4PIBA

Crystal structure of uncharacterized conserved protein pixa from burkholderia thailandensis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
176
structure length
174
Chain Sequence
SHITINVMTVIDVAAIIDELKAQEKKLGQTPDTATSIGHKYIYMSSDDPRGWSVDPGNITLNAHVGDTLSFFCASTSDNSEYAAFIYRLTGGDPHLDPSHVEVIKLQNAAQPTPSNGYPFTTAPVAFSSCDAKVAQQGQAKNFYVWAALFTLDDSGEKQVLAGYVKWDPTVNVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Uncharacterized Conserved Protein PixA from Burkholderia thailandensis
rcsb
source organism Burkholderia thailandensis
molecule tags Unknown function
molecule keywords inclusion body protein
total genus 41
structure length 174
sequence length 176
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2014-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12306 PixA Inclusion body protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pibA00
4LZKA 4PIBA 4Q52A
chains in the Genus database with same CATH superfamily
1WK0A 2R2HA 3KJ4B 3QXDA 1OY3B 4EOWL 3D33A 3R1GH 4AT6B 1UD3A 1VLXA 3RGBA 3FB6B 2H4EA 5HI3D 1A6ZB 2JCWA 1UEMA 3MJ8A 4GP4B 4LK4A 2VDLH 3W81A 3EJQA 3QUYC 4CA4A 3ABZA 3A24A 4TXVB 5EOCH 1VIWA 2F74B 2CRZA 2NDGA 4AMWA 1IKOP 3NAAL 3O2DA 1ZHLA 1SYVA 1AIZA 1Y18B 3DGCR 3ZUCA 3FB5B 5EU3B 4UAOB 1R0AH 4TPRL 3BFQG 5EEUA 1F5WA 1XGUA 4Z7VA 4A6YH 3QK0A 4LASH 3MSPA 1RZFL 3LEVL 4U1MB 1KNOA 1R5IB 1LO3H 2AXFA 4Z7UF 2IC2A 3FBQA 4H2AA 4R4BA 3QR0A 3GIZL 1H8LA 3QPXH 2AJZA 2GIXA 4YDLB 4G8AC 5IP4A 1GH7A 4G80B 3TU6A 3K1DA 3O9WB 1H9DA 5IKCA 3U9PL 1FVEA 1LL1A 4WI8A 4X6CE 2ZE0A 5C3TA 3H8NA 2F1BA 4M43L 4MLIA 1NL0L 2IFFL 2ZUYA 3FQTB 3QPKA 4NQEB 3O41B 1P6WA 3GMOB 1HHGB 4G6JL 2X40A 5LCVL 2VH5H 1MLBA 2QMJA 3FO0H 5EA0L 4RRPG 2JKWA 4Q6IC 2FX9L 3QFJA 5L4JA 1A4CA 4E42A 3SYAA 2DLIA 4ADIA 4FNLL 1QSFB 2FBJL 3DX8A 4HUUB 3F58H 1G7LB 2EILB 3SKJH 1U3HB 4XVTH 5C0AA 4FZ8L 3LKPB 4YMPA 4ZPVA 1MFBH 3N55A 3VFRA 1CGUA 1H0DB 2HRGA 3K72A 1Z0NA 1S5HB 4IBQA 2XZCL 3HPLA 3NK3A 5EUOB 4WEBL 3LZLA 4YE0A 1X7QA 3CLEH 5DR5H 3WLBB 2XFXA 4WTQA 5KJRL 4OZIB 1T7XA 4KTGA 4PJHA 2FWSA 1YEHH 1J1OH 2EIZB 3NPSC 2ADJB 3HIZA 5K93A 3T4YB 3U48A 4LP5A 1BXXA 2ZKXA 3MGTA 3WENA 2Z93A 3M1BB 4P3CH 2VUOA 1KY7A 4OFYA 2G9HA 2L04A 3IDXH 4HHWA 3PL6B 3DPBB 3FYEB 3TF4A 3NCMA 4FI7A 4HPOH 4HUWA 1JMXA 1W6LA 1T0NA 3SBWA 5GSRB 4N2IA 3HE6A 4L1LA 4QYOB 2UYLB 1BVKB 3L1OH 3ULVE 3VDCA 4BFIB 1MJJA 2K8MA 1AS8A 4FCAA 3T1FB 4F2ME 2PPAA 3QWNA 4FHBD 4NN7B 1OGSA 3HMWL 1S7QA 4FFYA 4L4TA 2PCFA 2CKBA 1QLRA 2EDKA 1DJYA 1U8HB 1TCRA 2DQMA 3QG7L 2BERA 5KS9E 2FT8A 3B9KC 4BKSC 1CE6B 5A2KH 1JDCA 3WIFA 3PNRB 3H9SA 2EDYA 4HUVA 4E9TA 4JCMA 1G6VK 2VR3A 1SRDA 5AWNH 3W3BA 3QO0A 1SDYA 4PY8I 3MLWH 5JHDE 1MCFA 3RIKA 3TIEB 3VTTA 5ICUA 3VRIA 2W9EL 3L3JB 2A6IA 3HHSA 4GQQA 4PFEA 4UT6A 5BO1H 4LHUB 1OALA 1WBXA 1CFSA 3WMSA 2NPLX 1U8CB 3KCPA 3N0AA 1OTTD 1XH0A 5ALCL 3MRGA 3NRPA 2Z6FA 2V2TB 1JPSL 2NDFA 2DLHA 2P52A 3WFCH 4KO7A 1TKWA 4WFHE 5HYQA 1PKQA 1PNCA 4ODVL 4R90H 3ZIMA 5F7MC 5ADPL 3D09A 1TQCB 1XZ0B 2QMKA 4TNFA 4EQ2A 1EFXD 3QSKB 2B16A 2XWCA 1CFBA 4L8BA 2VDNL 4LKCB 4DKAA 1IQDA 3NIDF 4FJ6A 4KUZL 3MBED 5D93C 3SBPA 5F3BB 3O45B 3TBWA 3OAYH 4JK0D 1GGBL 4FMKA 4MA7H 5T33L 2NY6B 3SE9L 4K2UH 3VXME 3TEXA 3RJOA 3DJSA 3W11C 5IBTH 1EXHA 3PWPE 3IGUA 1TENA 1Z7JA 4KJPD 4G8GE 4X4XB 2Q6WA 3T0XA 5M7QA 3S8GB 5C0AE 3PY9A 2W9DH 2OMUA 1OF2B 1F90L 5DRXA 5IJDC 3TO2B 4XC1L 3LRHA 1UXWA 2OMYB 3QEHB 1KBGH 2OYMA 1ERNA 4A7GA 5D7JB 4H0LC 2R27A 1K8IB 1KGJA 2AXGB 4ZTPL 3MLUH 3THML 1YNLL 3PNWB 4ODUB 2BHYA 4XMKL 1U8LA 1TF4A 1FNSH 3II2A 3AZUA 4Z7IA 3J07A 4NN5B 1GZPA 4UAHA 3C87A 3D0LB 4YHPA 3HS8A 2Q2EB 3I6LD 1SGKA 4GKZB 4OCYH 2E8ZA 4RDBA 5J6GB 3ETTA 4KRPB 2QV4A 3EH5B 3VGEA 4CL7A 2FQFA 5ECJE 1PY4A 4P57B 2X4UA 2ENYA 2IWGA 3UMTA 4F7PB 4HK3N 1TXKA 5C0JA 4TNWF 1KIQB 3OJ2C 2MNWA 2VSCA 2R69L 2JJTA 5GS0C 1YMHB 2P1YA 3UCRA 1WICA 3G9AB 3MA9H 3QWQB 4XWOD 3FW6A 2XV0A 1NWOA 2DTMH 3BAJA 4PTTA 2XWXA 4H8QA 4O58L 4ZUUA 3S6CA 2RACA 2OZ4A 3HC2A 4CVWA 1HYSD 5GRZA 4APQD 3ARYA 4DEUA 2HFGL 5D1XB 1XCTB 3CLEL 3CVHH 3WS3A 1D9KC 3V7MA 4GRWH 3EHBC 3H3BC 4YPGB 5BPPA 1OWRM 4LVNC 5EDXA 1FLRH 3QIWD 2MCPH 1JFQL 4ZMXA 3C60D 1CURA 3GB7A 4FFWD 1ZGLB 5F8RC 2IAND 4UB0L 4NC2B 1C7TA 5KYUB 4NQSA 3Q5TA 4MYPA 1BIIA 1SMAA 3NTCH 4LCWD 1U92B 1ZJBA 1EPFA 5CBAB 2E59A 2HB0A 2FZ3A 3IFLL 2ZXAA 5I6KA 1EK3A 3PWPB 1YECL 3EOBA 4ZTOL 4J3OG 1F4YL 1FNGB 3F5WB 3MXVL 4CC4A 4D7PA 2WHVA 4NC1E 2ALWA 1VB9A 1FYTA 4OJDH 2J4WH 4K7PH 1MFUA 5DD6B 1JPST 3O4OC 1KXHA 1FZKA 5I1AB 3BZ4B 4F3FA 5I16B 3VW3H 2P4AB 3F00A 3H0TA 4UT7H 5D7HA 4ALAC 1RHHB 3IDJA 1CDYA 5FUZL 3FRPB 4BFFA 3U30C 1ZV2A 2W88A 2APVA 3JV6B 2WBJA 3UPRA 1HJCA 3GSNA 2DQUL 2YZ8A 4G1MB 4RWYL 3CLWA 3EXJA 1MCLA 1YUKB 4K2UL 4BFJA 2A83A 1R3LA 4HXAL 5JZ7D 3LVEA 5E08L 2F58H 4NP4H 2DBJA 1CG9B 2XOTA 1G1KA 3DHMA 4S1QH 1LNUB 4QTIL 1L6XA 2R8SL 2PTTB 4MCZB 1MUJB 3IDYC 2Z31B 2XPYA 1HH9A 3CHSA 4KZCA 4C4BA 5K39A 1PSKL 2AJVH 3QJTB 2QHLA 3SPIA 2Q7AA 4U6YA 5D7IF 4JM2B 4UANA 4JO4L 3RIAF 3Q44A 3TT3L 5I0YA 2R1WB 4YK4B 3IN2A 1J5OL 4GFTB 1YQ2A 2OFQA 4NNXA 1P84J 3E0GA 2ZX5A 4FNUA 2VDNH 4I3SH 3ZYOA 5FB8B 4HXBH 32C2A 3IMTA 5E6YA 4R0LB 3IGAA 1JGLL 1KZQA 3FT4B 