4PI0A

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell) soaked in copper
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
390
structure length
390
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMVLSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLEHYGISRVYAWHLPWMAVGAAWIFFWFVRKGIITSYIRVAEGKADDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKENVTTELNGGVYKVPGRELTINVKVKNNTSQPLRLGEYTAAGLRFLNPDVFTTKPDFPDYLLADRGLSVDATPIAPGEAKEIVVKIQDARWDIERLSDLAYDTDSQIGGLLFFFSPDGKRYASEIGGPVIPKFVAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown peptide
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 94
structure length 390
sequence length 390
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4pi0A02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 4pi0A03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4pi0A01
4O65A 3RFRA 4PI0A 3CHXA 4PHZA 4PI2A 3RGBA 1YEWA
chains in the Genus database with same CATH superfamily
4ZRGA 2WZ0A 2IPKB 4NQVA 1A47A 1QBBA 3U79A 3FJSA 3WEOA 1HOEA 4LVNB 4KROC 3CVHA 3VMPA 2YIBD 4TVPE 4HSQA 2H3NA 2OJZH 4Y19D 3RS6A 3GK8L 3UTPE 3QUZA 4DP0X 2FCTA 1J58A 3SGJA 4YY3B 3POSA 5I82A 1KTLA 1T5WA 1TO4A 3EFDL 1VERA 5D1ZI 1SLAA 1HRI3 4JRFA 4A6YH 4CN6A 1JHKH 3P1IA 1Q8SA 3POWA 5LAXB 1HNWB 4EQ2A 2J8HA 2X8KA 1SXCA 3MACL 3OKMB 4I9XA 2ZGKA 3UADA 1AZZC 1CD1B 1XHZA 2IOMA 4U1JA 4JM4L 3ZXFA 2P5EE 1ULOA 5FMCA 4R7NA 4DK0A 1Y18A 3D33A 2VGLM 1UM5H 3BVOA 2AANA 2UUCB 1PAZA 2Y5QA 4QKXB 4AVAA 2F8OA 3DRQA 3MNDA 4ORGB 4N2MA 3QNYB 4NZJA 3KBEA 1QNWA 2DIAA 4J9ZB 2NY1C 2VCOA 3BSZA 3D0VB 4FADA 3AKQA 1A4JB 2YBSA 3MPPG 1NGQL 3BH4A 4H8WH 3N9MA 1MXGA 2Z31B 4HPOH 4D9QE 4J1WA 3VGIA 2DQHH 3I9GH 4F24A 5JW3H 3CD6V 5MI0C 1DGRA 2UVFA 1WHOA 3IGFA 1GRJA 1NL0H 1PY9A 3IJSA 4AIZB 5KVEH 2R6QA 3FPYA 5IGXH 1ZT4A 3D7PA 5EOCH 1H8SA 1I7RA 1NWPA 1JUHA 4QIWF 4Q0XL 2ZXGA 3D4CA 5CEZE 3O3EA 4DO4A 1NY71 5BUVA 4ZI7A 2AEPL 3S3XA 4U1IA 3WJLC 4Z7OB 3ZFFC 3CFTA 3MODL 4N8VA 5GRVK 1IAIH 4RGNB 3U4EB 4JRWA 5HYSA 1MZ5A 4I30A 1FJGB 2YA0A 3OUIA 2P49B 4N90E 5F1OB 2F4LA 4TS6A 4TOYH 2YPLE 2AKRB 2XV3A 1NPNA 2EDHA 3PGCB 2JJSC 4H13C 4XN1A 1X6LA 3D36A 2R2HA 4N2CA 5HGHA 1PZ8A 2X2HA 1S3KL 1G94A 3N44F 2ZKYA 4PJ6A 1TSRA 2XJVA 2QPUA 1XTLA 2YAQA 3F7YA 1LP9E 3V6OE 3WP5A 2PTMA 5H35B 1V6JA 2JK5B 5FFGA 1GGYA 3QEQA 3KPLB 2FO4A 1GS8A 2LAAA 4FFGA 1G7JA 1U93B 3L6FA 3X14B 2UWEF 1RURL 3D85D 3D2UA 4QRPB 4H88L 5ISZD 1I8AA 1YTFB 2MQ0A 3D3VE 2Z79A 5E79Z 3Q3GA 4CDGC 3V10A 4Y1TA 5AB1A 4Z7VE 2X5IB 1I8IB 1P7QA 4JRYB 2CHHA 1JWUB 4DCQB 1W2KT 4XVOA 1WLTA 1XBRA 1IIIA 1AVAA 4ZOEA 3H1HH 3P4NA 1E2WA 3MMEA 1XE8A 5AW2B 4CZSA 4Z7WA 1AKJD 3LKPA 5I0WA 3FOMA 1NA1A 3PL0A 1NCAL 4IW3A 4L4TB 3HG1A 1OLRA 1HK6A 2GMMA 3J4UH 2BSKB 3ABZA 3WIHA 2C9PA 2VWJA 2ZGNA 4PVNA 3FBYA 3C8DA 4Q9QL 1UZ6E 3Q6GH 2DN9A 2WN2A 1A6CA 1CZVA 2BRTA 4XJ8A 2ED6A 3X3GH 3FFDA 4AC2A 3WG2A 3JUYA 3N42F 3GBMH 3HBPA 4AHZA 1GRWA 2FCUA 4TNVK 3KPTA 5IBTL 2B77A 1JZEA 4BH8B 1CWVA 1R9FA 4FZ8H 5FXXA 3WP6A 4HLTA 2HWD1 5KR7A 1Y7VA 5GTHZ 4MVUA 1NCDH 3BW9A 1KJVB 4UNUA 5BZWA 4MHHG 3GKZA 4ZFZB 1D0GA 2O61B 2B8OT 2ESVD 2RS11 1PNMA 2E3CA 1IKFL 2YD7A 3QXWA 3S30A 2WAQA 1G84A 1IGIH 3ZN0A 4Y16D 5C4WB 4X65O 2CLVA 2YSTA 4U6HB 1H38A 2OWOA 4P9MH 5SV3A 3RZWA 5EQUA 4CCEA 1OZUA 3C5ZC 5C0FA 3HE7B 4RFNB 1DVFB 4LRIC 2CDOA 1Q43A 4C7UA 4RIRB 4CCLA 2Y4UA 4PRBB 4ES9A 5I1KL 1RZ8A 1U3HA 4L2YA 3SQOL 4TUYA 3SKNB 4AXWB 1G9NH 2Z91B 4GB9A 1UWEH 5LKNA 3OHXB 3GZPA 1MCJA 3HFML 4YL9A 3UKTA 2PW2B 4KKBD 4JQVA 4AM0Q 5J2TA 5ADPL 2VSDA 4I3RH 12E8L 1HAUA 2R7EA 4D69A 1MJUH 3A0OA 4W50A 5E1QA 1VF7A 3QPXL 1V7MH 2JELL 3BZ4B 4U6YB 5GGRA 3WTSA 5HI5D 3I6KB 4M4PA 3JUZA 4G7SB 4L4VB 4ZUTB 5H4ZA 1BCCH 3S8WA 1FNGA 1DLHB 4HW6A 4JGZA 4YHOH 5AYUL 5FK7A 4W6YB 1XOYA 3CMOL 1LEIA 4FL4C 1I1AA 2C7FA 3FB7C 3B9KB 5L7OC 1AD0B 3A7QA 1HOCA 5HI4C 2EDNA 1E50A 3OXRB 5J3HC 1HIXA 1K5QA 4D7TA 2OUHA 1DBKH 4TUJA 1XGUB 5CIPA 1KWGA 4XNMA 4D9LH 2J71A 1ACYH 5I1CL 2G9HB 5KBPA 4WM7C 3PJYA 3O6FC 2C4FT 4J42A 3B94A 1VZIA 3V4VA 3BODA 3DDFA 2VABB 3IS0X 3KPSA 1MHHA 3NOIA 3U83A 3VXUD 4G80A 1X82A 1SUHA 3WEZA 2YPDA 1OJHA 1RZ7H 4I2XB 5BRZE 2OCCB 1T1YB 1EBOA 1LO2H 2JEMA 1QKZH 5AWNL 3AMHA 4MW8A 1AH1A 5L19A 1F5WA 2DICA 4OZIF 2DVGA 1A22B 4IEWA 3LDDA 3GJFH 3ZDZB 3FAVA 3LRKA 1LP9A 5A2AA 1GH6A 4OCYH 3V6OA 1VMFA 1WWCA 4J5VA 1Y76A 1ZRRA 2KA3A 4WW2B 3PCYA 3UP6A 4QRTA 1M05B 2F5BL 2J5LB 4F8LA 1BQPA 3B8MA 3QWOA 4GAYA 4UM8B 2PAEA 1PV0A 3VFNB 2ZGTA 2HFGH 4CVZA 2ERJC 4GH4A 2EYRA 5KX5B 2DYSB 1TNNA 1U8PB 2Z6FA 2AVGA 4IHBA 4KG0A 4PBDA 3G08B 1EAPB 1ZTEA 4NENB 4QTFA 3SDAC 1E5YA 3BPLB 1MSDA 3C2AH 5F3IA 1UU5A 4YSDA 4ZW5A 4P57A 4PJ5B 3C5XA 2ZWLT 2ZXQA 1W0KG 3BPCA 3MLXL 4LU5H 1G8MA 4Y19B 1BA9A 3GZOA 1YO4A 3V0AA 4JDVA 1LMKA 1VACB 3QRGH 2E5LB 3WFCL 5IQ9B 1FFPB 4P5TD 4NKMB 5LG1A 5JHLA 1SZBA 4WV8A 3AQDA 2QGEA 2A0LC 5EBLA 3W11C 3BLPX 5LHGA 5C3TA 4D8OA 1KEGL 1CK0H 4DHLA 1A5FL 3ARPA 3G5VB 3JYBA 4M6NH 3LQAH 1JHTA 1JVLA 3SGKC 4R6UA 3UBGA 3QQXA 2HLFD 4X7CC 4HMCA 2P9RA 2XBO2 4YVSC 4A3XA 3QCVL 4OULA 2QTOA 1RHHA 5LGHL 1NAEA 1B2WL 3IT8D 1H2LA 3BIBX 3BIKB 5JH7B 1CR9H 3E8GA 1E90A 2H3NB 3QHTC 2HP8A 3LIZA 4GEIA 1UM6H 