4PIBA

Crystal structure of uncharacterized conserved protein pixa from burkholderia thailandensis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
176
structure length
174
Chain Sequence
b'SHITINVMTVIDVAAIIDELKAQEKKLGQTPDTATSIGHKYIYMSSDDPRGWSVDPGNITLNAHVGDTLSFFCASTSDNSEYAAFIYRLTGGDPHLDPSHVEVIKLQNAAQPTPSNGYPFTTAPVAFSSCDAKVAQQGQAKNFYVWAALFTLDDSGEKQVLAGYVKWDPTVNVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords inclusion body protein
molecule tags Unknown function
source organism Burkholderia thailandensis
publication title Crystal Structure of Uncharacterized Conserved Protein PixA from Burkholderia thailandensis
rcsb
total genus 41
structure length 174
sequence length 176
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2014-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12306 PixA Inclusion body protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pibA00
4PIBA 4LZKA 4Q52A
chains in the Genus database with same CATH superfamily
4R5XA 2F7QA 4F9LA 5BUGA 1P4LA 4KAQH 4HH9A 3GXPA 1DJZA 2ED9A 1ZLWK 1N7MH 4HSAC 3QNXB 2ZX5A 5IFHH 1PY9A 2AJVL 4NQEE 3DRTA 1NOAA 4KTDL 3BSZL 4PRID 4GBXB 5AZ2H 5IG7A 2ZAGA 1GYVA 3GSQA 1MOEA 4U6VL 4M1GL 5BVPH 2XACC 2FEEL 3CC1A 5K9KA 1P5UA 1ACYH 1KTJA 3VXRB 3SYAA 3I75A 3FT4A 4IS6B 1N0LB 3VFOB 1WZKA 4WKZB 3UAFA 1FYTE 1I8IB 2DQFB 2WKGA 1JMXA 5D7IF 2QQLL 4G7YL 3SCMD 5E9AA 2YWYA 2LLLA 5DJYA 2R8SL 2UX7A 3QZOA 3M17B 4GMTL 4DVRL 2Z8VC 1K4DA 3EOBA 3DX7B 2FUTA 3PF2A 2GKIA 1YPZA 1CICA 1Y6KR 2J8OA 1F6AA 1OSZA 2GJ6D 2VGLM 2VYRE 4FDWA 4JL1A 4LVNB 2YS4A 3KPOB 4HIJA 3BGMA 3DK0A 4HIPA 5EA0H 3WMQA 1X5LA 1BJ1J 3OGCB 4F5CA 4YHML 5C3IA 3BVUA 1PAMA 5E51A 3T8MA 1OANA 2JJWA 2OQJA 4DOHE 2BRQA 4QHMB 5KZCD 1QSFA 2PP8A 3HBZA 3O2DL 1B0IA 1DBJH 5IHUH 3WHE1 2IDCA 4XHJC 2Y6TE 1N3NB 2P5WE 5BMFH 4PGZA 3BIKA 4WWKA 4K23H 5IB3B 1FVEB 3D0LB 3EH2A 5F96H 1AZNA 3CBJB 2CLVA 2DQEL 2OP4H 2WWOA 3IGUA 4G7VL 1LP9F 4MS8D 3QUXD 2VJ0A 1E3FA 3BP4B 4JQIH 1OP3H 1MFDL 5DC9B 4Y1AE 3RWEB 1MI5E 2JJUA 2DWYA 3RJOA 1NCCH 2LE9A 4AKQA 2YRZA 3NSXA 5K33A 3FQRB 1ML0A 3SQRA 4JJ5B 3KPPA 3UZQA 1S4IA 1TTCA 4PJ8B 1NEPA 4Y5VB 5J1AA 3SO3B 5I76B 3CZJA 2Y07H 1RU9H 4I13B 4Y2NA 3QEUA 3HFML 4OFKA 2R29A 4R2GC 5ADOL 4PEEA 2EAEA 1OEZW 2W07B 5DO2C 4KZEH 2ZE0A 3K71A 3BP7B 2ICES 1R3HB 1GGCL 5F7HA 3KM1A 4WSJA 3CSFA 4Q6KA 3T8VA 1NOLA 1FNLA 4LHJB 4S1SH 2JQAA 4DZBA 4K73A 3NOIA 4TN9A 4JO4L 5FF6B 3LZRA 3QO0B 4RGOL 5T5FA 3RNKB 5FUCC 3U7WH 1INEL 1LYQA 1IBDA 3H9HB 3X14B 3UCRA 4M3JA 1BG1A 2OW6A 3ECQA 1IKNA 2D0FA 2DJSA 3TBSA 3L2NA 4MA7L 2HT3C 5CLTA 4OQ1A 5F3BB 2BW4A 1SY6A 3EG9B 3GBLA 1IX2A 2WN3A 4NJAL 4U6HA 1IBBA 2ERJC 3GMMB 4GJTB 5ILTH 5K9OB 4PJHA 2V17H 6FABH 3SGEI 2Y7NA 3VI4A 1ZGLA 5E4AA 5IMMB 2V5YA 5C86A 1AFVL 2H32B 1U3HB 2J71A 3C60D 2V9UA 4QRSA 4QO1A 4X98B 4WFFD 5GRZA 3S4SB 1KWKA 1MI5B 3B7UX 3RBGA 1QRNB 5DVKA 4Q0XL 2D3VA 2NNAB 1L0XA 2VDOB 1WEJL 4YPGB 5EUOF 4JQXA 4WFGD 8FABB 3BT2H 2DYPD 4ZXBA 4LCYB 1JFQH 1UHVA 4K5PA 3HUJE 2MKLC 3MUJA 4WTWA 4MNGB 4Q58C 3QZWA 1LGVA 3BPNC 1O7SA 1LDSA 3RVWD 5A6LA 1ZCRA 1F18A 2JKSA 2WLYA 5EBWA 4AGNA 1UXLA 2FSEA 5JHDA 3IJSB 4UWQB 1B0GA 1DJYA 4MSWB 2OYLA 2AQQA 4A6YL 4AL8L 2X09A 3LNIA 3LS4H 3NCMA 2WTOA 3F7RA 3TH4T 2F2HA 3D52A 3P2BA 1BZ9B 1HQ4A 3SDCA 4HW6A 1BWWA 1QEWA 5CSGA 3KS0J 2E3VA 5GRJL 4D9LL 4HS6A 1S7VB 1RUKL 2BCKA 3CIQA 2ED8A 1BFTA 3R8BB 2DEXX 3FF8A 2EH7H 2NRDA 1WFNA 2B1OA 2IPUK 5F2FA 2GY5A 3SODB 2HCZX 3L1OH 4IRJA 3AU0A 2QHRL 3VI3B 5J06A 3WFHB 4I0CC 4OM1H 3IGAA 1DQIA 2FX9L 1MFBH 2VXTH 4U49A 4ELMF 2YJLA 3OZ9H 1G7HB 1Q9WB 2DS4A 5F6IC 1QFUL 1MIML 3CVIH 2X7LB 2X1WL 4GT7A 5DZVA 3S2AA 1UATA 4KFMA 1ZLSH 3QEHA 1ZSDB 2AQPA 4HQQH 4C59B 1JYNA 3QIBA 1R1CA 3CHOA 1HOCB 5CSBA 3UDWC 2ARWA 2Y69B 5IHUL 1Y18A 2D7QA 1U8IA 1INEH 2BSCA 3KE0A 4NXKA 1YMME 2FJUB 2L7UA 2C4FU 4XPGH 5CUSH 4G8IA 1P4IL 4ZMNA 1ITCA 2QGDA 4ZFOA 1S7VA 2EVHA 3WKPA 3CJJA 3QQ9D 3UTQB 4X8JB 2OI9C 3LVTA 1SBSH 3MBEC 3HG0A 3P9MB 1C7TA 3F6IA 3PU7A 3U79A 1CYGA 1BMZA 1YHPA 5AKVA 2DY2A 2AEQH 3RZCA 3MOBH 1QUNB 2EIJB 2FSEB 4JY6B 3H42H 1T5WB 5GS0D 2IAMB 5E5LA 1NCAH 3W11C 4KXZH 1KEML 3MVSA 1KYOJ 3T8XB 1OHQA 4C57C 2K6ZA 2NY1D 4Y16B 5I74B 1DBKL 1M7DB 3QNXA 1I3RA 3HG3A 4C56B 3H4FA 3K6SB 4PJEE 3QUGA 1RP8A 3QRGL 4AIEA 3MREB 3EGSA 3EYQC 5BV7H 2WOBA 4PTUB 3U6XS 1XXFC 2O6FA 3A67H 4QO1B 3S4SA 5K59E 5B39G 3ZTJH 3DUUB 2E27H 4PJIF 3QIWD 2NNFA 4JFDD 5IHZA 1RPKA 2IEPA 4OBRA 5MP6H 1T7ZA 1T89C 1UB6A 3GLDA 3P3TA 1XL4A 1J8SA 3P4NA 4NUPA 2PYFB 5TQ2L 5DRZB 3WSQH 5F3BA 2EUVA 3DX8A 5MHSE 5C0CE 1MCIA 4PJ7F 2HPOA 2AEIT 4QRAA 2WTRB 2KLSA 4MRBA 4CADB 2OBGA 4G8GA 4OGZA 3WXVH 2COQA 4FCHA 2BY2A 2CIIA 3RNKA 2Z4TA 5DHYA 4WEUD 1CXIA 1O7DC 1QFUH 4UT6H 3ZGIA 5F88A 5JQ6L 2NXYB 1ZHLA 2MEJB 4PJ5A 5T1KD 1WK0A 3CFIC 4RDQG 2JI2A 5FHBL 1XX9C 5C0BD 2EXTA 2F0CA 1HZHH 1FVDB 2VL4A 4PCYA 5T1DL 1U8KA 2BXZA 3UGXA 3PXLA 1ZRUA 4KTEL 4YDMA 1JZ2A 4P04A 1SJMA 1S7WA 4YL4A 4ZS6C 2ZCHH 5FM5M 1I7TA 3E8UH 2M1KA 4Y1AB 2DQGH 4NFCA 4LGRB 2NUPB 3JTBA 2FWOA 1ITBB 1GJIA 2XWJB 4JFFD 1A4AA 3C09C 3O3AB 5DEGB 3STLA 4BFRA 1W80A 2VSKB 2PO6B 4BFJA 2APSA 4GIAA 4NM4L 4YHOL 3U7WL 1RLBA 4NGHH 2VLKE 4NKQB 2WB1A 2A9AA 4Z0XB 