4PI0A

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell) soaked in copper
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
390
structure length
390
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMVLSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLEHYGISRVYAWHLPWMAVGAAWIFFWFVRKGIITSYIRVAEGKADDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKENVTTELNGGVYKVPGRELTINVKVKNNTSQPLRLGEYTAAGLRFLNPDVFTTKPDFPDYLLADRGLSVDATPIAPGEAKEIVVKIQDARWDIERLSDLAYDTDSQIGGLLFFFSPDGKRYASEIGGPVIPKFVAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown peptide
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 94
structure length 390
sequence length 390
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4pi0A02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 4pi0A03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4pi0A01
3RFRA 3RGBA 4PHZA 4PI0A 3CHXA 4PI2A 1YEWA 4O65A
chains in the Genus database with same CATH superfamily
1VBB2 2SEBB 3IDXH 1IM9B 2AUYA 1D5BB 1N6VA 4PBWD 4J11A 1FPTH 2Z6FA 4JPQA 5EU6D 3WMQA 1BXAA 3IN0A 1OCZC 3ZE0B 1UWWA 4JY6B 4RX4D 3WFEL 3DX9B 4LNUB 5FO7B 5KSUB 1O3RA 3GSNL 3HR5A 4IERA 5FY5A 3EYVA 4YWGH 1TYJA 4GIOA 3VVWA 4Z7OE 4L8QA 3AKQA 5DC2A 3LIHA 2XN9D 2AS5M 3VD5A 2P67A 3ITQA 3TEZA 2XU9A 1RUF2 5E00B 5B1NA 2N3JA 5IVXF 4PV9A 5LBVA 2ZEZA 2ADEA 1SBSL 1TFHA 4XCEB 4XPBL 1RJ8A 5GSRA 5KTEL 2CHHA 3ZSTA 2DEXX 2YWZA 1ZBE2 4JDMA 1CGVA 2PPFA 2W9XA 1S7TA 5JOPD 1BAGA 1NAKL 1VQ9V 1QNIA 1H1AA 1TJIH 5K1NA 2KUTA 2ZYIA 3GYDA 4XP6H 5CCGE 4PJ5A 3T3PB 3BTAA 4Z3JA 2HFFA 1HCZA 4IEPA 3VZNA 1B0RA 3I74A 4FX5A 4MBOA 1KCSL 3LQAC 1T1YB 3QR1A 5EU6B 4FC3E 5FNVB 1YHFA 1UA6H 2HLAB 1ULPA 1V9U2 3IGLA 2E86A 4JHUA 3RZJA 3DTXA 3ZSJA 5H37H 2RJLA 3EYPA 4MTXA 5A3UA 2OL3B 1UOGA 3ZU8A 5EWSA 2HTKC 2XN9B 4DW2L 4WGKA 3KCXA 4AUUA 4JNXA 2Q8EA 3TOPA 5ICYB 3K2IA 4M1DH 1DIWA 3AP4A 4QQHA 2B5IB 5J6GB 3TNPB 3QXTA 1RJCA 3BMVA 4HJTA 5IVJA 4IHOB 1Z3RA 1I1AD 4D6RA 5ITZB 3WCYA 2WC7A 3QTCA 4OZGA 1S2BA 1J05A 3D05A 1UY4A 2H0BA 1D3CA 2EAAA 1YDPB 3FO1A 4JS7A 2FO4A 3VFSB 1JBJA 3UJQA 5JIMA 4MLIA 5MHSE 2X1PA 5C9JB 5BV7L 3T4AC 4XPVA 3KJ4C 4TNFA 4XDPA 4B9GA 3QORD 1JG9A 3UCSC 1AB3A 3J2PA 4ODXA 3CPWU 4ETQA 2BWAA 3L72H 4XPGL 3O9OA 1RIRA 2IBGA 1POV0 2GBOA 2X4OA 3X3FH 2D6LX 4WI7A 4Q52A 4F7MA 4Q89A 1IGOA 2P6JA 2EYSB 4LE4A 3EFFA 1T20B 2OMBA 3QUYA 4YX2H 2X7LB 3OGCA 4FFBB 4G42A 4RD7A 3NNFA 4CDWC 1KDIA 1GN2A 2AANA 2X0LA 2E9GA 2Z93A 5D1XD 2H32B 3M45A 4ZQTA 5I9QB 4X98B 1LMIA 1UZWA 4QXUH 5F9WC 2PW2A 2R39A 4AH2A 3JV5A 4ERSL 1JZHA 2WLJA 1WV7T 4YLBA 3ZO0A 5TJWK 4YSFA 1UA7A 5A3PA 1Q3EA 4G7QB 1COBA 2B9BA 3L1OH 1K4CA 3V5HB 2DTWA 4L4VA 2XR4A 4CDWA 3EJCA 1AXSB 1ORSB 1IGYA 1KS4A 3HZYB 3I9IA 5C6WH 4XVSL 3HLAA 1M90W 2YAMA 2ZX6A 3VG9C 4I0XB 2ADFH 3AYCA 2AW9A 1KDJA 2FQEA 3STZB 2Y1ZA 4BFIB 4HUVB 1PGSA 4XZUG 5LA9A 4JKPL 1FJ1A 1AHKA 1R5WA 4NN7B 3MRCB 3NIDB 3M2MA 3V4PA 3B3BA 4JFPA 3QHZH 4QRUB 5TTRA 1D4M1 5DUXA 2PXYC 3B9AA 2R23B 4XPTL 5K1VA 3V2AR 1DHKB 3HCVA 3QXWA 4JKMA 4YHIA 3U1PA 3KVAA 4IIJB 5D1XB 1DJGA 5CADA 3BE1L 3TJHC 3JXSA 3FBMA 4PUBL 1UYXA 3RNQB 1GZ9A 3E2HB 3ARZA 3CVHB 4XI5C 2CTVA 3DIVA 2DMBA 1KIUA 1UUNA 5L3DA 4LGRB 1E65A 3LZZA 3MW2A 5FHBH 5FMOS 4L1LA 4WQOA 3P0VH 1MHEB 4O02L 1AD0A 3DX2A 3NFSH 4U7KA 4XBEL 3ZJAA 4DPBX 1DF0A 3SQOH 2DUPA 1VF5B 5HCFA 4DO0A 1LTXA 2O8QA 4QX5A 5I23A 4Y1AA 1L7QA 1QPPA 4YXHL 2G9HA 4XO5A 4XDOA 4M9OA 1FYUA 4P3CL 2PLV3 3O7OA 3MV9D 4L0ZA 4JQTA 1BD2A 2D3LA 2EDMA 2FX9H 1F13A 3MUY1 3LXCA 3RI5K 1GS6X 5CIRA 4OU3A 1CIUA 4Y4KD 5EEXA 4HH8A 3P3NA 3QUXD 2ZXWB 2FJHA 2KC0A 2YMXH 2Z8RA 1DANU 1S2EA 5DHYB 2F6BA 1H6YA 4AGVA 3U4BL 4XUNA 3JYBA 4HIHA 1B3IA 5CWSB 5JPMB 2G19A 1YYMH 3EQEA 3LUTB 3FUNA 2QTEA 1S72V 5A7PA 1KJ2H 5KJ4A 4JDOA 3T3MF 4PJHF 1BLNA 3ZRFC 4LEJA 3V0FA 2Y06L 2HUHA 5C7XH 3HNSH 4MA8L 1J8RA 2CCVA 1U0QA 2PCFA 3UAJC 4ODWA 5IB2A 4EVNB 4RQQB 4JGMA 5JMCA 4XB8A 2WXQA 5KVGL 3CZNA 2BW5A 3TN0C 4HSLA 1DYOA 4FQPA 2QKCA 3DHJA 4WW1B 3MV9B 5F6HJ 1MAJA 3H9VA 2IGFL 2RIKA 3C3TA 1RK7A 2B39A 2MPAH 2J5LC 2QPUA 1AI1L 3QUXB 4R8CA 4NQDD 4YY3B 5BMVA 3UAJA 5IAXA 2GI7A 1AGDB 1QO3A 3VQMA 2MFNA 2DL2A 3AGWA 4NP4H 2F8VA 3KLHD 3E6BA 2R59A 1ZLDA 4BQYA 3JVFC 4M8RA 4C1WA 5ERWB 1OHFA 3PNWB 5FQ0A 5LBCA 1AL21 4Z5RB 3TYGL 1U6AL 1CFTB 4X89A 5FLJA 1BVKA 1KWKA 1CZSA 1QMJA 2BFVH 1A4JB 2BU9A 4E5XA 3G6JA 1W15A 5DZFA 2CCWA 2F58L 2PAKA 3LIUA 5T3ZD 1UTDA 1QJX1 3BWUF 4ZO9A 3C7GA 2ZP9A 3ARDA 3QWRD 4XHJD 3BP5B 5BVJA 2DURA 1K92A 1N9PA 3GJFA 2IU3A 3B2UC 3N3EA 5D71H 3CV5A 5L4JA 2DW4A 5HDBB 1JZ2A 3R05A 5GLTA 2HWF3 3TN91 1QQCA 2FDHA 1YPZA 2IH1C 4A68A 5BVPH 3I97A 3G6DH 1U3HA 1X4ZA 4NQDB 4C56A 1P7BA 1T7XA 2W0KA 4WK4B 2WRAA 2I7OA 3NH7H 3WQ1A 2UWCA 4X4XA 3VBFB 4U4IA 2HVBA 2IAND 5DI8A 1RUC1 4OGQB 4I0BA 1FG9C 2IPUG 4OCRH 2Y23A 2CKBH 2H0PA 1ENVA 3MKGA 4MNHA 3LD8B 3MOQA 1CU4L 4JAMB 1KYAA 3E8FA 1HV1A 1L7LA 1FNGA 1MOEA 3CMEV 4AL8C 2GG1A 4LBLA 3ARQA 4AG4A 4JDEB 4CAGA 3BZ5A 2FECL 3IVKB 1JNNH 1RXGA 3IDEA 4F33A 1INEH 1SS3A 2EA7A 1A6PA 2X10A 1S0BA 4FEIA 1YQ5A 2WUHA 4CCOA 1XGQB 4TOYH 4TQPA 2J3SA 1U5IA 2OKXA 4GI8A 3QEQB 5E94B 5LWYL 4CS2A 2GVYA 1U8MB 5IFAL 2DYRB 5KAQG 1RULH 3POEA 