4UQ2B 2W9LA 3RVTD 1D7BA 2GJ6D 1ADWA 5HHME 5A2JH 5CM1A 2IAMB 2WIMA 2VJXA 2J2ZB 3RWEB 1IRAY 1F6FB 3HMWH 3K8LA 5JPMC 3T1WA 2BNQA 5EU4B 3VD7A 2HX7A 2ZKWA 3MBEC 4ELMA 3S37H 4G42A 1KT2A 1I8MA 2HKFH 3FOLB 4AYDC 3WKMH 3U46A 1UM5L 1THAA 3HI1B 1R3HB 3W11D 5ESAA 3SOBH 3C8HA 1E4XL 1R17A 4Q9QL 4LOFA 5HYJE 5E6ID 5B4MC 3L16A 5JW4Q 1ZK9A 3WL9B 4U1HA 2WAHA 2PCYA 3HN5A 5H8DA 3I9AA 2YSTA 4FQXB 4JDTL 5DI8B 4M4RB 4KRPD 4V1DA 3WSQL 3GTTA 1PY9A 1NFIA 1RUKL 5ALBL 3RTQA 3A6CL 7PCYA 3QQDA 2ZG3A 3VXSA 4PRID 3V0IA 4GG6F 1N6QH 2Y2WA 3D25B 4BH8A 1A6TA 1JNLH 2Q76A 3TO4B 2FX7L 4ODVH 2CMRL 4QTFA 4PHXA 1G7QB 3REVB 2YPVL 3QHZH 5JQHC 4FTVD 4E5XG 2DQHH 4LBEB 1S7RB 3HFMH 5KVEH 5TDPB 4PLOB 1CJYA 3BO8A 1ND0B 3CFDB 3V4LA 3IKCA 4XZ4A 4PTUA 5DZ9A 5TDOA 4JREC 1P1ZA 4WW1A 4BCYA 2E7HA 4LL9A 1A1NA 2WXHA 1A9VA 5HJDA 2BFVH 4OB5H 3MRPA 2J55A 3MODL 4PS3A 1TETL 1DVFA 1HZHH 5J11C 2NSQA 3UTSB 4JRYB 2K9UA 4WIQA 4KX8A 4WHTB 3GZQA 1ZE3C 2OMVB 1J0HA 5DF0A 1V7NH 4PJGB 1HCFX 4MXVF 1BSIA 3GSWB 4APQC 5JW4N 4LNRB 4W4OA 1AGDA 2QJDA 3PAZA 4PJ7E 3BXNB 2IPKA 2AXJA 3SCMD 1CFTA 4L5FE 3AADB 2EEAA 3KYMA 3MREB 3BAEH 5B38G 4K15A 5FW6A 2OS7A 2VRAA 4DUWA 4EI6B 3O2VH 5EV7A 2A1WH 2Q8AL 1FIEA 2K45A 4Z7VF 1E5ZA 4FE9A 3RP1A 4ICWA 4QHKI 1EZVY 5DJCA 1AI1H 1LM8V 4MAUH 1RZGA 4PJ7A 4L8DA 4DESA 4HJ0C 4Z76B 5EU5A 2GAZA 2R1XB 5EB9A 4FDWA 1A6VH 4JFQA 2Y3AA 1XFPA 1QO3A 2G60L 4P49A 3DUHA 3TN0D 3UL4A 4A6YL 2F1EA 5FGCB 1UD8A 3CFKA 5DC9B 1MREL 3WIHH 1A7QH 3NOIA 3APCA 3GWJA 3QAZC 4QGTA 4XP5H 4N1CA 3F12B 4IU2A 2VUKA 3HR5A 3SOTA 4KK9C 4GI9A 3BVNB 2B39A 3P1VA 1M3JA 3GI9L 3S37L 3ARGC 3OB8A 4H8WL 1BZ9A 4F7TB 4U6XA 5HHOD 2YN5A 1EA9C 4N8UA 2RR3A 4MS8D 5B1JA 43CAA 4FNRA 1H3TA 4A6YA 1E67A 3OQ3B 2ENPA 3QRGH 4PGDA 1UZ8A 4PJ5E 5JZ7C 3D3VA 1OTUD 4ZQKB 4QXGL 3ILQC 2QFPA 1NGYB 2WUBL 3PGDA 4KHTH 2WXPA 4XTRD 1MCPH 2A77H 2FJHB 3ZE0E 1J8SA 4FQ2H 3MV9B 4XB3A 3EGDA 4MAYA 4LAQH 4WV1A 4WEEA 1ETZA 4OQ1A 3P2BA 5IT2H 4WI7A 2LU5A 3CNKA 1M6OA 1OSYA 4DO4A 4HIEA 3FQYA 2VLJA 2VXUL 4K5NA 1WGOA 3BUIA 5GGSA 3WNKA 4PJFE 3AG4B 2NW3A 4A7VA 1CGXA 5E5MB 1NDMB 5T1MA 4OGYL 1FNEA 4GG6B 1BZQK 3NJFA 1A6AA 5FOJA 4Z7OF 3H85A 4IJ3C 1RZJL 4HHAA 2BRQA 2X4PA 4JFFE 4PRHB 1FE8L 5DWUL 1NBZA 3GC3A 4QHKJ 3BCFA 4W9DC 3V0EA 4CGTA 1YNTA 3S88H 3U2SA 1MXGA 5B1JC 4ZZFA 4E9YA 3GHBL 3MRJA 4KTDL 5ICXB 1XGPA 3Q8BA 3VVWA 1UTDA 2CJUL 2LW3A 4EEEA 1A5FL 4U7KA 2YPLB 2FO4A 2I85A 2FX8L 2ZOKB 2BOBB 3FQRA 1O9WA 1M2OA 1X5FA 3EAKA 1S46A 5JQIB 4GW1A 5F71A 4J1UA 2XXMB 2CA3A 3FT3A 1OP9A 3FTGA 4TQ8A 1AIFB 5CS7A 3VRLF 2CO7A 3DK2A 4B0MM 3T8MA 4CU7A 5B1KA 4PV8B 4UQ3B 2LLNA 5F7DA 2QPSA 1EDYA 5TGBB 4KAQH 4Y16B 2J8UB 3QO1A 4RRPM 2L7EA 5K59E 1A9BB 5E6RB 2Q7NA 1Q9KB 3HUJE 4E41E 1IM3A 3S3PA 3RPIB 5AW1B 2ZKMX 3CZSA 3CN4A 4F8QA 4PRPE 3AS1A 5CIPA 1N10A 1G1CA 2EKSB 3T0AA 3JWOC 4WK0B 5MEPB 2OQJB 1MEXL 1I31A 1HNYA 2R1YA 4ODXA 5D5MF 5DA0B 5G2NA 5JIPA 1OAYL 5DK2B 1BD2B 4NQTA 3AG3B 3B3IB 3R19A 4BSWB 1M7XA 2K4WA 5JUEH 3HZMB 1KCRL 1T83A 5EO0B 2RALA 2RFXB 4GPVA 2Z1PA 1O7SA 3M7FB 2UZYB 3KXFE 5DJXA 1ZLUK 1C5CH 5F7WC 1RZIA 4BWUA 3ZE0B 1KEML 1FV1B 3F65A 3OKEB 4JHWL 4GSDL 1MCKA 1WHOA 3GINA 4IYKA 4JFYB 1XF3A 1T20B 1ONQA 3NJJA 5IK3A 4RMVA 3ETBJ 1Y0LB 3UJTL 5K9OA 3WKML 3BVTA 3VH8A 2WJ7A 4UT6H 4WO4C 3HG5A 2JB5H 2YXFA 4P2QE 5A2FA 2K1MA 5MI0B 4JQIA 1RV6X 2BNRD 4EN3C 1ECZA 4HSAC 5A2LH 2ILLA 1ZEAH 5H94B 5T5NG 3L1FA 3U0WH 3BZ5A 4H13C 4HU2A 2HFEB 4PJAA 3SCMC 1T21A 1UWGL 2ZPKL 3D34A 4ELME 1QFUH 5HJBA 1T0MA 3ERXA 5C0GA 1IUZA 3N50A 1AOZA 4YEFA 2IGFH 4ODHL 3TO4C 5JW5B 3PYCA 4BZYA 1S7TA 2NUPB 2NY4B 1RIVH 1VFBB 3Q13A 4HIQA 4Y5XC 2ZYSA 5HGDB 4JPSA 4XMKH 5SWSB 4BHUI 4ZS7L 1FFPA 2GTZB 4P3DA 4C56D 1HHIB 2VXVL 4JLRA 4KV5E 3FCSA 1AZVA 4NO2B 2R4SL 3VWKB 1EAQA 3OX8A 4OLUH 1JNJA 4OF3A 5DEZA 5I76B 3P3SA 1JFQH 4LB8A 1QBMH 2JSFA 4NOFA 5DD0H 4YDVB 1R24A 4WJG3 1FP5A 1SHWA 4OCNC 2VLJD 4IRSD 3KS0H 5HHPB 2W9DL 3BIBX 4F8OA 1E4WH 2B20A 3WU1A 2W5PA 3PXLA 2ERJB 3SD5A 4GW4B 4K8RL 4PU2A 4X6DA 5KBNC 1F11A 3VMNA 2KYIA 5B21A 3X13A 4U6HB 3S48A 4BZ1A 1CVSC 3GXFA 1ML0A 1P4IH 4KGLA 2F7RA 3C2SA 3TCLA 5IHHA 2GQHA 4Z7WF 2V7HB 5J13B 2H41A 2EE9A 1IGCL 1ESOA 2VE6B 4DCQA 3M1OA 4G8GB 5DZOA 3TV8A 4LLDA 3DX1A 4ZUSB 2A9ML 4OR1A 1U4EA 1I1CA 3SE6A 2Z0UA 3ZU8A 4RDQF 4I18C 5L2JB 4I0CC 2AV7B 5FW7A 4JHAL 3L3DB 3VFMA 3L7EA 4Z7UA 5FLVA 3RG1C 3VXUA 5BVJA 3EFFB 4GH7B 3LKSA 5DZLA 1D5ZA 2PUQT 1DO6A 2JNZA 1D5MA 1GMEA 3IBOA 4X98B 4RNRA 4G9DB 2YR3A 4RZCA 3L5HA 4AQEB 4M1CC 5E6ZA 4ANXA 1CD1A 2YGVA 4P9HL 4AIOA 2O5ZL 2AEOA 2XN9A 2HPOA 2OMXA 4NBZB 2VNCA 4KROC 5ACZA 2WNKA 4HZAA 3D52A 4JREB 2XRAH 4M48L 3UTZB 3CSYB 1VSCA 4JANB 3A5VA 1TG8A 4H4NA 3CFUA 2ZUSA 4XOAA 1IGFL 1AXSB 4U3CA 3AM8A 4JN2A 4TSAH 1JUFA 4N22A 4P46A 3W5NA 1HTYA 5DFVD 4AMXA 5I1CL 2NY6C 2Z8VC 4FZEL 1J9CT 3DO7B 1HQRA 2DQTH 3KW8A 5I66A 3IS0X 2Q3XA 3EZ8A 3JWDL 3L5WB 4E41B 5HPOA 3PXHA 4PJDE 5JO5B 4AEHL 4XPAL 1ZRUA 5T3ZH 1CXFA 4N68A 2BHFA 3RI5F 3GXTA 3RWFB 3TA3B 1RK7A 1HI6B 2PO6A 3Q2LA 3ARDB 4J3WA 4M7KH 5GS1A 5L7XH 3ULVF 1JF6A 5I1EH 4KC3B 3NDYE 5JOEA 3B9EA 1HEJC 1KY6A 4YE4L 1RMFL 3ESVF 4ZRGA 1QLFB 4PRBB 2LE9A 2R29A 5LBSL 4ZFOA 3MQIA 2AFNA 2OZNA 2NY5C 3ARFA 3Q9PA 1IMHC 4Q9CA 1JZHA 4PCSA 