4PIBA

Crystal structure of uncharacterized conserved protein pixa from burkholderia thailandensis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
176
structure length
174
Chain Sequence
SHITINVMTVIDVAAIIDELKAQEKKLGQTPDTATSIGHKYIYMSSDDPRGWSVDPGNITLNAHVGDTLSFFCASTSDNSEYAAFIYRLTGGDPHLDPSHVEVIKLQNAAQPTPSNGYPFTTAPVAFSSCDAKVAQQGQAKNFYVWAALFTLDDSGEKQVLAGYVKWDPTVNVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords inclusion body protein
publication title Crystal Structure of Uncharacterized Conserved Protein PixA from Burkholderia thailandensis
rcsb
source organism Burkholderia thailandensis
molecule tags Unknown function
total genus 41
structure length 174
sequence length 176
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2014-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12306 PixA Inclusion body protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pibA00
4Q52A 4LZKA 4PIBA
chains in the Genus database with same CATH superfamily
3LIUA 4UQ9A 3L3OC 1C5CH 4I18C 3S5YA 2AHIA 3PP3K 4WFEE 1C16B 2RFXB 2WOYA 4XZUA 5EN2A 1OZTG 3IU4H 5EUOB 5B1AB 2MPAH 3N44F 4AL8L 4DK5A 2QSQA 3SE4C 5AAWC 3P0YL 3EH2A 3HIZA 4GS7C 4RWYH 1UYWL 1GTNA 5IHLB 2XZAL 3BUYA 3HRZB 4UQ3A 2X2IA 4MQ7B 2AJXL 4FYTA 4LVNB 1BBDH 2SODB 5IM7A 1IE4A 3JWOH 4HC1L 1G6RL 3MC0A 1AIZA 1HSBB 2CBOA 3UMNA 5IIEA 1JFHA 2QSCH 3EDEA 5AL0A 5C6PB 1ZVHA 2GCYA 4GJTB 3I6GA 2DJSA 2BC4A 2EYSB 4NNYB 4FLSA 4MJHA 5E8PA 4FAAB 4GXUM 2JJTC 3D39B 3SKJH 4YUEH 1RUAL 2WUCL 4HJJL 4WWKC 3OKKA 2Z35B 4Y5VB 5IUSA 1JZIA 3ZKXB 4YX2H 5TFSL 4P05A 3T3PE 1MH5B 4LXFA 3VFNB 1OTSC 2IOIA 3U7YL 2X7LA 3P2TA 2R0KL 1LHZA 1BFOB 1MY5A 3TWCL 3UTTB 3UTZA 1KYOJ 3OZKA 3P30H 4M6OH 4MX7B 3FUIA 2RQEA 2WNKA 4LNVA 2WCPA 1JN6B 4JKPL 2F53D 3DHMA 3R1GL 2VMFA 4IKKA 4LLDB 4QY8A 4WJ5B 3L4CA 5HHNB 5I1IL 4ZXBB 4FXKA 5E6RB 1CFBA 1S7QA 2OTUA 4DIXA 1T22A 1HILA 4QRQB 5A2FA 3C08L 3L5JA 2HG5B 1IBZA 1E28B 2JKTM 5E1GA 2NY6C 