4RO2A 2YD2A 3T6QC 4JM2F 1U8PB 4NKMB 2CMRH 3ARGA 3A0NA 3V4PL 1OCWL 2HG5B 3X14B 2D40A 2B1OA 4PJAF 5BRZA 1MREL 2AQ2A 3BZFA 5EOCH 3LNDA 3HEIA 4FTBA 5LRSA 1T5EA 1WP6A 3MMEB 5FFLA 5IHHA 5JHLH 2QWQB 2IANB 5EO9B 1NGWA 2YPKA 2GH2A 2Y34A 5D21A 3I49A 3ALPA 1OIOA 3QG6B 4GKSB 1QSED 4KHPO 5FZCA 5L9VA 4XWGL 5DRXA 1KJMA 5E1AB 4N0CD 1DJSA 3H2WA 1BZ9A 4HPOL 3LCYA 4BH7A 4IYHA 3BVDB 2H6CA 4YW2A 1RH8A 1G9AA 5CSZB 1FNEA 1QBZA 2A6KA 1YECL 3F84A 3S0MA 3DX7B 5E70A 2VN5A 4UV8A 4FLYA 3MW4A 5D7IF 2ICWJ 3FB8B 4ZDHA 2ODIA 1X7SA 4LFCO 4O2AB 1NQJA 5F5IA 3DUSA 4N2IA 1KNOB 4OFYD 1K34A 4XJUA 3H01A 4B5EA 4LF5O 3DIFA 3IB3A 1PLAA 2XPGB 3AC0A 1XPWA 1DJIA 1QZ1A 3Q8CA 3L9DA 3QZWA 2JG8B 3HC4L 5CN3A 4QMAA 1QSEB 4DCQA 1XDCA 2FTKA 4EDWH 4DV5B 3BJ91 2FCTA 2UYLA 3QZBA 3PWPD 3L2YA 5EIIG 4R0LB 2RMU1 3UZVB 5CAZA 2AJUL 4UWQB 4DR7O 4Y9CA 3V0EA 1VBC2 5FKCA 3MX0A 4R5VA 3F7LA 3SDXF 4DV4O 5A43C 2ISDA 1OLLA 3WQ0A 4NN6B 3LV3A 2VTFA 2GAUA 4W4ZA 1IOAA 1JOIA 5IBLD 1FLTX 4LSSL 2EINB 4LNRB 4JC1A 2G0LA 2B5IC 1SKVA 2A9HA 3FN0L 3N44B 1HR0O 3C2SA 1WP8A 1Q38A 3CDGB 4MVBC 2HEPA 3MLWH 1AKJD 1O59A 1CF1A 1RUI1 2BZDA 3H4HA 4OM1L 3BWAB 2WXJA 4PRID 1R093 3P3TA 4YVSB 5A7WA 1R3LB 2XPYA 3QJOA 2ZGKA 4JY5H 3AT8A 2VNCA 2HX9A 4TV8A 5EQUA 1RUE1 4ZMOA 2J7LA 8FABB 3UPRB 1BBJA 4XO3A 3PV6B 4JHBA 4GMP1 5AB9A 1U8IB 1I3RA 2WKOA 3PWPB 3JWNH 2JG9B 1OAUL 1GXEA 2VMGA 4OSUH 2VLLB 2G2PA 2Q86A 1DJWA 2DQEH 1TZGH 3W21A 4R96A 2GHZA 3MXWH 4MA1B 5BW7A 1J8HD 2UXBO 1RURL 1K3IA 1MFBH 4XJAA 3MXVL 1XF5A 3EGXA 3MCKA 4R6ZA 1AJPA 2H0FA 2P3YA 3T1HB 2ORZA 4IEXA 1CJYA 1S6NA 2BIQA 3M7OA 4F8TA 2WINB 5I9QC 4IETA 2ZOWA 1SRYA 3PP3H 3EOBA 2YLHA 4JVPA 1RHI1 4KZCA 4QDGA 1SLCA 1Y3TA 1YO8A 3J9SA 3S98A 2DMHA 4L92A 4FFZA 3VU2A 3JAKA 4D0DB 4I0WB 4PRIB 1T20A 3DX3A 5EUOE 4JI1O 1T0PB 2WQZC 2VQFO 1DO6A 4QRQB 1QRNA 1H8EG 1S9WA 4HUUA 4HXAH 5IW6B 5FYTA 5TISZ 2JLPA 5I1JL 5IW1B 1WLTA 5BZXA 1E9OB 4MB1A 4C58B 4JCKA 4F80A 3DO7A 4U7OA 4AG4L 5ETUB 1NC4D 2JDMA 2A74A 5KEZA 4DP6X 3STZC 3IGAB 4GULA 4PQ9A 4Y3OA 1QI4A 1BQ5A 4TUKL 3X1GA 4F8OA 5HXVA 1LOCA 4FTVE 4OIBA 5C3QA 3WXVL 1J8HB 2VH5H 3PWLA 5G04L 4FQJL 1NBYA 3W59A 5GRXG 2JWPA 2X7RB 2COQA 1FYJA 1MLBA 5D1XC 1P4UA 1LGNA 4ELMB 4L2NA 2W0FB 4NQCE 3RZKA 3KVDD 1H2LA 4OFIA 4Z3TA 5DZ9A 1TCRB 2HWZH 2V8LA 4YSSA 9PCYA 3O11B 5CZVH 1JP5A 1SFDA 4AQ1B 3BQVA 2X53S 3AKSA 4JKNA 1ZRUA 2KI6A 3CMOH 5I91A 2V0AA 1CTOA 4K7FB 4ZOEA 4AGNA 2R4SL 5TE7L 1BF5A 4JDVA 1QHTA 4ZW7A 1JYIA 3IS0X 1VF5C 2QDVA 2HWB1 1PJ9A 1K5NB 2FT6A 3FO9A 4OLVL 4COWA 2D7NA 3TEWA 2HJFA 3Q8FA 1NC4B 2YB7A 4WW2B 3WS3B 1G7IB 4LOVA 4F8QA 2MHFA 2GTAA 1H3TA 4QAWA 4Y1TA 1QVOA 5DZVA 4NWUH 4D7TA 3QIBA 1DVTA 2V2WB 4XCFL 4UT7H 5J1AB 4PJ9A 3T0DA 2HRHA 4HVOA 2ZXWC 4F7CB 5FV2A 1S3JA 1W91A 2I74A 3Q5OA 4M5TA 1S0GA 4FTEA 1HNWO 5C93A 1G86A 3K2MC 4HSAC 2P3KA 1J88A 1MAKA 5IUCA 4PDWC 5A33B 2Q68A 3CGTA 2YRPA 5FAAA 5F7MC 3BGMB 3UEZA 5JPMC 1AYN3 1A0QL 3MRGB 1YJWV 5FFOC 4JI0B 1DQVA 1XE0A 4PRAB 3ZMOA 4I3SL 4CS4A 3HS9A 5DU7A 2WXHA 4Q4W3 2H3NA 4FZ8H 4QU2A 4S2HA 4FXKA 3VZOA 3MDSA 2FECI 3KD4A 4U1JB 2WQVA 2E75C 2E4FA 2ATFA 1F4XH 2K0RA 2UWEA 5HPMA 5E0FA 3STLA 1TVHA 3H3LA 2I9TB 4PDWA 4LCUA 1WP7A 4RWYH 1I7RA 2ADQB 3QDMD 4D8MA 3FFCA 2N59A 3OR7A 4OUUB 2JKXA 2C1FA 4MGTA 2R7EA 1QLEH 2OXHA 3MNDA 1Q8QA 3K75B 5EZJA 4Y4KC 1XV8A 2AJSL 3AY4A 5BR8O 3QUXC 1V10A 3BI9X 5FY7A 2PABA 4IOIB 1O3TA 2HAZA 1WB8A 3ZMEA 3RMYA 3VQLA 2OMWA 4DO4A 4XGZB 3BHBB 4NWTH 1HNGA 3BAEL 4KOBA 1JHKL 3Q2LA 3VRIA 4DOHB 5F3IA 4TSCH 3NQKA 4WW1A 4Z95L 1QJY1 1EAH1 2A0LA 2TEPA 4YGCA 3FSWA 3MLXH 1XGTB 4XCCH 4XUQA 2O93L 4I55B 3WP5A 3ZX6A 1NCBL 1GGYA 3JQXA 4XJWA 3DXAB 2XETA 3KT4A 3AS3A 1GTOA 1XF1A 3LSQA 1KYOJ 2FX7L 3EJZD 3OXRA 2BJMH 1A3RL 3VE0B 3VFMA 1ZA4A 2EDWA 2MCPL 4Z8FH 1F1GA 5A1AA 1R0AH 2YAPA 5DZEA 2R2HB 3TBYB 5DWUH 5LBEA 4RAIA 4M5ZH 4L0PA 5L7OA 1IBMO 4KNCA 5D2LA 1UXZA 4YGAB 5A40E 3J81N 3PUSA 3IJHB 2V7NB 1A4KA 5GGSB 3IJEB 2KG7A 2GHWB 2ZJSH 3S3XA 3VRJA 7PAZA 4IDJL 3V95A 1OAXH 4PP2A 1EEQA 4YPGB 5IVXE 3DECA 1B09A 5LVEA 3C5SB 3B7MA 3D3AA 4IM8A 3JUZA 5D1QE 3KYKL 2WIMA 3P3UA 4OGQC 3KLHC 2QDRA 4HOOA 1RSFA 5LGTA 3HG1B 3AT9A 3GHBL 4XCAA 5I76A 2GJ6E 3RWNA 1WHOA 2XWDA 4JHWH 2YGQA 4UM8A 3VN4A 3TFBA 1VQMV 4HWUA 4UTBA 1FNSH 4M7JH 1FS0G 3G6AA 3D50A 3APCA 4XP1H 4FFZL 5DD6B 4OHYA 3FU9A 2BSRB 1UY3A 4KJYB 4DNLA 2R1YB 2OTPA 3ZW3A 1MXGA 4LFHG 5AVZB 1TLMA 1K45A 4HYOA 5C0RH 4CE8A 2A71A 5CGYD 4WUKH 3ULUF 2HMID 5BXXA 4PW4A 4XHJC 1TXKA 1FPN2 3GI8L 3MZGB 5GS3A 4UCTA 2A9MH 1XB9A 3L95A 2W2IA 1FFNB 3RQ0A 1DN0A 1A32A 3POBA 2HG5C 1V5JA 1L0QA 1NCOA 3O2DH 1BZEA 4HAFA 1SOXA 5GGVY 5JUEL 2N0KA 1G43A 1KJRA 2JECA 2QQJA 3N9NA 2Z31C 1AANA 2HA1A 4WM7A 3PIQB 4H44B 1LOAA 5ADOH 3K72B 2DJMA 4PJEA 3DX8B 3F65A 3T4YB 4Z7VF 3IETA 5L3CA 1ZGLM 5MEOB 2CLVA 3M1BA 1QJU1 3GGLA 4K7JA 4XHBA 3OAAG 3WSOA 2AJ3B 4PS7A 5EU5A 3WTTA 5F32A 2P6HA 5E1AC 5FYBA 5KC5A 5CN1A 4Z7OB 3EJJX 4P2QA 2JS5A 2Z31A 2UXFA 3NJIA 2NDGA 4FABL 4I3RL 1FPOA 3UJJL 2RFXB 4TL5A 1Q1JH 3E3QC 2EXHA 1H3XA 4WJKB 2J42A 1CE1L 1I7ZA 1ZE3H 3QCVH 4QO1A 4G9FE 4U3SA 5C07E 4AI0A 3AZUA 2E7MA 3U7YH 4RSUA 2C3VA 1ROWA 3JV0A 1VDGA 4LPTA 4FLUA 1J1TA 2HTLD 2O5XL 2BRTA 2FQGA 1P9MA 4XX1G 3EO1B 43C9B 