5EF1A 4FKEA 3SYCA 1KLGA 4EO5A 2BIHA 5DRZB 1V3MA 3VI4E 3FO2B 5GISH 3UZVB 5BOJA 4PJCB 1DQDL 1NMBH 1HE8A 4LIQH 1UFGA 2CJTA 3WV0A 1YNLH 4QY8B 1JGEB 1FZJA 2IPTH 1N6VA 1F6LL 3W9EA 3FU7B 4M3JA 4YHNA 2HYMA 4DVBB 4R83A 2MKWA 5ESVA 1AD0A 4MB1A 2C9QA 2J8UF 2AHIA 4OB5L 4PJBA 3DHPA 1QOKA 4OJYA 4P5MA 1KJMB 4ZUWA 4P4KC 1CLOH 1QRNA 4BELD 3TC9A 1WT5A 2G3MA 2IMMA 1IAOB 1OSPH 3BAKA 4L23A 3BGFC 3H7BA 2YQ3A 3ZL2A 2EDJA 3ZMNA 3WKNA 1H6TA 4OT1H 1FSKB 1CR9L 2ENSA 1TYJA 3QI9A 4FLSA 4NI6A 4WO4D 1HEZB 2HA1A 1NBCA 3MA9L 3CHOA 4NRYA 4WKXA 5JOPE 5DFWH 4FXGB 5HYFA 2V2XB 3S5LB 4M6ML 1R3JB 1KJVA 4NQCE 4ZW3A 5AOIA 3WDJA 2IWEA 3RUGF 5C08A 3E6FB 4KKLD 5A2AA 2D7NA 1WA1X 3CVIL 1HSAB 4X9FA 4ZNCD 1OGAB 2NY5H 4K3HA 4H1LA 4YHZL 2ZYRA 3NZHL 1T4KA 4HK0B 5E9DB 3UBFA 3FU0A 2J8HA 3CDFA 5FYJU 3TO4D 1MFDL 5ISZA 5I6OA 4KBPA 1C1EH 2X0UA 3CLFL 2CJSA 3UEQA 1AE6H 1C12B 1PZ2A 2XFGB 3MHZA 2CKBL 4G6KL 1HS6A 3LH9A 5I1HL 4KXZI 4HD9A 2YPVH 3HG0A 2XETA 3SDCA 3IMSA 2EH7H 1KV7A 2BVEA 4G8IA 4P2OB 3QS2A 4Y2NA 1QVOA 3MLXL 2EYSB 3GGWB 4LCIH 4ZOBA 1H15B 1JXKA 3G6AA 4KAQL 3VXPA 2NCEA 3ZE2B 3KPNA 5EORH 4YN3A 5JW3H 5KVFH 3C6SB 1ZHBA 2IO5A 3PJLA 4M6AA 2YUWA 1Y1DA 3QDJB 2X4OB 1Z66A 1MFEH 2QTVA 2YGQA 4K07A 2FNBA 1BXVA 3RU8H 4D9LL 4R7NA 5AVSB 1WWCA 5C07B 1U41A 3D85A 4QHMB 3SDCD 1HIMH 3FT2B 1BZ8A 4WF7A 1DQJB 1TNNA 1JWUA 1BX2B 3WUWG 4PRIB 2PPCA 2PW2A 3MNZA 4DK5A 1WFUA 3QP3A 4GAYA 4PJIE 1N5YH 3DUUB 3GMQA 2B2XH 3O3AA 4QOKA 1E9PB 1TIUA 3MX0A 2D2OA 1UADC 2D8KA 3G5VB 1IC5H 4MD0A 3P40A 4XCCH 4LSRL 2J1XA 4MJIE 4RRPA 5D4IA 4FEMA 3A3YB 1TQTA 2R15A 2AK1L 5I23A 3W39B 3QHFL 3M7OA 3B9DA 5E2WL 4NI3A 4NQCB 3F64A 5KZCD 2YUXA 5D1ZB 1GC1C 2WUCL 1DDTA 1YLBB 5KVGH 2W9EH 4PY8J 5I8EA 1W72H 1QZNA 4X8JB 5L4FA 2CBPA 2XA3A 2EXWD 5IOPA 1UA7A 2I32A 2R69A 3BN3B 3DBXA 1KENH 4WU5A 5GRXG 2D0GA 3T0EB 4L0YA 3DV4A 2C9XA 2X4SA 4MQ7B 4HEPG 5FYKL 2OMNA 4HMEA 4XN8A 5E4OA 1P2CB 4KVCL 2AQSA 2CKBH 2P26A 4G6KH 4Q6IA 3S34L 1RK0A 1CL7H 2X7LB 2P45B 3RUGA 4UILH 2NY6D 4XBGA 2I7SA 3J2PA 4OZHF 4IHOB 2VC2B 4Z77B 4UMGA 3TYFA 1AP2B 4B9PA 2VWEE 3AB0B 1MRCL 2QQKL 4I0PB 4LQFH 2VR5A 2KLRA 5C0IB 3NABH 5DGRA 2WCPA 3T6QC 4XBGB 1IGMH 5JHLL 3VI4B 3S4SA 3A47A 3NFPB 4P2OD 3KPLB 4ZG1A 3MGAA 1MNUL 2OPCA 2IWFA 4RMTA 3HRZC 3RNQB 3HG3A 4XC3H 5F6IB 2QADB 3UTTD 3TBVA 3TBTB 1HH6A 5C08D 5IOPB 4X8JA 3J27A 4Z8FH 4EF3A 3MUY1 3QUXC 5D6DA 3SY0B 1OCCB 1PCXA 2G30A 3OL2A 4N2EA 4QF1A 4UOJA 2CH8A 1CB4A 5CN3A 1LILA 1QHOA 3KDPB 3R4DA 1JGIA 3T04D 1WT5C 2VR4A 2APXA 2VLMD 4Y89A 3MJ9L 3TJHC 3ASNB 4N20A 1S9XA 4P4KD 3T65A 5J13C 4MD0B 5CJBA 3G5VA 3HFML 4ZAKC 1XAKA 4I9WD 3IMUA 3MX0B 1D5BA 1J0JA 5FK9A 1CFVH 4MAZA 3OWRA 3TIDB 3S8WA 2F9BT 4GAYB 5CSGA 3ZO9A 4QTHA 2P5ED 3LXAA 4JVPA 1JWUB 1DQJA 1NCCL 3CHQA 3O9WD 3D4ZA 1T7VA 4QHMA 4TN9A 5IVZB 4PG9B 4W9CC 5B8CA 4MSWB 1S7UA 2J1KA 2ESVA 2WXOA 5IROC 2Y6SC 1TCMA 3DI2B 1J8HD 3IFNH 3NJLA 4MCNA 1UD5A 2WINA 2MCAA 4OGAC 1NTDA 3U36A 2BXYA 5DQJB 3RBSA 3TT1H 4MNHA 4ZNEE 1WUZA 2ZD0A 1M7DB 2VZ1A 1WE5A 2ZYHA 1H15A 1XTMA 4F15B 1XV8A 4WHYG 4MQXC 3QJHB 1ZAGA 5ACMA 3NABL 2ZXGA 4AQ8A 4GRWF 3GO1H 3LX9A 4WFFD 3UZQB 5M95B 1O6SB 4JFZL 4N3UA 3KJ6H 4LCCB 4U1GB 2Z35B 1FL3B 5MEQB 2IDQA 3NRFA 4HK0A 5E9DA 2C3XA 4RMQA 3STZB 4H1LB 3UGXA 3KPRE 2ED7A 4R9HA 1E5CA 3BP7A 3K2UL 1HSAA 3D6GA 1IGCH 2NZIA 2YD7A 3DRQA 5FYKD 3V4VB 1KJ3L 4BFOA 2YPLE 5T3XE 1IC5L 1K8DB 4KZEH 1NBVL 5C08B 4TTDD 1OW0A 4XP9H 4Z7AA 1SJMA 5GGTH 4GOSA 4N8CH 5F7LB 1TZHA 4PYHA 3ZJAA 3GHEH 1YEFL 3K3QA 1KB5A 4LLUB 4TKWA 1ZT4B 5ESQB 1OSEA 3SE9H 4XNQA 3U4BH 1EEYB 4S1DD 3UP1A 4EKJA 1HEZA 3O3EB 1NGQH 2A9NL 4G8EA 3OGOE 4AI7A 5J1AB 4XC1H 4KU1A 1SPDA 5I1LB 1Q4NX 1YEGH 4K73A 4EI5D 4PGCA 5K9JH 5GJTH 1CFQA 4RAUB 4XNUL 1BZ7A 2VDNB 1IAOA 2YXWA 4X8XA 1QRNB 2XXFA 4PJ9D 2V5YA 5E6SB 3TT3H 2V8MA 4ZMPA 5IB1B 3FU3A 2N0MA 2CO6B 3RQ3A 4PD4J 1AD0B 5TF0A 3U6XA 4P2YA 3IVKB 2HRPH 3IF1B 2GSGB 4UDTB 1F4HA 4FA8A 1SMOA 1FZJB 1JGEA 1A47A 2M83A 4G72B 2J21A 5CD3B 3SPVA 3AWFA 2J5WA 4PJCA 5I9QC 1F56A 1MIEH 4JG1L 1NC2D 3K6FA 3EDEA 2ODHA 5KJ4A 2IXQB 2JIXB 5SX4I 1CN4A 3NK4A 3GSUB 4XCEA 3US1A 4L18A 3ARFB 4W9GC 2OSWA 3QDHA 1L5GA 2NY0B 2YMOA 1TOXA 3QZMA 3IU3B 2O6EA 4OKDA 3U4BL 1SY6A 4KVNH 4ZFOB 1PZDA 4KK5D 1J1PL 2ZSWA 1XGZA 1MCBA 1Q94B 1YCSA 1XSKA 2IQ9L 5IHWA 3ELQA 2VM9A 3FTSA 2QDWA 4NZRH 1K4CA 3BUQA 5KOMC 1I8UA 3NJXA 1QSEB 4KRMB 3N1MC 5AZEH 4UQIM 3RTQC 4YSEA 5LQBH 1HI6A 3MBXL 2B9BA 1G87A 2ZOOA 4L9LC 4OLYL 4XI5C 3TA3A 1X5ZA 1GSKA 3LHPL 3NN8B 5HHQB 1U30A 3IFOA 2GUOB 4DUXA 2WXQA 2ZJSL 3W56A 3DO7A 2WPGA 3EGSB 3TVMA 2PWHA 3RURA 4P46B 3IETB 1B0RB 5EU6E 4YXKL 5D4JA 1RI8A 4JO2L 5CSZA 4H7VA 4F37F 5EULV 2G4GA 2D03L 5IR1A 5LXVA 1OF0A 2RHEA 1GYWA 1GTFA 2OMXB 2FO8A 4IBWA 4NQVB 1J0KA 4NOBA 4Q4EA 4AIZB 3IU4H 5JUEL 1A3LL 3DSFL 2EEDA 3U7YH 3UX9B 4AQEA 5MHSE 2R69H 2QVIA 3B2PA 4WNSA 4WEBH 4K9EC 5E03A 1XF4A 3Q6GL 5BV7H 1T6BX 3JTSA 1I1AD 3FO9A 4LSSH 1IBBA 3BJLA 3LKSB 1IC7L 2MHAA 4CC0A 1Q9LB 5H2BA 3L7EB 1B3JA 4Z7UB 3VFMB 2BRRL 5D6CB 3NFSL 4BE5A 2IH3B 5E8NA 5L2JA 2WKOA 3ZO0A 4EI5B 1CZ8H 1SJXA 1CFMA 4ZUSA 5DEFA 4TRPL 4YDIL 2VE6A 5TPWH 1RH8A 2X9XA 4TS6A 3UG4A 1B9KA 5JOFA 3FCUB 5BQ7A 4ZSOB 5IV2A 2BS71 4OM1H 3SDDD 5KN5B 2BNQD 3SPGA 4UTBH 