1BZ9B 3O0LA 4LKCB 3RWHB 2ICWJ 2NR6C 5F1KC 3ZL2A 5JR1H 4V1DB 1OP9A 4NQUA 4LBEB 5BRZE 2D7TH 4PP2B 3MRKA 2GBVA 1D5BB 1DCEA 3AY4C 1N0XH 4CRPA 4BZ1A 4M43L 1A64A 2B1HH 1N0LB 3X13B 1PU0A 3WN5B 4PG2C 1YEFH 3NUKA 3UPAA 5I18L 3HZKA 1MJUH 4GAGH 1BZOA 2H2PD 3CAFA 3QJRB 1JZ6A 2VC2H 3UEQA 3HI1A 1FAKT 3ABMB 3QA3A 5EWIL 4DGIL 4JFUA 3JV5A 5A2LH 4FTVB 4GIPD 1EPFA 2GT9B 3TA3B 2YARA 3SZ6A 3I75A 3W9DA 2CIKA 4U3SA 1SJEA 1ITCA 5E8EA 1YEEL 4QR7A 1KIUB 2Y2TA 3D9AL 2VDRL 1GR7A 1QAWA 2ITEA 3W81A 3BCDA 3FH8A 4TUUA 1AQMA 2AI0L 4IIQA 1F97A 3S35X 3QFDB 1HESA 1NCJA 4LASL 2AKRB 1H0DB 2RR3A 4QAWA 1DBBL 4XNQB 5E5UB 3HLAA 4FQIL 5MP6L 1OD7A 2QKIA 1RPQA 3CC5B 3QDHA 5BO1L 1NCAH 2NY3C 5H94A 2X5PA 5IHHA 5IBTL 3TA4D 4PY8I 1CPUA 3MLWL 3KXFE 5LXVA 5EOCH 3QEUA 1Q0YH 1M71A 5CSGA 1GTFA 3QG7H 4HH9A 1TTFA 2EEBA 1FORH 3BW9B 3ZKND 1KB5A 1T89C 1X7SA 3V6ZA 3O6FB 3B2PA 4FQQB 3O41A 5DQJA 5E51A 2VXSH 3DX2A 4WU5A 4EAEA 1J18A 1JYWA 5IVOA 4Y19D 2WNWA 2OCCB 5HHME 4NYLA 1L0QA 5IB3A 3UPRA 1V3LA 4G7VH 3LCYA 1ZTMA 4WW2A 5EFIB 4WRLA 3T1FA 4Z7OB 2CA4A 5KVGE 5HYQB 2W94A 1AGDA 3S98A 1JFQH 1PKQE 2YSSB 4Z3JA 1WHPA 1JCKA 3QEHB 4L8CA 5AL8A 4UOW1 2GY5A 1CFTB 4XPGL 1YEGL 1V3MA 3OMZA 4BSJA 4XC3L 3JWOC 3OM3B 4IHOB 2G0KA 2NCMA 4OIBA 3Q2CA 1RP9A 2AXGA 5E2VH 3JVFC 3QSKB 4C56A 2PABA 3FONA 2NSQA 3POCA 1PZAA 2OI9B 3RILA 2A6IB 4M61B 1I8LA 1CVRA 2DMBA 2H0FA 5IVNA 1WLHA 4HPOH 3QDMB 1UT9A 4PYHA 1D6EA 2VAJA 1UZ8B 3E1ZA 3EOAB 3L1OH 4TUJA 5I66B 3TZVB 2ARWA 5IR1A 4D9RD 4BGDA 4M29A 3SO3B 2PKDA 1DZ0A 3MV01 1CLYL 3NZSA 3QYMA 4MXWH 4AW7A 5DJ6A 1GZPB 5EZJA 1JF5A 1V27A 2IFGA 2YGVA 1SEBA 3CHPA 4EN3A 5IUCA 3CBRA 5DLML 4XBPA 5BRZB 4Y4KA 2C5DC 3U2SB 4FNRA 2JTDA 3RI5F 1BXUA 4PJFF 4UI2A 5EIIG 3T08A 3WFHA 3BQUA 4AMKL 3GMQA 4YBLB 2V2WA 4LSPL 1WWCA 4WV1A 1MREH 3U2IA 4TNEA 2W95A 3CDGB 4YS4A 3AUVA 4S1SH 4HVBA 4QJ5B 4M1CC 4FTVD 4BCZA 4EDWL 4PJGF 2GUYA 3VQMA 1YYML 4I3SL 3RPKA 3MLPA 3B2VL 3AXLA 3N1FC 5I6XC 4XN7A 1X7QB 2QVMA 