5EPAA 4YHPB 2DQTH 5MHSD 3J8F3 1RHHB 4ZODA 1IX2A 1T22B 3INUH 5LP6B 2CLZA 4QGMA 1FORH 2P43B 2EH7L 4CNIA 1ZANH 2Z91B 1RMFH 5L9DL 1QDOA 5CA0B 3GSOA 1ZVNA 4G8FA 2DD8L 2JG8C 4OUMA 4NNYB 5CAYB 4RDQF 5DO2C 1HEJC 3ALQA 3ZMZA 3CQFA 4R0LC 1NGPL 5DVOA 3P4MB 4Y4RA 3U25A 4M0NA 2OXGA 4AYFB 1W6NB 5TF0A 2D3VA 4EQVA 1E5ZA 5KN5A 4NN6C 2WZPA 1WW6A 2JG8A 4MASA 1NKDA 4GQRA 5DAVA 1SEQL 3MW3A 3KGTA 4X88A 2FWSA 1WGVA 2P48B 4P5TD 12E8H 1FAKT 1XX9C 1DJYA 3AQDA 4G6JL 5F0JB 5H94A 2CE4A 1PM7A 1SBDA 5L36A 2BBVA 3AP6A 1AR61 1Z66A 4OLLA 2H6PA 4X1YA 4WI0B 3RWGA 3BKJL 4YXLH 4X4YA 3AKTA 1NINA 2G3NA 2ZXEB 4FFIA 8PAZA 2EABA 5AW4B 3G4SV 3WEMA 2YEVB 1R3LC 1Q6UA 1VIBA 2Z1KA 3CCRV 4OV5A 5K33A 3RYCB 1ZJAA 3MV7E 4FDWA 3VXQA 4YLCA 1I8IA 1AXTL 3J07A 5BY1A 3ZUNC 3ZYZA 2JG9C 1HP8A 3IJYA 4ZQKA 5SX5K 4JZGA 5FL7G 1JF5A 5DO8A 1QWNA 2VUKA 1HRV3 3AB0A 3O65A 3NIGF 5C92A 1GNZA 2JGUA 1JYWA 4R8HA 1G7JA 5LKNA 5ISZA 5L3EA 1AO7E 3TV8A 2YD5A 1AFVH 3UX9B 3SJBC 3VI4A 3AFGA 5JXHA 4ALAL 1PVC2 1I1EA 1S9YB 3BXNB 3FTSA 3NPZB 1UM6H 2YA1A 3O45B 2ERJB 5IBLC 4AT6B 3WTVA 3CC4V 4P5TB 5DEGB 1G8WA 5EEVA 3JQWA 4I1NB 3FTWA 4AIOA 1RUPL 4JV5B 2R32A 4UINH 4W6XB 4XTRC 4RS5A 1VP7A 1BVNP 1QMUA 1UZGA 3H6AA 4PJ7A 3PVBB 3FUFA 1AQMA 5JH7B 3C75A 2XVGA 2ICEB 4U6VH 2YSTA 4ADIA 4KRNA 2K3HA 5DEDA 3T3ME 1RPUA 4PJHE 1DCLA 4MGXA 1X9TA 4P48A 1CI3M 4UTBL 5JSPA 4GAJL 3OF6D 4XNUH 3WAKA 3PUUA 1RL1A 4JFFA 4N8CH 3IGAC 2D8KA 3G5VB 4LIQH 3CHPA 4IIQB 4P9MH 3ZRXA 5HI5D 3EXLA 1F15A 1ZYBA 1ACYL 2RGSA 2K1EA 5CA1B 1MFAH 4O5LL 1Q9LB 3S4SA 3H53A 3L3KA 4UOJA 1QBMH 3GHEL 2NX5A 4OGXH 4Q4V1 5TSWA 4HP5A 4ZOBA 3L5XL 1MVUA 4FQQB 1G0DA 5F88B 1FVEA 1R081 1VMJA 1GH7A 4K40A 4FCHA 5DUBA 1YQVH 1REIA 1E6OL 1CDUA 3IDNB 4AQ1C 1NOAA 4NGHL 4EZMA 4FE9A 3FFOA 1YSCA 2E9JA 4BRJA 4X1KB 5HYJA 3L17A 3PDOA 3QBTB 4B9YA 2IMNA 4S2SB 4UB0L 2P3IA 3GJBA 3E6HB 3ISYA 3T0AA 2ZYSA 3VHOA 1GAXA 1C7TA 3CWBH 2YD6A 4RMSA 3L3JB 4OJYA 4JG9A 5L7XL 4QXTA 3K8KA 3H42H 3KYOA 2EIZA 3LKQA 1GMEA 1B04A 1OSYA 1Q0XH 1TZAA 2K4AA 4Y5VC 5E6RB 3VFWB 2NUPA 2YPDA 4WW2C 5KAQF 1E4JA 3DOHA 4R26H 5I1KH 2HWD1 5KR7A 1DQJB 5TPWL 1BE3H 1VFAB 1WE5A 1F3JA 3DV8A 2Z7UA 3VGHA 3HT1A 1XR9A 1YLBB 1NCDH 1BHAA 3B2VL 3RIFK 5ITBH 1DGRA 4LEEA 4Y5VA 2PCPB 5F1IB 4C54A 5IYZA 2FTAA 2NW3B 3SYAA 1FJGO 2OMNA 4MNGE 2EDBA 4ORGB 4KMTL 4XMKL 4XPAL 5HVWA 3EF4A 2X6CA 4M0HA 4EN9B 2XLGA 4JFXB 3UJTH 4OI2A 3ZYHA 2NXYC 3PNRB 3D12B 1QUNB 3APFA 4V33A 3VA2C 2VH9A 1SCRA 3OGVA 1RZ8B 1AD9A 2W07A 1BBDL 4YHML 4AHZA 1ZTMA 4BQ2A 4EUPG 1YEFH 5JAXA 1UKRA 4Y1UA 5D7HA 2B46X 1S0DA 4CVZB 1T7ZA 2BVUA 4LCIL 4W70A 2YZ1A 4AQYO 1XF2B 3VI3B 2EUWA 1CPNA 3CQPA 2E26A 3FBQA 1RXFA 1QPKA 3MRHA 3H3KA 1XGYL 2MHAB 1KELH 4PY8I 4PVBA 1RXLA 3BT2L 4RVBA 3ULSB 1HQ4A 3D39A 4OLXL 5J9PA 1RFDH 5FXVA 5KJ7E 1JPST 3JSLA 3MRDB 1OAKH 3O3BB 5ANMA 4JGZB 1AR91 2K9ZA 2ARJB 3ZKUA 4OCXL 1WAAF 1MIML 1ET7A 2IWKA 3KLAA 3S8WA 3VBOB 3H8RA 2QEXV 1SLVA 5AW7B 3ZKSD 1M53A 2DM2A 3D0LA 3HAEG 3U37A 2VCMA 3D69B 1MZEA 2BY1A 3GB7B 1N0XH 4X5LA 2LOEA 4JHAL 4PJAE 1ZLSL 5CIPB 4AITA 3L9RB 3D0VA 1OK0A 3M6DA 5CA3A 3RFRA 1LO4H 2GEQA 1JUHA 1HHKA 2G1MA 3VDDB 4QU1A 1SHWA 1UFUA 4ZMPA 2DCZA 2XPJA 3AXLB 1ZA7A 1KCVH 1HXS3 2XNAB 1SPPB 2JS3A 1NDGA 1F6FB 1CZVA 3CXHF 1ULFA 1FGVL 3NW4A 5JZGB 1E5RA 1UWGL 2VQAA 2W91A 1C1EH 4H0IA 1KCLA 4X5RA 2PN5A 5LNDA 2GJZB 3AXIA 4PJXF 3N42B 2BVOA 4RLDA 3ZHDA 2ZM6O 1NLBL 1LO3L 2B59A 2R0KH 4G43B 4M43H 2XL7A 4G8IA 4U7NA 3LN4B 2NPLX 1W0PA 4F24A 3CN0A 5L3GA 4UNVA 4GMTH 3CFKA 3QNYB 1OLRA 1NGQH 5FECB 1J58A 2QQWA 5D7IE 3SKMA 4KGGA 4NN0A 5D5PA 5JZ7D 4CEWB 4K5LA 1DVQA 4PCKA 3RVUC 5B66Z 5B8CB 5FZIA 3PHQA 4F9LC 1MMMA 4DV6O 4HALA 3HMXA 4FFYA 1FVDA 2VDLH 3M07A 2JDKA 4QYOB 4RSYA 1VKXB 4U1IB 3EBHA 5FLIA 2GTZA 1IE5A 4J7JA 1YWKA 2HLFD 2ZIDA 3K59A 3UC2A 1YNKH 1LESA 2F17A 1CICB 3BD5A 3JBG2 1U92B 3BKYH 1P6AB 3D36A 1KB9J 3DUHA 3K0WA 3SDDD 4OZHA 2EDDA 3ZXKA 4Z9KB 4CH5A 2DM3A 3EJZC 2IBZH 1SVBA 5E51A 4ADGA 5IHWA 3PTYA 1Y7VA 3SDXE 1EEYB 3VFTB 1JXNA 3THPA 3R7RA 2QQIA 4RMTA 3NAAL 2A9BA 5HGDA 4XX5A 1OPGH 5JIQA 4LJHA 4D9LL 3JASA 4JRXE 1N10A 4PWGA 1CGUA 1EYBA 1JOPA 2BTQB 4KJPC 4MTFA 3VTAA 1E9PB 2COVD 2HT3D 4NUPA 4YJ2B 4DUZO 3DX0A 5GGTH 4E9YA 1SFPA 3NA9L 1T89C 4RFOH 3MN8A 2Q1ZB 3MIFA 3Q5TA 4YDIH 1WCDJ 4LFAB 3WB1A 2G5UA 3V6FA 5IMMA 3C2UA 4OYUA 5F3HA 1MEC2 2IH3B 2AC0A 4Q4X3 4BBWA 4Z3FA 1R1A3 3SDAD 3D6EA 1OJHA 2JI1A 4QQ2A 5FC9A 3K3WA 2CDGA 3OB0H 4H88H 5I1LA 5LHHA 3SDDB 1J11A 5CILL 1G5GA 4LDOB 5JQGA 4JO4H 3GQFA 5CGYC 5KYUB 3GMLA 3L3HB 4JO5A 3IKKA 4O4JB 2EE0A 2WLMA 4XTMA 1MCQA 5KJRL 4HT1L 4I4TA 2ZGOA 1JGLL 3C6LD 4D69A 5DMIL 1Y6KR 2XBO2 2PP7A 3QO0A 3BFOA 1CTNA 3EO0B 4V11A 3QH3B 5LP6C 4P9YA 1OP5K 3VD2A 3ES4A 1UZ8A 1NMCB 1H2GA 3ISWA 4TULL 1PNGA 2VQEO 1YITV 4GMSH 4WV1C 1ALYA 4R52A 3TBSA 4ODVH 4JG0L 4JGZC 3DDGA 5FPRA 1UWFA 4MVOA 1S3RA 2O4EA 1DZTA 3PL6A 1WFOA 3T0EA 3ECWA 3OGSA 1BYPA 2QPEB 1N33O 2Y36H 3WNLA 4P04A 2HKHH 3K5OA 5D8JL 5DK3A 4X80L 1RSOB 3ZMVA 1A14L 1T0NB 2UXVA 4F4LA 1YFUA 4MX3A 4HHWA 2F74B 2M2DA 4WV1A 4XIOA 4JMXA 4MXVF 1QYGH 4GKKO 2P8PA 5FLVA 4JGZA 3KR3L 3L08A 4FLSA 2HTLC 3C6LB 5D7JD 2A79B 3AZWA 1G1KA 3GJEA 2FDKA 1RZKC 2R1BA 4D9QE 1HQRA 4LIVA 4E0RB 2V37A 