3KWUA 3I02A 5DS2A 2F58H 2VM4A 2J8UB 3IAQA 1CR9L 2H6UA 2F8IA 4QRQB 2B14A 3Q13A 3IJEA 4XN9A 4HT1L 1IAOA 5DR5H 2NMSA 3PHQA 1F4AA 3SE6A 1ROCA 4QCIA 4HUWB 4G7QB 4PMEA 5ITBL 5D1XD 4UM8A 3NIFB 4XWGL 2NUTA 2RFXA 2MFNA 1HYRC 2FJFA 1L9QA 5L88H 3GZQA 4QTHB 4ETQB 3C6LB 3K74B 2UZIL 3SDDC 4BSJA 4ZO8A 3BCFA 5KOVC 1DJIA 4LQFL 4BXSV 5K1NA 5I6LA 1WJ3A 4FOMA 3ZQXA 1FFOA 3FJTA 4LE8A 5I18H 3GHEH 4BH8A 3QUYC 2I25N 4F1SA 2APXA 4P4KC 3DX7A 5L4MA 4E5XG 1E30A 1PQZB 1T04B 1KZYA 3Q8EA 2QSVA 5F7DB 4IRJB 2OTWA 5JPNB 4CVWA 1SN2A 2DEYX 4Y5VC 4GIPD 2RQ8A 5AD0B 2WQ8A 32C2A 1G1KA 5T3ZE 5AVZB 1BSIA 2AK1H 4MDJA 1UACH 1E5UI 1KB5H 3LMJH 2LOEA 2RB8A 4NIYE 5F9JB 3UC2A 2VWEC 1P5UB 5HGHA 4NQXB 5T1LB 4R96B 3IFPA 3HN5A 1JGEA 1XIWC 4Q8BA 3L3JB 4X5PA 3CVCA 3P3YA 1FHNA 1KFAH 1F4WL 2PR4L 3NSCA 1BFOB 1UB5B 5D9SA 4HU8A 3OMIB 4TUKH 5D5MB 4F7MB 3RGVC 5F9WC 2E5EA 4M6NL 3SDXB 2YD7A 4HH9B 4PV9B 3S5YA 3UROR 1S46A 1B4JH 4GMTH 1JYWA 3MRGA 4G82A 3JTSA 1H6UA 1LP9B 5SX4I 5C07B 3B1UA 4G1MA 5EU5A 2RHEA 5KSBF 3V5HB 4IMLB 4NT6B 5ISZD 4ZUWA 5HDBB 1NH6A 5ANME 4AZUA 5LNEA 3O4LD 4WTXA 2H9GA 2Y2YA 3RVTC 1XBRA 1BM7A 5IJCC 4ONGH 2VDRL 4F37K 3WJLA 2XY2A 1EAPB 1IGCH 5GS0C 1R34A 4FYTA 1A7PH 4G6FB 4AENA 3K46A 1IB5A 1ZE3C 4KMTH 1QFWH 2PXYC 3KWWA 3K4DA 3BHBB 4KROB 1U3JA 3UCQA 5IMMA 2ZTBA 3F3HA 4WVRA 1HIML 3W11D 5IFHL 1RP9A 1YEEL 4HJ1A 3IBEA 2DYRB 4LKXA 4TQEH 1UT9A 4MJ2A 4UQAA 1I8MA 1E27A 2DM7A 3TN0A 2FSDA 5D7JC 5EU3A 2APWA 3HAEG 3QIWC 3W1ZA 1NDTA 1M3IA 2JB5H 3K8MA 1DQLH 3QS2A 3VXME 1C08A 4XCNB 3LN4A 3QRBA 2ZUTA 4XNQA 4QYOA 4FFTA 4XVSH 3DV4A 4HBCH 4U2ZA 1PZBA 4G8FA 5F97E 1GZQA 1B0WA 1P7QB 5LVEA 4CGUB 3P11L 5B7FA 1BIHA 3ZGHA 4P2RD 4QF1B 3RVUD 5M94B 1KY7A 2IDUA 4PSRA 1E5YA 3T0WA 2K1MA 2C8NA 3MOAH 4WGVB 2UWEA 2BRRH 3PCYA 3TIEB 1N19A 4MCZB 4KHTH 2DF3A 5IF0A 3N9GL 1SMDA 3P9LB 2L3BA 5ALBL 3G6DH 4G2AA 4L2YA 4PG2C 1HCYA 4XPFL 5DVOA 4CC1A 2WVUA 2XI9A 4HHGA 4JDTL 3TBVA 5IV2A 4P2OD 2AFNA 3IXAA 3VGHA 5EF2A 1UM5L 3KPPB 4XO9A 4OGXL 4GAJH 4X0KB 1JG9A 4YHKH 5DHEA 5E0FA 1RZ7H 4LLWB 2V8MA 3PABB 4M93B 5IM7B 1B90A 3VH8G 1YPZF 4UOW1 4U1SB 3QIUA 3D39D 1GGTA 3TVMA 1FIGL 2XKUA 3E6HA 2Y36H 5JHBA 2F58L 3HRZA 3QG6B 1Y07A 4XAWL 4YDIH 1BGXL 1JGLH 1P7KA 1KN2L 4L3FA 2O6EA 1IM9D 2QVTA 3VFUA 3MLPA 2HN7A 3IFOB 2HKFH 3RPBA 2ENYA 5E8DH 1KDJA 1UKQA 2YQGA 4GS7C 4NRZB 4XO4A 3HIZA 4L3AA 5LDSA 4WW2F 1PZ2A 4XOEA 2OK0H 4PI2A 2V2TB 4ODXA 5J11C 4HHAB 3SBWC 2M2DA 3CSYB 2DDQL 3BI9X 3KDMB 1U21A 4N9GA 5FAAA 4DZ8A 5L2JA 3HNSH 3DUSB 2R39A 1UT1A 3P0YH 5HHNB 5IZ7A 1GJWA 1YY8B 3NJIA 3OF6D 4OFDA 4P2AA 5FOBB 4FNTA 5IGXH 2KC0A 2N01B 3QEGL 3QXAA 3UGUA 5LXGH 3DETD 4XXDB 1E9OB 3I75B 1ECYA 4EI5A 1IGMH 5L8KB 4YXKL 1EEZB 4O2CA 1P7HL 1OWWA 4AJ0A 4NHCL 4DSYA 4X8GA 1R47A 3ZZLA 3OJDA 1IC7H 1UVQB 4XMZA 2N59A 1S9KC 2OV0A 3R4DA 2I07B 2WXNA 1DVTA 1JXKA 1P6FA 1XZ0A 2MKWA 3NJMA 3QISA 1T0MA 2QVIA 2DQTH 1OAJA 4XVSL 3RHWF 3US9A 1QO3B 4GUQA 4KOBA 1DUYA 2WYTA 4XCEB 3J2PA 4MGXA 4B7IA 1IKFL 3ZZ1A 1VA9A 5DD5L 4OCNC 1R3KA 4ODXB 1G7MA 1FLRH 1WTLA 3O6FB 1B3IA 2ZNXA 4WFHE 2QSTA 3A67L 4V1DB 2AS5M 4D9RE 2C9PA 3WIHL 2I9LB 3ZY7A 4NPYB 3VXSB 4BZ2A 3SE9L 3VXUB 4YHKL 3LZFL 1X5YA 3MJ7B 1NLBL 1NCTA 3BZFB 3DTDA 4LVHC 2PTUA 2VW6A 4X9HA 3EJJX 2VDRH 4K94C 4P5TB 3BEWA 4EXPX 2R9HC 3SGJA 2CJTA 2DQJL 5HDWA 2FNBA 2OMTA 3WUWA 2VL5A 4LLWA 5DJZA 3VGEA 3OHXB 1N12A 3FBQA 1BAWA 1N2RB 2BHFA 3MV7E 3OLGA 5DD0H 12E8H 4M48H 1OD7A 4BQBA 5J3HD 3BUQA 1JYXA 4RWHA 1N59B 3BKJL 2EINB 3SDAB 4CMHB 5A2IH 1DQLL 3GJFH 6CGTA 3UGEA 4J3BA 2ICEC 4JKKA 5HGDB 2FUQA 4QWWC 3CXHJ 2VERA 5F1KC 3EGXA 3R0MA 4K8RH 4RQQA 2EDHA 3PL6A 1G5GA 2FWSA 2Z1KA 5E00A 5C0CA 3D2UA 3LQMA 4XNQB 2X6VA 2EABA 3PL6D 1AQKL 1VZHA 3LXCA 1H3TA 3GZPA 1CVSC 3OXRB 5ACMA 3NSYA 5J9PA 1G0YR 2GUOB 2YPVA 5LN8A 2BXYA 4MB4A 3NCJH 2AJXL 5CSZA 4AJVA 3P3UA 4X6FB 2BIQA 4AM0A 2KS0A 1UEYA 3QHFH 3V4VH 3RURA 5DXWA 2JXMB 2OXGB 4KQ3L 2WQAA 5E99L 4OAWB 3VGDA 3QXDB 1FZJB 4FNUA 1CZ8L 3RTQC 3D30A 5HGBB 4YZFE 5T1MB 3IDJA 1F5WA 4UIMA 2XPGA 1X5FA 5KYWB 4D8OA 2NY0D 1UD2A 4DKFH 4M7KH 35C8H 1UM4L 2J20A 5HGGS 5DK2A 3MO1B 5C07A 4PJ9D 2QVFB 1W72L 3ES6B 4KK8C 4B0MB 4QLWA 1OTTD 1U8JA 5EO9A 3QXVA 4WU7A 2C3GA 4XNBA 5DLLA 1S9VA 4GLRI 5D4IA 4UUJB 1I31A 2AK1L 4W9EC 4Q14A 3TBCA 5HP5A 4Q9RL 5F3HB 2X4RB 4G6FD 3ZRFC 4HLJA 5CR8A 3V9EA 5HY9B 4DP4X 4CNIA 2EC8A 3IT8D 4DK6A 5J9PB 1P2CB 2NY3B 3HE6B 4PRBB 4QGYA 5JYMA 4LZKA 1IGML 4XI5D 4M7ZB 4OF6A 1UM5H 3KXFE 4U1GB 5TF1H 3SKUD 3FAWA 3QDJB 3NK3A 4PRPA 1OSYA 1XO8A 1DQJA 2CSPA 2XN2A 4KZ0A 4YUEH 3PJNA 3M7FB 4L0ZA 4BRJA 1GZHA 1JWUB 1RSFA 2VDKH 1BREA 2W92A 1UA6L 5I8KL 1N6QH 1R3LA 2I32A 2W60B 4H1LB 1SNRA 5BZDA 1N59A 2EDJA 5F1NA 1U8QA 4KV5F 4QRUA 3KPSB 1GYCA 4DP8X 2R27A 1KELL 1U93B 1N2RA 4P5SA 4I18B 4G6JH 3A22A 1D2PA 1NMCC 3RI5K 1SVCP 1MXGA 1P4BH 4GYBA 1SY6H 2DM3A 1GAFL 5E08L 3MCKA 1KUMA 4KROD 5HJ3A 2CKBB 1NDGA 3ARDA 3T04D 4D0DA 3C60A 1V3MA 2OZ4H 3GSUB 3SE4A 1OB1B 2GT9A 4BE5A 4D94A 5L0QB 3TPKA 1IMHC 3QDGD 1T1YA 3LJ3A 4P4KD 2MTPA 1BV8A 3H1ZA 5J89A 2IFFH 5DRWB 3WGVB 4XP1H 2UXTA 1QPXA 2G30A 3I6LE 4OTXL 1BVNP 4TSAH 3STLB 3RX9A 1WRFA 5ABAA 1PZ5B 2NY7H 3HI5H 3O6FC 1MHEB 2M26A 3OB0K 3OWEA 4PGBB 3SJVD 3BUDA 3ZOAA 3RU8H 3PQYA 1TETL 