2YBGA 4NERA 3AU1A 1B6DA 4LVOC 2QGBA 2BNRE 2AK4A 1KTLB 3QORD 4LT7A 4E9TA 3NSTA 2GB2A 3HMWL 4W4NA 5DQ9B 2EALA 1VALA 1AR81 2GBUA 2W60B 2ORXA 3HI1A 4OZOA 1NH2D 4FLTA 2A9DA 2AJUL 2FHBA 2NR5A 4MTOA 2AK1L 5KVFE 5CZVL 4RH4A 1CB4A 1XEDA 4ADIA 4U1JB 5INCB 2VDRB 3L3OC 2VM3A 3CLEL 3ZHKA 3L45A 5IT2L 3DGTA 5FHBH 3VBUB 4ZTOH 1IGCH 1DBNA 5IUQA 5KYYA 5KBMA 1U42A 3ZEDA 3V5HB 4S0SD 3OM3B 5GHWL 1AOHA 2IXQA 5KA6A 1NC4D 2LT9A 5EP9A 5EO1A 2XX0A 3WHXB 4IE4A 1BMV1 4H5SA 3AYEA 2A83B 3P3TA 4OKVA 4LF7B 5DRXA 3P3RA 4EZLA 5LWYL 3VGAB 2B8MA 2Q30A 4IBTA 3OBRA 5IFHL 2DE0X 2W92A 2W6IG 3B6SA 4QAWA 4GXLA 5C7XH 2VOTA 2XQBL 1OAXH 3MROA 1OSYA 4ZPTB 2AMGA 3A3YB 3D6EA 5IJ9B 5C70A 3JBG2 1FZKA 5KVDE 2JKTM 1LK3H 5FZGA 1O0VA 1UWGH 4ENED 4XQ4A 2QJ1A 3M8LA 3ARFC 3Q2CA 4KK9D 3HG4A 3I6SA 3CAFA 4BCZA 4U1IB 1E1RG 2Y69B 3QEGL 3DVNA 4LQFL 5KANI 3AM8C 4N8VB 1JMZA 4ODHH 1JFQL 2XVBA 1ENRA 2N1KA 4G9SB 1GSKA 3GSXB 2NLJC 2WQVA 4TUKL 5ISZB 1GTNA 2R0FA 4TV9A 5CZXD 4F33A 4B50A 1CVSC 4ZZ8A 2D31A 2PABA 5BNOB 5BJTB 1HCYA 1HNFA 2XN1A 3F83A 5BRZA 3TZVA 3VCLA 5I75C 1CGWA 1ROCA 2ICWJ 2VR7A 4XP4L 3BKYH 3BLKA 2FDGA 4F91B 3X1BA 1JNNL 4AENB 1OEZW 4NVPA 4XMUA 3WXVL 1LENA 1TEIA 3F7YB 3GMQB 3L4TA 4HKOA 3O8XC 3H3BC 4TV8B 1LOGA 3QUMA 1P4IL 4MQSB 2QV2A 5J6GB 3O0LA 5MENE 2IH8A 3U10A 3WLBB 1UZ8A 4PRHE 1LE9B 1G7JB 4FPJA 1BVKB 4X7DC 5EIIB 3TBSB 4F2FA 2IH3C 2DQ0A 1OK0A 1R6NA 2HVJA 4X5WA 3CLFH 4MTXA 4UOW1 4NTYA 3VYOA 1YXWA 5CG8A 3UJOA 5L88L 2Q9LA 1FYHB 2ZSWA 1INQA 4YPJA 3WOVA 5I1GL 2XJTA 2BFVH 3GBNH 1QUPA 1ZVSA 1N33O 1R0AH 1W9WA 1YY9C 2P5PA 4YK4B 1AXZA 4AILC 4DR6O 2EKSA 5G2NA 4OI2A 4CW1B 2FIKA 4LPVA 4OTXL 2R15A 1PP9H 1UCBH 5DEZA 2ZR3A 2ESVB 1HFUA 1L8DA 2C5DC 1VAHA 2UY6A 1UOBA 5ACA2 1JXJA 4KKCD 3UTTE 3H54A 2Y5TA 5BNNB 3MRMA 5IG7B 3LSDA 4ODVH 3SE4A 1LOCA 1ONQA 2OZ4L 5E4OA 4KVNL 4PTUB 4FD0A 2F23A 1YUHB 4CL7A 1FPN1 3NIFE 5K0UA 1TMF3 1ZEAL 2OZ6A 5AFBA 4N2AA 3WHTA 3VRIA 1BMFG 2ZDIA 4P3WA 2P8MA 2HVKB 3UJTL 2YROA 2LGNA 3E22A 1NIEA 3V4PA 1DVYA 1GZHC 1RB8G 5F5CA 3W0WD 1UB6A 3W57A 3T1HO 4ZO8A 5EH1A 3VYNA 4EN3D 1JGLL 3GLEA 5D1ZA 3R8QA 2HKHL 5I8KL 3EH5B 1F31A 5EDXA 4OW6A 2EYSB 3QUKB 4ZODA 2CLVB 1JPSH 5BXFB 5IBLD 4X6FA 2R4SH 4OJYA 4BZ1H 1NCIA 4NWUH 5IJDC 1C5HA 1EV12 5B3SB 1SHXA 2V0AA 3LRHA 2QQNL 1Z5YD 5CHNA 5C0FB 4EIUA 3K9AA 3U6RA 1PKQE 3FTUA 1QWUA 2GHWB 1J5CA 1RZ8B 4LO8A 3UKVA 5FGRA 3L1OH 3WHE0 4W6WB 1MS0A 2BP8A 4KUZH 4MA8L 4POUB 2HTLC 5ABAA 3AWGA 2I9LB 4UT6L 3WNOA 5SX5K 4C83B 5AFAA 4ZFOB 5JIAA 5KG9B 3N3EA 3N7JA 2DLHA 1WNSA 3WFDL 3SCGA 4FKHA 1XB3A 4RCAA 2XYBA 4YLZA 4J3OC 5E08L 1ND3B 3VXUB 43CAB 2RR11 4HVQA 1K5MA 1NE6A 2ZIDA 2UWBA 4WHCA 1GAXA 2R073 5I9QC 5C3OA 1LEIB 2X6UA 1I1AB 2DJ4A 2P7TB 3B2EE 3KYKL 4K3EL 1C5DB 4OIFA 5IROD 1N1YA 1PL3A 4APQD 4A45A 4UTCA 1AO7A 1P7KB 2HWF1 5FY7A 1QSEE 2C7UA 3RNKA 4HCRA 4HVOA 3FE5A 4TF4A 4GFTB 4XCFH 3LKOA 3P4MA 4E27A 4XNMB 1JPTH 1LLAA 2WLJA 3ZDXE 1UXWB 3BKJH 4MBOA 3S0PA 4I88A 3M7MX 1YJ9V 1JZHA 3OYWA 1JMXA 3HNTH 5TQ0L 2Q3ZA 1OHFA 1YN6B 2VUAA 3I50H 3QVNA 4OR1A 5EO0A 3RWDA 2HWB1 3GSWB 1G1XB 5GLUA 4LSTH 2FX9L 1IO4C 2XFGB 3WY4A 2GH8A 2J12B 2AP2A 5FCUL 4I7ZC 4Y4KC 1ZXQA 3ZE1B 1MI5A 4R9AA 2OIIA 3FQ4A 2CTQA 2QL1A 2BTVC 4X4ME 2RE9A 1XCQA 3A24A 1W80A 5JJJB 1IL1A 3GMRA 2DQDL 2EE6A 4P5TB 4BFKA 5CB4B 4QRTB 5MENA 1MLBA 3PJSB 4JHAL 1Z9PA 4FPGA 4ZX4A 4PRHA 4WK2B 1NGWB 2HH0L 3BKZA 1YJDH 1QHPA 4FQ1H 4CC5A 3AYDA 2DFBA 2QSCL 4CVZB 2Q1ZB 4LO4B 2EYRB 2VLMD 2VXRA 2ENYA 4BZ2A 4YSFA 3GWKC 4UV4H 3MJ9H 4CS3A 5FPXA 2EYTB 1KU9A 2J1ZA 1W72H 5L9DL 3KZ4C 3TB0A 4AVSA 1FGVH 4HUXA 5KAQG 2CAVA 3JWNG 4MB3A 1T6WA 3VVVA 1UZYA 5JOYA 2D3VA 1AD9B 3ULVF 1DBML 4PJHF 1DQ5A 2Q0AA 4L87A 4GRLD 3MCG1 4NDMA 4UAOB 4Y1SA 3U2SB 2W87A 3JAKB 4JGSA 4ZW7A 3UAAA 3NKGA 3BZFA 1AG6A 3QORB 2CUMA 3KE0A 5EBLB 1V55B 2CBPA 3LB6D 3OEEG 3R7RA 1I9RH 4TNWK 2IPUG 4QOKD 1QLNA 4IV1A 4PLMA 2WAOA 2DCTA 3CZLA 5D6DA 3ETPA 2PW1A 2E6VA 2X3CA 1UPSA 2WO4A 4PUBH 2VU9A 4JGYC 1F45A 4LAJH 2CRMA 1I7ZB 4ATWA 1N2RA 3DX6B 4FI8A 1OD9A 1WK0A 1OXCA 2VQAA 1Z66A 1NC4B 2F17A 2E6QA 4P9XA 2XV0A 3UKMA 4FQXA 2AACA 3QUYC 3U1SL 4ELDA 2R1DA 2AK4B 2ZGOA 2RDRA 3ZYZA 4AVIA 3US1A 3I2HA 3W58A 1HDKA 4PJBF 2Q68A 2D3RA 2V7NA 1RUE2 4PB9L 2OMNA 2UYBA 1AI4A 3HI1B 5GIRA 3WFBL 2JTDA 3CVHL 1Q0YH 3IXAB 3C6LC 2PYFA 1NJ9B 4ZOAA 2EH8H 1O6VA 4I0XA 1E4XI 3BP5A 4BINA 3VBFA 4HJGA 4K21A 2WGNB 4OZXA 1FZOB 1YNKH 3THMH 4O2BB 2VISB 4H0HB 2VM9A 4RS5C 5KYYB 2XQYK 2HG5A 3ILRA 1UU4A 5IW3A 3UJIH 5C1MB 2ITCA 3QXVA 2WYHA 4LPXA 2V9QA 5DEGA 1AJOA 2JDKA 1A6ZB 4MS2A 4JI7B 2QDVA 3MV8D 7PAZA 1COV1 1W8UA 2I85A 1NA8A 2RR3A 2O0OA 2YMZA 1AYM3 1X9TA 4JGNA 2EZ0D 2WZAA 1NBVL 2AQTA 3EDEA 3ZL4L 3BWAA 4AGNA 5JDSB 2LS6A 3MROB 1E8ZA 4YXKL 1Z9LA 4KVCH 4ZO9A 1T7VA 4PA4A 4PP1C 1URXA 5IJRA 2PLV3 3ULSB 2LAGB 4KNCA 5LA6B 2ZGMA 2RDSA 3ASIA 3RGVA 1ULPA 1JWSA 2X4PB 1FFNB 1QSEA 3P40A 1NGYA 1P4UA 3QZLA 4P57B 3V4LA 4HP5A 3VD4A 4D6SA 5FGCE 5CFAA 1CWPA 4GRWF 2Z5UA 4PJIB 3UESA 1P4LA 1U5ZA 1FH2A 1AHMA 3ZJAA 3K6SA 4U3FH 3NCBB 3M17B 5GRJL 4TV9B 2JIXA 3TV3H 2UZYA 3GBWA 3H9YA 1LGCA 2PWEA 2Y1VA 1MIEL 2D31B 3VD1A 3CPWU 2DJMA 4Z7UE 1NC2A 4CDXA 3TZVB 3VCLB 1IC5L 1M4WA 4CU7A 1C5CH 4QD2E 3V4UL 3G6DH 1NBZA 