3WI9A 1T2QH 2HFEA 3GSWB 5CBEB 1IU1A 1D7DA 2VM3A 4JQIL 1TOXA 1AI1L 5E6IC 1X5JA 3APDA 4JFEE 3FSOA 3L2LA 5DD5H 4TQ8A 2JQMA 3HUJF 4AIOA 1MRFH 4F9PC 3OAUL 2RJMA 3ARVA 3VQLA 3V9CA 2WJ7A 3DC0A 1TTRA 3FO9B 3GJFB 4ADGA 1S5HA 2GJZB 3OXRA 4Y7OC 5C8JB 3RGVB 1M2VB 1CGWA 3WLWD 3IGAB 1FNGA 4N0RA 1JHTA 4HEMA 2AF2A 1OAXH 1Q9WA 3NTCH 2OL3H 4NQXB 4N2GA 4LSDA 4MXQD 1A5FL 2ITFA 4YSTA 4N1EA 5C3IA 2XV2A 1QUPA 3I6SA 1JWMA 3D69B 3IF1A 4XAKD 1KIPA 1BGXH 4BUGA 1U8MB 2IANA 5SX5K 2A73B 3B9KA 2BFVH 1L4IA 3N3EA 1TZHA 1A4JB 4L4TE 2Q1EA 1OSYA 1UGNA 4HIIB 5F88A 4EMZA 1HHHA 4OQTH 2E9BA 3ZE1E 3LKPB 2FYYA 4G5ZL 5E00B 4FJYA 1PSKL 4ZMVA 5GHWH 3ILQD 1CFVH 4FNSA 5CFHA 2GUOA 1XTMA 5GSRB 5C0DB 3ZSTA 4OI8A 4O02H 2H1PL 4K2UH 4GH7B 2EO9A 3GB7B 3GMOA 4WO4B 1JXKA 5CP7A 1XAKA 5LBSA 4PWHA 2ZOKA 4NM4L 4OZ4A 1ZLSL 2WWOA 5HHMB 3HN5A 1C1EH 5G4OA 1BPLB 4JREB 2K8MA 3UH8A 4AIZB 2EVHA 5L6YL 4ZW6A 1KTDB 1A02N 3QXVA 5EOCJ 5FUZL 1INDH 2YD7A 4EDXB 2PWFA 1IBYA 2AAAA 4ONGL 4PVLA 2XTSA 2QQNL 4MNGE 1ZLVK 3U48A 1HQ4A 1N5AA 4MNQA 3AACA 4JFZH 4GAFB 2XVKA 2VT0A 4QCIB 5D7HA 5J89A 3QDMD 2Z8RA 4KQ0A 4LKXA 2VLLB 1E4KA 3ZGIA 1R24A 3I84A 4XB8A 1S7SA 2LQRA 3FN9A 4I0CC 4JO2H 4D8PB 4F7MA 3IE4A 2P42B 3ISYA 2JH2A 2BOBA 2X05A 2O61B 4FN0A 2VDPH 4HIJA 1ZLVH 2VSDA 5C9JA 3CVHL 3OVUB 3JXAA 5FHAL 2HLAB 1ETZA 1OLLA 3UCRA 4HALA 3FCSB 3WFBH 4U1SB 5DGQA 1OKEA 2WWKT 1U3HB 4JZNA 3GRBA 5AUMB 4IRJC 1TQCB 4R2GB 5L7XH 5CGYD 5ISZE 4B6ZA 5KVMC 1NDMB 1QBLL 5ACLA 5FGCE 4MDIA 3BRFA 3K2UH 3IDNA 1NDGA 4H5SA 5KAQF 4JFDA 4KDTA 5GGVY 5F0JB 1WA1X 4JDZA 5FV1L 4LEEA 4PH8A 2EIZB 2C7FA 3CE1A 5TTRA 4GSDH 4YVNA 4N2CA 1JGVL 3KMDA 4YDKH 1R9FA 3ARBA 4BRVA 5IVXB 3LZPA 5CZKA 3MRBA 4KJPD 3F00A 2HKFH 3LXCA 3EO1A 4U6YB 1AMYA 4YC2B 4HIQA 1FVCA 4A7GF 5J6HB 3BWSA 5DUBA 1E5AA 4JM2A 1CN4A 2NXZB 3Q9PA 3T8XA 1H3VA 4IJTA 4PJ9D 3MLVH 1GOGA 4HPHA 1L0XA 4N2AA 4ANKA 2PPAA 4EZKA 4F9LA 2IGLA 4KVNH 2EINB 1FIGH 4WUUA 1QSEA 4HUXB 1M57B 1A1MB 2F58H 3QJFB 4QGYA 