2FE0A 2GBUA 2VLRA 2BHUA 3QIUC 4U6HA 4UOW1 3S3SA 2YC1A 3S3BB 3IM1A 2HKHH 1B6DA 4X6DB 5D1ZC 4DVRL 1CDIA 1X6LA 1T2XA 2WB7A 3C5XA 4UDUA 3HNSL 4J3OC 3SDAA 3QUXB 2VERA 5GZND 4F8TA 2VLRB 1XBRA 1QFOA 3ARBB 4ZZKA 2XY1A 3LEVH 1FNLA 4ONFL 5KN5A 2VW4A 4JPKL 5IV2B 4CJ0A 5E1AA 3QFGA 1BQ5A 4HT1H 2QVFB 3DVNA 3DOSB 5DEFB 3AFLA 3T8VA 4EI5A 3VWKA 3AITA 4DPAX 3RWCA 5AFAA 4P3DB 4LP8A 1DZ0A 1FFPB 3FZUC 1E28A 3H54A 3NJKA 1CTNA 4WGWB 1QYGH 4HXAH 1MWAL 4M9OA 3JTSB 3WEXA 3WFBH 1RCYA 4F37K 3FT0A 1KIUB 5G4NA 1RUQH 5AD0B 5C0GB 1UA6L 3BWUF 3SO3C 2Y69B 4NQVA 3L3IB 1DQLL 3ZSSA 4QRQB 1VEOA 1W15A 3HI6L 3OR6B 4PJFF 1JJUA 4NUMA 2ZUXA 5H94A 4TTDC 5DFTA 4ANKA 1RULH 3HC0B 1VZHA 3BSZH 2Y36H 5CSZB 1GW6A 5AVYB 1FAIL 2DB8A 5I6NA 4DP0X 5F96H 2NY2C 2OZ4H 1LLAA 3IETA 1ZTXH 1WEJL 4KX9A 4XNXL 1NKGA 2WUBH 4W9FC 3CFTA 1QASA 4LLQB 1G9ML 4W6YB 1NC4D 4MHHG 3NN8A 4EZMA 5HHQA 4EI5C 4JGNA 3X2QB 3C5ZD 5KS9B 1W6WA 4X4MA 1XF3B 1VENA 5FYLH 1AH1A 5F9OH 1XIWD 2UXTA 1IT9H 1QSEA 3WIHA 3HE6D 1CU4H 4AMKH 1LTXA 4DP7X 4JO1H 5J7CC 2VM4A 4N0RA 2RFXA 4DERA 5EO0A 2XPGA 3ARSA 1CWVA 4PS4H 4JO3L 5EZOL 3RZCC 3B3IA 4FLHA 3PP3H 1OCOB 3KLLA 2IXQA 2JIXA 4R4ND 4ODXB 4G6FD 1BBDH 3QC6X 5B1AB 1U8OA 3OQRA 4HIPA 2HUHA 3BT0A 5JMRA 4GS7C 2DBLH 5F1NB 1GIGL 3H9SD 3RPIA 3CE1A 4BUHA 2B8OT 3AVEA 1OGAD 4FG6C 4NAJA 5IB1A 3DJZA 2J8UA 4Q9BA 2DIEA 1BJMA 5C0FB 1MQKL 2YRLA 4PV8A 1S7XB 2E6JA 4HKJA 2CCWA 2CO7B 3ZR5A 1AIFA 1N68A 1BZ7B 5CD5C 1UH2A 2BSEA 4J1UB 4GW1B 2FECI 1F42A 4MBRA 3IAGC 3BWAA 1F3JB 4XP1H 3LD8B 2ZOKA 2FGZA 5J1AA 2JKJA 1UD6A 5GPRA 3QQ4A 4C56B 2NYYD 2VDQL 5CJOH 5ICXA 2JXMA 1ZV5A 3QCUH 3VSVA 4MCMA 1KB5B 4FNPA 1EVUA 4JGUA 1YNTB 2XC8A 2AQ3A 3HZKA 5DC0A 1G6RA 4GQPH 4PRHA 4J12A 4GKOA 2DLGA 4CSPA 4F33B 3QI9D 4WO4A 4ZAKB 5I8OL 2MOVA 2AZUA 3UFIA 5ID1A 3POCA 1G9NL 2EE3A 4GG6A 3Q1SL 2WWMD 2BSTA 1IB5A 2NXYB 2VQ1A 4OQTA 5F88A 4A2HA 3II1A 3K74B 3MLZL 5GGSB 5JA9A 2CNZA 1RUKH 1W9XA 1KTLA 4OIFA 4ONHB 4QR7A 3RI5K 2FBRA 4HIEB 2DL2A 2Q0ZX 1NQBA 4N26A 1I1AC 3FONA 3HC3L 4XXCA 2GHWB 4LCCA 1AHMA 3QRBA 1O6SA 1QWHA 1OSPL 3DI3B 4FFZL 4AJWA 1GW0A 4OD3L 1FNFA 1ZT1A 2OR8A 3EGDB 4LHUD 4K3DL 4GO6B 1BAFL 1E7UA 5I1IH 1FFOB 1RZ7H 1M7DA 2E46A 3D3VB 1GAFL 2QEJA 5L9DH 3BE1L 3F3HA 3UROR 4A6YB 3FUNA 3SDDC 4NB7A 5MENA 3BX7C 4M8VA 1BZ9B 4F7TA 4S1SL 4ZD3L 2WINB 3B7TA 4Y19B 4BH7A 4WENB 3P4LA 4MMXB 4Z6AT 5CZXC 4PLKC 5F7AA 4X5PA 2CR3A 5D1ZD 4G3YL 3UIZA 4QO1A 5KVGL 2E6PA 1D9KB 4H8HA 3TCTA 1S7UB 1E3XA 4MSWA 4ACTA 3QIBC 5T1LD 4HMDA 5IVZA 2N7BA 2EKJA 3HE7B 1N64L 2GSIB 3ZYIA 1DJXA 3DXAD 1QQDA 4J3XA 1TJXA 4QTHB 1OAUH 4WK2B 4JFQB 4IJ3B 4YWGL 4Z7QB 5EBLA 1N26A 2O6FA 2GAZB 5CU9A 4XHJD 3KPSD 5EU5B 3TIDA 4Z76A 1MCDA 1GGCL 5GGUA 1D5BB 5FK9B 1QRKA 5KVEL 1WFTA 2OTPA 4ZTPH 3P0VH 2QGCA 4D9QD 3LTVA 1OM3L 5DJCB 1WZMA 4ES8A 4E9VA 2CDEB 5FFLA 4S0SD 3P4NA 4TSAL 5IHBA 1E2ZA 3D2TA 4PJXB 1GZHA 4HCRL 3VQ1C 4WEUD 5KG9B 1E8XA 4YPJA 4AZ8A 1EO5A 1BXAA 4OCLC 5IW3A 3ARDD 4L37B 5AW8B 3OG4B 4EIGB 4Y8DC 4ERSH 5EOCJ 1FJ1A 4OI7A 4XMUA 2ZUTA 4JB9H 1NPUA 4HALA 1HH6B 4A55A 1S7SB 5L2KA 5ALCH 3TBVB 1TO4A 4BCZA 3Q5YA 4JRYA 3RNQA 3UTSA 1WJ3A 1DBKL 4NXSA 3OBAA 1P4BH 2J6EA 5DMGD 4N0CD 2NY2D 3MNDA 3MRPB 5E9NA 2V9QA 5BNXD 2D9CA 4RLDA 1P1ZB 2LOEA 4WW1B 3UPAA 1MLCA 4LDLB 5IW6A 3CFBB 3HG1E 5EF2A 3CFDA 3EH2A 1KG0A 4MMXC 5C8JB 4Z77A 1ETA1 1S7RA 1CFNB 2AJYL 3LH2L 1SBSH 3H1ZA 4R8WH 2C4FT 4HCRA 1WHPA 3HE6C 4Q6IB 5GS0H 1QMUA 3RB7A 1A6TB 2Q76B 4A7UA 1LDPL 1K5NB 2VN6A 2BS9A 2DQCL 3RTQB 4WU5B 2B4CH 4YBQC 2P5EA 4PJBF 5AAWC 2VDKL 4R2GB 2MTAA 3TFKC 4CMHC 4XMLL 5FYJD 1HNGA 3LB6D 4WWKB 5SX4H 4FQXA 5DI8A 1PEZA 3BDBA 1MIML 4MXWL 3M46A 2VB5A 4HF5H 4OZFH 2Q2LA 5K69A 1X7TA 2P7TB 3CDGB 1SM3L 3W39A 1J18A 2WNGA 2AQTA 3RX9A 1J5OH 3GXIA 3MR9B 3RKDD 3HI1A 1AOHA 4WSGA 5E8OA 3IRCA 5HY9A 3GKWH 3IJ9A 2DMGA 3FOLA 4KMTL 4XP4H 5EWIL 5A7BA 3BUPA 3T0WA 1JWSA 2YOCA 5ERWB 1N2RA 1DFBH 4ELMB 2X6BA 5J3HC 1MW3A 1E9PA 2FBOJ 4QOKB 3GMQB 3O3AB 1OZUA 3PAYA 2NCMA 4DF9A 1FVCB 3FH8A 3RWEA 3EH3B 1CU4L 3ZTJG 4BFGA 4FQHA 4LHQB 2EUZA 5BS0E 1BX2A 1QFUL 4RWHA 4XMXA 3IWUA 3DLQR 5HVFB 3L9RB 2FBJH 2DQCH 3D85B 5C07A 4Q6KA 4X6CA 1N19A 2RCSH 4UQ2A 4R7NB 4IK7A 1BA9A 4CN1A 2OJ1A 5F44A 3MRKA 4ALAL 1YEIL 2Z64C 4HUNB 5J4MA 2VO5A 3IGAB 3ULVH 2PWGA 1W16A 3JWOH 4X6BB 5HYIA 4OFIA 4NWTH 3C60B 3K8KA 1M4KA 4K5OA 4B9GA 1LO4L 1NUDA 2QKSA 1WA0X 3P3UA 5CNHA 5F0LB 2G3NA 2VLLA 4KQ3L 3KLAA 2SEBA 1F13A 4JM2A 5DUPH 2EYSA 3GGWA 1QVOB 3EFDL 3WS6C 1F90H 4UNIA 3GSVB 3SGKA 4CW1A 2WLNA 1HE7A 3SDCB 1QKZH 2APFA 4JM2F 4R8WL 4X5WB 3T77B 4NKDA 3SE3C 7TAAA 4AL8L 4ZYKA 5C0DB 5FHAL 1EFQA 4UOQA 5D2LF 2DWDA 3S8FB 1G7MB 5AALA 4PRAB 3V7AE 4FLQA 1JTOA 4Y9GA 2BJML 2H1PH 2X38A 3T08A 3WDHA 1YJDC 2ZXBA 2KZBA 3WN5C 2G3ZA 5ETUA 2OJZL 3I75B 1SUJA 5DQDH 5T3ZD 3V5DA 3P11L 1DSWA 3QJOA 3IDJB 3E6FA 1G6RH 1ZLSL 5BRQA 3BZEA 1U93A 4XNMA 4UQAA 3BZ4A 4F3FB 3GBLA 2ZAGA 5IG7B 3ZTEA 3ZR6A 1R3JA 3BD5A 2Z7ZA 3S35X 3RAJL 1T5XB 1KCRH 5D2NA 3WEAA 4I8DA 1XO8A 4QWWD 4NRYB 3I74A 5GS0L 3PIQA 4ZFFB 1N3NB 1ZHNA 1IL1A 3UGEA 1FNGA 3F5WA 4N90D 2WUCH 3MLWL 2PKDA 3MV7B 4XOCA 1UB5A 3DXAA 2FYYB 4GBXA 4J2XA 4XHJC 3KGRA 4POZD 5ACLA 1UGKA 3EYVB 1B6UA 3H7BB 4DEWA 4O5LH 1EEQA 1KSRA 1JGVH 