3AMMA 5KMGA 2OQJA 3USUA 1YQ8A 1MFBH 3FW6A 1PU0A 1BPLB 3VXME 2BVUA 1MCIA 1SXNA 5C9JB 1RUJ3 2B46X 4X4MA 3ABTA 1KYOK 1F0LA 4G7QB 3DGCR 4WHTB 2VOXA 3H3LA 4GKKO 1HNZO 1XQ4A 5LA0A 4RFOL 5C92A 3THDA 2HVJB 2UXGA 4Q6YA 1HQWA 4NOBA 3H1WA 4Q14A 4ERSH 2NY3D 4XX1E 3S3PA 4HZ3A 1R5IA 3TIDB 3MOBH 3OPWA 1NEUA 3MLRH 4LEXL 4XAWH 1QXPA 4P9HC 2OMBA 1S7XA 1JK8A 1T1XB 1ANUA 3KL5A 2FIKB 3MKGA 4RMSA 2CR6A 5JW5B 4FZ0A 4G70B 1KSRA 4MTFA 4DR7B 3SE9L 2IZWA 4AQYO 4KX8A 3IE4A 4ZKTB 5DC9B 2E7LA 3TT1L 2Y5TB 3MRMB 3L3IA 3AGWA 5E56A 4ZMNA 2G2PA 2KL6A 4X2UA 5KJRL 1HB2A 3HT1A 4ZXBD 4HS6B 5JIQA 2X1OA 4XO3A 4BQ8A 2LTNA 1J9TA 3MFFA 2CTRA 4WUKL 3JV0A 2X2IA 2E32A 5LVEA 2UY7A 2OTLV 3ARGC 4OCRH 5HHNA 2Y1YA 1R092 1TZGH 3IB4A 3AG1C 1CFQA 4P2OD 1M4UA 3WEXA 3E35A 4Q4V1 3GI8L 1ZBA3 4LLUA 1AE6H 2PYEE 4TSCH 2A6KA 4PRIE 4ONOA 3MO1B 3M8AA 3SJBC 3IN0A 1RFDH 2ZF8A 2OYLA 3UH8A 2WNUC 3E8VA 4AGRA 1S5HB 3H8XA 5A6XA 2VR8A 5EYYA 4K4KA 5CA1A 5HDWA 3U6RB 4IGBA 3SE3A 1UIJA 3GCWA 2Y64A 3QJRB 5E1HB 2OQ6A 1IARB 5E5MA 5GQBA 4P9YA 2EVFA 5FMBA 1YC8A 5FYJL 1R3LA 2WB1A 4DW2L 1A21A 3D0LB 1PNCA 3S88L 1AL22 4J6GA 4JKNA 3QDJA 3AUWB 4RDQG 3PL6B 1PL0A 2MSPA 4PJDF 1OAZL 3GIZH 2PWHA 5AENA 2NXYC 1VQKV 3OFNG 4YE4H 1TTGA 2PPAA 1DQJA 2WVVB 3B9AA 5DG2A 1LILA 5C07A 2P5WB 4ARXA 2BOCA 3C7HA 4LBEA 2WSVA 4TWTA 1SXZA 1Q4NX 1UA6L 4ZUUA 1JBJA 4TQEH 3KF5A 2G9GA 1H0DA 5KSBF 4OJDH 4XGZB 2M7WA 4W9HC 3V0HA 3P54A 3LKOB 2VDLB 2FDBP 3B8NA 4F7EB 2AZ2A 1N59B 4I0KA 1F4HA 5K9OB 3OYWB 1U95A 5F6LB 1NSNH 1MZEA 1TJHH 4NRZA 5CEZL 4Z95H 1GSMA 3FTYA 2Z4TA 3I2IA 1CZ8H 1OALA 1YEGL 3HS0B 3U9PH 5LK7B 3WGVB 5GKAC 3N41B 4R7VA 5E1AB 1AR62 4JFHD 4Q26A 4UUJB 4QD2A 4NTWA 4LFBB 1A6PA 2A74C 1MI5B 2CHDA 2VL5B 5DURB 4PRNA 3LH2L 4UDTA 4Q2FA 1I9JH 2WXNA 5A7PA 2NZIA 4FJYA 4GRLB 1SLLA 4JKKA 1V8HA 3GMRB 1IL1B 5LXGL 4BQYA 2ZWYA 3BFWA 3E38A 1JRHH 4W65A 1B06A 4I4TA 4IGGA 5ESQA 5KAFZ 5CA0A 1OZTG 3C8KA 3QCWA 3IC9A 3NTCH 4DV7O 1G6RL 4AHCA 3P6BA 4CXWA 4ZONA 4F7ZA 4MMZA 5JPNA 3KCCA 4JFEE 4JI4B 1ZLVH 1J1TA 2XKUA 3V6BR 2Y6HA 3E1F1 2HFEA 4X62B 4DK1A 2A4ZA 2COQA 3EF4A 1MMMA 1X5IA 4N0RA 5GLWA 1I31A 3CK0L 1F3DH 3MLVH 1JXFA 2B9ZA 2HRPH 3RWHB 3ELAT 5SX4H 2PLTA 3FH5A 3FTXA 4J25A 4B1MA 2BWAA 1ENQA 4DGIL 2DQ6A 3RL1B 4X5XA 3BCFA 4O4YL 5FK9A 1QRKA 2J57A 5K1JA 1UQXA 1LO4H 1YFXA 4NIGA 3QJVB 3ROOA 1PO11 3WW3A 1MVUA 4MS8D 5D7IE 5PAZA 4DO5A 1QNYA 1W2NA 1HQNA 1ND2C 1C12A 5JHLL 2XZQH 5BO1L 3MW2A 3QARA 5LMNO 1AR1D 4IRJA 1SZXA 2ZX7A 4N0UE 4YSQA 5HV4A 4CILA 4PD4F 3A4FA 5DC4B 5C5UA 3U4XA 1BQLL 4ZK8A 3N04A 4WU5B 4JDTH 2J1VA 1RJYA 1R5WA 1PD3A 3ESVF 3HRZC 5HDOA 2RDNA 3WD5A 1ADWA 4P2YA 2FWOA 5KXDA 3THCA 1NGXA 2WUBH 4Z9KB 1E9PB 3SPGA 2X6VA 2YZ1A 4DIXA 1WW6A 2WS92 4PRIA 1UEMA 3OJVC 5GIRB 2HRHA 1GV9A 3NDZE 2WO3B 4Y5YA 2QKSA 1A1OB 1KLUA 2B08A 4WF7A 3CF6E 3K2UL 5FOJB 5JSPA 1FFOB 1NFIB 4XOGA 1DJHA 3BP5B 2C3HA 4TN7A 1H6TA 2FL5B 2QVMA 2MEJB 3VXSE 3I75A 3CCVV 3QHZH 3CQOA 4GH4C 3HJ0A 4RQPC 1S77D 2GBTA 2ICCA 4P2QE 2AJYH 3RTQA 4DRRA 5CD3B 2NXZD 1Z7S1 1YSOA 2GJZA 4JM2D 3SZ6A 5FXVA 4LLYA 5I28A 4PCKA 4PWFA 2AMUA 3TBYB 5K9QI 3AS0A 3OG6B 5C9AA 4RGKA 1J8RA 2WZPP 2IOIA 1GGIL 4NQEE 5FR3A 5LG6A 2RM22 4QHLA 2HN7B 4M56A 1AQ8A 2AQ2A 3EJRA 4J1XA 3VFOB 3CPLB 3K46A 2OJEA 3VGHA 1OH4A 4KI5D 4NPLA 3BUQA 1CU4H 4HUNB 5DQJA 3VAEA 2Q6AA 3STBA 2ODIA 4DR2O 1JWSB 4JO5A 3MRIA 3T6VA 3PIQA 3A0RA 1NGYB 4DNLA 5KYXA 4D6QA 4ACPA 4XNUL 1DVXA 3WS6C 3PMEA 3PUSA 2FSEA 1JPFB 3LY6A 3FL7A 1XGTA 4JZNA 2F0CA 2H8PA 4F9PA 4RMQA 3H1KH 4G8EA 3C08H 4FG2A 4OIIL 4WO4D 5BOZG 3S5QA 2I7SA 1AY1H 3RKPA 4ADJA 3OB0H 4ADGA 3K6SB 1XL4A 1EAH3 1KFUL 1UYWH 1XH0A 1R64A 2C9RA 4RRPG 2GK0B 2NY3B 1YEEH 2J1SA 3H2QA 3H8RA 1ZA3A 3IFNH 4Z0BL 1NBZB 4P2AA 4WFAV 5MEOA 1NKOA 4OLUL 3KXFD 2OQJB 3POCA 1R17A 5D1XE 3VWKD 1X3DA 3QJUB 2V2WB 5IB5A 5BQDA 2YMOA 1WW7A 2A75A 3C6SA 3QZNA 4WTZA 2JKBA 3VBOC 5BNPB 4AFBA 2B9AA 2EXTA 1JD7A 1OK8A 4CC4C 1I3GL 1UYYA 3LAFA 5IK3B 2VKWA 4HIIA 1PMYA 5A2FA 2I60L 1BD2E 2K8QA 3QUML 4AYGA 1IVLA 3CHXA 4WAFA 2JGUA 2YD3A 3EO0B 2YBPA 1MOEA 2BP0B 4N0YH 4PCYA 3ZSMA 3CIQA 1MG1A 5GGTA 4EN6B 2X70A 3DK2A 1S7XB 1J1PL 1OAKH 4UMGA 2CM6A 3J80N 4MCZB 2Q6WB 3VFVB 5BVPH 3HVNA 4GALA 2I9TA 2BERA 3WXWL 1TYJA 3IMBA 3EYSH 4FNRA 1KEGH 2WWKT 5I1AA 2ZNXA 1NQDA 2D6MA 5DO2D 2P8PA 3D4GA 5FZOB 4N2FA 4O51A 3FQTB 1PYWB 2FBRA 3U36A 4H44C 3B8SA 3LMJH 2PI5A 4B4QA 4PPTA 5KAQF 1VRSA 4LOUC 1PLCA 1FNSL 2OK0H 1IGOA 1T03H 5LBGA 5HHQB 1YRZA 4MJJA 4U6XB 3AXEA 4UVBA 3MFFB 3IMRA 5KYNA 1PX4A 1ZDQA 1FO0B 4QCIA 3IJEA 5BV7L 4ZOBA 4N2OA 4V1DE 3CC1A 5FO8A 2ILLA 1NUNB 3L3HB 2A9HA 1S7TA 2GMEA 3V0FA 4OQTA 5E6IA 3E8HA 1VQ5V 2YWZA 1NAMA 3MKKA 4LLUB 3S35H 3AK1A 2NX5A 3R06A 4F7TB 3VDDB 3VHOA 4HHWA 3H42B 1WFIA 2H47C 3VN4A 3RZZA 3V4PL 4AJWA 2CRIA 1QY4A 3TN0D 3OLIA 4JQIH 2XG3A 3H1YA 5H5NA 4XXWA 2AR6A 2YUXA 5IB2A 2DIBA 3EUUA 3LJ3A 3LVTA 4XC3H 3TV8A 4KGLA 3VXSA 3B2MA 2WKLA 1SY6H 1AJQA 1A9VA 2NT0A 5GM0A 5AW6B 5F3GA 5IEHB 3QJHA 1BOGA 4E5XB 1YEDA 4JPRA 5JZ7C 5KVFL 3G6AB 3NG5A 3KMDA 1WUVA 3M7FB 3UFIA 3PMSA 1VGKA 3T6QC 4W81A 3JV4B 5F7BA 5TGBB 5I30L 5D70H 1SLTA 4ARYA 2WWSA 4LLMB 2Y60A 4Q4Y1 4UNTA 1F02I 2HHHB 2WNXA 3LS4H 4NQEA 4JI2O 3O11B 4G9DA 4KRPC 4NP9A 