3OLGA 3U4EA 4M93C 2FNWA 4PRPA 3FU7A 3OAZH 4BWWA 1C5BL 2CHWA 1MJJB 3OAYH 4QLRA 2YUWA 3D30A 4Q9RH 1BFVH 2OTPA 2FHCA 1OSPH 3FTUA 4MA8H 3RKDC 5DQ9A 1OOAA 2XT1B 2YRBA 3BZ4A 3BMVA 1RFDH 4N2DA 5SWZA 3ZW3A 3HE7B 3ULUL 4LCWE 4RISL 1X44A 2A83A 3N06B 4FQPA 3WKMH 1YNTB 4HZ1A 4HIEA 5B21A 5KYUA 3HG2A 5FOJA 1CYWA 2R1YA 1JUFA 3DKHA 1OVZA 1AO7B 3HBPA 2VDOL 3QRBA 5LHDA 2VL5A 1KN4L 4TQPA 1CFMA 1LO3L 2VDML 4D7BA 1DHKA 3VSQA 3L1FA 1T7XA 1A6VL 1N19A 2ZNXA 3IKCA 1ICTA 2IH1B 1VADB 1E27A 5E56A 2FECI 4ODUA 1LWHA 3WJLA 1KJ2A 1ORSA 1Z5HA 1KLGB 5AW3B 4MNGB 1SHMA 4HHAB 1OP4A 4KTEL 4PLKD 5TF1L 2VZTA 3Q2NA 3AADB 4YHIA 2JJSA 1G9HA 5F8QC 3F85A 2ZG3A 5IFHL 5E4EB 3KZ8A 2LLGA 5J6GA 1G1CA 1H5BA 1Z6JT 5GRWA 2WQXA 5E6ZA 4WHYG 3A4FA 4KUCD 4LMQI 2YAHA 1RHHA 1II4E 1BQKA 1TQSA 5KEZA 2JF1A 1XF4A 4LHUA 4FQXD 1KTBA 2EEXA 2A9NH 4ORGA 2D7QA 1XGPB 1G9MH 2K3TA 5TPWL 1BQ5A 4ZT1A 5HYSA 2ZJSL 2XWBA 2NZ9C 4XPAL 3GFUA 2GIXA 1TZOA 4RCAA 4BZ2L 2EDFA 1L9OA 2VDLH 4JFVA 4UINH 3FTWA 1LM8V 2OULB 4HS8L 3ZIMA 4EOWH 5CD5C 5ISZB 2ICEB 1MPAL 3MLTB 2NCEA 4ZK8A 1AR2A 2V37A 3EDKA 2J88L 3PWJA 4GI8A 4YQXH 4KV5E 5FGCB 3T6QC 1J11A 2UUDK 3QI9A 3QIWD 4KFMA 3W5NA 3GXUB 1Q9KB 1PLBA 4MJIB 5FHBH 4BH8A 3B37A 3K4DA 2OZ4A 3QG6B 3L6FA 4P57B 4J8RB 3KCPB 2WXQA 3PGDA 4UTAA 1EUTA 3WL9A 1Y7VA 4F58L 1IL1B 3TX4A 3IJEB 5INDA 4HGWA 1HFUA 3FT3A 1UD8A 4D0DA 3VRIA 1RUQH 2WK2A 3WNNA 4CKVX 2MCMA 4P4KA 4X8GA 3SQBA 2C34A 1YN7B 3Q2WA 3IM1A 3JSSA 3U9UA 1ZA6A 2AK1L 4APQA 2FYVA 2NTSP 2A4EA 1J1PH 2JMRA 4PD4J 5BNXD 3BVDB 4IOIA 1YYLH 4KK5D 4Y5YC 1R75A 3OGOE 2DMHA 4EI6A 4TNWK 2HPTA 4L4JA 4DKEH 1HEZB 1TVBB 4LT7A 3OKNA 1MZYA 5ACMA 2ZP8A 3APNA 3ARGA 5F6IB 4N2LA 5C0JB 5IQ7H 1DFBL 4FQLL 3A4EA 2G5UA 3WIHL 2LOEA 3QNXB 3MRNA 5C0CA 3U6RB 1TU2B 1WAPA 2CO7B 1AO7D 3DVFA 3FQNA 4UOZA 2VOTA 1MQKL 2F7RA 3KLQA 1XAUA 3VAEA 5M95B 3QRFM 5EO0B 4OKVA 2X1OA 4LCWB 1MN4A 1SXAA 3IDMB 4QNPE 3HPJA 1UOKA 4NRXA 5BZWA 1NMBL 5GGSA 3BZFB 1PDKB 2WLLA 2DQTH 2ADIA 