1S7RB 2N7AA 1QR4A 3I54A 1UD1A 5CBHA 1E28B 5T3XL 4RHV3 3U2IA 4Z7QF 4Z1MG 3ZTEA 5FIXA 4PVLA 5T5JA 1OV9A 4I9WA 3MPPG 3BI3A 4TVUA 4U3HA 4L2YA 4PQQA 2E4TA 2W46A 1RUAH 3US9A 1OAYH 3CBRA 1RM1C 2YR3A 4MQSB 4N43C 3JCIA 4AGGA 5IK7A 4DZ8A 1NCWH 1O0VA 5MEPA 2XA8H 4GB9A 4MXWH 4DESA 2JKWA 4P23D 3ZKQD 3W38A 3OUSA 2VIRB 3EOYG 3JALB 3JT0A 3N7MA 4BXFA 3GNEA 4TXWA 1BQHG 3MPCA 1KZYA 1V3JA 4MS8D 3X3GL 1GCFA 2BSED 4LMQI 4P5TC 4ZS6C 4YAQA 4ZUUB 3O1MA 3MD0A 4JZNB 1X5XA 2V6HA 3L2NA 5D7JB 4ZX4A 1GQPA 1B0IA 3IFNH 1W05A 3WQBA 4PRNA 5JOYA 2NZ9D 1GA2A 4KL1A 1PCSA 3BP7A 1FATA 4XCBA 1KEGL 3ZHVA 2XASA 2BH0A 4MBRA 3U9UA 3BVTA 4DKFL 3K71B 3ZFFB 1NY72 3BVCA 2R042 2ICEC 1P0SE 3QDGE 3VXSD 4XQWA 3S5LB 4BMBA 4UVCA 3HMXL 1NCAL 4FFYL 2ES3A 1RC6A 1E4HA 1JGVH 3BVUA 1W6PA 1K8DA 1WZKA 4PGDB 1DSFL 1VR3A 3M99B 4DNYA 3KMDA 1YN6A 5F7UA 1KC5H 5ACMA 3K8LA 3RUGB 1NANI 1I8MB 1S8DB 4IIQC 1O4TA 4DR2B 1J0HA 2HYMA 4HXBH 4XMXA 1SF5A 4P23B 3VCLA 1RUH1 1MCNA 3H9AA 3PG2A 1SETA 1FRGL 4NQCB 1VARA 1UOVA 2HCZX 4OJDH 5DCCA 2PYTA 1HKLH 3FCBA 3L3IB 3JD72 4OD3L 4W9ZA 3C5XA 3V0AB 2Q8AL 3AJ7A 5BV6A 1XNCA 4JANB 3S37H 3ZIXA 2J1RA 2D7FA 2F19L 4N5UA 5CCHE 4LSPH 5JUVA 2K6WA 1NCIA 1JWMB 4LLMB 3SPVA 2CO1A 3FHAA 3MCLH 1ETZA 3QPXH 3F58H 4YW7A 2Y24A 1BG9A 2X4NB 1MZ5A 4LLQA 2CV6A 4Z0BH 4L5FE 4BA8A 2CL2A 3RPQA 2P24B 2AI0H 1KTKE 5ESQB 4FYRA 1IGTB 2R0WL 3CE1A 3E38A 3MEPA 5L4IA 4ZU5A 1ZT7B 4NO3B 1BW8A 2EX3A 1EBAA 2G5BA 2V3EA 3U4AA 5ADPH 2GBAA 1VMHA 4XMUA 5I71C 1W59A 1MIEH 3CFJB 1RUD3 1T1ZB 4UQAA 3KPPA 2V1DA 5E4OA 2NPIA 1V54C 2P5BA 1J5CA 1FYTE 1EGJH 1R1CA 1U58B 2VZOA 2Z7ZA 3O6MH 3U6RA 2VL5B 1JFQH 5DXDA 4WF9V 4EYUA 5I8YA 1WAZA 1OF2A 1TTRA 2X89D 5D2NB 1W9TA 2Z35B 5AAPA 4M62L 2GK0B 3LS4L 4JFDE 1NMBH 4DUWA 3CN2A 1HNZB 2LW8A 2X6MA 5A3TA 1XF4A 1I5XA 1OO2A 2R72A 4GRWH 4MJ6A 3S88H 1JN2P 4H55A 4TF4A 1DUYB 2WV3A 4I3PA 4IOFD 2DU1A 5IM7A 2UZYB 3OD3A 1AZDA 2OQJA 3MF9A 1PKQE 4LSTH 4ZSOB 3ETPA 1R5IA 5LASA 4X5PA 4Y22B 3G6BA 2M26A 3QO7A 1AR4A 2XKSA 4MCYB 3QIWB 5FP4A 1SERA 3ZY7A 4BV1A 3P2BA 1BSMA 3GMPB 5KW9H 4J39A 2QGDA 3Q2WA 4HWEL 4BQ6A 3ULUE 3CZLA 5KHKA 2PWFA 3SGDH 4J1WA 4HX1A 1TJXA 3UMTA 3BEVB 43CAB 2LU7A 1LHOA 2DU0A 3T4VA 4B4RA 5CFDB 1WNSA 2VDNL 3CLEH 4NNPH 2ZKNA 4H4NA 4XN5A 2GJ6D 3GINA 3EOTH 3RKDD 1C57A 1AYRA 1Q6IA 1EX0A 2XX1A 2WXKA 3FUHA 4PWJA 1NQTA 3GMOA 1DZRA 1LL1A 3W56A 1EANA 4GYCB 2HH0H 5IVYA 3VDDC 2G9GA 5HJ3A 1MNUL 3MLSH 5FKPA 4NIHA 2DMXA 1JZ5A 4Q4Y1 3ZYBA 4PB9H 4Z7VE 3K77A 4ZONA 1KB5A 2C5DA 5JZGC 5FWEA 1JTPA 4FQ2H 4R90L 1CD3G 4ZT1A 3MLYL 1N1VA 3V0HA 5JOZA 4K5MA 1AHMA 3GZTB 1HL5A 2FQFA 4D8PB 2UXCO 4F58H 2P80A 3HZKA 4L4VD 3ACFA 1T03H 1K85A 1DL7L 3T77A 4NJAL 5IVXB 4COZA 2Q0OC 2JDUA 2LQTA 1RERA 5D1QB 1IQAA 4JPIA 1HIMH 1UJ3C 5J12B 4CADA 4CEWC 2GJ6B 2OMXB 5F21B 2JJ6A 4DUYB 1EEZB 4OQ1A 5B8CC 1IC7H 3KM1A 3CTTA 2APSA 3V4VH 1JV5A 2NUTA 5IVVA 1OC1A 4UW5A 4CDGC 3LN4A 2GSGB 3I6GA 5AZEL 3WD5A 1KGYE 3QRLA 2IDTA 4BK5C 1CG9B 2UYAA 4X42A 4QE9A 1CGXA 3TBVA 1CICC 3B8NA 2YRZA 3KGUA 2ZKHL 1UJ3A 3TT1H 3ARBB 2BSTB 3CFNA 3FQNB 1TTBA 3LZFH 3N55A 3LNEA 4ZUVB 4ZNEE 5B3SB 4H25A 3BUBA 3LCPA 1ES0A 2ID5A 3IAGC 4CDUB 5D8AB 2RVAA 2RG4A 3O41B 1IGFH 2J8UF 3V55A 1J7VR 1NEZB 4KO5A 3TZVC 1VKXA 5EIYB 1YJNV 4XCNA 4LKCB 4KTYA 4OZIF 1L9PA 2CO6B 3THOA 4YQXH 2DQHL 3L7FA 5JHDD 4M48L 4PJBB 3UZQA 2YUXA 5JXAH 2XZCL 2JVUA 3IDGB 3NACL 3W7TA 3L3GA 3ZDXF 3MJ6A 5JZ7C 3W20A 2VMFA 3FAVB 1JN6A 1YEIH 3C5JB 3K6IA 1I6XA 4AEKA 2K8MA 1BD2D 3GXUA 4HLTA 1GW6A 4PW3A 2M7WA 3VZJA 3TZVA 3NDZE 3S34L 1LGCA 4AEJA 1U0AA 1SQFA 2XNDG 1I9JL 3PHOB 2GFBB 3IDIA 3QZNA 4TSBH 5FMCA 3R6SA 4LSUL 3NRQA 4BDVA 2ZOLA 1GJUA 2FHCA 4QD2E 5C0BE 4M8UA 5B3NA 5HVFB 2OMVA 3DVNB 4I2XA 1MJJA 4OGYH 3SDDC 3GXTA 3I8TA 2E5EA 2FJUB 1E5UI 1GY1A 2Z7WA 4EOWH 2EVXA 4BCZA 5IATA 3NIGE 2P8MA 5ABDE 2CWRA 5M0TA 3QEGH 2R2EA 2XY2A 4XXDA 5CA6A 4DR6B 4JLRA 2FIRT 4M1CC 1MI5E 3GGWB 4O2BB 5JHDB 1C28A 5KMGA 5FXWA 5EEZA 2Z79A 1UQSA 3QG7L 4NPKA 2JD9A 3KQ4B 1FFTB 2HT3C 3WV0A 4Z7AA 1P4IH 3CFBB 4G80B 5EZOH 2WYTA 1C12B 4R4FH 4X9QA 1NMCC 3S3SA 3OF1A 1S5LZ 5BZWB 1EMTL 1JGUH 4LIUA 1TOXA 2YUWA 1IM3D 4WUUE 5D7LA 3UABA 3OKDB 1QR1B 1AO7D 1ZVSB 3TV3H 2GI0A 5JOFA 4UQ2B 3TGUH 2V33A 3GF6A 4XPFL 4NPJA 4ZAKA 4UT9H 1P84K 5E5MB 5TDOA 5BCAA 2IXIA 3ES6A 3FLTA 1SYVA 4BPZA 4YHHO 2ZXGA 4WF7A 2CDOA 4OULA 1LO5A 2CAKA 4YGVB 1HINH 1KCUH 3BRGC 4IBUA 1U8KA 1YY8A 3JTSB 4OB5L 5C0EA 2FDJA 3VGBA 2QQPA 5EBMB 1FDLH 3N41F 1IZJA 1N7ML 4MAYB 1F4MA 1VIWB 3QOPA 3C6LC 3C60C 1CAWB 1OP4A 2YARA 2Z1PA 1G7YA 3FRPA 5FBJA 1MS0A 2LJ2A 3ARDD 3F7YA 2HWC1 3UYRH 1Q90D 1VENA 4LVHC 3K6SB 1I8KB 4A4AA 2P8LA 3CXFA 1EV13 3GM8A 4PLKD 1OQXA 2X2UA 3T65A 4AGMA 2BFUS 4FQIH 4RESB 5KHGA 2FYYB 4Y4FA 3OJVC 3ZXJA 4N8VG 5LY2A 4Y4HA 1AF9A 3LB9A 5BZDA 5D5MF 3W39B 1MCSA 1K5MB 2YLKA 2VXRA 1IM3B 2EDXA 4IS6B 5H2BA 3SKOB 3C60A 4Q20A 1S5JA 1AO7B 1EHKB 3ESVF 5C0ND 4R97B 5LWBA 5F96L 1XGRA 4NX0A 1KB5L 5IEHA 5IHZB 2E0PA 3S3BB 4GBXB 4LORA 1JPSL 5IFPA 2D31B 2GW5A 3UTPE 4X8PA 1MNGA 2KT6A 2B1HH 4OKDA 4AVKA 1IGML 3VW3L 1T5WA 1R19A 4IE6A 1SA0A 3K91A 3U10A 4ZUSB 5JCTA 4XP5L 4J3OG 1BVZA 3O3AA 5C09E 4L1DA 4DVRL 3RX8A 3L9JT 3L5HA 4H7LA 4IBTA 4PJHB 2QQKL 4N24A 3RDIA 