4XFBA 1SM3L 2EUZA 4YM1A 1AI7A 2BOCB 1JG9A 2D4FA 4PJAF 5FQ0A 4NT6A 1RUQH 4NROA 3PDOA 1MS4A 1ZSDA 1AI1L 2Y06L 3E6FA 4X4XB 3LZRA 1XNKA 2Y6GA 1VLNA 4Q0PA 3MXWL 5E4EC 5A3OA 4YJZL 4FMVA 4CKVX 4H26A 5E88A 2HKOA 3SCMA 1BLIA 2GDFA 4AQAA 1TEYA 5KVDL 3L9BA 1AOZA 4LMQI 1J1XH 1U95B 5B8CB 1YN7A 1UMIA 3PWVA 5TPWH 2NMSA 2UXCB 1I8LA 3X1NA 4ZFFB 3P1VA 2FBJH 1HXS3 2WP3T 2VZUA 1BFOA 3QUZC 4Y89A 2L4OA 3SQBB 7CGTA 4MXWH 4PN6A 3CCSV 1WA1X 2HJLB 4JBSA 5I0VA 4RGNE 2GG1A 4JLRA 5D1XA 2AEZA 3MJ6A 4U2AA 4XE9A 4OCSH 4HS8H 2XLGA 3CRRA 3ZSSA 1ID5I 3OUJA 3ESNA 4WLCA 4WFGD 3T6WA 4YHZH 4HSAC 1A8MA 1D5NA 2ARAA 4QB1A 1GK9A 3S37H 4M4RA 4XOAA 1B3IA 1N34O 1BECA 2AQRA 2WYSA 4JQTA 5FLHA 4C0BA 1S0IA 1LECA 3V0VA 3BRCA 3TETA 3RPKA 4ZD3H 4LFAO 3FN9A 1ND0A 1SZNA 4MMZB 4ETQA 3QYNA 4AVJA 3G04A 4DW0A 1V9U3 1BD2A 2IAND 1ZSHA 5KYUA 4EWDA 5TF1L 4YFDB 4ODSL 2KB1A 3K3OA 2HEWF 5J12C 3RZKA 4JI6O 5K39B 5HVHC 1CYGA 3CTTA 5GRZA 5AL0A 4NWTL 2VITA 2XWBA 1O5LA 2MKLC 1OE1A 1BEYL 3LPPA 4J8RB 1YECH 4G2KA 3GXDA 5ALCH 4PLNC 4MMXB 3IDGA 2VMDA 3V55A 1W6MB 4GWNA 4D8MA 1QSFA 3HKBA 2VDNL 4J4PC 1Y66A 3ZDYF 5C93A 1FZMB 1PNKA 3KGZA 4HK9A 2GAUA 5TDNA 1W6NA 3T1CA 1KB9K 1RU9L 1SJMA 4TL4A 2ICWI 1QLEH 3CXDH 5GSVA 4AYBA 1S9YA 4AT6A 4RX4D 3PAUA 3T8XB 3LA3A 1IZKA 5FY4A 4NXMB 3RURA 2RMKB 4KZCA 4Y9BA 4YDMA 5DT1L 5CA6A 1MCCA 1ZJBA 1I85C 1CXZB 4LHUD 3L54A 1SMOA 4LHLA 3MLWL 5JUEL 5JDJA 1JZDC 3BHPA 5FHAH 2P6HA 3ARDA 3KPNA 3VD9A 4JM2B 3NJZA 2XPJA 2RMNA 4LA3A 5CLYA 5JJNB 1YQ5A 1K72A 3QO8A 4Y2OB 1TQUA 4YAQA 3UQ8A 1JPXA 1FLTX 1HHJA 2G60L 2F1AA 3BAAA 4HWNA 3WLWD 4Y5YB 1KLUB 4BCXA 4O2AB 5J2UA 3ZIXA 3V0IA 4NKOB 4JVAA 4FK5C 2N7BA 1A0QH 4R0LA 2OMZB 2D6OX 3HG5A 2QADD 4NUBA 4BWOA 2WCGA 3Q5TA 4NCC2 4IHJA 5E9NA 3SGDH 1G7HA 1HKLH 3I75B 4O2FA 2Y07L 1KECA 3BEWA 5BCAA 3GPEA 2F66C 3QTCA 2F19H 5EC1A 5BPPA 5FY8A 2IU0A 2GW5A 3P4LA 3D0SA 3D87B 4QF1A 1BSIA 1CE6A 1MFMA 4XHQA 1AQDB 1BIHA 1M7IA 3CZFA 3U2JA 4WO4B 3DSFH 3S4SB 1WC7A 3WNJA 5C97A 1H8TB 5K4LA 2G75A 3P3SA 1NLDH 4K8XA 4NM8L 4XCNB 5AAMC 4HPKA 4WFFE 3TBVB 1HYSD 1O6UA 1WW4A 5IW0A 2RJMA 1HS6A 3E6HA 4R96B 4WDIA 3HMXL 4XBLA 4FNQA 3IBOA 1BXXA 2AI0L 1NA1C 2B14A 2XWJA 5J1SC 2F7QA 3KXFB 1OT1A 1MNUL 4RDQF 1HH9A 1QPXA 1A78A 1MFDL 4UCOA 2IDQA 2Y25A 4DGYH 2E63A 5TE4L 3J8F1 4CTEA 1YZZA 5KHKA 1XGTB 2H8PB 3I3BA 3T0EE 4FLVA 5LY2A 1RUC3 3ZYPA 4QGNA 3QOPA 3MBEA 3RI8A 1FSKC 3DI3B 3ECBA 2PYTA 1J59A 2XZAH 1FFRA 5EIQA 4XIOA 3JV6B 5EJ1B 2F5AL 3RBSA 2VCMA 3G6EV 2VE1A 3FUKA 4OD2A 1P84J 2D0GA 4K8RB 1S3RA 1YAIA 1IGFH 3ZPDA 2X4TA 5DA4A 1JNHA 2QTEA 3VZLA 1XHHA 3DX4A 3I02A 2OTJV 5IOPB 4B3MB 1KOAA 2Y23A 3CJHA 3BVDB 2XFXA 2WRAA 2EXSA 5JQ6H 4XO4A 1M9NA 3A6BH 1UWXK 3A21A 1UOJA 1U3HC 2OL3A 4CGTA 4JZJC 1QO3A 2OV0A 3EBHA 1QRND 1SNRA 4LIQH 5KUKA 4FCAA 3ZDZE 4OYUA 5IWFA 5E2VH 5FYKE 3NAPA 1OCWL 2ZZUT 3WFVA 2YS8A 5EU6B 4N7IA 3JWOL 4C59B 1E4KC 5GGUA 5FPLA 1IBKO 3FOLB 4QRRA 4XDQA 4J11A 1OY3B 5HGBA 1PGL1 2R83A 3IPFA 1XFPA 1KTRL 2JJWA 2XIIA 4EI5D 2GSYA 4JGZC 2PPDA 1QQDA 4S2SB 3AZYA 3HD8B 3U36B 4AHXA 5KXBA 2C2AA 3P9WB 1OTSC 2VNOA 2AF2A 2Y72A 1TTAA 4LSSL 3EOTL 3H3PL 4R26H 3L13A 2IXHA 3RVHA 5D5MF 4M5ZL 4E9XA 3UZVB 4CRPA 4OPHA 3CXCU 4LNVA 4PRDA 3QAZC 1FN4B 5LP6A 2GC2A 4P5HA 4B3TO 4QCIB 4EZKA 2GBAA 5E6SB 3RWEA 2CJ3A 3H8UA 4YYOA 4ODBD 4IXLA 1NOLA 1GAFH 3BAEL 1MZ6A 1CAXA 1NAMB 4Y20B 2FQGA 1WG3A 3R06B 1SQPH 1WAAE 3UO2A 2WKKA 3B5HA 3VWJB 2DQCL 1NBMG 4R6ZA 2FLRT 2G5UA 3EJZD 5BZZA 5A43C 3ZFEC 1I1EA 1BWMA 1H6XA 3MBXL 3QRLA 3U07A 5IB2B 1G7IB 3QJOA 4XC1H 2BDNL 3V6OC 1OPMA 4I5BA 1OE3A 3WT3A 2EDYA 1W99A 2WLQA 1FRGH 4FPEA 4LK7A 3KPOA 4X99A 4X8NA 3L7EB 5JMRA 1JUFB 2YFOA 3CMOH 1USQA 2DH3A 2OTPA 5FZ8A 3BDYL 4JCMA 1KMIZ 3SDYH 1WJ3A 2B7YA 2OW6A 1Y4MA 4JHWL 5J9PA 2ZE5A 2QBWA 1TME1 5ECJE 2ZX8A 1K4DA 4PSPA 2A77L 3K72A 2HKAA 3KM5A 1QFWH 1L7LA 3FKUS 1OTUD 1OB1A 1F41A 3ATBA 3FT4A 1WIPA 3ZK0A 3BPOB 4NQSA 4JFZL 1RM1C 4S10A 5DCCA 3TBTA 2E5EA 4JFYB 1KWKA 1KY6A 1JGEB 1B9ZA 1H3WM 3S36X 1KNOA 3V0AC 3VXRD 2XQYA 1R34A 4A7GF 4YSCA 3MRQA 4FTSA 1IXBA 5M94B 3IIIA 2LU5A 4AAPA 1QSVA 4I3SL 2HWC3 3QFDB 4N8VG 1JE6A 2J72A 5B66Z 4H26B 2F1EA 4OLWH 4N0CC 4QHUB 5HYSG 3BB6A 1J05B 1RZFH 2XETA 3EVKA 3D39D 3LDBB 3DHJA 1K92A 5DFVC 1MAJA 2VQUA 1F51A 3UG3A 4AQAB 3T0EA 2E7TA 3DTXA 3C7FA 4GSUA 1YN7B 4LLFA 4QMEA 4MJ2A 4D0CA 4JAAA 1K3IA 3FBMA 2AS5M 3AS2A 1KP2A 4J3SA 5EFIB 5CGMA 2B42B 4IEYA 4OLVL 3B2UD 3UCQA 3HHSB 5FUPA 1NCCH 2ITDA 4PB0H 3SPVA 4JLRB 2GNTA 5T52A 3D52A 5IESL 3A4UA 2DDUA 3UO1H 3X3FL 5EBWA 2K1EA 2IPTH 3NGBB 1JDCA 3RIKA 4NC2B 1SYSB 4M4RB 4LC1A 4BKTC 1XL6A 4P5KA 4YHNA 3TGXA 3TJHD 5ICZA 2Q7HA 3JWDL 1PZSA 2A9NL 3CFJA 1Q1JH 3KQRA 1UH4A 3IKKA 2AUYA 1XYNA 3G04B 1DO5A 4YQXH 1MRFL 1WF5A 2VUYA 2VYRE 4DETA 1SLUA 5IMMB 5KYUB 2X0LA 1SLWA 4PWJA 1ZGLP 1A6UH 3T4AC 4WI9A 3TVMC 1MCDA 5E5LA 3TVMA 3CCRV 1L3NA 4GIOA 1YVWA 5FUOL 1FL6A 2GALA 5E4AA 1T20A 3CPUA 5HHVH 5FZ7A 2BS9A 3PP3K 5FKAA 1CJDA 1KV3A 1VAKA 5F6IC 1AXIB 3K6FA 3D5OF 1MABG 1X9QA 3IDGB 3VFUB 2PNDA 4RMUA 1QSFB 3HKBB 2XCMC 5FPOA 4UCVA 1QCEA 2F6AA 4JGUA 1K2DB 3CHPA 4JVUA 4LCCB 1YQVL 2B0SL 5TDNB 1W6NB 4NN5B 4EFEA 3HMWH 2YIBA 1DQMH 3FONB 4QY8B 2E75B 1S9YB 4QDSA 4F3FB 5HVFB 5E2WL 