4L05A 1DEDA 2EDBA 2I27N 3S96A 2Y9RT 5KVGH 5F7EH 2GIYA 1RJZB 3WSQL 2H2SD 3DHPA 1IZJA 4PS4H 1JI1A 1D9KA 1NFDB 1S78C 2UX6A 5CUSL 3ZVVA 3KMDA 3DMMA 1MN4A 2QQQA 3WI9A 1YLBB 3S5LG 5E03A 1MY5A 3NJLA 4A38A 1EFXB 2NYYD 3B2VH 3A23A 5KJ7E 2XWCA 3RL2A 3WIIH 1CU4H 3WFDH 5IB5B 5D2LF 5MENA 4YHYC 1FL6B 4NAMA 1I7RA 3RZWA 1S7RB 1IBHA 2WAQA 2DD8L 1XR9B 3N41B 4OY9A 4QYAA 4KKRA 5H8DA 3U30B 5JHAA 4PRDA 2VR4A 1KXVA 4YDVB 4JREB 5DD1L 4RDQF 1LTXA 2ZOUA 4FXTA 4G8EA 5AVTB 2H5UA 1SLUA 1WWBX 2XVKA 3FO1B 2I60L 4WUKL 3GHBH 1N5AB 4X5WA 1AGDB 1NPUA 3PG2A 2NPLX 5D6CA 5LBSL 2ENQA 4BQ6A 4GRWE 4KQ4H 5GRUL 3TLRA 3SCMB 4N2CA 1EAOA 3C5SA 3BRGC 4PGJA 1R5VB 4CGTA 4MVBC 3AMLA 1NBZB 1YC8A 3HRZB 4M1GH 1DE4A 2B1HH 3HZYB 3TJEH 2IDFA 3KNBB 3TPUA 3L3KB 4JY4A 5D7LA 5JR1H 1U8LB 4FNRA 1MXDA 1O9ZA 4X7CC 5CAYB 1CGSL 5DJ0B 2Y6SD 2YXWA 2R69H 3B1TA 2EYTB 3RZCB 4XPGL 3SPIA 2XICA 2NW2A 5CWSA 1ZPLA 5FO8B 1ZD6A 3DVNB 4LCCC 3LX9A 1NGXA 4V33A 3U7YL 1OE2A 3TBTB 3MTXA 1TFHA 1YY9C 4KKLC 4H2AA 5GZNA 4LCVA 4Q4EA 4N1EA 1SPDA 2D4FA 1BQHG 3MNWA 2EDEA 1ROWA 1XF4A 3DARA 4GRLB 5IMLB 4X4ZA 1N6QL 3MRDA 1NBYB 1DVSA 5KANG 3UEZA 4C83A 1RIHH 1NCGA 4KPHL 4N2EA 5DUJA 4HWBH 2MH4A 3NJGA 4F7TA 1B4RA 4G8GE 1EZLA 4LKCA 1JCVA 4KWUA 4BHUI 3EADA 3SEPA 4D7BA 5JXEA 1ULVA 1C5BL 1Z5LA 3KPNA 1KIQB 3UZVA 1YYCA 1HNFA 2DM2A 3BPLB 1S7TB 3G9AB 1GOFA 3DJZA 3VWJB 1JE6A 2HRGA 4RCAA 2X0VA 2XPYA 3FF7A 3C5ZA 3DJSA 5FFOA 5C2BL 2VDQL 3AWEA 1W72H 3JVFC 4E0RB 4BZ1A 3DLQR 2GPZA 4GI9A 2BIMA 5HI4C 2GCYA 4LARH 5D8JL 4X5XB 5I1CL 4K3DH 3SYPA 1T6WA 5E6RB 4D7PA 2VIRA 3UBXA 4U6YA 1YO4A 2YD2A 4JUTA 4U1KB 5J6HA 1AZBA 4FYSA 1HNGA 2HFFA 4Y8AA 2AJSH 4XXWA 3T3PE 3LB6C 2NXZD 3A6BL 3SY6A 5KUKA 1BD2B 1M2VA 4Q2ZB 2IPTH 4YR6B 4NP9A 4WHCA 4OF8A 1BFSA 3BAEH 1KEMH 3MRPA 3KPLB 5D5MA 4F7MA 2RA1A 3EHBD 3CN2A 2YEVB 1OW0C 4ADGA 1Q90A 2A6DA 4DEUA 3FFCE 2F53B 5FWRA 1JWSB 1NFIB 4U7MA 1AO7E 4UQDA 4PCTA 5C08A 1ND0B 3QR2A 3DVFA 5DLMH 5D2NB 3FT2B 9CGTA 4KDVA 4AITA 1C16B 3Q8FA 1A3QA 3QCUL 1SVZA 1G1OA 4LHUB 3KM2A 1Z32X 3OHMB 4N0YH 2EEXA 3PWJA 1MFAL 5DRNA 3X13B 4FQXD 2UY6A 5GGVH 4Z77A 3VDCA 2WLKA 4LGSB 4D8PB 2IBZX 4M1DH 3IPEA 3LEVL 4I4WB 1HWGB 5CZXD 1K5NB 1TMQA 3CZSA 4KRMB 5FYKD 2O61B 2Y0SA 5BRZE 2YD5A 1IJ9A 1NWOA 2IH9A 3V4PH 4KZDL 1QI4A 1VGKA 1YEDB 4QR7A 2LR4A 2FHBA 4PJCF 1I1FA 1ZK9A 4YEFA 3X14A 2P49B 3CWGA 1V10A 2ZNWA 4X99A 3TBYB 4NNYB 3QIWB 5I8EA 5B3SB 1JXFA 3U2JA 4ZSOE 1QFWL 2IADA 1ID2A 3IN0A 4GT0A 3TNMA 1JTPA 1XVSA 1OM3L 4YSTA 1VFBA 3HJEA 1OW0A 3FRUB 5DMGD 3FUDA 3RLSA 1MW1A 4ZS7H 5AW0B 2B9AA 3OR6B 1Q0YL 3OD3A 4XP1L 4OCYL 5T3XL 2MHAB 4MXQD 3K71B 2B7DT 2EH7L 5B1AB 3H2PA 2O30A 3GINA 3ZE0E 5D1QA 1JS4A 2OL3B 4I0PD 4LPCA 1UOLA 1M71A 2XN0A 3FFCB 4H20H 5EU4A 5DFAA 5EPMA 3L4VA 1FO0L 4O02B 1ANUA 3LRGA 4HKJB 3CFEB 3LEXB 1X5MA 2EP6A 3FQRA 3WTSA 3Q1EA 4OD2B 2IXQA 3T0BA 3NP3A 3OC8A 4RISL 3V0JA 3SY0A 1TZGH 2IV8A 3G5ZB 4OFYA 1FGVL 5HYSB 3AACA 3OPUA 5D70L 5GISH 1AY1H 1FZMB 3ARXA 1U8KB 2WLZA 3L3OB 4M7ZC 2PLTA 1KN4H 5E9DB 1TT6A 3IWVA 5KVFL 2WW8A 4EQ3A 4F7EA 1MNUL 2WQXA 4KO9A 2IADB 2CDGB 3R06A 2YK1H 4KFZC 1C5BH 4N8UA 4NI3A 4YSEA 1MH5B 1RQ5A 2F19L 3DJRA 4OZGF 4B6ZA 1TPXB 1XZWA 2DKMA 1F6AB 1OSZB 2CCLA 2CKBL 1J9RA 1MWOA 1EXUB 3N42B 5IJDC 3DROA 2BOBA 2Z3FA 5I18L 5KSVA 4G80A 2YAMA 3L5JA 4UQBA 3RUGE 1QSEB 5E6YA 1BVLB 3HZVB 1S5HA 2LHAA 3U1PA 1BX2B 1XGZA 1XR9A 3BDYL 2ITCA 1DL7H 1EQWA 4XT1C 5C6TH 2DH3A 1MCLA 3DX9B 3FULA 3H7BB 1N18A 3L4WA 3BUIA 2VR5A 4KKCC 5CHNB 1SDAB 4F2MA 4ELME 2UUDK 5LGJB 4PAZA 1KBWA 1QPKA 1HSAB 3CFBA 4EI5D 3NUKA 3RL2B 5CGBA 1KN4L 2L7JA 1E5BA 4A2DA 4N2AA 3QJQB 5F7LB 3ZKND 3ZDXF 2FEEI 2V33A 1DFBH 3I6LD 3U9WA 2R1WA 3RY6C 5IFAL 3EF4A 4NDMA 5I23A 4KVPA 4AZ8A 1BVOA 4EIUA 4J3OC 5IG7B 1A1NB 3S96B 3JQOB 3MBWB 3K81A 3QDGE 1RIVL 4GKSB 3APMA 4LIQH 4MCNA 1UGKA 4JAMB 4OJEH 3DKHA 3MRIB 4I77L 3OX8B 2R1WB 3HG1D 3P2TA 5GJTH 5FLUA 3AABA 1MY7A 2A9CA 2Y3AA 1VLXA 5GGVY 1IGFH 4N2HA 3FPYA 5DZ9A 3O0LA 3LVEA 4J3OG 5E9DE 4Z7VA 3CVHA 4X6DB 3FQWA 2Y07L 1S5IL 3KYOA 1P4UA 4L4TE 1FN4B 5T3XH 5CMAA 3QA3A 1AI1L 2Z7UA 1XGRA 4OKDA 1JZ6A 5C2UB 4ZDHB 1FA4A 2RBLA 1THCA 3F58L 2YPKB 3TH3T 1E40A 5IW6A 1T2QL 3BZ5A 3GPEA 2DV6A 3MROB 2J6EL 4RZCB 5LAXA 4AVIA 1ECZA 4JO3H 1CIUA 1A4KB 5CINH 1U3HD 2WN2A 1IQWL 2F5BL 3T77B 5I73C 3EHBC 5EFIA 2CNYA 1DQKA 4IOIB 4K8RL 3DHUA 4NYLA 3B4NA 4LDEB 1TITA 2LAAA 5IQOA 2G2RA 4FD0A 5ICYA 2HP4A 2R23A 3LAFA 4HALA 4Q4IA 3SGJC 1F0LA 4AV5A 5IVNA 1H6FA 1G9EA 3BUYB 5FGCB 2FTAA 4MCYB 5IROD 2FBOJ 1JV2B 3GSXA 4U1GC 5IROA 2OX5A 3N85L 1NM4A 3CHSA 5HYSA 4B9ZA 5C70A 4YL9A 4C83B 2NYZA 2VH5H 4UTAL 2O6CA 5L8JB 2F5BH 43CAB 3WO3B 3WN5C 1A14L 2EO9A 2R29H 4W68A 1DZ0A 3WGUB 3ZXAC 2E9BA 4F3FA 3K1DA 3BFWA 1HH9A 2PCPA 4LASH 4NQVB 2JI1A 1NEZA 3SDXF 3GI9L 2ZOWA 4WW2C 2PTTA 3FKUS 3VACA 5A7EA 3KLHC 1PEZA 2YFOA 3FOMA 4Z5RB 3T2NH 1BDYA 4JFPA 1AAJA 1S7QA 3LB6D 1R0AH 5EZIH 5J13C 1PLBA 1WICA 4DP2X 2XA8H 2XVLA 3CDFA 3S3CB 1A25A 3PE9A 5FB8B 2V0AA 5FGBA 2BHYA 3MN8A 3OKMB 1BD2E 1HXMA 1WAEA 3QJFB 4K5NA 4WO0A 3SIKA 4PGEA 4I0PC 5BW7A 4LSUH 5KSAD 4R7NA 2WLJA 3GRWH 2EYSA 5EBGA 4HKZB 5CKAA 2HWZH 4KVNH 4Y1SA 3KR3H 2VC2B 4NO0D 4Y2OB 4JL2A 3MBEB 2XBZA 4Z6AT 1JIBA 3P4MB 2XRAL 5CCHE 2CO3A 