3VXRD 4HBCL 3FTXA 4XZ4A 5INCA 3ZKXB 4DKEL 4J8RB 3RYFA 2BHFA 5C0DB 1KCKA 4NIKB 4QTFA 5LDSA 2VE1A 3NCMA 1ENSA 1ZCRA 1JTZX 3WD5L 1JZ4A 3WEOA 5EUOA 1XQ4A 2Y4UA 3DRTA 4XJ9A 4M61B 3P32A 4GFXA 1IFHL 4ZMYA 4MZ2A 1FIGH 4Z78B 1AROP 4N2BA 5C0FB 2OX0A 2ZE6A 4GKJO 1NCQA 4P23C 1PY9A 5D6DA 5HHOE 1RUI2 4DYLA 1V7NH 2X5IA 3CBNA 4PIYA 3RGVA 3G5YA 4XQDA 1S7UA 2CQVA 3I75A 3NPSC 2C9UA 4XN8A 5D9SB 5FB8A 3F85A 1WAAE 2XAGA 2I7SA 3MI6A 1BGXL 1C16B 1TQWA 3IF1A 3JWDC 1MHPH 4FTVA 2B42B 3PABB 4JRYE 3KPMB 1YY9C 2XTJE 4FXLA 2NZ9C 3SZ6A 3SDCB 1OEZW 4TT3G 3IFOB 2OFQA 4W9CC 1YNTF 1PNKA 1RIUL 1MHCB 2IDUA 2K1MA 4XVTL 3VXRB 3HPJB 2V9UA 1MF2H 4HS3B 1YEGL 5JA8B 1NUNB 4NKDA 3JBG3 3ETEA 1OAJA 2KPWA 1JYVA 5GGSY 3CRCA 4JVWA 3TCLB 1G6VK 2R1WA 3FX7A 1I4FB 5SWZA 2IDSA 4E8CA 5EIBD 1QDCA 1WCQA 4JM2D 3MA9H 3UYJA 3GBML 4PJXE 3TO2A 2P5PA 35C8L 3IAYA 1JOYA 3DSFL 3ILEA 5GGUA 3WFBL 3GHPA 4MNGB 3THMH 1PPIA 3WF3A 2ZUUA 3HI1A 2XZQL 2YZ4A 4PLNA 1LXMA 2Y7QB 1B4JL 2QT6A 3LH2H 5KXCA 5AL0A 1NSNL 4AI9A 2BNRA 4UVAA 1BEYL 4E4DX 4FZEL 2CR3A 1RPQA 3ZFEC 3SPJA 1TJHL 2X4SA 3QNXB 1FC2D 1M7UA 2EXWC 3K04A 2RBLA 1PGW2 1JUFB 2GEEA 4A42A 4GLRH 4UNIA 1FO0B 5GW7A 3MIDA 2AEPH 2Q87A 4X8XA 1W8EA 4WSGA 3TWIA 4ATFA 4FA7B 3AM2A 1CFMA 3V8OA 4AIZB 2OZ6A 1H3PH 4ELKA 4GX1A 3ZFEA 5FLXN 4WFBV 3QIWC 5T5PA 2Q6AA 4A7UA 1E67A 4X5XB 4JM2B 1AQKL 4KKNA 4LCYA 4ISRA 1DVFA 1NLDL 1IC1A 3MCYA 4H33A 4FG4A 5GRYA 4BK4A 3MBED 1I31A 1A78A 3ZKYA 1E79G 4K07A 3L5IA 4PJAB 1HSBA 3UM7A 4JI4O 2UVFA 2BDNH 1NLRA 5FZ8A 4KTDH 3EIFA 3FO0L 4B0MB 5HPOA 4PIZA 1CE6B 4GIPD 4OY9A 4IEWA 1PDKB 2NQCA 2GTWA 1GM7A 4TV9B 5B2GB 4PDLA 1IQWH 5T5OA 5FRAA 5FYKE 1FLRL 3MHSC 4Y19E 3L5WB 1NYWA 4PI0A 1YEDB 4IEFA 1YO4A 4IOFC 4XRCA 5CD5D 1Q72H 3WY6A 5EWIH 3HJRA 3VD0A 3QUHA 3OYWB 4YZ1A 2N7GA 3GK8L 4AV4A 5AFBA 2IADB 2XWBA 3SJVE 3U9PH 1C5BH 2ZKOA 5DJAA 5DRZA 4R3SA 5DYOA 4NDMB 4CVXA 5D7IB 4NAOA 1E3ZA 1XZWA 4K9EC 1LP9F 3I02A 3MBEB 3ZHLA 1FP5A 3OY8A 4LUMA 1SF3A 4J3TA 5D1QC 5DSCA 1PYWB 4B41A 1NBQA 4LWSA 2E9IA 3WU1A 5KSBA 1P6FA 4TLGA 4ZFFB 2Z42A 1SHSA 3HKBA 1BT8A 1ZLEA 4H1LG 2FH6A 4ZIBA 2C3GA 2JRIA 2Y9RT 4NRZA 3RKDC 4F8AA 2R9AA 4FLWA 1W16A 3H0TB 1A7NL 1SUHA 1WF5A 4LARL 5FYUA 2NR6C 3ZQ9A 1A9BB 3TURA 3N9LA 5ALBH 1XNTA 1LDPL 4PLOB 1YMHA 2PTUA 3H3PL 1W2BU 3S35H 5C9AA 3WHE1 4QX7A 1RUML 2VMDA 3ARBC 3BQUB 3OBRA 3SDXB 2Q2EB 5B3SC 1VEOA 1XNQO 2EULA 1WFTA 1XIWD 3CH1A 4HK3J 1D5MB 3W11C 2RCVA 2Q2LA 1U41A 2QSCH 2AK1H 1N5YH 4M1GH 4PGEB 2C9VA 4FP3A 5D8AC 2HT4D 3ZFGC 4CDUC 4CBCA 3GSQB 1VB4A 5CMAA 2EDRA 3OBZA 4A3XA 2O5YH 3N91A 4JO3L 4RGAA 1GZPB 2RHEA 3D2UD 1CD0A 1CTMA 1WZAA 4GT0A 2PYFA 1P1ZA 2G5RA 4MXVE 2WKKA 3CVIL 1X5HA 1EH9A 1GYCA 2DQGH 5T5LA 1ZHBA 3QCWA 4LF6B 1Z3GL 3QFGA 4LO7A 3LEVH 1M1XB 4HDIA 3BTZA 1IFRA 3QIBD 5E1HB 4WFGE 2E27H 4PREB 1F2QA 3BCWA 2QPSA 1A34A 2QPDB 4EF3A 2KR2A 1U8JB 3FDWA 4N2GA 5JIDA 2EXSA 2OMZA 6CGTA 4M4RB 2BS71 5H37A 1IQDB 2RMNA 2HT2C 2YD4A 5F7AA 4Z7QE 1MWAA 3IJSB 4JGSA 4AYGA 3AL6A 4CH6A 1XIWB 1EAJA 3EW3B 3IDYC 4CP1A 2WCSA 5DD5H 1OT4A 2ARAA 2QPFA 4X0KB 4XIKA 1J0KA 5A70A 4WWKC 4TVPL 5C4WC 3CFUA 4FMKA 1TIUA 4MD5B 5TQ0L 3RL2A 1TUPA 1Y76A 3D2UB 2P6CA 1USZA 1EM1A 2G0KA 1I7FA 4D3CH 2WT1A 4G9FA 5C07A 4UILL 4GH7B 3IAPA 1G9ML 4TLUA 4ABQA 3W2DH 2XG4A 2UV3A 2ZCLL 2JB5L 3MLRH 4WWKA 4CSSA 4PWKA 3GWKC 2Y6FA 2E47A 4RMVA 5FZHA 5C4WA 3OHXC 3HKEA 2OIEA 4PJCA 2X1WL 3WQ7A 3TC9A 3CEWA 1XNRO 1EFRG 5DK2B 2IXKA 1BFSA 3AG2B 3NEOA 2AHZA 5TD4A 5KG9B 1RP3B 4FQCH 2XXMB 2B0SL 2UY8A 4X6EB 1NWPA 4F8PA 2VM4A 1UHVA 1MRDH 1JWUB 3OHXA 4UT6H 4KU1A 4C59B 1XNDA 3L2HA 3PHMA 3CQOA 1GRJA 1EN4A 1EJFA 5GGRA 3U6XS 3BKCH 1ZV5A 3KL5A 2YK1L 5IQ7L 1APNA 1JK9A 1H0BA 3OGGA 5EBMC 2FCBA 3LF7A 1FNLA 4MAYC 5JHMA 4HH9A 1OHZA 2HJLA 3B4NA 4HIEA 3RZWA 5CEZH 4QRFA 4PLJC 3FO2B 4JO1H 4HLEA 4KHXL 4B7LA 1GY2A 3N2KB 3DBSA 3GSRB 4KP4A 4K3JL 1UGKA 2D4FA 5DJ2A 5LO7A 3U4KA 4E41A 1EUUA 4M3KB 4PV8A 1N5AA 2EE2A 2K6ZA 4WK2B 5B1JC 1JK8B 4OCNC 1JHLH 4EN3D 1V6OA 1K5MC 3DTDA 1KJ3L 1B4RA 2EO7A 2FKXA 3JWOL 3IRCA 4J2QA 4X8NA 1DFXA 5LRRA 2GTQA 1ODMA 3L4WA 3R66A 5IT2L 1VZHA 3GO1L 2AJZB 3VDAA 3MV7A 2A83A 2DN7A 4DR5O 4GBXC 4JR9L 4BE3A 4J10A 2Y48A 4CCNA 4GT7A 3LVEA 3QQ4B 3O2WH 4LBNA 3ZTNH 3ALXA 5K5YA 2WNUA 2VDPB 5ACA3 1FFXB 1M2VB 4B3SO 2JDIG 4NFCA 3NK4A 3AZXA 5EBLC 2XKNA 5DS2A 5I1DA 3UNPA 3HC0B 5EIQA 5L73A 5IFJB 2QWNB 1H8SA 4NKIH 1YQ8A 3GCWA 5T1MB 1KKDA 2VRAA 3AXHA 3IC9A 32C2A 4LB8A 1QWUA 3QNEA 1KIPA 4PLKC 5IVFA 3IDXL 3SQOA 1ZLWK 4WHTB 3RWIB 1W8WA 3QA3A 4LPWA 1IEBB 1FPTL 1GZTA 2Z3FA 4EN3B 2N1KA 2Y0PA 3LRSA 5EBLA 3P3YA 1NZIA 4S0SD 4UQ9A 4QDQA 5ESAA 4GB32 4MQ7A 4FNRA 1UVQA 1IGJB 4K3UA 1AZNA 3D08A 2BNUA 3VRLF 4YWGL 5I5RA 5LYJB 5CSGA 2Y6LA 1IUZA 4MJ5B 4XXWC 2OR9H 2IXQB 4LE8A 3HBQA 4K7PX 3TCTA 4CN4A 3UL2A 2VOWA 3AYEA 1QQP2 1AOZA 4JFDD 3JD2A 5DJXB 4MMXC 3MBXH 4XX1E 5DUVA 5JR7B 2UU9O 3MRFB 1CFNB 1KJ2A 1VADA 1N34B 1AILA 1TJIL 3X12A 4CBPA 3SDCC 1E7VA 1O9VA 4XP6L 3T6XA 1RJLA 3VL8A 1PQZA 3AAZB 2EIDA 3FAWA 1X59A 4OZ4B 5AB2A 5CFHA 2P5EE 2DLFH 4MMXA 2A6YA 2MCMA 1IBFA 2QA4V 5IB1B 1WA4A 1UA6L 4FFFA 1JPEA 4XF1A 3ULUD 3BWUC 4MRCA 5DK0B 4KDVA 3SY0A 1IV8A 5HGHB 5FCUH 3BPLB 3P5BA 2DE0X 3SDCA 1AAJA 3MFAA 1AG6A 