4D6RA 1Z3RA 1DZ0A 3JD4A 1HNYA 3F7RA 1W6LA 3S34L 4ZQKA 2PO6D 4MJID 4YG3A 3F95A 2VNGA 5IT2H 4L8DA 3TWCL 4Y5VB 2G5BA 5ICYB 1M9WA 5I71C 2Q1FA 2CHWA 4ICWA 1EAOA 4BISA 2LW1A 3BCWA 3IJYB 1LVEA 1PLGH 4YR6B 4IEPA 1QQP3 3VXPA 2J22A 3QCTL 1HHJB 1EQWA 3NNFA 5E0QA 4JFFD 4ZHQA 1ETB1 4WI7A 5CLTA 3WD5L 4J1UA 3FNKA 5I2IA 1XNQB 3DBXB 4LARH 5F7NC 2H26B 3L4WA 4R4FH 4DR1B 2XPZA 3LNIA 1G7HB 2DYRC 4JI8O 3SEEA 4L3EA 5I17A 1KB5L 1I1CA 2W1QA 2ZQKA 1D6EB 5C0BA 2YI9A 3B4SA 2OYQA 2GUYA 2GY7B 4QF1B 3SKUD 1CE6B 5E2UL 2JGDA 4HPHA 4HPYH 3R4RA 4MDRA 4YHLH 2XUEA 5L0QC 2YWYA 5F96H 2ITFA 3VFPB 4HPKB 1Z0HA 3RJQB 4G6FB 4R90H 1TVBA 2OPKA 3WNXA 3RB5A 4IDJH 4MXVA 3E6HB 1IBLB 1Z5WA 1ULVA 1ZIAA 2AJ3A 3FU6A 4HG6B 1U5IA 3R65A 3EJTA 4M5TA 5DAPA 3X17A 3CN0A 2XAGA 4YNIA 3U7YL 4K55A 2XWTB 4M6MH 1S9XB 4L2NA 3ZMTA 1HH9B 2YXHA 3SE4C 1JNJA 1HJBC 3N6YA 2N7SA 3KHOA 3NUKA 5C7ZA 3ZSJA 2QJDA 4HU2A 3O2DH 3WXVH 5J1TC 1OB0A 5K0UC 3S36L 5IVYA 3RUGE 5EORH 1SOQA 2FWLB 2ZDIC 5DECA 1P4IH 1XR9A 1XZ0B 3J8F7 3K6OA 1IBGL 4RGOL 5C0ND 3AFKA 3AVRA 1QRNB 2CR3A 1MF2H 4FLZA 3UT5B 2WQUA 1A1MB 2IH1A 1R73A 4Q97A 3KPMA 1JDDA 5EUKA 4LHSA 4LDCA 2K3TA 5C6PB 3ASNC 4C0HA 5L88H 5AFEA 5D1ZC 3LKNA 5F88A 2QLYA 1U8QA 5AB2A 1JNHB 1YJNV 3D85A 5IVZA 3V5KA 2ZD0A 4JFOA 4LRNL 4NO0A 4EI5B 3NO8A 4I0BA 1W6OB 2XFXB 3DLQR 4KUCD 4KL1A 1DUYA 3EXUA 1FXKA 2X6AA 2CCVA 3H7LA 1S0CA 3HQRA 4OZHE 1TMF1 3NR7A 1CGSL 1QO3B 3D08A 4I1NB 4JI5O 3ZE1E 2FT6A 3VFTA 1Q82W 4L8CA 2O1QA 3QXDA 4KAQL 5DWUL 1JFHA 1REIA 1P69B 1B6UA 2BVPB 5LBSH 1JNLH 1W6PB 4N6RB 1TVHA 3NAPB 5FYVA 4HCGA 4AQ1C 1J1OH 2R0LH 1SS3A 5GGUB 4N21A 1GJIA 1DGWA 3BIWE 3BGFC 4YLCA 1II4E 2K6WA 3PHSA 1RUF1 3N9LA 1A3RL 5F97E 1OKQA 3M86A 3FZ3A 1UF2C 1YNLL 1Q81W 4YSSA 4MKMA 3SB3A 4G1EB 1GN3A 1O59A 3PABB 3L2NA 5FJKA 5A6YA 3VRLF 1V6KA 2Y7MA 2XUWA 2X6BA 2DWTA 3IPVA 1ZT1A 3TH2T 4JS7A 4NZRH 4OIAA 2RS33 3MFCA 1KRIA 2R69H 1FPTL 2HKHH 2A1WH 2ICWA 3T2LA 2DFCA 4BIKA 1S7QA 2OPWA 3GB7A 5LCVL 1KJ3H 3K6DA 3P9LA 3JB4C 5LP6B 5CFDA 4IEFA 3CU1A 1Y0LB 2VNVA 1F4YL 1F2XK 2EDTA 4BU2A 5E8NA 1M7XA 4Y8AA 2JV6A 5K33A 1DLFL 4UTAA 1SBDA 1CAXB 4FXKA 3VQMA 1DQ0A 3V0JA 2VLJD 4QIRA 4ZUVB 1G9BA 4UT6H 1CONA 2ZX6A 3KEDA 3I6LD 4D7PA 1VQ6V 4OQTL 1HN1A 2RS12 1LDSA 2F8VA 2YIHA 3ETBJ 5IV2B 1TGOA 2EAEA 2FX7L 3GXFA 4HXCA 5IK7A 2XACC 1XF4B 1ZZ9A 1GMIA 4K23H 4M48L 2KQMA 2QQLL 2Z35B 3CBRA 2YQ2A 4KWJA 3KPOB 2B1HH 4X99B 3ILQC 5HHMD 5I18H 5GXBB 2CHZA 1F3DJ 2LO1A 1KULA 2X09A 1MEC1 4C8XA 1QBAA 4FYTA 1W0NA 3WUWA 4MJ5A 3SJQC 4U33A 2P48B 4PY7A 1IAII 4MA3B 4DN3L 1I5YA 3OKDA 4WI2A 3SKOB 1FORH 5SWQA 3HE6D 4ELME 3ATFA 4JNXA 5D4JA 3WE6A 4B7EA 2IU3A 2A7AA 2ZMNA 2D9CA 1H8LA 4XFIA 2WL1A 2CJSA 2Z4QB 2Z65C 3OHMB 5D4IA 3QQ4A 2YY1A 1X5ZA 1ZTMA 5I93A 3W9EA 2ORZA 1KEML 5IVJA 5JIPA 1BEV1 3BAKA 4WWKD 1MG2C 5LL6Y 4YUEH 3LXAA 4LCIL 3UJJL 4K2UL 1POQA 1RLBA 1T4KA 2C9SA 1HZHH 1NR7A 3OAZK 1HJCA 1LOFC 4QM8A 3J81N 4RGAA 4G5AA 3WNPA 1DVSA 3RU8L 1LTEA 4IV1C 2YK1H 2BIOA 5D6DC 4Z8FL 1XGYL 1MFEL 1KTJA 3A6OA 1QJU1 1REDA 4WZCA 2P4AB 3ZYFA 1PFOA 5CG9A 4YDLC 4N43C 4ZSOA 4D0CB 1UJ3A 2E7DA 5JOPD 4YFLI 3STZA 4L05A 4MMYB 2KQNA 3OC8A 1GJUA 4FQXC 1F4NA 4X83A 2BWDA 3KV5A 3N7KA 3MCKB 4NQXA 4PJIE 5E9DD 5L9DH 4BIZA 1FOD1 2SODB 3SOBH 5HHXH 4GRMB 1UKGA 1X33A 2DU1A 2LVEA 4DPAX 5FWJA 5CSZB 2VE6B 1DBMH 4Z76A 4QU2A 3N35A 3UMNA 4DV1B 1FMD1 3ELNA 1ZANH 4UFMA 3VBFC 4X4KA 4JPIA 4IMLA 4MDIA 5FZLA 2PYJA 1KT2A 5ICZB 2UY9A 3EB7A 1R46A 3CFJB 1ZHNB 3JTTB 3MU3A 1YEIL 2ZCHH 5FM4A 1NS1A 5BRPA 2HG5C 5EC2C 3DUSA 3GO1H 5ESVA 1WB8A 3RPBA 5HYQA 4XF3A 5IJKA 2FD8A 2ZYHA 2JJ6A 1JPST 3OKKA 4WW2F 3RWFB 2W0LA 2ICEC 5ID0A 2ITCC 3AXIA 3QZWB 3TVMB 3T1LA 5T50A 2B1AL 3SDXE 2VXSL 2DLFL 3IAYA 5F21B 4YZ5A 4HL0A 1BQKA 1R3JA 4QXKA 5IEKB 4KWLA 3FQXB 1QBMH 2OMVB 2J7LA 3AYAA 3I56V 4NKIH 3O1OA 1OOPA 3NPSB 3ZIMA 4HSJA 2Q9OA 5KHHA 3O9WB 4JFFB 3WU1A 4YGDA 1VGEL 1VMJA 3MCLH 3NEEA 4G9FD 5DD1L 4X64B 2EACA 1BHBA 2NSMA 3W0WE 4X4YA 4Z3EA 4UXNA 1RUAH 3G7TA 2XN9D 4LP8A 3GSRA 4R2GB 3D3QA 1RPOA 4KZEH 3REVB 2F4PA 5IYCO 1EP0A 1S1AA 3WKMH 3VZNA 4FA8A 1ZLUH 4FP8L 1MCHA 2ZCKH 3ZL1A 1UC6A 4PU2A 1AYM1 4CDXC 3BJ91 1JQ0A 1NDGB 5BO0D 4QQ2A 3US9A 2F9BT 4XMLH 2HT4D 2KZBA 3UO1L 8FABA 5D2LA 3ITQA 4XPVA 4NRYA 4CMHB 4KH2A 4J1UB 4LF9B 1O5DT 1GO3F 1XAKA 1FXVA 2OMXB 1CGYA 1AR82 1EEYA 3ARWA 3IRPX 4JJ5A 3VU2A 4XJUA 4MB1A 1SETA 3IGAC 4D6TH 1YEJH 1KJ2L 3BAJA 3FHAA 1MPXA 1QXRA 5F32A 5EU5A 3VHNA 3JWOC 1AQKL 2NY2D 1PQZB 1F6LL 3ARBC 4FA6A 4RWYH 3NA9L 1CXEA 2JGDB 3FN0L 3OL2A 3DV6B 2PXYD 2AQPA 3L9EA 4WY7L 1LHOA 3KHQA 1HN0A 3LD8A 4DVRL 5KTEH 1YUDA 5FPZA 2EA7A 1NJIW 1CXKA 2D03H 1J5OL 1POV3 2ICES 2B2XL 4Y2DC 3PHAA 4A1RA 4ODUA 3H9HA 3T4YA 4OSUL 4ELMA 3RP1A 3BRGC 1IQAA 3FO0L 2CGNA 2NTFA 3O0RH 3ULUF 1NX9A 1TTRA 3IDXL 2NYYA 1M6UA 4FFZH 2ZACA 1R3HA 3APQA 3ZL2A 1CGPA 1QHTA 3MDJA 2XA8H 3ULAB 1C57A 3SDCA 3HHMA 5HFMA 3MUGB 3UL4A 1KC5L 1RUJ1 1UYZA 3ZHLA 3J7AU 2E7LC 1EHNA 4PVLA 4Z7QB 1B4JH 1U8KA 1QH7A 3HBKA 1W9YA 4X6DE 3JAWA 3V4UH 4IMKA 5B1BC 4R5XA 4YZWA 3FQYA 2G19A 5I1JL 1JZ6A 2NY5H 1PZ9A 5FA3A 1VHPA 4R97B 5H94A 5GGQH 5A3ID 2P80A 3K48A 4JKWA 2HUEA 2RCSH 1DIWA 1XWVA 1ETZB 3BSHA 5IQ7H 1MKFA 3QHFL 2ZICA 4OCWL 1POV0 2IH1B 