2FQFA 2YBRB 4OB5H 2ZPKH 3ISYA 3QFGA 1BBDL 2KZKA 1GGIH 4RFNB 5IEHA 1T7XA 4PV1C 3ARBB 3RU8L 4E36A 5JHDD 4HU2A 3QORC 4HXBL 2GBUA 4W93A 1O7DE 2QQNH 2XWZA 3DIDA 2V7NA 3FT2A 2BWIA 3P73B 4R97B 5JMOC 1TUPA 1ND0A 3ARGA 5IVZA 4AYGA 3RE0A 2YKLH 4HJJH 3VO0A 4NQSB 1NCWH 5IOPA 1K2DB 4IHBA 5DK0A 4ORGB 2KHAA 4TVPE 5C3LD 3DHJA 2VDNL 2VR9A 2ZYIA 4TUOA 1GKEA 1PKQA 3N42F 4KXAA 2UY7B 3C60C 3BWAB 5JQIB 3JWOC 2OCJA 3R8QA 5HYEA 4WIQA 1KXVC 2NXYD 4IU2A 4XTRD 5T1KB 2WXHA 4X6BA 4E5XA 5EWIL 1BD2D 1GH7A 4S0HA 1I7UB 1RZIA 1JZHA 2ZSVA 5JUEL 5ADPH 3IRZA 5ESAB 3PWPB 3WNMA 3U46A 1HILA 5I0YA 2Y36L 4GINA 4K7PY 2FD6L 1U41A 1XR8A 4OD3H 4QJ3B 2QEJA 3DX3A 5TDPB 3UEQA 1UJ3A 3NGBC 3ARPA 3L5HA 2GJPA 1PU0A 1HHGB 1QBBA 4PUBL 5KZCB 1TQBB 1JNNH 1F4HA 1I9IH 5KYYA 4YWGL 1QYGL 5CF3A 4MAYB 4Y9EA 4XMLH 4HWEH 5TDOA 1GS6X 3L1GA 5KSBE 1D5MA 5C08E 3MRCA 3ROOB 3O4OB 3WTYA 2VLME 1WHPA 3CZNA 1A1MB 1B4LA 3OGCA 4KHTL 4ATWA 3Q6FB 3QVAA 1OF2A 3F04A 3KPOA 4YSDA 2C4FT 3QAQA 5F3FA 3N0PB 3ZE1E 1BA9A 2B59B 2WBWB 3FO2B 3IFLL 3EYOB 3VFPB 3PWPA 2YA2A 4D3CH 1OP5K 4FFZH 1K8DA 4OI8A 2XN9D 3TO4A 3WNNA 3L3GB 2JNZA 2CLRA 1O5DT 3T4AB 4ZTPH 35C8L 3E7JA 3LKNA 4HG4J 1N0LA 3QQXA 3GEFA 4YO0A 4FE9A 5SWSA 2DYPA 3KPRE 4ZXBD 1Y1DA 2V2WB 5CEXA 4WI4A 2AXGA 4DAGL 4WU5A 2Z93B 4L3EA 1NCBL 1ZXQA 5IVXE 4D9QE 1I7ZA 3PHSA 4EXKA 5IOPB 3KXFB 3MCG1 2YXFA 5DO8A 1PJWA 2B1HL 1W8EA 3PWLA 5DUBA 3MV11 4FNPA 1IBGL 3QI9B 2G2NA 1O7VA 4PP2A 1I8UA 1QR1A 3DK2A 3DOIA 1ZVSB 3V0WH 2V7NB 2E9JA 4UQCA 5LXVA 2VXUL 1HH6B 4R9HA 4F8OA 3RVXD 3WFBH 1UXSB 4K3HA 5AQ0A 4ZPTB 3CHRA 3FO0L 3BXNA 1CDUA 2BHUA 3QIBD 2EDRA 4L8CB 2FIRT 2WXIA 1F3RB 2NT0A 3ZK0A 1XWVA 5C97A 4XR8C 1RJYA 1UJ3C 1ZWIB 3PLYA 1G87A 5BRPA 4PRDB 4JEGB 3ERXA 3RX5A 2GK0B 1G7JB 2KZ1B 4P4KA 4B0MM 3NG5A 1CXEA 3U6RB 1P4BL 2GSGA 3HR5A 3BKJH 2ZSWA 4XC3L 3U0WH 2VXVL 4PW4A 1KY6A 4UM9D 5BJTB 4X6FA 4UINL 4PLOB 5TE6L 4GO6B 2F54D 1ETA1 4NENA 4XMPH 2R56H 4DEPC 1PX3A 3O2VH 3VU1A 3OXRA 4DVRH 1MCEA 1RJLB 3DX1A 3ZL1A 1AXTH 4W6WB 2HJLB 1BQHB 2DLFH 1DLHB 1JPFA 3DSFL 2Z0UA 4RWYH 2Y06H 4RQQB 3GS0A 5DRXB 4RA0C 2VMCA 3RL1B 1AJ7L 1I9EA 4LSTH 2HAZA 5SWSD 3WXWH 1AH1A 1EHNA 4H8QA 4IHOA 4A2GA 1LJMA 4B9GA 2X2IA 1WA1X 4UAHA 4UQ3B 3NAAL 3U1SL 4XBEL 3U0TB 4LCWE 4G9FB 1ET7A 1DVQA 2WJ5A 1MF2L 1J10A 3L6FB 2VN5A 3Q6FA 1ACXA 1SXNA 2FECL 4X7SH 4MNHA 4M6ML 3GXDA 4J1UB 4LK4A 4PJ9C 3HNTL 2K45A 2EXSA 1F8TH 5FM8A 4QRPB 1CR9H 2VLKA 2XKSA 2YPLA 5B21A 5EOQH 1WA2X 2AVFA 4DKFL 1FV1A 3LY6A 1E4KA 1MUJA 1NFAA 4IOIA 2X40A 4L1BA 4GKZA 1IRAY 5D7HA 1AKJD 4X83A 3BPCB 4NP4H 1NGZB 4UF7C 4F15B 1I8KB 1R24A 2IANB 4UOQA 4J6RL 4JRXA 3MR9A 2X4PA 4MKMA 5H37G 1FZKA 1HEZA 5IW6B 4X7SL 4L3EE 3VX0A 1G7IA 3EO0B 4OQTH 3U48A 2X3AA 3FUHA 1UOVA 3OBAA 4XBEH 4ZDHA 3ULSB 4ATTA 2Y3NA 5JIIA 3FOLA 3GSRB 1C12A 3K2IA 1I3UA 3CVDA 1U8QB 2CO7B 3GGWB 1FDLH 4G59C 5KN5B 1UJ3B 2OJZH 1KTKE 4HS3B 4JN2A 3UYRH 3FCUB 4M43H 4B9IA 4MBRA 4F7PA 5EBLB 2UZXB 5F44A 4G9FD 4TQHA 4UQ2A 5T3ZD 2JJSC 4S1QH 2V5RA 4EKXA 1NIAA 3QDMD 1MLCB 3PWNA 3OX8A 5DZOA 1EA9C 3I6KA 3RWDA 4EZJA 4U1MA 3HCVA 4MXVF 4WHTB 4E42A 3EYVB 3Q1SH 4PJXA 4WDIB 1TTGA 2EDFA 3BWAA 5AKSA 5IREA 3CFKB 3T6XA 4H8PA 4R5TA 3RUGA 1KPUB 3TF7C 5GGUB 1BQLH 2BNUB 3DI3B 4M6OL 3UPRB 2EO1A 1S9VB 5HI5D 4MA1C 4UTBL 4EI5B 5EEWA 1A6AA 1N64H 5DK0B 5E2WH 4AC4A 4IRZH 1PBYA 4F33B 2UXGA 1UCTA 5I71B 4ZFOL 1TYRA 1Z6JT 4XTRC 4Z78B 3H3BC 1F3DJ 5CP7A 5GJSH 3R0NA 3GMOA 2PABA 5SV4A 2XDHA 3P40A 1AP2A 5JLZB 2ENSA 1I9RH 1N8ZB 3MBEA 1YUHB 4N3UA 3V10A 2JCCE 1E9QB 2YLHA 4E5XB 2MNUA 4XN4A 1TJHH 3C08H 5JDSB 2G0KA 3GHPA 2ZKHL 5F0LB 4MTMA 3VFUB 2BNRB 3MV9E 5AKRA 1UWXH 4V1DE 5E5RB 3ZO9A 1FE8H 4Y2OA 4QCIB 1P5VB 4I1NB 5E9DA 3RVTD 2B16A 3EJYC 3HN3A 4PP2B 4ZZKA 1OIOA 3WKML 2HMIC 4LCUB 4PJ7E 3NA9H 2AP2A 3WEBA 5E00B 4NERA 4YX2L 3RVVD 2XIIA 3NA4A 4PM1A 4LHUD 1F1DA 1U58A 2VXVH 1JHTB 4HAKA 4MFHA 4OD2A 5AAWA 2CO6A 2XBDA 4IOSD 1Q9LB 2AAVA 2KMWA 1SM3L 4X2UA 2H8PB 1A6VH 3APCA 3IMSA 4XOCA 4WWNA 3RJDA 5EN2B 4JM4L 3D39A 3BAJA 15C8L 1UA3A 2C5DC 5AYUH 3B7TA 4Y4KB 3B2DC 2J4WH 3KLSA 4R3SA 1CFTA 2CM5A 3FU9A 3HS0C 1FZOB 3ZKXB 1OWRM 1MWAH 3J8F7 5TPWH 3MYJA 2DQJH 1EHLH 4XNZB 2WWMD 2HLFD 2QKIB 4X6CB 2NZ9C 1RPQA 1T21B 1MJ8H 4PRNA 5AENA 3WNLA 2XZAL 3G6JE 3SKMB 3FTZA 1ORSA 1F3JA 1JV2A 3Q3GA 4MQXD 3WUWG 3VD2A 1JL8A 4QHLB 4ODSL 4MXWL 1TKWA 1EJ8A 2A5UA 3QZPA 4XWGH 4A7GF 2GI7A 2YPKA 3INUL 5ISZA 3WAKA 1ICTA 3GF8A 1TTFA 1J9QA 2I9LA 2BSRB 4OLWH 3L5XH 3MRRA 4QRTA 4KV5E 1OP9A 1MNNA 3FSOA 5I1CH 3QUMH 4F5CE 4K5LA 4UDTB 1JXJA 4FQIL 3PIQA 4O4YL 4OLUL 4XCCL 4M6AA 3EOTL 1TCMA 5I82A 3P30L 1I8AA 5G4NA 1WAAE 5D4QA 1UACL 5E6ZA 4E9VA 2R2HB 5LN4A 2WVVA 3FU6A 5DJ6A 2WCPA 2VXQH 5SV3A 2IWEA 1BOYA 4XBGA 4J6IA 1D7CA 5EORL 3T8XA 1GJUA 2RH0A 1F90H 1XCQB 2ESVE 2AJ3B 5D1ZA 4KQ3H 3VG0H 2OXHB 4OUOA 5D72L 4LSPH 1R46A 1U4FA 3IAPA 3E8VA 5CLYA 4JY5H 2YQ2A 3RX7A 3ARDC 2VUOA 1RIHL 2B08A 1K2DA 4LFHD 4YDKH 3I2CH 2VN4A 2OMWA 3OSKA 3L3JA 1TDQA 5DDHB 5EO1B 1UD6A 4DN4H 1SHSA 1SQMA 4PSPA 5AZEH 4YVNA 3AS0A 3CVBA 1GZHC 2QBWA 1XH1A 2CBTA 5CIPA 3PIQB 5GGTA 2I5YL 3HG2A 4UDTA 1ZJAA 1Z9SB 1FH5H 1WISA 3QUXA 5CHNA 1HN1A 4TULL 4GUOA 4ZMWA 4P99A 4P2OA 1J5IA 5EIIB 1SQ2N 3ET9F 5C0DB 5KTEL 4LGPB 