3L5XH 4PJBB 5FLUA 4K94L 3VU1A 3S88L 4JN1L 4XB7A 5ESVB 3ZZLA 3X1BA 4FC3E 4XVUC 5AB1A 1KPUA 5FPIA 1BMZA 3T9WA 4Z7OE 4FADA 3RPBA 1FYTE 1THCA 1JHKH 4GO9A 4U3XA 4WO0A 5KWYC 2HT2C 5L7XL 4L4VA 3FO1A 4ZUUB 4MFHA 4AG4H 2IDFA 1WBYA 3L3KA 3MLSL 1I7RB 4Z3EA 5F1IB 1ZIBA 1UA6H 2I60H 3UTSD 4N85A 1MREH 3L2MA 5F0PB 4DGVL 1AQKH 1H3VA 1N5YL 2HG0A 3BD4A 4FFVC 2X4UB 1S3KH 2F54D 5TDNA 4AGLA 5GS1B 5ITBL 1NM9A 1QSVA 2MPVA 3CDYA 4RGNB 2ADIA 3RWGB 2AF2A 4OF6A 4OLVL 4Y16C 2DV6A 2BVOB 2CIIA 3L5WA 2BCMA 2EDXA 2UXGA 3CIQA 3VFGH 5I66B 1HQRB 1GZPB 1QBML 5LDUA 1JUFB 1U8LB 3PFQA 5IB4A 3ZK0A 5HI4D 2XYCA 1GOFA 2RJMA 4M5SA 4XN1A 5AKRA 3QFDB 3UTZA 2AXGA 1K8IA 3TFKD 2DWYA 5JW4M 2R0LH 1WAPA 2E7CA 1AO7D 5DJYA 1GHFH 5DMIH 5FUOL 2BZ7A 1D7FA 1YN7B 1AYOA 2JQZA 3S5ZA 1MFAL 5GRJL 1X5AA 3TO2A 3N44B 4AUUA 3BKML 2R0WH 5FOBB 1PAZA 4RZCB 5DT1H 4G9DA 1MJUH 4KVNL 3V0VB 4D3CL 1JS4A 3PV6A 4MMZC 4ODSH 5SWZE 4AQOA 4X4XA 2EUXA 1CDHA 4IKKA 3C8KA 4PJCF 4NX0A 4PS8A 4Z7NF 3RKDC 4NFCA 2FO1A 1D5ZB 3QCUL 3U9UB 1RERA 3GZPA 3HKFA 3TBWB 3ULVL 2NUTB 3LV3B 2D31B 1OK8A 1TQSA 5H4ZA 4L9LB 4B5ZA 4TLTA 4E0RA 2UX6A 2KS0A 4I85A 4L8BB 4LLDB 4G8GA 4XBEL 3RJDA 2C26A 1XIWB 5LXGL 2H2SC 4PRPA 4ZOEA 4OLXH 1JRHL 1S5IL 2V7HA 3MRFB 4P4RB 2FEDC 3RGVB 4P48A 1FFTB 4QRPD 4HQQH 3B9AA 2A99A 3MMEB 2OSXA 4X7TB 4MMYB 2J12B 2K7PA 4R5TA 3MRGB 5GJSL 2HMID 5DSCB 4KITB 1V3KA 1CFSB 2GY7B 1IGIL 1O7DE 1YEGL 4FQ1L 1MW1A 1UVQB 5G4MA 2J5LB 3NCBB 4K9JA 3PUUA 4PB0H 3VRIB 3EYQD 3BYTA 4JL2A 5LNGA 2BC4B 3MV8B 4ELMF 1R1CA 3IK2A 3QO0B 5HDLA 4JM2C 1I7UB 2Z91A 3HEIB 1YN6A 2F7IA 1LO5A 4A7SA 4DOHE 3MI6A 3OMIB 1DQDH 5IQ7L 1SFDA 1C16A 4LF3B 3H9SB 2KKQA 3WIFB 3FK3A 2EC8A 5CZRA 2XWZA 2KZ1B 1CE6A 4RGNE 2QQLL 5F1SA 3D39A 5I5MA 3M17A 5I8OH 1TCRB 1U8HA 4M7LT 1CBVH 1JXGA 1U91B 3KG5A 5GRYA 2HTKC 1HHIA 2GTZA 1S7QB 4KUCF 5TH2A 4I5BB 4OGZA 4DTGH 1VFBA 4DPRA 1M9WA 5IESL 4GAAA 2NUPA 1B2WH 2QVKA 5LBVA 1ICTA 2EIKB 1XGTB 4ZX5A 4ZMZA 3QZWA 5KW9L 2NW2A 1H3UA 2YEQA 3ILPA 3ZKMD 3HE6B 1T0MB 1GHFL 5DMIL 5GSRA 1T0NB 4GI8A 3D9AH 1FO0A 2GITB 3MRMA 1ZSHA 3NZUA 1IV8A 4PJAB 4G59C 1Q1PA 4X7EC 5LGHL 2HFEA 3PL6A 1TQCC 3MV7E 1JBJA 4RIRB 3DSNB 3I3EA 3AUWB 2RTTA 4JRXD 3SKUD 1LEIB 5A6MA 1MRFL 5D1XD 3F05A 3T4YA 1ROWA 3PAUA 1MHCB 5LG1A 1YA5A 3PHAA 4OZIA 4QWWC 5EZPA 1UM4H 4AEFA 2AS5M 3CCHA 1X7QB 4O02L 1UACL 1ZLVK 3S2AA 3VH8B 4OFKA 5IWLA 4HFWA 3SQBB 1P1VA 3AT8A 2FYVA 1Y0LA 5K9OB 3U82B 1M7IA 2ZCKL 4QNPF 4HIIA 4JFYA 4ZPVB 4Z7OB 1G7LA 4N86A 3BWSA 4P8QA 3VXRA 5EO1B 4ENEC 3QG6A 1CLYH 2ZT9C 1HL5A 1P4UA 1GYCA 1RZIB 2OMBA 3VXMD 3QQ9D 5DJXB 3RWJB 1CL7L 5ITFA 2K7QA 1YEJH 1LWHA 2E4FA 5C0AD 4XO5A 1MLBB 3PXJA 1YNKH 4BSWA 1JHLH 4QRRD 4LSQH 4XCFL 2J5LC 4AQ1B 3GMOA 2ZP9A 3O41A 5HGAA 3FCGA 1PNDA 4OJEH 3QG7H 4S0TD 2BVYA 2XBDA 3KH4A 3O9WA 5AOMA 4Q9RL 4G80A 5DZVA 2AV1A 1PZBA 1SJEA 1G7IA 3KYOA 4Y9EA 3CH8A 2DYRB 4TL4A 5F8QC 1MRDL 5SV4A 1H6FA 4FFZA 3LRGA 4PG2C 3ISRA 1V7ML 1ES0B 5KAQG 4WJKB 4EDWL 1E4KA 2YGPA 1GR7A 3QO1B 4Y16A 1TJIH 1NDGB 1I7ZB 3WNOA 1GSMA 2PP7A 4UQ3A 3MKKA 4WTZA 4LKXA 1L9NA 5JNYB 1QI4A 1B3IA 1IGIH 4KWUA 5LN4A 1OARL 3KPPA 3NBNA 4FFYH 3BRFA 3ET9F 4OQTL 3TWYA 4URKA 2BVTA 5DURB 2BOBA 3FQRB 2CALA 1V3JA 2FO4B 2K6YA 2YPLA 3RX7A 5C09E 1Y6NR 3GDBA 5BRZE 1XGPB 3RRQA 5C3LD 5E6UB 1IC7H 1I7ZA 4YBLB 3U2SB 4Y1AD 2X9YA 1ES0A 2ZAIA 1EMTH 1Y7VA 5FWRA 1UB6A 5CEZE 2XN0A 4AT6A 2X4PB 2AGJH 3L81A 1JXJA 1KXQE 1G7IB 2AV1B 2FQEA 4MAYC 3ABGA 4TNWK 1G0DA 1DBMH 1FNEB 1H3PL 1E9QA 1RUAL 5HGAB 3V6BR 1LO0H 3QPQC 4Q52A 3P30H 3VXQB 9CGTA 2ATKA 3B2UD 1A3RL 2VLJB 4AXWA 1KTKE 1EJFA 2FDBP 3PWJB 3CFCL 4WWPA 3NRQA 1OVZA 5ITFB 2FUTA 1ETZB 2IANE 3RVXC 4DZBB 3QG6B 5FX3A 5EO1A 4YHOH 4KKAC 3VXRB 4MAYB 3MXWL 4ZFFA 2EABA 4B0MB 4WJ5B 2E9BA 2FJHA 5J56B 1NGYA 3PGDB 1H8NA 4HIIB 1MELA 4ZQKA 1VEPA 3PV7A 2IG2L 2VDQH 4X9GA 5CJOL 4KTYA 3M07A 4HFWB 2H8PA 3IGKA 2BVQA 3CCHB 4C57C 1CBJA 1I3GH 4A37A 3BPNB 2CRYA 3V6OA 1N4XL 1REIA 2W91A 3IPFA 4L4JA 1FL5B 3BVNA 3LZOA 2UXVA 2RIKA 2NR6D 2WXGA 2XWDA 4TVPD 3GSNL 4ANUA 1LEIA 4FL4C 3SDXF 4IU2B 2XICA 2G0KA 2R56H 2WLLB 3DSNA 4QT5A 4RIRA 1WFJA 4H20L 4JM2D 1DBAH 2B08A 2YRBA 3R4RA 3UBGA 4QLRA 3JT2A 3CFKB 4L3AA 4EPSA 2GITA 1YMME 3MRMB 4OZFG 2XHNA 2IBZY 4JO1L 5EIVA 1QO3B 4FQIH 1XSJA 3ILPB 1L9RA 2ZYIA 3QZWB 1V8HA 2LHAA 4GQZA 3WFDL 1M56B 4U6TA 5E6IC 3GBML 1XGTA 4TUKH 5B4MD 4OIIH 2IDCA 5EU6A 4PJ8C 5D1QE 3R1GL 4F5CE 3NFNB 3MNWA 5D72H 3VWJB 5TH2B 1XXDC 3EJUA 5KYYA 2A3TA 4NNPH 4KRPC 1U91A 4AYBA 2JQAA 2J25A 1AY1L 5I18H 5KTEH 3D39B 3KBPA 3CUPB 1MDAA 4EI6A 3CH1A 2E7DA 2X09A 2XTJE 4X0KA 3KYMB 3MREA 1NGQL 3BW9B 1T83C 2H32H 2X88A 4OCYL 4KZDH 1CFTB 1RFDL 2IPKB 2BSRA 2Y7OA 2VDPH 4B97A 4Y1TA 1I9JL 1I7UA 3GSWA 2C5DC 2VUYA 4QJ4B 2BC4A 2UY7A 2OMVA 4JFZH 3QFJD 4CDGC 3FSAA 2CSPA 2IBBA 4U4IA 1UVQA 4OD1H 4TQPA 1PJ9A 4FHJA 1ED3B 4IGBC 1JGVL 3S35H 5DSCA 4EUPH 4AWJC 5I0VA 1WQVT 1NGPL 2FAUA 4DQOL 3E6HA 4X7TA 3MMEA 4FI6A 4HIHA 3WFDH 3RGVA 4ADJA 4YEEA 1R3IH 4ABQA 3MRFA 1BF8A 4MJHA 3IKCB 4MQTB 1ND0A 2W8CA 3FTVA 4GMTL 1XIWA 3RNKB 3KYNA 2XQYA 1IE5A 3W9DB 4L9LA 3VTMA 4UV4H 3F84A 1IEBB 2D31A 3MA7A 3LV3A 4J3SA 2NUTA 3GRWH 3UO8B 4ENED 5ICZB 5E1QA 4QHUA 1OIOA 4OSUL 3FF8A 3TO4A 2WVUA 4BH8B 1LYQA 