1GMGA 2ADJA 4DO2A 4MG2A 5E8EB 5I75B 3ATAA 4OXSA 4PTUB 4JDTH 2FR4A 3MRIB 3PIGA 4M1DL 4XN1A 3EG9B 1AZBA 4JFDB 1HRI1 2XIBA 2NW2B 1QH6A 3BN3B 1Y0LB 2O61A 4U3JB 2VISA 3ZCCA 4B3MO 2NY2D 5GZNA 3ACGA 3ABGA 1ZHKB 2PW1B 2IU0A 4JRWA 3WS6C 3RURA 4L4JA 4AQEB 5CU5A 1RUG3 5G05L 1PKQB 3EYQD 4WGWB 2WA4A 3QBQA 4PIXA 2E7LA 1WD9A 4CDXB 2A6IB 2BP0A 1VQ8V 4UMGA 1HCVA 1E1RG 2WZ8A 5IYDO 2H9GB 4GRMA 2A6DB 3I3EA 2NNUA 1COV1 3FT3B 3MFCA 4CCDA 2DYSB 3RX7A 4UYPA 1QSFD 3TFKC 4X66O 4L29A 3ZN0A 4HWNA 3X3FL 4HCFA 3AU1A 3WS6A 1TU2A 4RZKA 4JM2C 1UM4H 1K2DA 1Z0NA 4X0NA 1U93A 1MS5A 4XBMA 1M1KW 1LEKB 3WTUA 4YX2L 4CL7A 1SFNA 1H2SB 1AHWA 2J8UE 3D48R 3OAUH 5I17B 3PU3A 2YWYA 4JFQB 3H1LH 5T5NG 2QTSA 4OF3A 1JXGA 4RN5A 2PMWB 1A1MA 3Q6FA 2CKBA 4OZIE 1RD6A 1DCSA 3UYOD 5A7BA 4QXUL 2HWE1 2ZCEA 1KF9B 3ARWA 3NJHA 4P9WA 2NY2B 5ENWB 2YIAA 5AVQB 1WA1X 1IGCH 5C70A 5IJKC 2X6AA 3B7RL 4MSWB 2W92A 4X6CF 4AC4A 3L1OL 3NV2A 2WPGA 2Q6WB 3FQWB 1VP6A 2DWEB 1KTLB 1PD1A 4H5SA 4PJAA 3MICA 3VQVA 5FDYA 4K3DH 5K0UB 3CUPA 3WUWG 4OBSA 3OJMB 3RNSA 3RG0A 4KO6A 4LQFH 2WZ0A 5BNPC 3D5OF 3GMNB 1YJ9V 2ADFL 3HKCA 2J88H 3OMZA 2KKWA 1GZHA 1QSFB 1ASJ2 1ONQB 3NSCA 4BUQA 5HV4A 4HIQA 2ZQKA 3CZFA 4IL6Z 1FFRA 4JJHA 4TPRH 4OGAC 4AKQA 4DGVH 2YGOA 3P3SA 3HTLX 5DHVH 3P0GB 1PO21 2WZPP 1FAIH 3KXFA 3QHZL 3LQMA 3MBEC 1JCVA 4WTXA 5PAZA 4MVZA 2ITCA 4LT7A 1ULCA 5BUPA 3TO4D 3T2PA 2LFRA 3A6OA 5JHLA 2WAAA 3ETTA 2XFGB 4JFFD 1KS5A 3QEUA 2QGBA 3QUZD 3SH4A 2H3OA 3PRZA 4RBPK 1TEGA 3LZOA 3PYCA 4EKJA 1QJFA 1GK9A 3GALA 4XNMB 1G7LA 5CB4B 4FNPA 2X1QA 4DPCX 4DS0A 3H9HB 2NX5D 4W4NA 5E4AA 5FHBL 4UOW0 4YBQD 3P0VL 4HOZA 2EDNA 5AENA 3V0BB 4I02A 3FK3A 3NFSL 4OAWB 2VDKB 3O8XD 3SQOL 1FE8L 1OTTD 3BQUC 2XWRA 3O81A 3I4IA 2IWGB 4OCMC 4O4LA 4AJYV 2A3YA 2DVFA 4BHPA 3O0WA 5FXZA 4G2KA 4OLWH 4DK0A 4PTTB 1XZ0A 1ND0B 3SGKC 2EDJA 4AIEA 1BQZA 3R4DB 5LZ6A 3K4DA 1MI5D 2FX9L 5HGAB 5JW4N 5KBFA 5B38G 2LHAA 5AYUH 5A3OA 1RP8A 1QTSA 3WELA 4CVUA 3GUTB 2Q5BA 1XAKA 1GSMA 1ZS8A 4XB7A 1C5CH 1YC7A 4B53A 5SWQB 2YMXL 1NPNA 4X65O 1DBBH 2IG2H 1W0JG 2XRAH 1ZWIA 1XT5A 3BWSA 3PP4H 4J3OF 1QD0A 2ODMA 1W8UA 1T21B 3GTVA 1NR1A 2XVKA 3DWTA 1KIRB 3QUZB 5LXGH 4KNTA 3SGKA 1YYML 1Q56A 4HIJA 1A25A 3MC0A 5FW6A 4JRXA 5JDSB 2AZAA 2ZSVA 1LHUA 2ZX0A 3OMAB 1CEZA 1K9TA 1KJ2L 3VXNA 3AX4A 4O51B 3VFVB 5C7XL 1D5XA 3FU3A 3HNSL 4X20A 1IQDC 1JUIA 1MS3A 3FTUA 5J2TB 2VDRH 3O8XB 5D5ME 3FQTB 1XDTT 1D5AA 2AHYA 5CD3B 1XIWC 1TME2 2AXGB 2XQBH 4FPHA 4L3CA 1AI6A 5HBAA 2PYEA 1BYOA 3D25B 3ZSLA 3VH8A 1C8M2 1MI5B 2CO7A 4FI7A 1RUI3 3P73A 1DEDA 4AEIH 5FHAH 3HZVA 2R8SL 2MPAL 3DNKA 3EJUA 3B6SA 3IS1X 3B2PA 3MGTA 4MNQE 5DS1A 2X6VA 1KULA 3W82A 3OSDA 4JKKA 3S6CA 4Q74A 4AENA 4NP4L 3BPSA 3KJ6H 4N8PA 2XIDA 4PRPA 3IGKA 2BOBA 4XN7A 2FWOB 5TK2A 3OG4B 3GLEA 1CB4A 1XXDC 1JERA 2UY9A 1M6OB 3RVXD 4GIAA 2B7YA 3A4UA 5DA0B 4B3EA 4TRPH 5HY9B 3TX4A 5BXFA 1AOHA 3TYFA 5I30H 4H13B 1G7HA 5LW9A 3CSYA 3P11H 2BFVL 4L37A 4N0UA 5SX4H 2PXJA 3K06A 4PWIA 2C1OB 3PUQA 5J48A 5T3XD 3UTPD 4A6YH 2R49A 4Z82A 3V4LA 1F8VA 1M71B 4IEZA 4WCEV 2VE6A 3EYOA 3QUMH 1UZ0A 1OF3A 1SXBA 2P42B 4LZKA 3KPRE 5D71L 1JR9A 1ODNA 2D03H 2N4IA 1I3VA 1KFXL 3KPSE 5L2JB 3A4EA 4X6DF 1IURA 2GN7A 2NNCA 5C09D 2IAMB 5BVPL 3TWCL 1M93A 3G6DL 2JQAA 4AEEA 2EALA 2ZEXA 3VXME 1MUJA 3NH7L 5JORB 2N7BA 3GS0A 3TBWA 4UFKA 3DOIA 1JD7A 3QWQB 5GRJH 3UT5B 2X4TA 2XYCA 4OCRL 1LHNA 2CKBL 1L0NH 2W1SA 4JFOB 4L9LB 2VDQB 2H0VA 2FLMA 2R063 5DDJ1 3VFOB 3HUJA 5J6HA 2VD7A 2GBTA 1W2OA 3QQ9D 4PJIF 1JNNL 4U05A 1INEL 4YHKH 1E1QG 1BQLH 4JZJA 1IPKA 1D4VB 3PIJA 1H6XA 4TOYL 5FO8B 3MBWA 2GJPA 1QCEA 1IBGH 1UB5B 3G80A 1XI1A 4X8AA 1RULL 2VDOH 1JU3A 1T1WA 5FUCC 2CMRL 3QRBA 4UWDA 4QPGB 4OMCA 5C8CA 1YC8A 2LABA 3QYCA 5C09B 1HQWA 2F15A 3PWNA 2DQ3A 4HIIB 1JS4A 5EOCL 4LEXH 2Z92A 4GWJA 1SXSA 1PKXA 4PU2A 1R24A 3QGVA 1MG1A 5JHLL 2OAAA 2D6KA 3T0BA 1UJWB 1Y6XA 3VGIA 4XMPH 5CJXC 4IT5A 3EBIA 3K08A 1JV2B 4K5NA 4R9CA 2EAEA 2YD3A 5EO1A 4EN3C 1MS4A 4UU9B 4PGBA 2XGXA 5FZDA 1Q86W 2WNEA 3FQXA 4HONA 2AKRB 3CSBA 2OLDA 3NCEB 5E6UB 3B7SA 4WHYG 4Y5YB 3BHPA 3QDGA 5IG7A 5JMOC 2FVNA 3N40F 4EJ1C 5KS9A 3QWOB 4TUJA 5K4LA 1WA8B 2A75A 2ZX8A 1GHFH 1H8OA 3FFDA 4Q6IB 5CJXA 3WKMH 1CZ8H 1HC1A 4G83A 1T1XA 2ZE5A 3P4LA 4DEUA 3FW6A 3OMNB 1RV6X 2CH7B 2UXGA 3IRPX 4IGBD 4AMKH 1NG0A 2SBAA 4NRPA 4KG8A 2VM9A 2TSAA 4WDIB 2AYHA 4MHUA 2QADB 4S10A 5FYJD 1KXGA 3QC5X 2R69H 1P2CA 4W4OA 1ZSHA 3FT2A 4EQ3A 1ZLUH 2WZ5A 4HL0A 1DDHB 2JEMA 1NUFA 5JCOA 3F7VB 4UIMB 3K48A 4U36A 5DABA 5FXXA 4EQ2A 4W50A 5EIIB 1RTVA 1NBZB 2IVFC 4IRSD 2XV3A 2UUCO 1LGVA 1INQB 3CQQA 3QEHA 4EDWL 4PD4F 3Q3GB 2VG9A 1KEMH 4IU2B 3MLKA 5HVGB 2ZMKA 4AGRA 1DQLH 2HHHB 4PJXB 3BVNA 1SQ2N 3JZ7A 4YSTA 2ZHNA 4ARYA 1PIV1 1XMQO 3QFDA 3DA0A 3B7YA 3BPLC 4L4TA 5TH2A 4LHNA 3LKRB 4KKBD 2EQDA 3AK0A 4Y5SA 1HHHB 1YJDH 3ZYFA 5I75C 2J25A 4NRYB 4HKXB 3MJ8A 1UKGA 3GS4A 4IGBB 2R29H 3P9WB 1UUSA 2CIIA 1LP9E 3PL6D 1K9MW 3GVMA 1RU9H 3BPOB 2QR4A 2IDQA 4Y19D 2HEWF 2DBLH 4KPHH 3MLWL 2B8MA 4UMSA 4JE0A 4NHKA 3EJQA 5J3UA 3IU3B 3QULB 3QHTC 3N2GB 1FYTA 5I6OA 5E0QA 5EBWB 2AR6A 4JY5L 3BODA 3COOA 4GAYB 3FU7B 4UUJA 3W9DB 4IRSB 4BFKA 2VPVA 3ZVXA 2P1BA 4PWFA 3UG3A 4HOWA 4CDXC 2OYLA 4R2GD 3HKDA 3ME0A 