1MQ8A 3QXUA 1ML0A 4F27A 2XWXA 4KNUA 1XTLA 3HPLA 3DYPA 2OTWB 2F6AA 2M26A 3FU9A 3BGMB 3RURA 4JFPA 3BUDA 4M8VA 4K3HA 5E2TH 2X4RB 2EC8A 4K3JH 3DGCR 3I85A 1WC7A 2XZCL 1I7TB 1LO4L 3CBKB 3BEWA 3UBXA 5FUOL 4ACPA 5DJ8B 4QTHA 3E8UL 4Z3HA 3CXHJ 4KMTH 2NUPB 5IJKA 1UGKA 5CD3A 1NCDL 2ODHA 1SXCA 2VXUH 5DLLA 3NGBB 4PI2A 3ZDWA 5FYLH 4Z3GA 3LKSB 2YD4A 3DROB 3N04A 5HHXL 5AAPA 1HZHL 4FCAA 1JTTA 1H15B 1SDDA 2VLJD 4F2ME 4DKAA 1F58L 2BS8A 4NZTL 1KBVA 1QI5A 4Q0XH 3MV8D 4GSRA 5AVZB 4HEME 1AJ7H 5E8OB 1MI5A 5KSBF 1DBKL 5DFAA 2BW5A 3LQZA 4POZD 4GUPA 3FU6A 5JPNC 2ZAHA 2IH3B 2IH9A 1F8TH 1PLAA 4X6EB 3RGBA 2R23A 2OXHA 4K5OA 5J06A 2DQIL 4Z7UE 3I6LE 2NY2C 2W07B 1EXUA 1JZ7A 1ZMYA 2KKQA 1KXTB 3IXTA 3WKPA 3UZVB 5C0FA 3PIQA 3M17B 5DC4B 1UKTA 2YKLL 1FSKB 4Y4HB 3VFWB 2Q76B 3IJSA 1ZRUA 2JCWA 4KHTL 4QXVA 4X2UA 4MJID 2ID5A 2YUZA 4UOJA 1MCKA 4UIKL 3OKEA 4K9JA 2O6FA 1F3JB 3HFML 1G9MC 3BAYA 4EKXA 4OLWH 3WFEL 1RUKH 1FJ1A 5LBGA 5EBWA 3VWKB 1IT9L 1A6ZA 3OTTA 4NS0A 4ONOA 5JHLH 3IWVA 2QHLA 5K1NA 1ZLDA 3UG5A 3B9VA 3WLWC 2X3AA 1RURL 4AGOA 4F7CA 4HETA 1ED3A 1M3IA 5DMIL 2V7NB 3QXAB 3RY6C 1TYRA 3QDAA 1KG0A 3CZFB 4MCNA 1C5CL 1T5XA 4XVOA 5TF0A 3GPEA 3OSVA 4ZSOA 5BZDB 1NBVH 3IU4L 2YA1A 3L5HA 2MPAL 1D7CA 1ZLWK 3MRLB 4J6IA 4K7PH 3MLSH 4YXKL 2Y23A 4QD2E 4HAFA 4XWOD 4W4OC 1BBDL 4X7FC 5F7LB 5FM4A 3WY4A 4N3UA 4AQ1C 2CJUL 1JS4A 2WVTA 3JWOL 5FCUH 4DVBB 4OGYL 3C60A 1ZJAA 3M46A 1J8SA 2ISDA 2FCBA 4PJ7E 1P5VA 2X12A 5HJDA 2FJFB 4PGBB 4I77H 3E80A 3D48R 2ZX8A 5AB9A 3ZYJA 2X4SB 4YXLH 1ZLWH 1MDTA 1DFXA 1I4FB 1ET5A 5HD8D 2YPVA 1T3FB 2V4LA 4IDLA 4KX8A 4L23A 4KKCD 5LN4A 2NY0D 3F6LA 4JKLA 3TBTA 1D5IH 1XCXA 3SKJL 3FBQA 3X1NA 2Q2EB 1TUPA 4K9EH 2ZYSA 4N0CC 1MHPH 1U8IB 2OMZB 3A6CL 1EJFA 3C8DA 2OMNA 2P8LB 3FU0A 3WHXA 3D87B 3FRUA 1OOWA 1CBVL 1BM3H 3G6DH 3T9WA 1JZ8A 2CSPA 2AQ3A 4J3XA 3KPMB 4HCFA 2YAFA 3FT4B 4KI5D 4M6OL 2LVCA 5I71C 1MUJA 3UJIL 2ADYA 3ULVH 1WZ1H 1WBXB 2X4OA 4HK0A 4P2RE 4YHKH 4F7TA 1BEXA 