3D25A 5EHFA 3C8KB 3D9AL 5FDYA 3QQDB 1Z5HA 2GI0A 1FNHA 3PV6B 5DVMA 4XNUH 5CKGA 1FN4A 4AV4A 4DSYA 3E1ZA 1NUGA 5TQ2L 4A2DA 2X3CA 2C1PA 4HJTA 2I26N 4XCYA 4ZMYA 3IFNL 4FYRA 2EH7L 4WK4B 4Y4FC 4UV7L 4LPUA 3RE0A 3FQ2A 4U1HB 3WL9A 1UOVA 5DJYB 2HCZX 1AS7A 4QOKE 3D4GA 3KVQA 1BZDA 1SN0A 1DLFH 1MFNA 2EINB 4B41A 3C2AL 2BFVL 2WWKO 3NP4A 5F1OB 5MP6L 1HXYA 2PXYD 3CBJB 3OF6A 1I3GL 1KEGL 1U33A 4L3EE 1KT2B 1I8MB 4GSUA 2VMDA 1L9OA 3DNKA 2APSA 2Z8WC 3M45A 3QGVA 5GZOC 4YHMH 1MI5A 2CIIB 3L4XA 4Z1PA 2Z31C 1KMGA 3ZZSA 1B88A 2KQMA 4I18B 4Y2DC 1RMFH 1NSNL 4EJ1C 1H6UA 5E4EC 3V7AG 4Z7UE 2IAMA 3UBHA 5A6IA 4JRWA 1P4IL 3QJXA 4NUGH 2YLKA 1I82A 2ZOLB 4OD3H 1FORL 3FT4A 2HKAA 3ILQD 2Q10A 1ZIAA 4XR8C 3DJTA 4R2GC 4BJLA 3E7JA 2WYZA 4K3EH 3D3VD 2X70B 2ROYA 3FO1B 4EIUA 3F7LA 2O30A 1AHWB 4UT6L 5FB8A 2OSYA 4IGBB 3T3PB 3ULUL 3FTZA 4HV8B 1TZGH 1NLDL 2K4AA 4JO2H 4N2NA 1AR1D 2HX9A 3LHAA 4YDJB 3H55A 4DETA 2F68X 4U6YB 1IQWL 3U1SH 2LU7A 4D8PA 2HT3C 3LQAC 3LKOA 4LCUA 4Z5RA 2GG1A 1SY6L 4KKAD 1HOCB 1HH9B 1MVYA 2Z31A 2G9KA 3CXFA 3F7VA 2PTTA 3QNYB 3EDKA 1N6UA 5ES4B 2P8LB 4MWFB 2YHGA 4XO8A 4X2UA 4M1DH 4NM4L 4PRHE 1UB5B 6TAAA 2M8XA 2VQ4A 3PQYE 3ZE1E 4B27A 1BAGA 1IL1B 1N3NA 1Q72L 4XPHH 3PIQB 3I9GL 3LN4B 3X1FA 3ZKNC 3GSNB 4BFEA 1JHLL 4YBHA 2VLKD 2Z8SA 1T5XA 4MZIA 5D2NB 3FRPA 2V8LA 3O6FC 3CSPA 1RHHA 5IG7A 4KXZH 2DYPD 1P6AB 4F7EA 5I16A 5TPWL 3U0WL 3NJVA 2F1AA 5DD6A 3QXTA 3RFZC 5HGHA 1E8WA 5C0BE 2A38A 1FLTX 1MPAH 3D39D 3HC4L 1A3RH 4P99A 3FTYA 5IBTL 3I75A 1UD4A 2PTUA 2ZG2A 1MW2A 2VWEC 3O8XD 1J9SA 4JDTH 3SGEI 5CCKL 1FRGL 1KCBA 3W82A 2BIMA 1SHXA 5CBAA 3QH3B 5HJGA 1NAML 4PRAA 4MWFA 1G7MA 1GPOL 4GRWE 4W9EC 2P8LA 1BIIB 4ZFGH 1YEKL 4OCSH 4B9IA 1CYXA 1GS8A 3F7VB 1BECA 5TQ2H 3SD2A 3L54A 3VFUB 5B3JE 4PJIA 5ICYA 2CO2A 3CQQA 5GHWL 2DLFH 1P4BL 4NKDB 2JELL 4X5WA 5AVWB 3T77A 3E2HB 1ZGLA 1FE8H 4G70B 3GB7B 4D8PB 3GSVA 1F8TL 3RVUC 2DQTL 1ZS2A 4YDJA 4YPGA 4ZOCA 3PJNA 2Q3AA 2EEXA 1VFMA 3V4PL 1TITA 1O6TA 4M7ZB 4HV8A 5D1XA 1MW0A 3SYOA 4N2OA 4IGBA 5BZZA 5DJDA 4KKPA 4OV5B 1EEZA 3M6DA 4JY5H 3MLVH 4M7LH 4TVPL 2WB1A 3EH4B 3MRQA 4PTTB 2IPUG 1OCZB 1AXIB 1DQML 1T5KA 3MRKB 4GQRA 3C8DA 4LNVA 4X80H 3AWGA 3BPOB 3OD3A 2ZOLA 3C08L 4L3CB 5HDQL 2C3HA 1KIQA 3L9RA 1FWXA 3M86A 4DJMA 4N2GA 1CICC 2C8NA 5C0RH 4FQHB 5HVHC 4B9FA 3LJ3A 2VCOA 3E80A 4GKZA 1SLXA 5FUCC 4H88L 4BQBA 1MI5B 2Y36L 3D0LA 3CVIH 4KRLB 1DBBL 2AK1H 3GKZA 1IBZA 2FHCA 1NCDL 2P80D 3BSHA 1HXYB 5E8OB 2MCPL 3RZWA 3TT1L 5I30H 1KWKA 1BREA 1UKSA 5J12C 3MR9A 3FXIC 1LQSR 3ZKXB 4MA1C 2X3AA 1A7RL 2DMCA 4LIQE 3T3PF 2P7TA 3CDGA 2XN9E 4PGZA 4ZK8A 3ULUC 4NRXB 2M26A 3TYGL 4LVOC 3OVUB 4IEFA 2B1AL 5DHXB 1JPTH 4WWKA 2XTSA 2OW6A 3ZDZB 1T1WA 3D1MC 1TPXB 1OF2A 4UIMB 2OMUB 4BV1A 3DO4A 2P5EB 4CUCA 2Q6WB 1YG9A 1K5NA 1DVSA 4MDJA 1TLMA 1S9VB 4ZFGL 3SQRA 2JVUA 2WTOA 5GGQL 1F4AA 4WQOA 1IM9A 3EOYG 2DDQL 1BQKA 4FG2A 1IEBA 2YD4A 3MA7B 1KTDA 1UJ3A 2DM4A 1CFNA 4JMXA 3NCJH 5C8JA 2L3BA 3IDGB 4F15C 3BT2H 3CFBA 5IW6B 4HIXL 5HYQB 1TKWB 4B9YA 3MYZA 1X44A 2AP2A 4HAGA 4ETYA 4H2CA 1BQRA 1X6NA 2NY4D 4GP5B 5IBUB 3PGFL 2BK8A 1E9OB 1WBXB 5LBSH 5CILL 4LHUA 2PP9A 1A22B 5JHLA 4K71B 4PS7A 2WV3A 5IHLB 5I8KH 3HA0A 3JVFC 1NCHA 4PJGE 1M6UA 4MVBC 4YSPA 4L37A 3NCEB 3BW9A 2KQNA 2ZXQA 4IRSB 3L08A 4M9PA 3CH1B 5CJ5A 5KG9A 3ZTJH 1E4HA 4PJXA 2FWUA 2PMZA 3PUCA 5A2BA 3LZNA 6PAZA 4EDXB 3HOGA 5CR1A 5KYYB 1OAYH 4OLWL 3STBA 3MNWB 3VWJA 5E95B 4OBSA 3T1FA 3A6CH 5EU6B 5GGUB 2UX7A 1DANT 1KFAL 1WITA 2I25N 2ZOWA 4BFIA 5BUAA 4W9IC 1T2QL 1QQDB 2DTML 2SODB 3ZKND 5L8LB 4NZUH 2HH0L 2GSIA 2G2PA 4JGMA 5AZEL 3HE7A 3TA3D 3DPBA 3BUTA 1W8OA 3QR1A 3IAQA 2WLLA 4QT5B 5FYLE 1PZUB 1FBIL 2G9HB 1DVUA 1D9KA 2VERN 5J5EA 3WXWH 4WFEE 3EOTH 1A2YB 1FL5A 4BH7B 1VFUA 4Y19A 1DBBH 3GMRB 1J9TA 4IKJA 4RA3A 5L0QB 2P3YA 2BVQB 3E2HC 4GQ9L 1QNIA 1H8OA 4NCC1 4RMWA 2Q1EA 2E86A 4XE0A 1S5HA 3HAEA 4G3YH 1IFHL 1IX2A 1FFOA 4R7LA 4RZKA 3NYKA 5HDWA 4WJ5A 4FNTA 1SF3A 3DX8B 4HUUA 1X5XA 4D9RE 2D9QB 1WTLA 2GBVA 4UBDC 2FATH 3LPPA 3VG9C 3QFJB 3JVGA 3FONB 4FNQA 4MBOA 4YFLF 4M7JH 2ATKB 4JQIH 4ONHA 1KTLB 2UZIH 3VXQA 5LVEA 3BISA 5IUCA 2YD1A 5F88B 4PJHE 3CV5A 3DIDA 3X17A 3OZKA 5JHLH 2CHNA 1CO1A 4OLUL 4ZAKA 4WO4B 3DECA 4FA7B 5DVOA 1UB6B 2ZP8A 3KVDD 3HZKB 5FW8A 5DD3L 3AREC 2XVGA 3SEPA 1R5IA 3WAKA 5EEYA 1NCCH 2J3SA 1XBDA 5L88H 3QVAA 5DHDA 1OAZH 1SLUA 1OANA 3QWOB 1IM9D 2WGNB 1GGUA 2HKHL 4ECNA 2D7TH 2VGLM 3LS5H 3BWAB 2AQRA 4L0ZA 3ZKQD 4YJZL 3PP4L 3FB5A 5EU3A 2Z9TA 4LRIA 4YXHL 3KBFA 3DVFA 2VW6A 3KPPB 5IROA 5JNYA 1S7XA 1YYMH 4LKXB 3ZIYA 4FX5A 1HK6A 5C0FA 1NDGA 4F2EA 1FHGA 1JYXA 3MJ8B 4X6EA 3WEBA 4ABVA 4XCFH 4G11A 2JB6B 3O4LE 4N0UA 5HJ3B 5E2WH 1SJEB 3KYOB 4UZUA 5F1NA 2R2HB 1L9PA 4ATWA 1ZVNA 4V2BA 1NDTA 5C0CE 1CBVL 2E27L 4RISL 5HSFA 2XV6B 4N8VG 4GT7A 4TVPH 4UM8B 3MUHL 3ZDXB 2V7NB 4QRSB 3OM3B 1HCYA 4KUCD 4AQ1A 1A7QL 5DD5H 4IBSA 2RCSL 2YD0A 1EZUA 2ZUWA 3RWJA 3QNZA 3GBMH 4OKVB 4TUKL 5EZLA 4XGZB 3Q2WA 3ULVD 2HWZH 4WFGD 4HJSA 5GGTA 3DMMC 2NNXA 3T0EA 5KS9A 1M7IB 1I7TB 1I85C 1NFDA 2GK0B 2WQRA 1MXDA 5FXCH 1QFWM 3SQBA 3UADA 2ARWA 3H3KA 3BDXA 4J2QA 1OW0C 1VZGA 2HXAA 3CMOL 5FO2A 1U3YA 5IOKA 1M53A 5J11B 5E1HB 1ZT7A 2YBRA 1HZHL 1MHCA 4NQCD 5C9KA 1I4FB 4YHML 