2BW5A 3P4MA 1T4KB 3BD3A 3HAEB 3NIDF 3MOQA 4R4BB 3BDBA 1U8MA 1XIWA 1XCWA 4GMSL 3N2JA 4M56A 3T6VA 4O51A 4QRFA 4FGMA 2YUVA 3ESUF 5H94B 1YVLA 5IEKA 2ZCKL 1LO0L 4R90H 4FQQA 2Q6WB 1HQRA 2OM5A 3AQXA 5FKPB 1OT2A 1YNLL 1L7IH 1IGIH 2NY4B 1A6WH 3PWVA 4KI5F 1A4BA 1URLA 5GGSB 3IGLA 1D6EA 2NUTB 1HAWA 2FBRA 2XA8L 3N6YA 3WS6C 2V5MA 3GBNH 2X28A 4GXVL 5DZNA 5CJ5A 4E68A 2JKRM 1DCEA 3LH2H 3VH8A 3P9WB 5IFJB 1E4HA 2GSMB 4PRHE 5CGYC 2EDTA 1FZMA 2W0KA 3FFDA 4IIQA 3MKGA 2FQEA 1ACCA 5F89B 2CAKA 4N2NA 4ELMB 2VR3A 1CL7L 4K8RD 2K78A 4CVXB 3UBGA 1AXTL 3QQ4A 3M1OA 3FQTB 2NY6B 2ADJA 4M6NH 1AKPA 5TGBA 5ICZA 3VH8B 4NHUA 3QJHA 1M6UA 1NL0L 3C8HA 3LYRA 5E2TL 3FB7A 5FHAH 5B4MD 3D7PA 3N1MC 4FHJA 1Q1JH 4B3EA 2VNCA 2GI0A 5E9NA 1KB3A 2HG0A 5MP6L 1U3HC 2DJUA 2DQTL 4HA1A 1BF5A 2X2HA 3U2SA 8FABA 2B9BA 3KNBA 3VSQA 1M7IB 4L4TB 5CILL 1D6EB 4UU9B 3KH3A 3RVXC 4MZRA 4QRSB 1NFDE 4X98A 5F7YC 3O2WL 2F8XC 1TIUA 2JH2A 3V6BR 3VFTB 3N44F 3PL6C 3QQ3B 2Q1EA 1RY7B 3B7RL 5EIVA 2QSQA 3FAXA 4V2CB 3T2NL 4QOKA 5ECJE 5F9OH 1KT2B 2P8MB 3X1EA 2Y72A 4A7UA 3IDXH 3LQAC 5C6WH 1SFDA 3N43B 3OKKB 1A3LL 4ZFGH 2X0WA 4JG5A 1LO2H 4GFXA 4P2OB 1M9WA 4I3RL 1FGNL 5DDHA 3KPQA 1DQDL 1DDTA 3FUFA 1BQRA 4Z7VB 1RZKL 1F1GA 1A7OH 1K6QH 1OQXA 3SDCC 4JPWL 1BHGA 4P5MA 1AR2A 3T6WA 1GC1C 4TTGA 3VFGH 3MX0A 3RILA 2CA3A 3G7TA 4OM0L 2AJ3A 4NWTL 2I7OA 4P4RA 4BH7A 4QHNB 5LKNA 1MDAA 5ETUA 4HFWB 2OJ1A 3CDZA 4L2LA 1FLTX 4ZSOA 2IAMA 5FX3A 3QDMB 3FHEA 4JRYD 1GS8A 1T5WA 3D6GA 1H9VA 4L5FE 3IFPB 4PYGA 1KJ3H 1CWVA 2HT3D 3S37H 2B5IB 4AQZA 5CJXA 4JJ5A 3UZQB 2CR3A 4N5EC 4NPJA 4KTYA 3QAZC 5CJOH 2IQ9L 3LZOA 3NIFE 4YDZA 1KG0A 1QTYT 5L9DH 1ZANH 4U1KA 4PRIB 1TQCB 2CR6A 2I24N 3U36A 1ZE3H 2VUKA 4JY5L 2XTJB 3TZVD 5K9QI 4XXCC 4LLUA 1IKOP 4HUVB 2V9RA 4ZD3L 3TA3B 3KVQA 2YC1B 3K5RA 3TZVA 5L2KA 3VXMD 5TH2A 2W65B 2OL3H 3H3PL 1ORQA 1FZKB 4OFQA 4AQEA 2L04A 3C6EA 3MNVB 3UJIL 1I1YB 1U8IB 3Q3GB 4MA1B 3M8OH 4PJ9B 4QRRE 4EI5C 2GG1A 4GG6F 4QTHA 1TQTA 3OKDB 3QORD 4ABWA 1IC0A 1OCCB 5CU9A 1WDAA 5ISZB 1DVZA 2H26A 3U7YH 2X4OB 1NFKA 1JPGB 4MMYA 2OW7A 1KZQA 3WY1A 1UD5A 1SN0A 4W9KC 1HSBB 4KVNL 3SKMA 3LKOB 4U4IA 3BQUA 2NCEA 1C5DA 1V5JA 3L5XL 3ZE2B 2BFVL 3V7AG 5A6IA 2ZT9C 2NZIA 5IQ7H 4GRLC 1Y6NR 5EHFA 2WIMA 5G5DA 2PUQT 3O4LE 4CVUA 4HCRL 4CSTA 2ATAA 2R0KH 4GRLA 4DUWA 5IMLA 2DRUA 2HJFB 4PREA 3UYPA 4PJ5E 2ZP0T 1Z9OA 3HLAA 2EUWA 1GGBL 3LOWA 4GUPA 1RVFH 4Z7WA 3RG1C 2H3XC 3L2MA 1I3GL 2ZUUA 4N2MA 3SDCB 5HHXH 1VJSA 4KQ4L 5GRUH 4Z7WF 3GSVA 4E9QA 1HCZA 3GSQB 2R7EB 4ELMA 4JFDA 2CR0A 2Q20A 4RGNB 4M8RA 3V6ZB 3VQMA 1CCZA 1NLDL 4OD1H 1KCRL 5I0VA 2F19H 2X4RA 3TWYA 1IT9H 1KTDA 2HXAA 2R2CA 4UUJA 4X50A 4EN2A 1SXZA 1H8LA 3NQIA 4Y88A 1A7QL 1XDTT 5C0BB 4MS8C 5DHYB 4EOWL 4N86A 1MDTA 3U6RA 5DD3L 5TE6H 3IF1B 1BP3B 2BSSA 3MRHB 1X5ZA 1B0RA 1JP5A 3MRBB 2J21A 3TYFB 4P5KA 1IFHL 1QFOA 3PP3H 4DWHA 1K5WA 4OGQC 1GKOA 2HWZL 4JO2H 2BNRA 4AGQA 5GRXG 4M4RA 2ZJSL 1IO4C 5IR1A 1A8ZA 2Y2WA 4NLHA 5I6XB 4IRJD 3V9FA 1E9PA 1R3IH 3IS0X 4A2HA 4R7VA 2VITA 3MLSH 4FMKA 5D7JD 4ACTA 4TKWA 1M1XB 2F54A 5GHWL 4NQDA 3UH8A 4JMNA 1W6WA 3ZPDA 4BQ8A 4DW2H 3DTXA 5CSZB 4EI6A 3RP1A 4IKIA 1WBXB 2O5XH 1ZIBA 1S7RA 3OAZH 2DQIL 1YNKH 4I0PB 3PGDB 4WWOA 2F53A 1PL3A 3X3FL 3KWTA 1IC5H 5GZND 3T1FB 2A6DB 2QV4A 4LQFH 3CH1A 1INDL 2LAGB 1PY4A 4H0GA 4I9XA 4IMKA 4JZOB 4WZ9A 4AXWA 5AW2B 2AXGB 4IOFD 4GAGL 1DANT 2FBJH 4DP9X 1JN6B 1VFAA 4MJIB 2E6QA 3BLBA 5D7LE 4JFFE 2FQGA 3ISWA 4JFEB 2WB7A 4PJXF 3V4PL 2OSWA 5IIEA 4KZDH 5TD4A 4GXUM 1CB4A 1YYML 3MLXL 5D7EA 3BE1H 5E8PA 1JMZA 2VQUA 4NN5C 5CJQL 1JGIA 3ESMA 1BFVL 1B9ZA 3FU7B 2X2UA 3S3SA 3GMRA 1XFPA 1DQQA 1T1YB 3RFZB 1G7IB 1ZEAL 2HJKA 1VZGA 3BMVA 3EO0A 3OQRA 4N2BA 4X5XA 1A6ZA 3IGKA 1JD7A 3DGCR 2ADGB 4B9CA 4CA4A 1IILE 2XTSA 2VR6A 1T22B 1FPTL 3GGWA 4D0DB 1PCSA 2E6PA 3BPCA 4UTCA 3CPLB 3DGGA 1ZLSL 5IESH 3FYEB 5CINL 1UADC 4YXKH 1IT9L 4ZW3A 2OL3L 3H3PH 2VLKB 4X4KA 3LD8B 1TVHA 2QZ5A 3BJ91 1S9YB 2BC4B 5A2LH 3ILEA 1GGUA 2D3JA 3SOBH 3WG7B 5C0IA 3CXFA 3ETSA 3CN0A 3BZFA 1KIQA 4KK9D 4HLZH 4TS6A 2FYVA 3UZVB 4BV1A 3T0EB 2E7DA 2FR4A 2J72A 1CXLA 1IBYA 2GHZA 2WVSA 3VG0L 1NDMA 2D03L 5CD5C 2XT1B 1IGTB 3AQYA 2MCG1 3M1BB 4WO4A 3T3ME 2LFGA 2VB5A 3QSKB 1KEGL 2P24B 4D9LH 4IHOB 4NAJA 4BQ9A 1Q9KA 1YPZB 5HDQH 3KYNB 1I1AC 4JRXE 4JFQB 4PRHD 5E1GA 2X1XR 3FU7A 4FQ1L 4IBWA 5C07E 4ZFQA 3BH9B 3QWQB 4C8XA 2GVYA 5ANMB 4KKAC 4HWUA 3QZNA 4JO4H 4IU2B 4PJ5D 5T1KA 1BXVA 2KZBA 2EC9U 3F85A 5C9JA 3JWNE 4PVBA 1T1WB 1OGAB 3I6GA 3ZZSA 5HY9A 1VGEL 2EQDA 4JZOA 4PCSA 1XTMA 4WU7B 4PLKD 3ZIYA 3VA6A 1JTTA 5DJ0A 3WU1A 3T1FA 2IH1A 1A6PA 1AS8A 2GAZB 3TA4D 3Q48A 1VHPA 4MAZA 2ADFL 5CZKA 2NSQA 5GIRB 3L3DA 3V6FB 1NAMH 2XZCL 1Z3GL 1G7JA 5DZAA 1E6OL 1ZT1B 3L3KA 1KPVB 1O6TA 5J12C 1P5VA 1KYDA 2AITA 2IIJA 3DTXB 3POCA 4ODVH 4RMWA 4JDTH 1P4LB 4EN3D 1NCCL 5SX5H 3VB9A 2ZX8A 1AACA 3Q43A 4P2RB 3GHBL 2IQ9H 4HV8B 3SDXE 3TM6A 3MNZA 2VXSL 1QRND 2WQSA 4GSXA 1AZZC 5CBAA 3H9SB 4F37F 3ZKQD 1MRDH 1OCOB 1NC2D 2ZX7A 1BBDH 2HRPL 3A0OA 1RJYB 4OLXL 2JCWA 3RPKA 4L5FL 4UIKL 1R3IL 3T09A 2YFNA 3JWOH 4J3OH 2X4NA 5I1KL 4W9JC 3BGFC 1P4IH 2B39A 2IQAB 3U4BL 3QXDA 1YPZE 4WHYH 1ZHKA 4M1DL 4XVJL 4J4PC 4QHUB 1HE7A 3AB0C 1F11A 5DQ9A 4XODA 1X9QA 1XB6A 3F7VA 