOA 4I0KA 3CPUA 1OGAB 5CNHA 1F4MA 1GZPA 4ZOAA 4LKCA 1X9LA 2XBDA 1Y3TA 4ISQA 3UDWC 4IGBA 2W60B 1YEDB 3ZZSA 2J1EA 1G1KA 3U4BH 1OWRM 1TUPA 4PB9H 2WD0A 1RHFA 3THOA 4HJJH 1J1LA 2RG4A 1DQTA 3CZUB 3MTRA 3VTAA 2OTWA 5TPWL 4IEUA 5F8PA 2JH2A 1UOWA 2C7UA 5CADA 1UKQA 4TUOB 2D9CA 1NAKL 3UL2A 2ET7A 3MW4A 1DFXA 3VBUA 1BBDL 2NY7L 2UXNA 3LRGA 2VOKA 1MQTB 4YZWA 2DMGA 4Y1TA 1T5XB 3BH9A 3F7RA 2PWFA 3M8OH 5E8NA 2ALWA 4CCEA 3OKLA 3AKPA 4N9IA 3IJ7A 4DR5B 1OAKL 1QSEA 1G1XB 4N9HA 4BQ6A 3E6BA 5E9DB 5EZIL 2GJ6B 4LNVA 1RPKA 4LMQE 2EJ1A 3WNIA 4Z95H 5GS1B 5GSRA 4IOFC 1IS6A 1F4XL 3RPBA 3W81A 2WXQA 1US3A 1YPZE 2F54E 3TOPA 3ATBA 4MXWB 3GMOB 1XEDA 1AAJA 4LHQB 4A2DA