1P9MA 3U7AA 1VF5C 3OMZA 1E7VA 2F19H 15C8H 2CE6A 3NSXA 3I9IA 3BFWA 4Z78A 2RAMA 2Z3FA 3VCLB 3MOBL 1QFWI 4U1GC 2OYPA 5I8CB 3BP4B 4MVBD 1BIHA 5KUKA 1LEGB 3WNNA 1FO0B 3C08H 3FOMB 1SXBA 4HBCH 3QCTH 1RPKA 1KIUA 1QAWA 2NW2B 4M4PA 3NZ8B 4AYID 2HG5A 1NGXA 1RJYA 2VL5A 3WEXB 3BAIA 1WF5A 1AJ7L 2E7MA 3QEQD 4D0DA 2CA4A 1T22B 1ETJA 5KSBF 4I5BA 2HWZL 5IJKA 1RUMH 5DMYA 2FIRT 1JE6A 2WBWB 3U7WH 3LH2H 4G6JH 3RY6A 1UG9A 3M17B 1L6PA 2JFCA 4JFFB 3CDZA 4MS6A 4BKTC 1SYSA 1NZRA 4KK6C 4ZO7A 1WFOA 3DVNB 3RZCB 1BVLA 1U8KA 1C16B 4LF3A 3EJZC 5E1AB 1W8NA 1LO5B 1L3WA 1YN6B 2XA8L 3F85A 3LZFL 2Z91B 4GSDH 4NQQA 3TA3C 3VQ2C 1VZIA 5JHBA 2HFGH 1I9EA 3MV8A 2Q3ZA 3WY4A 1OV8A 3TNMB 4YFDB 4RGNC 1OE3A 5IW1B 2QGBA 2NNCA 4OT1L 1JPSH 1SOSA 3HMXH 4HWBL 5F7EH 3E38A 2DW5A 3KCWA 3Q5OA 1FIGH 2YC1B 4RAHA 2VSDA 4MMYA 2J8OA 3FUFA 4W9HC 1F2XK 2OCJA 2VAJA 3AY4A 1JK9B 4ZSOA 1FA4A 5BQ7B 4P4RA 1MEXH 4V11A 5DXWA 5JOFB 1P6FA 4NT6A 1PD6A 2G0LA 4PRPB 1KLFB 1CXLA 1KLUA 2ZCHH 3KWXA 1IFGA 3EYUL 4E0RB 2EDDA 3ZYZA 4WCYL 1AACA 3UTTA 4PN6A 2IH3A 5E8NB 5C7XL 1BM7A 5D6CA 3P9LB 4L48A 4S0HA 4KDWA 3G7TA 3U9UA 2MHAB 4FI8A 1XF2A 1K9TA 3OPZL 4LGSB 2OMWB 2X0WA 3KWVA 5JIHA 4KY1L 4QCIA 5D7LA 2Z1KA 3QE5A 1SUHA 1AANA 2JK5B 3TJHD 3V0VA 2BCKA 1V3LA 5DZPA 3QZPA 5FOBA 3WEMA 2CRMA 2VXQL 4HOWA 1UXSA 4X99A 1BYOA 3HRZA 1YN7A 5ECGA 5I1KL 3KPOA 2ZUUA 2IVFC 3CVCA 1QFWH 5MEOA 1KXTA 3QFDA 4FXGC 2DQFA 4G43A 1QPXA 3ZMEA 4MASA 5IB4B 4ANVA 3B9KD 3QUML 3O9WC 1KOAA 3TVMB 1VGEH 3EGSA 3GBNH 4TVUA 4JQXA 4P5KA 3UYPB 3RDTB 1E65A 1F18A 2R0ZH 3QT2A 2BVOA 3IFOB 4IDLA 1BVOA 1NCIA 3RWHB 1E50A 3AT9A 3O2WL 2Y6SD 2X10A 2QVTA 3HNSH 2ADIB 2ZOUA 3RWGA 2J88H 3IBEA 2EDEA 4DPBX 5AW4B 3CQPA 2V9RA 3NJIA 5TDNB 2IMNA 1AGCA 5K9KA 4NUPA 1SZNA 4QHPA 2EYTA 4HBCL 5F1IA 5CGYC 1I7RA 1Q94A 4OFVA 2ZSWB 5I6MA 1OTTC 1WBYB 2VDOH 3AQXA 3L3KB 2DI8A 3FULA 1L5GB 2O93L 4NUJB 4MCYA 4WLCA 1RKRA 3UCQA 2VXVH 3GSUA 4L4VB 5FHBL 4KZEL 2XBTA 1MZYA 4NZ8A 3F7QA 5FYJL 3WNLA 2XLLA 2H5UA 2NX5D 3V8CA 1PY0A 3SPVB 1KPUB 3SHSA 3TH3T 5CD3A 3O0RH 2XZQH 2G60H 5EOQL 5L6YH 4AGQA 1XVSA 4UDTA 3IF1A 5I1JH 3CTTA 1CDJA 1JK8A 3LKNA 3F58L 1A7NH 4JM0A 4Q14A 3SGJA 2VXTH 3MV8E 3N40F 5EZIL 2CO6A 4CU8A 5IY5B 4UQ9A 4W68A 5TTRA 1A6UL 1BHGA 5CZVL 1BG9A 2DF3A 5DDHB 2DL9A 3WMQA 5L2KD 3E8UH 1X9UA 4PJGF 1J0IA 5FFGA 1L6ZA 3VE0B 3BLKA 4RAUA 5ANME 1CFQB 1CR9H 1WPCA 2EIMB 3EYVA 4PGCB 2V0AA 2FYYA 4GBXB 3DXAB 3QCVL 4IK6A 3MV7A 4W6WB 3WELA 4WHDA 1ZHNB 4S1DC 2YRPA 5F2FA 1EEYA 3QDMD 4XNQB 2ICCA 1ZT4A 2X53A 2H9GA 2XU9A 4LLUA 4YR6B 1TZHB 2B3RA 1J8KA 2QKIB 4D2NA 3QORA 4XNMB 1K8DA 1U93B 4UNTA 3BZEB 3MLTA 1OWWA 3R18A 3V5DB 3IMBA 2YZ1A 3DRQB 3V4VA 4NLAA 4DP4X 4APQB 3R06A 3FN3A 1JPEA 3K0YA 5ETUB 5EEWA 4B7LA 5CFAA 3IGLA 3AG1B 3VNZA 3STZA 1A3QA 1I1RA 4JFHD 3RY6C 2FJSA 5MEQA 4DGYL 2Z35A 2O72A 2DWDB 2GJ6E 4NQED 1TQVA 3QZLA 5GS0D 5C0DA 3FSWA 4ZYKB 3UZQA 1G9MC 4Y4HA 4JFPB 4KVCH 1Z6JT 4QRFA 1NC4A 5GRUH 4CW1B 4M6NL 1WFNA 3QJHA 2I5YL 4POUB 2BSBA 2NY2B 4EVNB 2SEBB 4FG0A 3KLAB 2CPCA 2VLLB 4KK6D 4F9LA 1G9MH 3ZDZF 2RBLA 3P2DA 1F6AB 2A9CA 4WW2F 1QSED 3ZY7A 4AV0A 4MNHB 1L0YA 5T3ZL 5FHBH 5DQJA 2H7WA 4XNXH 1D9KD 4JKLA 2QKIC 3OMNB 2WNWA 3U36B 5EEZA 3C60A 5FYKE 3LEYL 2YPLD 2UXFA 3QIWC 5T3XD 1FO0L 1OCWH 2QGEA 5EH1A 4X6BA 3U83A 3PRZA 1KGCE 4FFWC 4PW9A 4PJAF 4F9PA 1NICA 5HHXH 4HP5A 1A7OL 5E2VH 1OAKH 3E9UA 1KCVH 3QA3A 5D1QC 1ZGLP 1SOXA 5B8CB 4X6CB 4PG9A 1EHLL 1A7BA 4ICXA 4PG2A 3EXLA 1JNHB 3P4MB 4YBLC 5IB3A 4MD5B 1FVCA 2YUZA 4PRIE 1DVFC 2XTJC 3Q8AA 2YFOA 3MRRB 5HD8D 1CIDA 2L8AA 3ZT6A 4F2FA 3U7WL 3ZHKA 3GJEA 2IALB 1N2RB 2MNJB 2NT1A 5ERWA 2FT7A 1JWSB 3ME0B 4WI0A 3T65B 5LJYH 5HY9B 1II4E 3T6WA 5D70H 1PG7L 2NLJB 5BUGA 4YHKL 4S1QL 4JX0A 3LRLA 5I1HH 5DJZB 3MTXA 3PS6A 1IGJA 1S7VB 2Z34A 4HJGB 4CILA 1DQLH 3VRLE 4B50A 2Q87A 4B3EA 5KSVA 4G1EA 5CXPA 4NENA 5GSVA 1QTSA 4P59H 2PABA 4KV5F 5HDQH 2HSIA 4OVUA 2Q20A 1YNKL 4QHLB 4HGMA 4YNYB 4LMQI 4K3JH 2L0DA 2E8YA 2H26A 3ARGB 4MNGA 5F9DC 1MAKA 3L5IA 3S37X 4JFUA 3S4SB 3DA0A 4JM4L 1K2DA 2C1OB 1V55B 4S2SB 3SKMB 4W93A 1YHPA 2X12A 3DBSA 1FDLH 4I0PA 3FHQA 2AW2A 1BYPA 1AP2A 1BVNT 1ASPA 3NZHH 1JGUL 1KG0B 3TYFB 5CEZH 1G1YA 1CTMA 5D5MB 5E08H 2RQEA 3C6LA 1MLCB 4WI4A 2DJ4A 4TLUA 5EU6D 2WANA 2NTSP 2X7LA 3RUGB 4F58H 3GF8A 5AKSA 2VITB 5E0FA 3DPDA 2XCMC 3NJNA 1DSFL 4JY6B 1P2CA 1LP9F 3KYAA 2PYED 3B2MA 3P2TA 4GY4A 5E9DE 1IJ9A 4MQ7A 2X4SB 4K3DH 4FFYL 3DV4B 1W0YT 3APDA 3VSTA 4EUPA 3AUVA 5L2KB 1S7SA 2KI6A 6FABL 1WDAA 4YVUA 2H2PC 2BJMH 4QEGA 5I8EB 5E2TL 1FJ1B 1KFGA 5MHSD 5EIIB 3TP4A 5IJCC 5D1ZA 1Q72H 4XPHL 4GUQA 2Z8RA 4NNYA 1KN4L 4AZ8B 1N4XH 3GBEA 3NCYP 3RFZA 4HPYL 5K9QG 2NR6A 1IGTA 1NM4A 2ZCLH 3GSQA 2CLZA 2UUDK 2ITFA 2ED6A 3P4NB 5CN1A 5EBGA 2CDEA 1NBQA 4LOUD 1X5JA 2E5EA 2YAFA 5TE4H 2LAGB 2FJFA 4ZMOA 3BH8A 3LPOA 4PIBA 3VYOA 4ZW6A 4DP2X 5C0NC 2J6EH 4N24A 4HK3J 4L29A 3RWDB 1AQMA 3DUUA 3NCCB 5EBLB 4O4YH 1YECH 4ZTOH 4BGDA 3DUSB 3V52H 4OJFL 3MNZB 4XP5L 4PRIA 2F54A 2D0FA 2XNAA 2BY3A 4N6RB 3DTDA 3FT2A 1M7UA 4NLHA 1T7WA 2QADD 2V33A 1OO2A 5I9QB 3RPKA 2HFFB 3W57A 4LPTA 5JXEA 4X5QA 5SWZA 3OAZH 4NS0A 4QO1B 1XCQA 2A73B 4NC1C 4MMXA 2NXYD 3ARBC 2X4OA 3NQIA 1N0LB 4XMVA 5MENB 1ZHBB 3C6SA 1JGDA 1GKEA 