3HC0B 1DUZB 5J1SC 2KPNA 2WLIB 1BJ1H 1I1RA 3O0RH 3OKOB 1VF5C 4W9LC 3K3QA 2VZ1A 3H85A 3GI8H 2R1XB 2O6PA 4AMKH 4AX3A 4LSQL 4R84A 3QJTB 4F93B 3WV0A 4PGCB 3TOPA 3OLEA 2IDTA 2ED7A 4YHLL 4XP4H 4OGYL 5LGHL 3IDYB 4GUPB 2CHNA 2WLLA 3L1FA 2PYEE 3VDAA 2QTEA 1CGWA 2BDNL 5JOPE 2OSLB 3BAEL 5DEFB 1PFCA 2DL9A 2JCCA 4XP9H 1MREH 1QQDA 3B6SA 4P23C 2CLRB 2FK9A 1IGIL 5EZLA 3BZEA 4FJZA 3W9DA 2EXYC 1K8DB 4HWBA 3WLWD 2VE6A 1MCJA 3BP4A 2KDYA 1N10A 4G7SB 1T2JA 4OIBA 5I15H 3MXVL 2XXGA 3BQUB 4N2OA 2XLLA 4HD5A 5D55A 3UBFA 2XFGB 4HX1A 3VFNB 2YKKA 2R0WL 3KPRA 4UILH 5EU6E 4ODTH 3WEXB 5EUKB 3RIAK 3W5MA 3I3EA 3BH4A 4NRYB 2MQGA 4MJ4A 4ZYKA 4FLRA 5D1ZC 1TVHB 3ZTNL 5EG6C 2OMTB 3VXUA 2KERA 1MUJB 3NJNA 3CN1A 3OF6A 4XXWC 4DJMA 2B1AL 3KYAA 3RGBA 4P23D 2VZOA 1XTLA 2XG4B 4WHDA 4RZCA 5IWLC 3MROA 4NO0B 3S7GA 1DHKA 5IHWA 3D3VE 4TLTA 1TETH 3NIGE 5L2KB 3QCVH 3UMTA 4MD0B 1UWGL 1YNTA 2Z7ZA 5C0AE 1DQQB 1U3NA 4J1UA 3NK4A 3KVPA 3P0VH 3U36B 1ZGLM 2HTLD 3HI5L 2AQ3A 2BMKA 3CBKB 2HVKB 4MMZC 1OGTA 5MHSD 3FQWB 3QS3A 3W2DH 2D31B 1UOWA 3GMPB 3PPEA 2JF1A 2WD0A 2PMZA 1RURL 5KWYC 3B2XA 3CC5A 5K9KB 3BSZH 2AJSL 1I7UA 5FM4A 3LIZH 4GG6B 5DFWH 4KKCD 3MBWA 5TQ0L 4KKBC 3PHOB 1V8HA 4PRBA 4BWUA 2WZ5A 2PCYA 1WD8A 3OAUL 4KMLB 5AAPA 3KEDA 1KOAA 4R96A 4LT7A 1CD0A 4LHUG 1USQA 3APFA 4F8NA 2EZ0D 2Y7MA 5L0QC 4YFLF 2F54B 4AWJC 4F2MB 3MO1A 4M29A 4DGIL 8PAZA 4Y2LA 2B15A 2RCSL 3GSOB 1T04A 3D0AA 3LIZL 4DP0X 3BSHA 5KYWA 3P02A 1AQMA 4ZI8A 4ZUSA 3I9AA 3F7KA 1RURH 5AOLA 3RBSA 1MJ7H 1NCDH 1XSKA 2CZNA 1QOKA 1U8PB 3FB8B 4PD4J 4PY8I 4Y8DC 3TASA 1GY1A 1P0SE 5ELIA 1QBML 1OTTC 4RRPG 5I1AA 4YSSA 3QIUD 4AQ1C 2A77H 4ETQA 1ASPA 2X4TA 1NSNH 1KLGB 4X8CA 6FABL 4ZXBC 4DIXA 3C2AL 3O4OC 4G7VH 4B50A 5L6YH 4M93C 1WZMA 3QDME 5CD3A 1AGBB 3FTWA 4UDUB 5MERB 2XRAH 4PD4K 3N40P 3MCLH 3EFDL 2EIDA 2IXQB 2NY6D 3QJHB 4JM0A 2F1EA 3U9UA 2IWKA 4PQXA 2WQVA 3QUML 4N8CH 4KGJA 1J5HA 3MFFB 1FNGB 4ZK8A 4ONFH 4PS3A 4WUUE 5I6KA 5HHPA 1SJHA 2XCMC 4Z7OF 4KRPC 3U4AA 5JORA 4M48L 2OYKA 5I0ZA 1S78D 3L5IA 5HHVL 1ERNA 4IOFC 4NQVA 3VI4F 4G8FB 4QMEA 3TFBA 1YQVH 3I84A 4JFYA 3WHE0 3UO8B 3IPBA 2NQDA 3KYNA 3NJFA 4ODUB 4BFFA 1UA7A 1JNHB 3NCYP 2OS7A 5I2IB 2F61A 3HHSA 5L7XL 4ZPVB 3U82B 4YOKA 3KYKL 3LN5B 1VFOA 3Q6GH 2OI9B 3PFUA 4GAFB 3GUTA 4IBSA 4P9HC 5GGSA 5EU7E 1TJHL 3PWVB 3ROOA 1OCWL 1ZTMA 3SBRA 4DO6A 4CU8A 1C08B 1I1YA 4PJ9A 1FYHB 3CFDB 1N0XL 1NC4B 5JNYB 3KDPB 2LU3A 2XFXA 3ULUE 2WYHA 2ZAHA 5GS2H 2XNAA 2GTZA 1BQ5A 1CE1H 4FZEH 5DJ2A 3S98A 3WIHH 2JJSA 4YJZL 4LLUB 3TH2T 4QXGL 1OZUA 3E38A 4PJEA 4ZQTA 4TUKL 4PYHA 3FONA 4Y4HA 4XX5A 3RKDC 2ISDA 1CDYA 3GO1H 3AG2B 3U0PB 3V8CA 2R0LL 2ADGA 4LEEA 1CTNA 1PSKH 2FEJA 3RWGB 3KLAA 1U2YA 1A1OA 3MRGB 4RBPH 5ESAA 5BZZA 1GXEA 2Q8BL 5AB2A 4UB0H 2ZSVB 4H8WH 5CMAB 4EOWH 4HQQL 2WNKA 4JAMA 1S7SA 4MJ6B 5ALCH 4NHCH 4YSCA 3VD4A 2I07A 5E6ID 3ARSA 2H6PB 3WFEH 5DQJA 1QLRA 4DEPB 4P4RB 4BH7B 1JRHL 2ZKXA 4PRHB 3D2UD 4LAQL 1IAIM 2ZUSA 3WHXB 1U3YA 3IN2A 4MB1A 3FCGA 4YR6A 4OZHE 3UZEC 2JE8A 4NB7A 2OZNA 1LEGA 3KPMA 1CK0L 4Y19E 3T08A 2HFFB 5FOBA 3EGDB 4HSQA 3SO5A 3SE9H 3BKML 3ATAA 3DUSA 3VMPA 3MFGB 3ZR6A 3RNQA 4GI6A 1PX4A 2VMJA 1WUNT 4B9KC 2Z91B 2OYMA 4GKLA 2VC2L 3B34A 3JXAA 1SHMA 2EEBA 4JCLA 1OP5H 4DKAA 5CGMA 4XP5L 1HOCA 3HI1B 2OSYA 3A24A 2YA0A 5KSVB 4L4TA 4C47A 4F7EB 4HUWA 4HUXA 2X7LA 4UV7L 3KLQA 2V3FA 3TYFA 4MDIB 5HI4D 1D3CA 5I1HH 2HT4D 2AVGA 3BT2L 4H0LC 3SE4C 2PXYA 1PLGL 3ZDYE 5C6TL 4JR9H 1AC0A 1YUKB 2CDGA 1TCRA 2CMRL 1TO5A 2XN9E 3APDA 1LM8V 5F70A 5FB8A 4WI7A 3W56A 2NQ3A 3MRDB 4ZUTB 3UTSD 5C0JA 3DMMD 4ZUUB 3MI6A 5EU6A 3IDGA 1KLUB 1X9UA 3ABMB 3C8KB 2FLMA 4Y4KA 2R7EA 1H3VA 3VFMA 4KY1L 3NABL 1R5WA 1S7WB 3T6ZA 4PY7B 4XB7A 1GC1H 3KYMB 3BISA 2OCFD 4LSRL 5G2NA 1FQ9C 2XVBA 4XCYA 3TX4A 4JRYA 4HUCA 3MJ6A 2J73A 4U7KA 4LSSL 1B0GB 4MSWA 2YEZB 4PJDE 1L5GB 4RGNC 4OW6A 3GEWB 4X7TA 5EOCH 1FYTD 3H0TB 1NINA 4Z1PA 1LEKA 2BVPB 4KI1A 3ZDZE 1HJBC 4PS4L 1HQRB 2WZAA 3NCYS 3TT1L 1ADQH 1TQVA 4MDIA 3GJEB 4I1PA 5F7EL 2X4SB 4JG0L 4POUB 1FF5A 3LH8A 1G4RA 1E27B 4GP5B 4ODHL 1H9DA 1R17A 3AROA 1OAKL 2X3BA 1KJVA 1X6LA 4FA7B 1GSKA 1U8MB 1XIWB 1E7UA 3P4LA 1U91B 1TYEB 5EC2A 5BZXA 4LLVA 3OKDA 2B20A 5FO7A 1Q72H 3VW3H 1RU9L 4MYPA 3MGOB 1Q0YH 1CK0H 1OCWH 3C6LD 3H56A 3ILQC 4BSVB 4HPHA 1CGVA 3QYCA 3VI4B 1ORQB 5ICUA 5HPMA 2YSSB 3VWKC 1CQKA 4DTGH 3MREA 4WUKH 4HP5A 2H2SC 3AXHA 4M61B 4L1HA 1YNLH 3VFWB 1MHPL 2JLLA 1J9TA 4XO8A 3BD4A 5KYXA 4K7PL 5AW1B 4JM4H 3V5HA 1D2OA 3UC0L 1Q0EA 3H6JA 1JI2A 4G3YL 4UB0L 1D6VH 5IVXB 3KPLA 2H2PC 3AMKA 3QUZA 1KJ2H 4QRRD 2W9EL 3MLRL 1AG6A 1KPUA 2WHVA 2GEEA 3PS6A 1YMMA 3GXUB 5AAMA 1M7DA 4Q2ZA 2Z31B 4S0SD 3EYSH 4MYWB 4KX9A 5JHDE 1M4KA 4WJKB 1S3KH 1U33A 2WUBL 3MRPB 2AQSA 2HRPH 4OLXH 4JM2F 2DWSA 1MCSA 1SDDB 2OR9L 4N0UB 1YYLL 4BM7A 4J3WA 3SE8L 1B6DA 3OG4B 1CTOA 3VFVB 1GVIA 3WY4A 1Q94A 2YQBA 5CCKH 1UD8A 4S1QL 1CMOA 2HUHA 4W6YB 5LXGL 3C5ZD 4HIEB 5FS5A 2ZAIA 5J5EA 5E6IB 3B5HA 4ODWB 3E3QC 4ZMXA 1LWHA 4U6YB 3D69B 4PJAF 3CFJB 2WXOA 3H6AA 4PBVC 2F8VA 5BVPL 1KT2A 4N0CD 4P9MH 3O8XB 3VXOB 4PUBH 4OSUL 2DQUL 2G75A 3Q5OA 2CG9X 2X6CA 4KGLA 4NKDB 4A66A 2ODIA 1T21A 5AL0A 1WFIA 5FOJA 3UAAA 3DXAA 3REVB 4YFEA 3T6QC 1RIVH 1PZCA 2WGNB 3G5VA 4IEFA 2Q2LA 