3BYTA 4FFKA 3ZE0E 4DR3O 3AC0A 5EUKB 2ID4A 3RY5A 4HLZH 2ADJA 4XDOA 1ZMYA 3LKNB 5LATA 2E53A 4HOWA 4EMZA 3MRBA 4G6ML 3PUIA 1GGBH 1DJYA 2BVEA 2PP9A 2VLME 3V5KB 2QQOA 2R49A 5EDSA 1FDLL 1DBBL 3CFEB 4IESA 4Z3JA 2X0WA 4H8UA 4I9WD 4IGBC 3OT7A 5E6RB 5FDYA 1FXKB 3LZFH 2NN8A 2J7MA 4IHOA 4DEUA 3VM7A 1IIKA 1VCAA 4L8CB 4B9PA 3ZFGB 5CNAA 3TNNA 3QXDB 2DMHA 1R3LC 1ROPA 4DR6B 1KGUA 2CCWA 2WQWA 4FQCH 3EG9B 3ZSTA 1E67A 3IE9A 3N40F 3RVUD 3CZNA 1AGCA 1XJAA 2A9AA 4EI0A 2CK0L 2OL3L 3SDXA 1XIWD 2J6EH 4XE5B 4OUMA 4IE0A 1OQ1A 5AZ2L 1ZBA1 4QOKE 3SJVB 2A6DA 2WZR1 5CILL 3IMMA 4W9IC 4F6RB 1MJ8H 4RNRA 1IKQA 1F4AA 3QNZB 4HFUH 1U4EA 3VUAA 2DI7A 3W20A 1ZT1B 4LBEC 5DMGD 4KJPC 5CA3A 3F5WA 2ADQB 4XP9H 3WB0A 1CYXA 4Z7WF 1NGPL 4ZI8A 4LFHG 2DWDA 1DGRN 4F15C 4XCCH 4YDJA 3O4LA 5FECB 4Y5TA 3MJWA 1UURA 3C6EA 1JCHA 2BPA2 4QQOA 3RYIA 2BIMA 3NZ8B 4XVUD 4ZZFA 3U6XS 3SDDC 1X5JA 5HHMB 3U7WL 1FPN2 1UXSA 25C8L 4GULA 1QATA 1KGXA 3QYCA 4HJTA 3NNJA 1SEBA 5ALBH 4MB4A 3ZTNL 4FXKB 5FYJH 5KW9L 15C8L 2VIRA 3DC0A 3NCJL 4FJ6A 4YHPA 2FO1A 1T1WB 1OSPH 4QXCA 2V9TA 5IYYA 4ZUSA 2EKJA 2QELA 1BG9A 4LB8A 5C0AE 1JYCA 3OEBA 4GD4A 3FB8C 2YI8A 2W1UA 2Q7GA 3EOAA 1XE0A 1HDMA 3GGLA 4HN1A 3PVNA 1C1EL 4XMVA 4BMBA 1FVCB 3LH8A 5HYIA 4UW4A 3UZQA 4GQ9L 1PZBA 3MV8E 1UY0A 4HF5H 5HHPA 1UVQA 2JIJA 5D21A 4KK6C 2XAHA 4Y88A 1MJJB 2VTFA 4LP5A 2PQQA 3WYRA 1OPGH 1JERA 2E9WA 2NZ9D 3E1ZA 3W1ZA 5LB6A 4HAFA 2K4WA 3WUWB 2DYPB 4MJ5B 5JPNC 3LNGA 5IVXA 3AT0A 1A8ZA 4NAJA 4MAYC 4PY7B 2Q1EA 1ENVA 3DARA 3MJ8B 5GZOA 2K78A 2J8UA 2HFEC 1WUZA 1JX9A 3DX9B 4KHXH 5SWQB 3DIFA 2R1WB 1NOFA 2JG9A 2AQSA 1G9FA 1GYVA 2JB6A 4APQA 5F7HA 2EF6A 3EYQD 2XSKA 5F2WA 3BYWA 4B9IA 1O9HA 3W9EB 1LO0L 2XQ0A 4Y8DC 3ZE2B 2D7NA 4G2AA 3FTZA 2RR12 5AVTB 5A3MA 3WN6A 3W7WA 5DHVA 1ZBE2 4K94H 3ME0A 4X6DA 4CDWC 3F58L 1SQXH 4LKDA 3JCUZ 2D7TL 4PF5A 2XASA 4AEDC 2JWYA 3BXNB 3RMXA 4IRJC 4M1DH 4N1EA 3QJTB 3T1MA 3RZCC 3ILPB 1E3ZA 1NLRA 43C9A 1IC0A 2QM7A 2I07A 3B2XA 5F7EL 4D0DB 3KL3A 5KVMC 4OFGA 2J2ZA 3GXMA 1K4CC 1DF5A 3GF6A 2Y2YA 5C08D 4KNQA 3GGWA 5KSAD 3VGEA 4J23A 4PV8A 3C9NB 1EJ8A 2FJFB 4TTDD 4Z76B 4QB6A 1IAIM 1MIMH 2DEWX 3VDCA 2KUTA 4ET7A 1EGJA 2NY7L 1X5FA 1YHQV 4K3JL 2FE0A 5TD4A 4NFBA 5A7WA 1KT2B 1TETL 4RFEB 4RGMB 3PWJA 2J1KA 2DTSA 1AR2A 4M0HA 1TUBA 1RXLA 2K7QA 5M7QA 4KXAA 3EZJB 5CZKA 3RTQC 4BSJA 1LULA 4K40A 2CU9A 2XN9B 3HZYA 3OF6A 4XMKH 4XTRD 5F6KA 1N36B 5B3JF 4NHCH 3TNQA 4JTNA 4GFXA 3OWEA 4FX5A 3QZMA 5C9AC 4KMQA 2A3QA 5LBBA 4AOFA 4N28A 3GWJA 4OH2A 3NVCA 5FYKL 2XN0A 4BWTA 1VQ9V 5HDRA 4A6YA 1WB7A 4Q9CA 2PCFA 2V3DA 2MNGA 5L8JB 1OOPB 3BU7A 1V7NH 1KFXL 5GTIZ 3TO4D 4MQXD 4LKXB 4G28B 4FLQA 3VW3H 2QKIB 3NSDA 4JKMA 1QJX3 1L7TL 3Q8BA 2OMUB 1RUH1 4L29A 5F3CA 3BHBB 2EEXA 2LROA 3ST7A 1K5NA 3KBHE 4Z23A 2WN3A 3R8BB 1D9KC 4AVBA 3ZJZA 2E86A 4F9PC 3GSRB 4HH9A 2G9KA 1MWOA 3AG2C 3O6MH 4QGTA 1Q9WB 3KJ4B 3SQRA 3MXVH 3F7VA 1HHGA 4FFYL 4KHTH 3VFGL 3VGGA 1GQHA 4DOHB 1NOVA 2YZ8A 1WW5A 1YYLL 4HV8B 4PBXA 1A7NL 3SC7X 1P5UA 2XJKA 1XNRB 4QJFB 4WBNB 1DQVA 3RX9A 4XP1L 5D2LB 5EWSA 4NRYB 1JGVH 4HWBH 4OZGF 5C0AA 5IYBO 1V6NA 2V4VA 4B6ZA 4O9HH 1O4ZA 1JOBA 4OI0A 1U8LB 1H3GA 5IWAO 1I8KA 1LO3L 1QTPA 2FYYB 1RZKL 2A73A 2VO5A 3OGCA 5LW9A 2F53A 3MV8A 3EOBB 5KN5B 2VLLB 4EIBA 5C71A 3M45A 4XQWA 5JVDB 3PGFL 4U1LB 4YDZA 1UU6A 4P9GA 4RAVB 4UILH 2A6JA 2R0ZL 3KPPA 2GJPA 1QJFA 4FOWA 1DTUA 5DQ0A 2YC1A 3N9NA 4XNUH 3D8CA 1QAWA 1XH3A 2OW7A 4ODUB 2X1WL 2JSFA 2XRAL 3H9HB 2EIJC 3T4YB 3GINA 2LM3A 3D82A 2I69A 4HD5A 1PK6A 4OIIH 4NOTA 5LGNA 4M3CB 1HH6A 3QA3A 3NJNA 1COV2 1R3HB 1OAQL 1SN5A 1CE1H 4JMNA 3OMZA 3A6CH 4JDEB 4JFSA 1N26A 1F4WL 3CJIA 2WXFA 3SDCB 4DR4O 2VDRL 5FGBA 1R3KA 4UF7C 2YGMA 3TNMB 1OCRC 1G1KA 1K6QL 1U8KB 5E8EA 5KANG 4NBYB 5DJAA 2RS52 1P0SE 1Q9OB 4PD4K 2X89D 5FA3B 1D7CA 4OCXH 3UYJA 5H94B 3F62A 1I1YB 5AVRB 4F2EA 2VDQL 1Q3EA 2OMYB 1MFAL 3U30C 5D2NB 2DQGH 1WZAA 2FX8H 1J0HA 1EZVY 3W9DA 4GLRI 2Y0OA 4X98A 3LEGA 1F13A 4HZLA 2KSDA 4QGMA 3UO3A 3RWCA 4LCUB 5E6IC 3FQ1A 5E8AA 4MGYE 2F74B 5CAYB 2ADJB 4JRXA 2VXTL 3LSOB 3CUPA 3UZEC 1Z7JA 1SFNA 1WCKA 5I19H 4L9LB 1WWWX 2WSKA 4N5UA 4POZC 3QIBA 3M3OA 3RLSA 3IDMA 1OAJA 4UNIA 4XXWC 3S5YA 4Z6AT 2FZ3A 2CXGA 5K9KB 5KS9A 3TEZA 1MVEA 3IPBA 3MV9B 4WF9V 3V6ZB 4EI6B 2PWDA 5ITFB 5AC93 5IT6A 3HWJA 4YW5A 4WRLA 4JYBA 1RJCA 3WE1A 2AFNA 2CR0A 3OR7A 4OAWA 3MREA 4IL6Z 1CBVH 4XAAA 3PE9A 3TNNB 2DV6A 4HLEA 2OSXA 1I5ZA 3VOUA 2AXJA 3QO0A 3QDMA 5TFSH 2OR9H 2HRGA 3L5XL 4EDXA 1FAIL 4HUWA 5CCJA 4LAQL 1J84A 5C7GA 1IM3A 3U0PA 1VFOA 4FZEL 4ZNEE 5DEFB 3GHNA 1U0AA 1U5YA 4JJHA 3M6DA 1KB9J 1XCWA 1OHQA 4ZXBA 5BV7H 5I1LA 2L7QA 2JXAA 3RSJA 3WQ1A 2V7QG 3MHZA 1CMOA 4P4RA 1BVZA 4E0RB 2EABA 1W59A 3UGUA 3WIIH 5L3EA 1M1XA 4FNPA 5A33A 1S9WA 5B38B 3AXLA 3FMGH 5L3FA 4I9QA 3N40P 3O4LB 1Z5HA 5L7XH 2CKBL 2BHYA 3GMLA 1MCFA 4OGYL 1TO5A 5GJTH 2IAMA 3SCMC 4BH9A 3QO1A 2ZUSA 4PHXA 3UAJD 4NEHB 3GM8A 1AFVL 1YHPA 3QCUH 1Q86W 1L9OA 1GWMA 3I3MA 3UBXB 4LO9A 2XOMA 1LODA 1LDPL 1SEBB 3EFFK 1I8LC 3DX8A 1A3KA 3GJEB 2VIRB 2W9DH 4HGKC 3HIFA 1LNUA 4U7OA 3QPQC 2BO0A 4XVTL 3T1WA 4I87A 4CCOA 4Q4V2 1YEFL 5D1XC 1QI3A 3RDTB 5D6CB 1Q9LB 2H6PB 4AGPA 1VIBA 5JOEA 4LA2A 4NI3A 5HJ3A 2GJ6D 1NBCA 3TBWB 2PPCA 