3G3LA 3KPNB 2MCG1 3A21A 3VMPA 2FJGB 3VXPB 3VGHA 3VM5A 5K9QI 2VDKH 3RZCD 4P2OA 5LGHH 2AITA 4N6QA 4A1RA 1JCKA 4LSTL 3S35L 1ZT1B 2YIHA 3ARXA 1SXZA 2YOAA 1VCBC 1C12A 5CFHA 3CD4A 4NKQB 2GTWA 2MQ3A 5I15H 4JG0H 3O2DH 4CVUA 5FM5O 5FYKU 2NQ3A 2WSDA 3VACA 1T7YA 4GNKB 1OGAA 2BSTB 2VQ1B 3Q6FB 4LXFA 4LEBA 3ZQWA 4Y4KC 5B7MA 4LSUL 5ID1B 4JZJC 5DWPA 3WXWL 2HTLD 3MCYA 3GZKA 3ZE0F 4F33A 4X4YA 5I6XC 1G6RB 4UM9D 3SDYH 4FKKA 5CLTA 1KJVB 3EBAA 4DKTA 3BP6B 4ZXBB 3V4VH 5EC2A 3S5LA 1FG9C 4A2LA 2JXMB 2NYYC 4G8FA 2OMTB 3A4DA 3FCBA 1TZOA 1H3WM 3QQ4B 4C56A 2APBA 3QI9B 3SBQA 3KPSB 1TTRA 4G6FB 1F3JA 4PWIA 4G6MH 1PSKH 1Y6MR 3MACH 3S9DB 5IFAH 3UTPD 5GZOA 1XD0A 4UINH 4ZFQA 4UNUA 5DTFB 4HKJB 2CWRA 2YN3A 1M1SA 3DKHA 3CIAA 3MCKA 3MJ9A 3VDAA 2WWMC 1LXMA 5TF1H 4KOBA 3ZE1F 1N59B 4PWFA 3F01A 4QRUA 1JZ7A 5KSUA 1QR1A 4KPHL 2NY0D 3ARGD 2V9UA 2R83A 3QXAB 4PW3A 3PREA 4DVBA 4YHNB 3W9EB 4C58B 1NAKH 2FNWA 2X0VA 4QY8A 4YHYC 5IEKB 2IPUK 4KFZC 2GJRA 5IIEA 4NKMB 3O11B 1U8OB 3FO2A 4X8CA 3ZX1A 4QXUH 1I9JH 5DRZA 3HHRB 5HHXL 3OZ9L 3PWNA 2WQAA 4DTGL 5IESH 2AQ1A 4ETQA 3APFA 4G5ZL 3SDXE 3WFCL 2JCCF 2QSCL 3L2NA 3UXFA 3FU6A 2WLZA 2XPGB 3R7RA 4LGPB 2VZUA 1YNTF 2X1WL 1QLFA 2WLYA 2P43B 1U6AH 3PABA 2HFTA 1S7WB 3FQ4A 4HUXB 3DVIA 3CZEA 5I26A 3S3JA 1LEKA 4XNZB 3ARDA 2XZCH 4AYMC 1QWUA 2TSBA 1UUSA 4AX3A 4U1KB 2EEFA 4ZT1A 4KDTC 3EYUH 3ULUE 5IZ7A 4GUOA 2EE2A 5JO5A 2DKSA 2V6HA 1I8AA 4YSOA 4LLQA 4I77L 4E41A 3Q8EA 1GCYA 4NM8L 1IQWH 3U1SL 3CN0A 3IXAA 5ENWA 1UWEH 4AEIL 2EECA 2CUAA 1P7BA 2F5AL 1E3ZA 1AXSA 2VQTA 4KK8C 1RJCA 3HC0A 3U1PA 2QZ5A 2ZWKA 3CSYA 2FTAA 4DP1X 3B1UA 4K7PY 1A4KB 4OLZL 4X7FC 2FWLB 1MWAH 1JTPA 3OR6A 4DT2A 4QRQA 1GYUA 2XN9B 3L3IA 3L1OL 4M93C 2WMPB 4MNGE 3DYMA 1CD1B 1WP6A 4YUEL 1EFXA 1VACB 2E75C 4X7CC 3QPXL 5AD0A 1D5MB 1BQUA 4QI3A 3DDFA 2NZ9D 4DN4H 2HT4C 4OF7A 3ZDXF 3K81A 4BGLA 3AU1A 1KIRB 3KPRB 3N85H 1F97A 5BVJB 5JYMA 3ARDC 4KMTH 5CSBA 1E28B 2KMWA 4LOUC 3EHBB 3U4KA 3RWCB 1AMYA 2AV7A 4C83A 2EDQA 5F7UA 2H6UA 3SIKA 3HZ3A 1KCLA 2Z4TA 4M93B 5C0ND 3O4LA 3O8XA 3I6KB 2FX9H 2JLLA 3DOSA 2EYRA 6CGTA 4HS8H 4JRLA 2AQQA 3TCLB 3BLPX 5DVKA 3BQVA 5KEZA 2XKUA 3WGUB 3ARBA 4FZ8H 2AEPL 4WUKH 1ECYA 1ACXA 4CSSA 3QUXA 5D6DC 4G5ZH 3SDAB 4UDUB 1F11B 3TGXA 1NMBL 3H9ZA 4YDZA 1DSYA 4OIBA 4P59L 4RDQG 3IAPA 5FM8A 4UTAH 1P5UA 3B2VH 4HGWB 3ZHLA 5F9WB 1INEL 4WGVB 5HHPA 3C2AH 5MP6H 3MROB 2WD0A 2NSMA 3NMEA 4PIRF 1R24B 3X12A 5FCUL 4LSDA 4JJHA 4E9WA 1OGPA 2UVFA 4YBQD 3CN1A 4N2KA 3TVMD 4WUUD 4JUSA 3FH5A 3CXHJ 1XR8A 4EN3D 1G9HA 4NO2A 1UENA 1OXYA 3FCSB 4JLRB 4E9QA 5DMKB 2Y1AA 4A2MA 1Q9LA 1QHQA 3FUMA 5H2BB 5TE7L 5IVOA 4FEIA 1DJGA 2DTSA 3FO9B 1S7TB 5ITBH 3UAFA 5JW5A 3OKMA 2DQJH 1RPUA 4Y2LA 1O5PA 4DQOH 1XF4B 1AQKL 4U4BA 5AW9B 3DO3A 3OKOA 3ULSB 3N43B 1D2OA 3WFZA 3K0WA 4OCMC 4AIZA 2Y2YA 3P0YH 1HL9A 1AGBB 2XRAL 3MOAH 3P4OB 1UYWL 4AC4A 3BAWA 3HW7A 2GIMA 4R7DA 1X7SA 3VG0L 1T03H 2I5YH 3HPJB 1P5UC 1N5AA 4UQDA 5IR1B 3IMVA 1I3RB 3WEOA 1RAMA 5A6LA 2OK0L 1TQUA 1B0RA 1FZOB 1PG7H 5DC4B 4YDNA 1QLEB 3RIFF 1EVTC 4AQ8C 1MNNA 3CX5K 3L1EA 3GZOA 5CJ8A 3HVDA 2GUOA 4XN9A 3B2DC 1E3FA 1LMIA 1QTPA 1T20A 4K0OA 5IK3B 2NQCA 3N41F 1QPKA 2D7PA 2QSCH 3UDWA 3TZVD 1N64H 3FCTB 2YAOA 3RY4A 1K4CB 5CU5A 3GS7A 5JHMA 2OJEB 4FQIL 2WLHA 2UZYA 4FQCH 4X83A 2ZICA 3RGHA 5DQDL 2W60A 1INQA 2Y7QA 3VXOB 5FEBA 1KB9K 1WS8A 3IU3A 4BRVA 3PP3K 1W2KT 4XCEB 2Y7SA 5C2UB 1FC1A 4TYUA 3GXPA 1L9QA 4CSTA 1XF1A 3RX5A 2OQJA 5MEPA 3BE1H 4OD2A 1SQ2N 2ZWYA 2EKSA 2JWYA 5CIPB 5F7FA 2EE0A 1FG2A 1DVTA 3C12A 2GHZA 2EVGA 2GSGA 5KAQF 1CI5A 3IVKA 2QSVA 3OXSB 3HVNA 3REWB 4OUUB 1IM3B 1Q9KA 4DVRH 4Y5VC 1QZ1A 5KSAD 1KDIA 1GPOH 2ICWJ 3INOA 5F7DB 4WKZB 3UBXA 5IGXH 1UOLA 1CVRA 2C9UA 4JPKH 4OLYH 2EH8L 3FTGB 4YSTA 3FT3B 5C2BL 3SGEH 1PLGH 1HQ4B 2PYEA 4U0RC 5I1LA 3V6ZA 4G8EB 1ADQH 3O3EA 1HSBB 1U8MA 1UT9A 3DMMA 4Q4IA 3MRJB 2Q8BL 1EDHA 1G0YR 5ESQA 2AI0H 3D30A 5CCGE 5KVDH 1NBZB 3S2CA 12E8H 4YX2H 4DAGH 4POZC 4HHAB 3N42B 4MD4A 2X89D 5JTWA 1A6AB 2UVEA 1MWAB 3BC9A 5GRJH 4FYQA 4B9ZA 3BP7B 2YGOA 2E9IA 4PD4K 3SKNB 3NEXA 1KTRL 1KGYE 4IJTA 4NKIH 4NO3A 4YDKH 5C70A 2XZAH 2WTRB 1JZIA 1HWWA 1NGWA 1UATA 3QEQA 4JPWL 4O2CA 1FL3A 4L3FA 5D2NC 1ULVA 2DYSB 3NCXA 4Z7WB 2W1NA 1BAFH 2FH8A 3E8UL 3UJTH 3JWDC 3NH7L 4WV1B 2VC2H 3TV3L 1MIMH 2P8PB 4TUOB 4Z7NB 3QRFM 4ODTL 3MV9A 4KI5D 3KAAA 4E9RA 4OI8A 5FA4A 5IFHL 3EF7A 1R3IL 1FH5L 1NCGA 3VD2A 2CDGA 3ZDYE 3WY2A 2GCYA 3BZFB 2WZ0A 1JP5A 43CAB 4F57H 4DK6A 4P9ML 2A4EA 5I6LA 2GT9A 3V55A 3OHXB 1AC0A 3QXWA 4PSRA 4Q6YA 2ISDA 1D5RA 2ESVB 3HS0A 5LLIC 5B1BB 3LNHA 3L3OC 5IEHB 3ZGHA 1T89C 3L9BA 1E5AA 3F8UB 3MV9D 3WHXB 3EO1B 5LAXB 2LU4A 2NZ1A 1IBHA 2JI1A 5BVPH 4XN5A 1SOQA 4AJVA 3LNIA 1A65A 4JY4B 4FP8H 4MJ6A 3X3GL 2R1XA 2ZXEB 1MQ8A 3O6FB 2OV0A 5D8JH 3U4EA 1IVTA 2IH8A 3Q0HA 4L8DB 3FMGH 5FO7B 3VFTB 1XR9B 1NCTA 3U6XS 2NY3B 5J57B 4GFXA 4XPBH 4KKCC 4OGQC 5T33H 1S9XB 2BDNL 1IZKA 2GC7C 2ZZUT 1GCFA 1R5WA 3V9FA 4AW4A 3GJFK 5KVFE 3FHAA 4CC1A 2X42A 4K8RC 1GGIH 4UIKH 3OHMB 4QF1B 1WZ1L 5IMLB 3IPEA 1XCWA 3SY0A 4F92B 4FL4B 4H0GA 2G75A 3ARZA 2JKRM 4JO4H 4L2YA 4PJGA 3TBTA 2ZSVA 1CDUA 4JPWH 3WN5B 1Q0XL 1PIGA 2H2SD 3H9YA 4WHTA 3Q8FA 5ILTH 4OFPA 4AIXA 1ZSDA 4ZFZA 1H5BB 5EORL