4QKBA 4F37F 2XDHA 5T1LD 2CRIA 2DYSC 3ULUC 1RB8G 1OE3A 1BLIA 3ESUF 4OSUL 3IE4A 1GS8A 1WBXA 3VAEA 2VDMB 2DQEL 1TZGL 2X9XA 5I24A 3EDDA 5EDXA 1HW7A 1A6ZA 3MXWL 4U6XB 4NQSB 4BQ1A 3DV4A 5AD0A 1FMD1 5LB6A 2PYJA 1MFBL 3ULVH 1JNHB 1B35B 2X4UB 4Y2DD 1NQBA 3KPNA 2F54E 1FD9A 3ROOB 3U83A 2AXHA 1GMMA 5HI0A 4Y19B 3WKYA 1S7XA 2E53A 2J72A 2BTVC 4KHPB 1ZBE3 3JTTA 1NOLA 5AG8A 2B1AH 1DEEB 4ABWA 3MU3A 4XVSH 4MSWC 5D7SH 4PSPA 3WN5A 3O3EB 3VO0A 3X1EA 3EYQC 2JJWA 4WFAV 3HS8A 3CCUV 4HXAL 5KVDH 2CALA 1W6MB 4IKLA 5K0UC 1K73W 1BXUA 2X3CA 3SJVB 4EMZA 5LGHH 1BHGA 4K3EH 3GHNA 4ET7A 5T1LB 1J5HA 1L9NA 4CSZA 4Z7VA 4LF3B 2H6BA 5DEFA 4J7RA 1PS3A 2RR3A 5C0GB 3JARA 5H2FZ 3CCHA 1DQIA 2JDYA 4MB3A 3O2DA 4PY8J 1H3UA 3L4YA 2VH5L 1J1LA 4XZUA 1NGYA 4AYDC 3B2MA 4LF5B 1OGAE 1NL0H 2BWQA 4L3FA 4POUB 4Y2DB 3OE7G 5GGRY 3E22A 3KHOA 2NY5H 2R6QA 3AACA 3HHSB 1KV3A 2JXMB 2VWEE 4DV7O 2HWZL 4P4RB 1LK2B 5F1KC 3OEAA 1DBMH 2EDYA 3KAAA 4TUOA 3MV01 1W0VA 1MCRA 3UYPA 5CZVL 4B3RO 4DV1B 3EXJA 3CMOL 2WZR1 5BY5A 2G9KA 4BIZA 4YR6A 2JVDA 2GC4C 1AVBA 1NIAA 4CH4A 5DGRA 4DR7B 3MREA 4K8RD 3M3OA 3OJDB 1I7TB 2Z4QB 4DV4B 4ZPTA 1F1AA 1O3SA 3ABLB 4JI8O 1CVNA 4DFIA 2XAFA 3QO5A 4W6WB 5ILTH 2E7TA 3LKJA 4EI0A 5EPMA 5CYYA 3GC3A 4NWUL 1XSKA 4YDLB 2PHWA 5I26A 3W0WE 1TQCB 3WBDA 1QHQA 1HR0B 1VAHA 4UT7L 3IXAA 3GSVA 3B00A 4HK9A 2ZINA 4E9WA 1U8LA 3NJZA 2FT8A 3BU7A 1MZYA 2MOQA 3TO4C 4JREB 1UU5A 2VW4A 3IKCA 4UQEA 2C1PA 1GZQA 2WLIA 4AK2A 3WIIH 1FOD3 3MF6A 1LR5A 3O3DB 1BMV2 3QUZC 1YXBA 3LGRA 1W8FA 4QPWA 3FCSA 4RNRA 5J7MA 4UV9A 3HRZB 4JFYA 4PCYA 4Z7QB 3VFRB 1F42A 5FGSA 4FZ8L 1LAJA 4XNBA 3LNGA 1X36A 3P6BA 3NJNA 4YBQC 4K8RB 1F4XL 2ZXDA 4H26A 2VNVA 3O8XC 1OTTC 2A4ZA 2HBUA 1U91B 4RWYL 3K03A 1MNNA 2UXBB 1R75A 3AZVA 2BVPA 5DD1H 2VUAA 2W52A 4K7PY 3RWEA 1F4HA 4QD2A 5H4ZA 5I17A 5C0BA 4ATWA 1WEJH 1QLEL 1X5AA 3LQAH 4HS6B 1SFYA 5BOZG 1ZY9A 1YZZA 3VBRA 4NUGH 3FT4B 2DICA 2WW8A 1NH6A 1WCSA 1RZGB 4BH8A 4O9EA 2W5FA 2IALB 1DLHA 4L8BB 1I7UB 2GUYA 3VNZA 1RL3A 3ECVA 3KMHA 1ECYA 1Q8OA 3D0JA 3QC6X 4PG9A 4NWTL 1FXKA 1OOPC 2R30A 4NQQA 4U1LA 2AV7B 2DYPA 3ETQA 4TSCL 1BEV1 2FD8A 2UU8A 1SHXA 2H1XA 2IPUK 2KDGA 4LFHD 1LWJA 1EV2E 4PA3A 1PU0A 2PCXA 2WGNB 3BFWA 1X5MA 3MLXL 4XCCL 4CW1A 1N6QH 3P1IA 5A16A 2C4FT 2BC4B 4H13C 5FMOL 5IJDC 3VD1A 4P2RE 1SBEA 2QWPB 3FB5B 1H8HG 4WFFE 2BJML 3OZKA 4R7XA 1OOPA 1SPPA 2GNDA 4Z8FL 5DM6V 1R0AL 2J1TA 3NKGA 3E9UA 1ZT1A 1O6VA 3IDMA 4WUUA 1AXZA 5DWUL 4M5ZL 5CR8A 4NHCH 4F27A 1CD8A 3VRLE 2VLKA 4JG5A 1ORQC 2AEQH 5GGVH 4BFFA 4ARXA 4RH4A 1D6EB 2ZJSL 2IAMC 3VD4A 2BNMA 2XUEA 1OAXL 2VCOA 4QRSB 3LHPH 1DVZA 3IPFA 1YC61 3F5WB 1YLLA 4PWHA 4ZI7A 3HIFA 1Z5LA 1ICTA 1QFWM 4IEVA 4IMLA 4HUWB 1HZLA 4QQPA 1BIIA 4L9LC 4BSWA 5EZIH 2MNWA 4JHWL 4IGGA 3BWZA 3G7DA 3H1WA 3RVXC 1ORQA 1TG7A 5BNOB 3AVRA 2PHFA 1FNSL 4GZRB 1YCIA 4M7JL 4XP1L 2BNNA 4D0BA 3OWEA 4IV3B 1G1CA 3BUPA 4HEME 1Z9SB 4C8XA 5HYQB 1MS1A 1A6AB 4BWWA 4DY5A 5C0RL 1RFYA 4BQ3A 4WUKL 4QYAA 3WTSA 2I26N 1G9BA 4KI5D 4YSOA 1U95A 3WIAA 5T5NF 2DDQH 1EVTC 1WH0A 1HNWB 2A9ML 2W5PA 3EOAB 5K9OA 2ZGSA 3R4SA 4Y7OC 1DQ2A 1AR2A 1OXYA 1NDTA 3O2DL 1W9YA 1FV3A 2YPJA 1S7WA 1E3XA 4W9DC 4GS7B 4P5KB 3T2QA 3RKPA 4FQ1H 5ADOL 3D06A 2YKLH 4TN9A 2CPUA 5IIEB 2JJ1G 2GT9A 4KX7A 3K74B 4RQPB 5DEJA 2ICWA 2I9LA 1YUHB 2RS51 3TBCA 3KNBA 1PK6A 3OEHG 3QQ9C 5ACZA 2XN0A 5F7NC 1JHTA 2FIKA 3SCGA 3P4OA 2BGPA 1X7QA 3DGGB 1WT5C 4A2FA 2F93B 4K1ZA 4G8EA 3MAQA 3CXHK 3DVGA 2O6DA 4OCWH 2H3XC 3ETGA 5IJVA 1ASJ3 1Q1JL 4Q6IC 5BR8B 1A22B 3QCVL 1RGSA 3AMKA 3GBNH 5I73B 3U7YL 1WCBA 1R9FA 2KMWA 1QVFU 4ZUWB 2XTJC 4FXTA 2QADC 2JJVA 3OSKA 2VC9A 5BQ7A 1UXWA 1ZSDA 4TNVF 1MCFA 5HHOA 1PZ3A 3ZDYF 2DQTL 1YF2A 4OVUA 5MEQA 3D3VD 2RM22 1AR83 3INUL 5E8OA 1I53A 1Q8PA 3TNNA 3PAUA 3F7VC 1FORL 3GPEA 3MJ9H 4P07A 5K9KA 1NFIA 1YHQV 1RMFL 1ZANL 2FYUH 1WAAA 2J6WA 4LLUB 3JUUA 3MIGA 4RL7A 3C8KB 1DUZA 1A65A 3MDJA 2LLNA 4X6CE 4JRYA 4XYXA 3VKMA 4AYMC 1WZ1H 3E97A 3Q4HB 5CLZA 4J1UA 1LEGA 2F5AH 4OCYH 2LUWA 1IBMB 4GQQA 3QSKB 5HGBB 1G4YB 3EYFB 4YUEH 5GTIZ 3BVVA 1Q43A 1WICA 2V7HB 4HKOA 1FL5A 3FQUA 1KPVA 2QV2A 1U8QA 5DTFB 2MQCA 5IVOA 3ZYPA 4CDQB 2RS11 2ZP8A 1KXTB 5F2FA 2RR12 12E8L 4U7MA 1OE2A 1WWWX 2Z8SA 2QNKA 3DGEA 1E8YA 5CZXD 3HT2A 3BPOC 2PUQT 2PWHA 3MLUH 4RISH 5CXPA 3UPCA 4YXLL 2X53A 2BSSB 1K12A 1A6UH 3UJIH 3B9EA 3O5SA 1XCWA 4LT5A 5I19H 3D3VB 3QUKB 3RWCB 3VWJA 5DJ8A 4QWWC 3UGHA 4C83B 2PUSA 5AFAA 4NBYB 5AW8B 5FCCA 4IRSC 1AJQA 4NN5B 3REWB 4BCUA 2CXKA 1LJ7A 3QNFA 4LPXA 3FL7A 1X5LA 1FBIH 1AIFA 4NUJB 5JW3H 2Z0AA 2VW1A 4CKVX 4UI2A 4MADA 4WO0A 1S7QB 1TME3 3LDDA 2KYIA 4RAUB 1AFVL 4KKBC 2CA3A 3QRGH 4BSJA 3CHXA 1JJ2U 4GUNA 3L6FB 2X38A 4R5XA 5LG6A 4AI8A 1E5IA 4BHUA 1HJCA 1PM9A 2GSYA 5JXJA 2IJIA 5KVFH 3GF8A 3D8MA 4ANXA 1GBGA 3H4FA 2WTOA 1FL3A 1C5HA 2UY6B 4UINL 3QF7A 5IJRA 5FZ1A 1NXD1 5JLZA 4ZRGA 1F0LA 2NLRA 2WXMA 5HHQA 1Z32X 4WNSA 4CEYB 4E2SA 2D6MA 5JR1H 4CUGA 2ADGB 4U6VL 2C3XA 3L7EA 3IPVB 3FQ2A 3P1VA 4UQ3B 4DO6A 1WWYA 4LDLB 2IOMA 2EEDA 3NN8B 1N4CA 4XOGA 4G1EB 3WR0A 2LROA 2NCEA 2J21A 4F91B 3RB5A 1JX9A 3EH4B 3QDAA 4CP0A 4XNUL 4NIIA 4N8CL 2YQBA 3OAYH 2MOGA 4LIQL 1ZL8B 4P9ML 2AJYH 2OMYB 2Y1AA 2K46A 3EBRA 2B9UA 4AL8H 1MFAL 2WAQA 1HB2A 