2Q5ZA 1UVQB 2C9XA 1VPOH 2MPAL 5ERWB 5D4HA 4KBBA 4HKJB 4M7LH 1HR0B 5L4FA 2BMKA 5I1IH 1RUMH 2NDGA 3UGFA 2JKSA 5LCWL 1WITA 1UZ0A 3MXWH 5C8JB 1ZZ7A 3RNQB 1D5MA 4NN7B 1SVBA 2J8UB 5IM7B 3CDFA 2H7WA 3FCSA 5MHSD 3DIFB 3T3MB 2ENRA 4R9DA 1I4FA 4PJEB 3MRKA 4I4WB 4DVBA 2JTYA 2DWEA 1SLBA 4QPIC 4M1CD 4WFFA 2ZX0A 5CJQL 4QYOB 1YNAA 2YPKA 5KYWA 2GI0A 1G1YA 2WQRA 3LN9A 4NO5B 5EZYA 1JUIA 3GJFA 2VTXA 1Q7YW 4WZFA 1BX2A 1UT1A 1RVF1 3FO1B 5FKCA 2BS8A 3WF4A 1NFDB 4S1SL 1VEWA 1PLBA 2CXKA 4UANA 1YO8A 2D7OA 4TPRL 2ZCWA 3KXFE 1CAVA 1A4CA 1BIIA 2CDEB 2IPUK 3SO3C 4QTIL 2VC2L 5JOWA 2I07B 5CJBA 1H15A 3IXTB 3ARDC 3EADA 4TNGA 2D43A 2IJIA 1NCGA 3I7DA 5AG8A 3AREA 2A3YA 2A6IA 1D5IL 1MVFA 3SPIA 4WTZG 3AWEA 4XPGH 3VI4A 1FJ1B 4MJ6B 4PV8B 3HJRA 1IS4A 3CSPA 4EDWL 4R0LC 5HY9B 4LNRA 2XGXA 5ETUB 3ABUA 4Z1VA 5BOJA 4KJQD 1LD9A 3P69A 4NXSA 5GZNA 5I5MA 5I0DA 2HEYF 2X0VA 2LUWA 1GHFL 5T1DH 4KG8A 5JZGA 5EC1C 1RUPL 3WJJA 4YHML 4L1SA 4XP6H 1A65A 3P9MA 4PCRA 2BOBA 3V8OA 1RU9H 4AGVA 1FNHA 4Q29A 5B4MD 3KV9A 5DI8B 2EDBA 2HZHA 4LR4A 3IKCA 2DI8A 1N1SA 4EKXA 1QJY3 4YY3O 3OOXA 4X8JA 4ZNEA 2ZE6A 1T5KA 2EIMB 3KM2A 4IRSA 4HC1H 5C09D 2PWGA 4G6JL 2YGOA 2Q3XA 3RWJB 1HNWO 1ICTA 3QEHA 1MS9A 3UPCA 4NP4L 4JDMA 2QJVA 1PEZA 2D93A 4L29B 4RBPK 5FZFA 1K5NB 2JJ1G 4JO1H 1PO12 1VLXA 3RFZB 2RS53 2UUCO 4CCDA 4L5FH 1URFA 2VQ4A 4HH9B 5FYKU 1C3HA 3ZMOA 2VW0A 3RZHA 4UCSA 1O4YA 1OC1A 1CICA 3MBEC 2Y07H 4QHPA 1J0YA 1CLYL 5E6ZA 1ADQH 1IEBA 2IOOA 1WO2A 3PV7A 5LJYH 4XABA 4QT5B 2YD0A 2VH5H 1QVFU 1P5UB 4N2IA 1N64L 4H0GA 3WZ1A 1J0IA 2QBXA 3NWKA 4GQ7A 2E46A 3GEWB 3W2DL 4ASMB 4PV1B 4HJJL 1UOGA 1X8MA 3RVXD 4RGNC 4HKZA 5JA9A 1WLWA 5GS1B 5EZLB 4XUQA 3V0WL 4XFHA 1MW2A 4KJWD 2F53B 3QJXA 4DGVL 4NUGH 2XJLA 3HMXH 4A63A 1INEH 3BT2H 4H0LB 1Q0XH 3D09A 3N44B 4KV5F 4LCYB 5E8PA 3V0EA 1WYJA 4KOBA 2AI0H 2VDKB 3DA0A 4QHKJ 4J7ZA 3WS3A 5I1EH 2FMDA 3VVWA 3HAEH 5GALA 3L3JB 5H6RA 5CISA 4RAUA 3KPPB 1KPRA 1GYUA 4AE2A 2EDMA 3EGXB 1CLCA 1FJGO 1YPZA 3NN8B 2A9MH 4B3EA 4EUPH 4HKWA 1NGZA 5DZOA 4OMDA 5TE4H 1ZLSH 4I5SA 1IVSA 2WXIA 5E6HA 5CB7A 5JSRA 1IVTA 1Z7S2 3FCGA 1PK6B 1BEXA 1BMWA 3D69B 1EJOH 5JW4M 2Q86A 2R2BB 2PHLA 3RVTD 1OP3K 4GKLA 4NRXB 4UDUA 1JF5A 5AUMA 5ID1A 1XNTA 2R56H 1HESA 1AQHA 3GXTA 4LEOA 1YEHL 2Z7ZA 2R29L 1R3KB 4LXFA 4WGWB 2P3KA 5C8CA 3VG9C 5K69A 3WCSA 1M2OA 4X9QA 5D96C 3TYGH 2X3BA 1CJPA 1EFXA 1KTCA 2IM9A 5BR8B 3DOIA 3FSZA 3HA0A 4WK4B 3RQ3A 1JRHI 1AYRA 3MNWA 3TBCA 5CN3A 2M6YA 3QYMA 1HB3A 1L7IL 3L7FB 4N2DA 2RDCA 4R50A 4ZKIA 1NQBA 1DF4A 6PAZA 2V5SA 2YGQA 2ZE0A 2IIJA 3BUDA 5L2KE 4A7TA 4BMEA 1EM1A 1I7UB 2ADFL 3VWKA 5L2KD 5DUUA 5J36A 1C5BL 1GGCL 4LKSA 3RMYA 4S1DD 2AJSL 1PIV1 1W8ZA 1A7RL 1QWNA 2B5HA 5AL8A 35C8H 4MD0A 5DJCA 3JD72 4JRAA 3ZHVA 3GSQA 4NHXA 4JRXB 4NNPH 5FZHA 3CUPB 5KSVA 3O9OA 2E8YA 4FQ4A 4GSXA 5SX4I 1OCWH 4JVWA 2WPDG 4P2ZA 4QJ4B 4DXSA 4HIPA 4BHUI 5E2TL 1BFSA 4XNQA 4U4IA 1H6FA 4CP9A 1PIFA 4NZTL 5KS9B 5EF2A 2GN7A 2IANE 1Q5OA 4OFYA 3J7MA 1JA8A 3IJHA 3WDWA 1B0GB 4OIBA 4XRCA 5EOTA 3FZUD 3MNZA 4ANVA 3SYOA 4YHIA 3OR7B 4OAWB 3MREB 4JRLA 5I8TA 3PNWA 2WO7A 1IGML 1MCSA 3GBLA 4FQ2H 1PEWA 4ZFGH 3QDMB 2QQKH 3REWA 3L2MA 1GH7A 4HUWB 1UD2A 3QUXA 5J9PC 1QYGH 3PWUB 2XXCB 3OF1A 4QWWD 1K4DC 1FH5L 3U0PB 3NACH 3HKEB 3QJFB 5I8EA 5I73C 2WAAA 3KLDA 4UBDD 4XF9A 3ZXGA 1AQMA 1J87A 2P45B 1UB5A 4A38A 5K5YA 3DPDA 3PJQA 4F92B 2ZX9A 3KWWA 4H1LH 3FUNA 4P4RB 3KW8A 5A9GA 5JCOC 3JWNH 4JEGB 3RHWK 2PQSA 4LVHB 1MQTA 1MREH 1UQSB 1S7RB 2VMIA 5A33B 1J5HA 1SZTA 3MRLA 5FWQA 5BZXA 1HXMA 2DQUH 5E95B 2DUOA 1OCCB 3WN5B 1E3FA 2YQGA 5C0RL 3GMLB 2GJ6B 5D71L 5BRQA 5F3BB 5LZ6A 1AR71 1FNFA 1SN2A 4TSAL 3CZUA 5IATA 3H1JH 3T0EC 4N26A 3ZYJB 2Y6SD 2WKOF 2YEQA 3HHRB 3HPNA 3V6FA 1NIFA 2QQIA 3B7RL 3DX8B 1T66C 3DRTB 3D0AA 3CL1A 2VMHA 5FV3A 1LK2A 4ATEA 4NM4L 4G5ZL 2V8MA 3GVMA 5F7FA 2GC0A 3LVEA 1ILSA 4UOJA 4XWOD 2CDGA 4BGDA 2HMID 2Z8SA 2UZXA 3CSYB 1X7NA 1QLFA 2WLIB 4JY4B 1SJVA 3RIAK 4NHYA 4H25B 4YZ2A 2HWC1 3FUIA 3WENA 2XHNA 4JFPB 5JO5B 3V0BA 1RUOA 1NEPA 3QAQA 1ZXKA 1JI1A 2WSDA 4ZYKA 2P28B 4I3SH 3CVIL 1U41A 5IWLA 3H8OA 1D5MB 4LL1A 2BNQA 3RI5K 2W0XA 1YQ2A 2Z92A 3FCSB 3NEXA 4GX1A 4QHMA 4AYFA 4BZ4A 1I4FB 1IAKA 2OXHA 1JN6A 2WBJC 3HPJA 1T0MA 3H53A 4ZTPH 3VJ6B 4CNIB 1S0BA 2DWEB 4P3DA 2XAJA 3E80A 4OLZL 1G8WA 1DJGA 3G4SV 5TQ2H 3UO8B 1SQGA 1QW8A 4AX3A 1U8OA 5KYWB 1X36A 4Q4Y2 4XVHA 4BXVA 1BV8A 2QHRL 4W9JC 1O4TA 5JIUA 3MLYH 1UFUA 1NLBH 2K2SA 2P3IA 1RK1B 3KL0A 4W1TA 4DZBA 1A7QH 2AAVA 3WMSA 3MA7B 3BUPA 3VXQA 3BOWA 5DMJB 4LXLA 1JYNA 3UDWC 5ABJA 3FQWB 2J44A 5DEJA 1OZ0A 1TT6A 4PJ9D 3QZOA 3MRGA 3VD5A 1IAOB 3MJ9A 5D93C 2WWMD 4BQ6A 5I1HL 4BE3A 1SF5A 4JTCB 5HDBB 4DERA 1FFTB 3I55V 1S7UB 3CEWA 1AJNA 3JWDH 1YY8B 2G4EA 4M3KB 1PO23 3OZ9H 1DFBL 1H19A 1EUTA 3FT1A 1O8PA 1S72V 1KXHA 2X53S 2MK3A 2W81C 5G4MA 4FM2A 5CCKL 5IMLA 1RZKC 4DAGH 5JHDD 4FP3A 1NKDA 4F6EA 3OLDA 3VI4B 1F2NA 3O45B 3ULVD 5L36A 1KENH 2E5LO 1OD7A 4YXHH 1P49A 1E43A 3B02A 4X80H 3JTSB 4TN9A 3PIJA 3ML0A 3TIEB 2H6CA 2XJSA 5C09B 1UCXA 3HKDA 2ZX1A 2CNAA 2XWRA 1I9RA 1EY2A 1CTOA 4AYID 5JZGB 1UGNA 2DD8L 2EH7L 5DDHB 5AW4B 1IC4H 3X2QC 4WVWA 2MTPA 2AXGA 3EOYG 3H01A 2Y38A 1DQQA 3B43A 1EGJL 5DRNA 2GC1A 3AP5A 3FHQA 