3AWGA 5K59F 4KY2A 1Q9WA 5BPPA 4QY8A 4YS4A 2VDQH 4L9DA 1ID5I 2LLGA 1FP5A 3OAUH 3OWRA 4TNWK 4Z3EA 2Y7QB 4UBDD 4C58B 4OQTA 1FNAA 3CVHL 1TZAA 2F53D 3AG1B 4U3XA 4Q9CA 4NSKB 3LKQA 1VIWA 5JIQA 2A4EA 3MACL 1ODUA 4TRPH 5HHQB 2DLEA 3EJQA 2GTWA 5MEOA 4KY1H 4QEGA 3KBFA 3ZE1F 5EU4B 2A74C 3B2UC 3M88A 3BVDB 5CN1A 5ES4B 3HB3D 1DJSA 2WNXA 2X6AA 4G5AA 4K3EH 4NJ9H 3NCJL 4NXSA 2VUYA 4X6DE 2MHAA 3CFNA 2H0PA 2H1XA 2O5ZH 4LAQH 3FS9A 4U33A 5F3HA 1OGAD 3MLTB 3ARYA 3ABGA 4OUUA 3MOAL 3O6KH 2P46B 1RPUA 1JDDA 3KL3A 3L3HA 2VLMD 1QRNA 1MFCL 3TVMC 1D5ZB 2F1BA 1KJ2B 2CIIB 3CUPA 3QXTA 1CLZL 4X99B 3VD5A 4BZ1H 1SMOA 3DGDA 3ILDA 4TL5A 3MRLA 1A6VL 4WW2A 5DR5L 1JVKA 5FGRA 5I1AB 4M7LH 4WQOA 2IV9A 3EH1A 3OL2A 5EN3A 2XZQH 2VSDA 2WINB 2YZ8A 2FJHB 2R0LH 4F8PA 4OV5B 1BFVH 5E9DD 1R5VA 1YUHA 4ZO9A 5EF0A 4Z18A 1AP2B 5JLZA 4U6HB 4YNYA 4XZUB 2HH0H 5LJYH 3LZLA 2C9UA 4QXGH 3OAYK 4WK4B 1R33A 4HMDA 3EZ8A 2BFGA 2ZF9A 4EMZA 2Y2TA 2OXGA 1QHPA 4WW1B 3L9YA 4YHYB 1RIUL 3VTMA 3QI9D 3V2AR 5FF6A 1E8WA 2WKLA 4YEEA 3AVEA 3WJJA 3EYFA 1IAIH 2X4SA 5T1DH 3X3FH 1MJ8L 1LK3L 1RJZA 4HVBA 5KAQF 3FO9A 2IMNA 4Q7DA 3H42L 1J5DA 2OULB 2VJ8A 3KGUA 4YHZL 2WQWA 4HEPG 2FLRT 3M6DA 1NLBH 2F9BT 1AYOA 3HCVB 4IGBB 2W07A 5EDXA 4H0IA 1UQSA 1XF5B 2FZ3B 3QJZA 3QR1A 4F2ME 1CO1A 1HZLA 5CILH 2CXGA 4BWWA 2D31A 4FLQA 1IAKB 3K6NA 4JGMA 3PGCB 2TRYA 1JRHI 2WUBH 4XCYB 5BQ7B 2NY1C 3QEQE 2DB8A 1BBJA 3GSWB 3LD8C 1CU4L 3WFDL 2YR3A 3OV6A 2CO7A 4PGBA 4BFKA 3WLWC 1ZS2A 4HOWA 1A9EA 4OZIF 5AW8B 1ETJA 1DSFL 5IB3A 4LFHG 3STZA 4BDVB 4EN3A 3OHXA 4I2XE 1IGYB 1NKGA 3QCUH 1ETZB 2BWDA 1KYUA 1NGZA 3S35H 1CE1L 3M7OA 3O4LA 5DGQA 3KJ6L 4CSZA 5L6YL 2R8SH 4I8DA 4U1HA 2Q9OA 3UABA 2VLLA 3K80A 5SWZB 1Z9LA 5MENE 1BVKA 1MHCB 2ZXDA 3ZTCC 3OAZK 3DIVA 4HPYL 5KSUB 1KCWA 3CD4A 4LEBA 1B88A 3FTGA 1A6UL 4LLMA 2AKRA 4EAEA 1CFVL 2ZD0A 4LKCB 1FG9C 3BYYA 1HHHB 2J1XA 3BGMB 1PLGH 5BZDB 1UH3A 5I1LA 1J8RA 1BLNB 2WYIA 3MYJB 2Z91A 2RCSH 3HMWH 4XX1E 3WJMB 2PF6A 1Y6MR 1JGVH 2OSLA 3VFOA 1DQJB 1QZNA 5JO5B 3P2DA 3WY3A 3FCSA 4L29B 4MQXC 4JZJC 4GMSH 4QXTB 1NEUA 1G7PA 3SDDA 2WP3O 1WD9A 5FYJD 2H4EA 3QCTL 1MVUB 1W0VB 1P2CA 4MDRA 4NO2A 2Y23A 3L45A 1XCTB 3JT2A 3QUYA 4NQDE 4OT1L 4XPTL 2G5RA 4O2CB 3UG3A 3LPFA 1HTYA 2R4SL 2XY1A 3OXSA 3VRJA 2JK5B 3I9IA 2JQZA 1L9MA 2EDNA 4YBQD 3SB3A 4QT5B 4MMXB 5JXAH 1KBGH 5HJGA 4A39A 4LPXA 3IB4A 2K4WA 1N9PA 3QZWB 2GITA 3QXWA 3DRTB 2CQVA 4GAJL 5H35A 3ULAB 4HWZB 2DJMA 2YAEA 3KCPA 4S2SB 3BZ4B 4CJ1A 5ID1A 3V5KA 4JDZA 3NGBB 1G4MA 1WBYA 3DSNA 1JF1B 5GGRY 4OLZH 1B4TA 4WEBL 2CJUL 3RY6A 2KBGA 5D7KD 3S34H 4F2EA 1RCYA 2ENJA 3CX5J 4POZC 4JDEA 4OIIL 2V8LA 4NJAH 4JHUA 1F42A 1TJMA 1WLHA 3IGFA 4G8EB 4ZO7A 5TK4A 3RAJH 1TNNA 1GCYA 2HKFL 1TXKA 3OKNB 3NCXA 3N91A 1F58H 4U0RC 2XFXB 5EOTA 4KI5C 3BRFA 2Y5TB 1DDHB 3JUYA 3S0PA 4FQLL 5ADPL 4KBPA 2J5LC 4MWFA 3CX5K 3MV9D 2QDVA 4FFWD 3V4PA 5HYIA 4B95C 4M5TA 2W0FA 2Z92B 2WK2A 3F01A 3V4UH 1MCPL 1PLAA 4YHPA 2XXFA 2WQRA 5KVEE 1NBVL 4Z7QF 3E2HC 3GBDA 1EJ6A 5DMIH 1SXBA 5HHOE 5EUOE 5C6PB 3FOMB 4M03A 3DPBA 3RTLA 4JFYB 4OGXH 3TEYA 2X42A 1RUAH 3L3GA 4QAWA 1RZFL 5C0AA 4XN8A 4H2CA 4ELKB 1QZ1A 4KZCA 1P84J 4UNUA 5IF0B 5KG9B 3BPNB 3EYQD 4A55A 1SDYA 3FW6A 3TIEA 5J4MA 2AQTA 4IM8A 3MLYH 5FHBH 5HGDA 4NX0A 4HC1L 2X70B 2P24A 1E4WH 3OKEB 1F1AA 4Z7UE 4HS3A 4FL4C 2NTFB 1W9XA 1A7RH 1N67A 2WBJB 3PGFH 3WXVL 4NQCB 4NZJA 3SYCA 3VI3F 2Z31D 4U0QB 1FO0B 1S7UB 1T1ZB 4PJFA 4BHUA 2WBKA 4MWFB 4PJFF 2Q8BH 5I75B 2Y5TA 4GSRA 1AHMA 3MRFA 5C3TA 5HDLA 3DX2A 3SYQA 2P5EA 3TN0B 1T0OA 2A4CA 2V37A 3LXUX 3B3IA 3EH4B 4CVZB 2L8AA 4M3KB 4YC2C 4RMVA 4CBZA 5A1AA 4M7JL 4J8QA 1IM9B 2Z34A 3HS0A 1I4FA 2CGYA 5SX4H 5I8CB 3BKCH 1U8OB 4OKVA 3NFSL 3WS3B 2CHZA 4N2GA 3T0ED 2NSMA 2HJKB 1R3KB 1C5CH 1WBYB 1NGWB 1DO5A 5C0FA 1YC7A 3GBML 3KPSA 5E94B 3C5JA 4EEEA 4XCFH 1KCSL 3QA3B 4AIOA 4FABL 3KCPB 2Z35B 4HK0B 2ROYA 3MV9A 2YEQA 3N41F 1XB3A 5HYQB 2X87A 2HFEA 5H35B 1XIWD 3SJVB 5LGHH 4NBYB 4MMXA 5E70A 2FX7L 2GTQA 3GLEA 1FBIH 3BN3B 4BRVA 3TYGH 1A9BA 4IRZA 3KBHE 4W9DC 4M8UA 1BMWA 1XZ0B 4DFIA 2CLZB 3LZQA 3CH1B 4OJCA 4W9HC 4ODHH 3B9KA 4G71B 5BNXD 3PGDA 4KX7A 5JPNC 3BRDA 3HRZC 5F1SA 4B9FA 3D87B 4LCWD 2HG5A 2NLJA 3BFQG 1IKFH 2JJTA 4MAUH 4YSPA 3ZKMC 4L29A 2BVOB 1SOKA 1VADB 1NQBA 3WJMA 1HSAA 3ESOA 5DYOA 1PZAA 4HEMA 4PJIB 5D2LB 2X1PA 4E41A 1VKXA 1REIA 4NRZA 2VITB 3DA0A 5SWQA 3OB0H 1HHKB 1QBLL 4JG9A 1BVLA 3HZVA 4ZO6A 5FYKE 1GC1L 4LAJH 3G04B 1TTRA 1G7QB 4PJEF 5F21B 3UOAB 2ADIB 3CVIL 2AMUA 4HHWA 3OPZH 3ZE1B 4R0LB 2D03H 2G0LA 3BAWA 5AAWC 4Z7VE 3KG5A 4L8CA 2EDDA 3WO4B 3E6HB 1B0RB 3MSPA 2ZXAA 4G8AC 4RAHA 3IF1A 3TVMB 3ULVH 1UWYA 3B9VA 5BOJA 3T4AC 3NZ8A 2HKAA 5AG9A 2ZYHA 4BSWA 3I9GH 1QABA 3WN5A 3V7AE 1BJMA 3SJVE 3PHQB 1UWGH 3HVDA 1CFQB 4WNQB 2CK0H 2J8UF 1ZTXE 3D2UB 3J07A 2PPAA 2J8UA 1C8PA 3UTTB 1Z3RA 1F97A 3JT0A 3SKOA 5IM7A 4HFUL 3ZMRA 2AK4A 3QCTH 5EC1A 5JXEC 4KJWC 1V3KA 3HE7C 1IEAA 3UX9B 2EKSB 2FWOB 3IBOA 3QQDB 1XF2B 3VFGL 4AKPA 2WO4A 3A6OA 4DCQB 2L0DA 2R69L 5GS1C 3T3PB 3HUJF 5D1QB 3EO1A 3MRQB 4PJ8C 3ULUC 4BKTC 2WKOF 5TQ0H 1KLFB 4AQ1B 2JB6B 2G60L 2P44B 4TV3A 2PWEA 3QFJE 2A6IB 1L0PA 2PETA 1X7QA 1JERA 3LKOA 4PWEA 4LCWA 4HZAA 1F13A 1WA0X 4TNEA 1A8JH 2X5PA 5FLVA 1JZEA 