1QBML 2EKSB 5C08A 4OGXL 2YBPA 3HQRA 2LO1A 3U0TA 1UPGA 5GGTA 4Y2DC 3O1TA 1Y1UA 2FUQA 4GEIA 4IDZA 4KJQD 1QPXA 1M5IA 3BH8A 5IVCA 3T1CA 2ZUWA 1YQVL 3IMSA 1FH2A 1BF8A 5KHJA 4NYLA 4U1NB 2W65B 3VDCA 1XCTA 2YGVA 4Y2NA 3ILQC 4X7DC 1PO12 1MQ8A 1HDJA 3RB7A 4E4HA 1WFMA 2GNTA 5FWRA 1IL1A 4IKJA 4AE1A 3UG4A 1AHSA 3NV1A 2YIBD 1HVXA 2W68A 3NJLA 3PWJB 2XOMA 3A22A 3ABLC 2FD6H 3TXSA 3H42L 3N0PB 4KX8A 1Q0XL 3IMRA 5C6TL 4G8GE 4L8JA 4QT5B 4QRRA 5IB5A 4TYSA 2WDBA 2DKSA 2CD0A 3APDA 4R26L 5I1KL 5EXOA 2EILB 2LFGA 4TNWF 2JEXA 3BPCB 4J2XA 3GDCA 4YDLC 1ZHNA 1DGRN 4LBQA 3GXNA 1TQCC 1ONAA 2EVIA 1PL4A 1UD8A 4L48A 4U33A 3N41B 4QGNA 4GWNA 1NDMB 1J18A 2HFEA 2DJUA 3DMMD 5DLMH 4X6DE 1CAVB 1NCDL 2ZYRA 3GTTA 5ITBL 3BKMH 3QO1A 4JREC 1PK6B 3QQDA 3TBTA 1V00A 4FM0A 2HEYF 3PJLA 2ZZUT 3C90A 1E90A 1U21A 1X9LA 1KPRA 3HMWH 5FGRA 3TNMB 1XGPA 2JJSC 4Z7UB 2ZCKH 3UJTL 4HFUH 7FABH 2BCCH 4FLXA 3HRZC 4MD0B 2WZEA 1A4CA 4S1DC 2WOBA 4P5MB 4MCZA 5D5MB 3H9ZA 3EHKA 2NMOA 3ZE0F 1YEFL 3ABMB 3GKWH 2OJZH 4K8RC 3C7FA 2EUVA 1EERB 3FTVA 3IGUA 3JQOB 3RIAF 3T1MA 1BMGA 4WFGA 2ZUSA 4PJIE 3D09A 3QQXA 4JQVC 3KPSD 1D5RA 3QJHB 4GXVH 2FMDA 3AMPA 1Q8SA 4EEQA 1KELL 1FG2A 5CLWA 4LVEA 3B02A 2ZS6B 1LNQA 2H1PH 4N53C 1RFDL 1TMF1 1U8HA 3VXMD 1OAKL 3HAEB 3JV6B 4LL1A 4DPAX 4BUGA 3ABKB 3MRQB 2ZG1A 1MW3A 3E89A 2GN3A 2A06H 3GUFA 4XBPA 2GDFA 3DMMB 3MA7B 4IOSD 3R8QA 4ZHQA 5FUIA 1A9EB 1L3NA 1CXKA 1N0XL 2EADA 4GAFB 4LHUA 1JD9A 1DVFD 2F1BA 2OL3H 4WNQA 1VFUA 5DLLA 1LO4L 2J2ZB 2WS91 4N53A 1YUKB 4WFEA 3ZTJG 3N50A 1F11B 1KCVL 1A6TB 1Z9NA 1CN1A 1CT8A 2LW3A 5IVNA 2WB7A 1OTSD 5EU4A 3ECBB 2IOOA 1C1EL 4MXWA 3CSTA 4AEDC 3CSXA 3FB5C 3RWDA 3O1RA 2GC0A 3KPSB 4PRHE 1G9HA 2R0KL 1UH3A 1BBT1 1YAZA 2ED7A 3BUDA 1D5ZB 1TT6A 4M43L 5J3HD 1JFHA 4G6AC 5D55A 4ISQA 3VXMB 4PH8A 4QHLA 1WHPA 1TQVA 4U2ZA 3M3EA 4GMTL 4AY0A 1NGQL 2I2SA 1I75A 2PYLA 4AEDA 2QDNA 2ALWA 2V5SA 2WP3O 4JFEA 3F5WC 1SFHA 3K1KC 4KV5F 3HE6D 4NAJA 5FUPA 2C24A 1YNTB 2KA3A 2F4VO 2YHJA 3N9QA 4XBGA 5HYSG 3R0MA 2VDLL 4B9CA 1TO5A 4NQEE 4X4KA 1YFXA 1ILUA 4Z1PA 1XE8A 5FY0A 2ENRA 4IV3C 4DP4X 2EC9T 4H40A 2OX5B 2GAZA 5EZYA 1YNKL 4MDIB 4W9GC 5F7BA 1V0AA 2H32H 2VQ0A 2ZHKA 3BKYL 5E2TH 4TQEH 3AQZA 4NFBA 2PY5A 3ZX1A 5EZPA 2R072 2HLEA 4ZFOA 2B4CC 4HLZH 4I5BB 5B4MD 5T5FH 2EP6A 4Q27A 3CC5B 3NR7A 1LNUB 3WLBB 2Z3YA 3AQXA 4GW1B 4HZ1A 3KG5A 1RAMA 1FFOB 1P4LB 2B20A 1KMGA 4JCLA 1R5VA 4SBVA 1DJHA 3WDVA 4HGWB 1DQTA 4IV3A 1U8NA 4Q26A 4ES9A 3B93A 1OPGL 3POJA 1Q82W 1FJGB 4MS6A 4KXDA 5I8EA 3SE6A 1HOCB 1E9QB 4BZ4A 1P8JA 4I89A 4OT1H 1H8TB 4R7DB 5I1AA 5I6MA 4DEQA 2DM7A 1NC2A 3VXPA 1XYPA 2PHUA 4GS7C 4CU9A 5GGTL 3S37X 2GABA 3VX0A 1GP4A 3HE6B 4RFOL 4YZ3A 4YDIL 4GUQA 4BW5A 5DFWH 3T0XA 3IN9A 4RWUA 4AQYB 2EXYD 4RQPC 4Z8BA 3IMBA 5C3OA 4HIXH 2JKLA 1KXQA 3ZVVA 2CZNA 2JKTM 1O9ZA 3QIUA 4K9JA 1WMXA 1IAKA 2EEFA 1SVCP 4L3EE 1AYOA 3ILPB 5BUGA 1HEHC 4FOYA 1UQXA 3I50H 2X40A 4H88L 2P17A 3LAGA 2JB6A 3B5GA 5C3LD 2RJZA 3CVHH 4ATTA 2QZ3A 3NIDF 4ZU4A 5AVSB 4Q8KA 1SESA 1OD7A 3QYNA 1EGJA 2ZAIA 1J5OH 2DWDA 3DDFA 5I73C 5HDLA 1DE4A 3NJKA 5FPLA 2C3HA 1TVKA 1LEIB 2RD0A 3U4EB 4OHVA 3SDLA 2WFF2 1NCRA 2XIIA 3FUJA 3Q8AA 4GKYA 2OR8A 3HOBA 5E16A 1GOFA 4FFHA 3HN1A 1IBKO 5B22A 2RQEA 4R4BA 2GP3A 1YIJV 3A5VA 3BD3A 4MJ2A 3TA3D 1A6CA 2VAJA 3AWGA 3GFUA 1H6TA 1ZGLB 1IEAB 2QKSA 3HRPA 4QM8A 1HSAA 4GMSL 3MJ7A 2OTLV 3MR9A 4ODVL 5FGCE 5E6IC 3D1MC 3N04A 3MO1A 4V1PA 4IU3A 3LDBC 3ST7A 2ZM6B 3IMTA 4WU7A 1UZYA 2XI9A 3NFNB 5IR1A 4WTQA 4HJEA 1I1FB 2F0CA 4Y33A 3JV4A 2P5EA 1AP5A 2HKHL 3PAVA 4MA3B 2BP8B 3IFPB 4LTAA 1LP9B 5CLXA 1UD4A 5FYKU 5KBMA 4IBYA 5JHAA 1YCSA 1UU4A 1IAMA 4CDQC 3BKJH 3I2HA 5KX5B 1QYGL 5E6IA 2YOAA 1KCWA 2NNAA 2QBXA 3KBHE 2CPCA 5KVDE 3LDBA 4NYKA 1RVF1 4DV6B 4XXCA 4BUHA 1W6OA 5IGXH 1BIHA 1SDDB 2VT0A 4YFLF 2WK2A 3RT3C 4QM9A 3CMAV 5FPZA 3TA3B 5IOPB 1U8OA 2X2IA 5EFIA 1Q9WB 3KWVA 4EDXB 4YW3A 1N8OE 4Y9EA 3SPGA 1I94O 1SDYA 3BB6A 4XFGA 4LBEB 2RDRA 5JPNA 2ICWI 3P54A 1MQTB 4XXPA 4WVRA 3ZHKA 1RUAL 1OAYL 4JKLA 1GGIH 4B3TO 2ZSWA 4V2WA 3LN9A 4JI2O 4PGJA 1NCWL 1JRHH 5CBAB 4HNAB 1BQHB 1CFSB 2XA8L 4AGLA 4E41D 1D0GA 2L8AA 4MXWL 2PLV1 1NZRA 5A2FA 1C7SA 2FRGP 4AHCA 1GQHA 4GEJA 1N3NA 3BIBX 3U0WH 1NU1H 4LLDB 3IT8A 1T5XA 4DUZB 3V4VA 4NO0A 2Z5UA 4RAVB 4KQ7A 2NYZA 1J59A 5IWLC 1IE4A 5CZXC 5EO0B 2VR5A 3L3DB 1ID2A 3IFNL 4FBFA 2XKPA 3AL5A 4CZZA 2J8UA 5MENA 1GRWA 3SC7X 5ABJB 3OPWA 5ES4B 3T2TA 2AJXH 4HKBA 2O6CA 4CEYC 1YN7A 4OZIA 2YAOA 1H15A 1ZAGA 2CAVA 4G1MB 3QDJD 1A2YB 1JGVL 4GQPH 4DZBA 1IEHA 1M7IB 2UYBA 2QV4A 5D93B 3O6LH 4YSCA 3WFHA 4O2EA 2RCSH 1DYPA 1QX1A 2NYYD 4Z7WB 1FN4A 2GC7C 4Q0UA 1KC5L 1D9KB 4FHJA 2QCSB 1MY7A 3KS0J 3E8HA 3Q6GH 5DT1H 4HXBL 5FM5O 5AW3B 3TL5A 4IV1C 4ZFOL 3T8XB 2OCFD 3DUUA 3C9NA 2Y22A 1W2NA 2SODB 4MZRA 4DRXB 1SJMA 2IH8A 1HKLL 2NY6D 5CN2A 5I6NA 1YFYA 2BQPA 5AVVB 2X8KA 1DN2A 3VFPB 1CXFA 3VHNA 4E2LA 1HXMB 3LDKA 3INAA 3PUHA 4DUVA 1IRAY 2VSCA 3S37L 3SN6N 4HXCA 4AQZA 3EFDH 4TTGA 3KT7A 1DDLA 1HEZB 3WJJA 2VQEB 4ZPVA 4NWWA 5CKQA 4LSPL 4IV1A 2WVVB 4ZZFA 1O9HA 1ZBA1 1UYZA 3QPXL 3MCLL 3F58L 2C7UA 4NR1A 3SYCA 5C8JB 4ZOLB 3VBUC 1HKFA 3H9SA 4Z0BL 1SF9A 1YEWA 1N33B 3QDJB 4J5VA 4GSUA 2D9QB 2QR0B 4LKDA 2AI0L 1OAQH 1AP6A