2VDOL 3BPNB 1SXSA 1R24A 2BOIA 3IKCB 4LNUA 3F2ZA 3TBDA 3QXTA 5KUMA 2D2OA 5DD0L 3UAEA 4Y5Z0 4UVCA 2YPVH 4IRSB 1WD4A 3UETA 1TG8A 3FB5A 1UOWA 4I50B 2G3XA 5F9AC 1HSBB 3EGDA 1X5GA 4N3TA 3GWOA 1ASJ3 5A32B 3T4VA 2OJZL 1ODMA 2J1WA 4FMKA 1QOKA 4K3AA 3K51A 1RMU1 3PREA 1E9QB 4PJ8B 5SWZA 4LSVL 1HB1A 3AMNA 3QCTH 4H0IA 3WFHA 3DN7A 2BRRL 4GBXD 2WZPD 5JVVA 2DJUA 4A6YL 1JHKL 3BEVB 1ULFA 4D8PA 5IREA 1RC6A 4HIHA 4PRAA 4QX1A 4O65A 2O5ZH 3BSGA 2ZUTA 1CICB 1SBSH 2OAAA 2F54B 3VBHC 4ODTH 3VHRA 1MWAA 5FFOA 4GMP1 4IGOA 3Q2WA 3VXNB 4LF7O 2Y2WA 3HCVB 1UM5L 3DV8A 3TN91 4L37B 1C8PA 3HKCA 3WW1A 5L2JA 1OQXA 3VXRE 4XMWA 2OA9A 4IL7A 1Q8IA 5ITZB 1YYMH 1CEZA 2CJUH 3K0YA 4IIQA 5AVSB 3WFZA 3I2CH 5JIDA 1JXKA 4HKZB 1QVOB 4D94A 4PTTA 2QUOA 3MDPA 5I74C 1PPJH 2P06A 4KO6A 2DRUA 4BE6A 2HVBA 4H8WL 4U1SB 4HPOL 5D7SH 5BNOC 1W0WB 3HB3C 2DQHL 5JW3L 1THCA 4WQOA 5GSRA 3WS3B 2MOQA 1OP5H 2VL4A 1KYAA 3TA3A 1NL0L 1ECZA 3DHMA 3U7YH 1CGVA 3MRRA 3VO0A 1AGBA 1YNTA 3NIDB 4BWWA 1IC7H 1ZVNA 5IBUB 1T1ZA 3IFOB 5IGXL 5IKCB 5FYCA 2BNOA 5GGSB 3MGTB 2D40A 1NGZB 2DTMH 2EDWA 3POHA 4HAGA 5L2KB 1SG3A 4IDLA 2B20A 1JF1B 2NY6B 3BESR 5FNVA 1J9CT 1K8DB 4YZFE 2Q86B 4YEFA 3VL9A 4NNXA 4FQIH 1P7HL 1IAIL 5DK0A 4RGOH 4FRWA 5ID1B 3GYRA 4X66B 3D39E 3QD6A 3BU0A 2LR4A 1I9IH 2NCMA 1RH8A 4TOYL 2C9AA 4WVMA 3QQDA 4CSTA 2QVKA 2Z0BA 3W38A 5GGSY 3VACA 4BYHA 1UL9A 4LK6A 2VLKD 1F35A 3BI3A 4PDMA 1KZYA 4EYUA 3MNWB 2GUOA 2ZKHH 3T8VA 4B4RA 3A4DA 2H1XA 2WM0A 1M57B 3CLWA 4N5ED 4Y1AB 1US2A 1WFJA 5CFDC 3VFSA 4ORFA 4ZPVB 2VQ1B 3NCCB 3NIGE 3J8F2 3QH3A 2ZEXA 2IXIA 2O57A 4DY3A 2YJQA 1TJIH 3RPQA 1M56B 4Y16C 2TUNA 4G42A 3CQPA 1KCSH 4GI8A 1DDHA 1MH5A 5DJCB 1DCSA 4ZS7H 1P7GA 2N3JA 3KLHC 1OLME 2HB0A 1XNDA 3HR9A 3ECVA 1DZQA 3ZLIA 4PLKD 1LWHA 1UA3A 3DWTA 2ARJB 2IADA 4HQQH 2P5BA 3PUQA 3ZTCC 5DVPA 1NFAA 3RRDA 1EVUA 3DV4A 4QXWA 3WJLA 3T3PB 5FOBA 4J27A 5IVEA 4BXFA 3PPSA 2RS31 4N1HB 2NY1D 3IJHB 5B1AB 4A7UA 1J8SA 1PMJX 3MNZB 4YHIB 5LGYA 1NPJA 1R5VA 1DL7L 2CM5A 4AUUA 3AP7A 3K1KC 1CT8A 3URFA 2YKLL 1J8KA 3ZRCC 2JJSA 2CRZA 3REWB 2CK3G 1WA4A 3GYDA 2H0EA 4NO2A 4Y5XB 3RWGA 2DZEA 1VE0A 2XXGA 1ULCA 4Z0XA 4JY6B 1ZV2A 3LH9A 1TQCC 5F7MC 1XVSA 1DZTA 3Q5OA 1W91A 5EZJA 2DOCA 5BNQA 4G72B 5KLVH 3GXIA 1ACXA 3KWWB 5HYFA 1SCRA 1G5GA 2D7FA 3KS7A 4FZ8L 3KVAA 5BNXD 5EZOH 4D3WA 1A9BB 4MJ4A 2MEV3 4R8HA 1NCDL 1QASA 3MLLA 4NIHA 1VP7A 1KTDA 1CDCA 4MJIE 3N91A 2DURA 4XJWA 5C3RA 3VXOB 1WFOA 1XF2A 5CCHE 3SGDI 1ND3C 2PR4H 4GO9A 1VBE3 4KHPB 1Y6KR 1B0RA 3CZUB 3H7BA 3FTGA 3WSOA 3QIUA 4BRVA 5L3BA 2FH6A 2HT2C 2VDMB 5E1GA 3N7LA 3FCTA 1Z9MA 3QQ3B 4JFFE 5D7JA 5IY5C 4EEEA 4CDQB 1K73W 3KYAA 4JJOA 3STZC 2XH6A 3FRUB 2CY6A 1G9NL 3R0RA 3HS9A 1LK2B 1UWEL 5B3NA 4B1LA 3GSNH 2ZABA 3AM2A 3WF3A 3IZOA 3BD4A 4PLOB 4PVMA 2EDQA 4O9EA 4NO3B 3VXRA 2NN4A 3P02A 2B4CH 3POEA 3DVIA 1MJUL 3C7EA 1TR7A 1WLHA 2Q5BA 1QLFB 3OR6C 3O2VL 4X7SH 4AEHH 4XMPH 4CU8A 4PJYA 1X5KA 2XG5A 5ICXA 3U0WH 1FO0L 2CPCA 4YHOL 3TBBA 2UUBB 3SGIA 4MHUA 3KYOA 1MCKA 3QWQB 4G71B 4K2UH 1MJ7H 4ZYKB 4QPGC 5ILTH 1L9PA 4DR5B 4MGSA 4BJ0A 2BNQB 5LGTA 1NH6A 4QHMB 5AKSA 4L8JA 1Q72H 4JYCA 1K3ZA 2B3IA 4AYFB 5JLVA 1IGTB 4PJ9B 5CEYB 1MFEH 3H9SA 3A23A 4D9LL 3MV7D 1ACYL 3C5ZA 1FIGH 1R3JC 4RA0C 3D25A 5F9WB 4E36A 1S6NA 1TME2 3ILNA 3NVQA 3FH7A 1RV6X 3QW9A 4LGRB 5DJ0A 4CCKA 1AYN3 4HIQA 4HLJA 2QNKA 5FM8A 3BQUB 1RZ7L 5EU3A 4BFIB 2E9JA 4S2DA 4PJHB 1LO2L 1QKZL 1OCZC 5D9SB 2TEPA 4DZBB 3A4EA 3Q8AA 4FXGB 3VI3E 1KBVA 2BCCH 3HUJE 4PJCE 2R063 4OCYL 3BIEA 1O5UA 5DUXA 4FPOB 2ZKLA 4J2QA 5EZIH 4JCKA 1YCSA 1IPKA 4W4OA 5SV8A 1OQOA 1CIDA 1UOLA 1AG0A 2C4XA 1BHAA 4P4KB 3VD3A 3WAJA 2FJHA 2DN7A 3FB7A 4E41D 4LF5B 3MYJA 4KTEH 4WHYG 5DLMH 2OYPA 3WO4B 5IMLB 1OLMA 5L7OA 1CQ9A 3I6GB 1G87A 4AQ2A 3DX0A 2K70A 3FFQA 1RPKA 5BVJB 5D1IA 4AG4H 4GI6A 2YXLA 1XD0A 3VA6A 3ZVVA 2DLFH 3MC0A 1BXVA 4HK8A 4FFVC 3RIFF 1AVBA 2E51A 2VW6A 1TLKA 2WLYA 3O6FA 3D12B 1T0OA 3GEFA 1I7TB 1P2CB 3ISWA 4LU5L 1BHGA 5CEXA 4URAA 3QRGL 4O2CA 3KGRA 3JCIA 4Q52A 4M01A 4LEBA 1GZQB 1ZVFA 4BKLA 1VGEH 4MX7A 3LCPA 2FGWH 4M6NL 4M7ZB 3LD8C 2RJKA 4TKWA 4V33A 1R24B 4M5SA 1HZKA 5FXWA 2UYLA 1LUWA 3Q8EA 1W15A 2H4EA 3P3UA 4LWSA 4O4JA 4RZKA 4XH2B 4PA7A 1HSAA 1Z5VA 1GN4A 4UQ9A 5J3HD 3WP3A 4ENEC 3KDMB 1VIWA 4QNPF 2WXRA 2NYYC 5IP4A 4YW4A 3SCFA 3FB5B 5DJ2A 4KK9C 5GRUH 3ZQWA 3EGDB 4AFMA 3WMQA 1CR9L 1UM6L 4K7JA 4CEWA 4L0PB 1Q90D 1OGSA 3NFPA 5SWZB 4RGGA 3WU2Z 3WFHB 1Z9SA 1LL1A 2YUWA 1NIDA 4YVUA 3V7AE 3VV1A 4WV1A 2XBTA 3MIDA 2XA3A 3ARSA 4XPTH 4YDVB 4LF3B 2HKFL 2VLJE 3RAJH 3QLQA 4NHMA 2WLLB 3UROR 3I6LE 2H32H 4I48A 4HNAA 1MWAB 1CFVH 1SXAA 5D1QD 2XY1A 4JI7O 4G8GD 5DU7A 2W5PA 4EVNB 3MW3A 4ZTOL 1IGCL 5DDJ3 1ZRFA 3AKPA 2XTJB 1E6JH 3U4KA 4EJ1C 4GRWB 4QDQA 4NLAA 2Z8RA 1QFWI 5AAWA 1REEA 3WQ7A 3AB0A 4UT9A 2R9HC 5AW8B 4IIQB 2WNGA 3FUOA 4YARA 4TNEA 3ETTA 2Z7UA 4Y9FA 3HQXA 1DTOA 1DEEB 3BZEA 1A3LH 2J42A 5FM5O 4UV8A 1IAMA 3OSVA 2VQEB 1H5BA 3QIWD 1H9WA 1RJ7A 3GIVA 3KPRB 5INDA 5JW4Q 4L8SC 4Q7DA 4B9GA 3V9CA 4KROB 5C7XL 5FMOL 2XVKA 3EFFA 3CC5B 1KIUA 3INOA 2AABL 1XGRA 3B8YA 4QNHB 2NY4C 4P08A 1CDBA 1LK3L 3LIGA 1UWGL 2CIIA 5GZCA 2BZDA 2X42A 5D4QA 5LA9A 4DKFL 5KJ7E 1TJGH 4UIMA 1SPPA 3C3VA 3OX8B 3VFMA 2ZXWC