5K9JH 2G2RB 5L4IA 2J7LA 4BSWB 3G5XB 2OMXB 5FK9B 3MJWA 2X4UA 2YD4A 3OVUB 5FW8A 3SHSA 4HOMA 3DX6A 5F9AC 3BDXA 3T2QA 3CHXA 3CLEL 1T5KA 1DYZA 2O5YL 3QORA 3LQZA 4N2KA 3DX8B 2YUZA 1JFHA 1KC5H 2X4NB 2OR9H 3TA3A 3L4TA 2MTAA 3JWDL 2WBXA 4JQXC 1J18A 5SWZD 4Z77B 5I6MA 1PLCA 4N6QA 5D70H 3KH4A 4N87A 2E74C 1PSKL 1JGDB 2YPLE 3MRLB 4QPEA 2GK2A 1DEEA 1QWUA 3U83A 1GRWA 3VSVA 3MNZB 4PJFE 2HMID 2XWTA 4H26A 5GGVL 4U1LB 4NZUL 2A83A 1RZQA 5B1CA 5GZOD 1A4JA 2BVOA 2FX8H 2H2PD 3A47A 2RMNA 4YLCA 3ARZA 1DUYB 4XCEA 4XNXH 3BZ4A 4HPOL 4WAFA 4RGND 1HJCA 2E76C 4GQZA 3EIFA 5E8EA 2IGFL 4JKMA 3IEAA 3TU6A 2UUDH 1TLMA 2YGPA 3TBBA 1MREL 3UTTD 4APQB 3NQKA 1MCWW 3TURA 3F7QA 3UJJL 2JELH 2AXWA 2VQ1A 2VQTA 4O5LH 2BS8A 3V0VB 1NCAL 2QHRH 1A65A 2UVFA 5AUMA 5MEOB 4U2YA 3ZYJA 2YAFA 2CBMA 2XN9A 1NMAH 3TO4D 3P9MA 2CRYA 3LZFH 1WS7A 3P54A 2P8LB 4GQ9L 5I1DB 4RMUA 1MPAL 3FUNA 2Z35A 4HK0A 1EO8H 3O11A 3P73A 1TZIB 5I16B 4I88A 5C0FB 1X5IA 3MGTB 2QKIC 1SEQL 4JB9L 1N7ML 4TF4A 1ASOA 1J9SA 2ZWLT 3ARBA 3DPDA 4OU3A 2APFA 5IEHB 2E9IA 1WAPA 4I89A 5K39A 5A6MA 4CN4A 2BY1A 4HUKB 5DK3A 4CKQA 5MEND 1N5YL 4OF7A 3K0YA 2D3LA 2LFEA 3LNDA 2G75B 4I7ZC 3GXNA 5AAMC 1U2CA 3IMUA 2NY2C 4W4NA 3FQ1A 4K3GA 5DD3H 4ANUA 1Q0XL 2J3SA 3OZKA 5C0IB 3IJHB 1FNEA 1I8LA 1UM6H 3IU3B 3BKYH 3VJ6A 6PCYA 3O6KL 5FYLL 5H37A 2O93L 4CL7A 3G5ZA 4J4PA 1A5FL 3H53A 3WTUA 1W8OA 3VU2A 1EAQA 1O0VA 3I2CL 4LF3A 4PWHA 5HHMB 2BERA 3NJHA 3S36X 3EXJA 4Q9QH 4QHKI 5EZPA 4YHNB 1NGQH 4KK5D 1AI1H 4F9LC 5KSBA 1GTFA 3MRKB 3RZCC 4ENEC 1S5IH 3GSNL 2IBBA 3RTQA 3O3BA 3P3SA 1OV8A 4JM2A 3V6OE 1RFDH 2J6EA 4E9SA 5C0AB 5FR3A 4CVXA 2J6WA 4HOXA 3OLIA 1WIOA 3NZHL 4NO3A 1OP3K 3DNKA 2C9XA 2H3NB 5DEZA 2OZ4A 3WE1A 4JN1H 4U1JA 1L4IA 4I87A 3VYOA 2DLGA 3PUCA 3VXSE 4QF1A 1OAXH 2EYTA 3CSTA 4WRLA 1XF5A 3X3GL 1JPSL 1T66D 2F15A 2EYRA 3TNMB 4FNLL 2PWDA 2R2EA 3D0VA 1H3GA 2IO5A 3ME0A 5E23A 1BVZA 1UD3A 4Q9BA 4KUZL 3D50A 4M61A 3VFWA 1NKOA 1XSJA 3T65A 5EU3B 1FO0H 4RFEA 1AKJA 4A7TA 5I19L 4PJ8D 1MJUH 1JFQL 4KZEL 2HLAA 2J5WA 4EDWH 5GGTL 4GP4B 1RZ7L 1F6FB 1T20B 3T3MB 5FFLA 3UBHA 2H32A 2WLNA 4MHHG 5GS3A 1NWPA 2P42B 4OIAA 4ABUA 3VXQB 2IDQA 3QUXB 2K3TA 4HJEA 4Y4KC 4FQ2L 5LAXB 4GQRA 2B2XL 4PTUA 4RETB 3DSNB 3ZYZA 5JIDA 5JA8B 1EAPA 1JRHH 2YPLD 5D7IB 4GKNB 3KEHA 1KBGL 3ZW3A 1OGAE 3CN4A 1JNJA 2VO8A 4Y16A 1KJ3L 1Z2KA 4H25A 1OGPA 4X6DA 4XPHH 1WV7T 2FNWA 2W8CA 4PS8A 3BPOC 4MD5A 3P11H 5F6HJ 1GYUA 3H0TA 5ICXA 2EYRB 3NACH 4HBCL 5CM1A 3BMWA 3DBSA 1D9KB 3SDXA 1MIEL 2JJVA 2NY3D 3HE6D 4H8WC 4U4BA 1BWMA 4ABVA 1QEXA 3HJ0A 1RL1A 5HXMA 2ZCZA 4XOAA 5FA3B 1KXTA 2JKIS 2VZUA 4U1NA 5DS1A 4DEWA 1W0WA 3GJFB 2R0ZH 4N0FA 4H8UA 3IETB 3VTAA 1G7PB 1PAZA 3LRMA 4OCSH 2JWYA 5J6HB 4JGJA 4FC3E 5AWNH 4IDJL 2A6JB 1IGJB 2YAPA 4LBEB 2ITDB 4RFNC 4Y9FA 5F9JA 4AK2A 3GNML 4J3XA 4MAYC 5HYJB 5DZPA 2OMZA 4MXQC 5JO5A 4JM2C 3HFMH 4HOZA 1HEJC 1SEBA 5DC2A 5CN3A 2PW2B 2FATH 5F72S 4MJ5A 4NNPL 4D0CB 3EJYD 3S3BB 3UTQA 1HHHA 3CE1A 1MQKL 3WTTA 1GTNA 3J7HA 2AHIA 2O4EA 3NFNA 4PJGB 2I7SA 4OGYH 1HCVA 4HIIB 3TJHC 3VFRA 4WENB 1KCSH 1JV5A 1YN6A 2PPCA 1D5XB 3O41B 5CCKL 5DWPA 4FLSA 3ARRA 4Z7IA 5BW7C 4DQOL 4FTVB 3PJLA 3L4CA 4F8QA 1KTLB 4FLOA 1F3JB 1H3WM 2XIBA 2ZUWA 1MHCA 1XEUA 1VAHA 4JPSA 5T33L 4U05A 4RIRA 5HJ3B 4P2YA 5HHVH 2A9MH 4WFED 3MLSL 3AQDA 1PPIA 2G5BA 3F00A 2NY0B 3MV8B 4LSVH 4PJGA 2WNWA 4F7TB 3CXHK 3D5OF 1N6UA 1WT5A 5LQBH 1MWAB 4NZUH 4W9FC 5ERWA 2XIDA 4WWID 4AQEB 3B2VL 2J1ZA 4MZ3A 3WNOA 1W2KT 4IDLA 5D7KE 2XQBH 1AZRA 1JGUH 3GKZA 3SE3A 5JDJA 3OQ3B 2XOTA 1OAQL 3H3KA 4GUCA 5HYJA 1NC4D 5CEZH 4ODWA 2A6JA 1AQDA 2MQ0A 1SLWA 1PJ9A 4KK9C 3ZT6A 1QNZH 4YDJB 3KL5A 1A7QH 1XH3A 2BH0A 4HS8L 5ITFB 1OK8A 1M53A 1IAKA 1L9RA 1MIMH 2HTKC 3KPTA 1LEGB 2HFTA 1Y0LA 5ERWB 2K9FB 3LNEA 4ETYA 1F4YL 4N0UA 4KUCF 5JOEA 2GUYA 1XT5A 1QEWB 1N68A 2Q86A 1HQ4B 2R15A 3FQXA 3QUMB 1W0WB 3GJFA 4KPHH 3B9AA 4MD5B 4TUJA 5ETUB 7PCYA 3Q01A 4U1NB 4XO5A 1P6WA 4LCUA 4R2GB 1OY3B 1H3XA 3FQ4A 2Q8AH 4ZXBB 5FGBC 3WNJA 4IBYA 3Q9PA 3ZHNA 1KULA 4HEPA 4G9DB 2FIKA 4ERSH 2MPAL 1J5OH 1I85A 1VESA 5EBWB 4PRPE 4XP6L 2VABA 4ZQKA 2UXVA 1A6TB 4CRPA 3TBYA 5IQ7L 1D5BB 1QFWI 2ORBL 4KUZH 4CU6A 5BS0B 4XPAL 5A2KH 1FLRL 1CLCA 1SHWA 1H6TA 5DEJA 3FFOA 1ILSA 2EIZB 1MCWM 5CBEB 3PRZA 5KEZA 4YHOH 1FH5L 1HNYA 4JDVB 4YDVA 1RERA 4IJTA 3MUUA 1KB5A 1KELH 4D9RD 4QOKB 5JNYA 2C26A 1LILA 3EJTA 1WGVA 2ZCHL 4QTFA 4XP6H 2CRIA 3ZJAA 5KYUB 1UWXK 4I85A 1FAKT 1HKLL 2B0SH 2Z7WA 4M1CD 4PJHB 4BE6A 3AT9A 3T0EE 4MNQE 2CUMA 3ZL4L 4DQAA 4GBXC 4AIZA 3T65B 2CXKA 3U4EA 2A0LD 1T3FB 1DVFC 1CT8A 5A2BA 5C0CB 3I3BA 1A7NH 1IEHA 1ZS8B 1P9MA 1HCFX 2BVPA 3GKWH 1AGEB 3W37A 2PPDA 2Y1YA 3EFFB 4FXKA 3THMH 5C7XH 1CGYA 2AZAA 3QEQD 1J48A 1L5GA 1G5AA 1FHGA 5I76A 1QBLH 4GNKB 3MFFA 4A2MA 4X8XA 3FRPG 5AVYB 2PPFA 5TDNB 4XVTL 3KYMA 4BXVA 3II1A 1OAQH 5ABZA 4I48A 5FYLE 1FRGL 2XV6B 1OCRB 2O26U 3PQYE 1DVYA 2QTVA 5KJ4A 4JE4B 3WO4C 3FB6A 1KLUA 5J1AB 2AQRA 4Y5YA 2Z1PA 3U9PL 2NQCA 2FT8A 2VDRB 4LL4A 1SEQH 3D33A 4JB9H 1EWHA 1CDHA 4JS7A 4LSUL 4UT7L 1MWAA 1BOGA 2CCVA 5IQNA 3RWEA 4OCMC 3AAZB 3GZKA 3LDBB 2CKBA 3CFCH 5E5MB 1AXIB 2EUZA 4AVKA 1J1XH 4KKQA 1CDJA 1FBIL 3KHOA 1FVEA 3AY4A 4K8RC 5B1JC 2NZ1A 3K1KC 4HIJB 3REWB 2AXFB 4LMQE 1MCCA