3EJYC 5FK9A 4NOFA 2D9CA 3MV9D 4K73A 6FABL 4A6YL 2ESVA 4QTIH 5BS0A 2H2SC 5JW4Q 3FJTA 4N90E 1IEHA 1U3ZA 3NRFA 4KKLD 3ARDA 3QO0B 4TNVK 2D7TL 4P2OA 5F71A 3TYGH 2DM3A 1UENA 1SOSA 4RESB 1N0XL 4Z76B 5FYKH 2LTQC 1DVUA 1NIAA 2B1HL 3IPBA 3UG4A 2OJZL 1CD9B 4F2MB 4MQSB 1Y18A 4MNHB 5J12B 3G6JE 2VMDA 4RFEA 4X9FA 3MA9L 1YEFL 4WZ9A 1GYCA 2X9WA 4PRPE 1J0ZA 1MJUL 1T1XB 3O11A 4GAGL 1I8IB 2VC2L 5KSAA 5KZCB 4ZMZA 1S9XA 2CH8A 4YSUA 3PAYA 4HQQH 4MAYB 4GAAA 3NFPA 4JFXA 1HI6B 4Z7UB 1QFUH 3TEYA 3AS1A 3D06A 3G7TA 1WD8A 4YHYB 3EJTA 2J8HA 1NIEA 1TQBB 1R5VB 2A3TA 2WBJC 4PJIA 5CZXC 3P4NA 2BDNL 1XSOA 5DD0H 2ORBL 3UTQB 4PJ9C 5ENWA 3IYLW 2LE9A 4OLZH 3W57A 3GSQB 2VMEA 4KY1L 5L9DH 3FCUB 2X1XR 4LSVL 3T0BA 2MMXA 3D25B 2MCPH 5DHDA 3VXTB 2YQ2A 5FLUA 3VTMA 4MKMA 4WW2F 2FGZA 5F7KC 4UQIM 3FZUD 5IJVA 1F6AA 4JW3A 4UZGA 1S78C 2B14A 4BWTA 1Q0YL 3KLHD 4BJLA 1FORL 3S36L 4OVUA 2V7HA 3GSNA 2VISB 1Q9LA 4Q74A 1GW0A 1HXYA 3CZGA 3NPZB 4GQZA 3SDCD 4G80A 2VXVL 2VW4A 1MNUH 1YRKA 3QS2A 2FWUA 1P4LA 4I0KA 4K7FA 4Q89A 5MERA 1TDQA 1URZA 5A3ID 1GJIA 3KM1A 5AZ2L 1NLBH 2ZXDA 1T2JA 3PNWA 2AJZB 1HAWA 1LMIA 2Y7OA 5E6YA 3RUGA 5AFAA 1J8HE 3TGXA 1TCMA 2ENYA 4PJ7B 5DO8A 3ZRFC 5CEXB 3B34A 1JFQL 4I4WB 3H6AA 4MYWB 4XOEA 3ZDZF 4DVRL 4M8RA 1JWUB 4Z0BH 5CMAB 3STLB 3HAEA 3Q13A 4MZRA 1AZUA 1KT2B 2R2BB 1DVZA 2I9LB 3KYMA 1J12A 1XT5A 1EERB 1H3TA 3C6LA 4N85A 3TM6A 1EZUA 2NNRA 2P24B 1JRHH 1YC8A 2R59A 3Q8FA 3REVA 3OJDA 4CN4A 1XCQB 1A47A 5HPOA 5L4FA 1A9EB 4RMVA 1YZZA 1XZ0A 1A3LH 5I15L 3TU6A 2E59A 1H8NA 3X1GA 5TQ0H 4ZYKB 2AQ2A 3ABKB 2XDHA 4AWJC 3UJTH 4PJXA 1R0AH 3RL2A 1J05B 1HH6A 3BSZA 2WYTA 3PV6B 3U0WL 2YEQA 3VW3H 3V4VL 3V6FA 3HKFA 2FTAA 1BD2E 4I18A 4K9EC 2KLTA 5C0BD 5I1EH 2C3VA 4P3WA 4P2RB 3ZY7A 4MXWL 4AYFA 4Z7QF 2K1MA 3SE4A 1W72B 1YPZE 1EGJL 2ZKHH 3Q06A 1ZKAA 2BSSB 3ZDYE 3HBZA 3VD5A 3D85D 2XFXB 2YD1A 2W81C 2X4QB 3VXSA 4Z1PA 4P48A 1FVDA 3LXAA 3AB0C 3OHXC 3QWRD 4KJQD 4NT6B 1PBYA 3DVNB 3IDIA 5EOTA 3ULVC 2HTLD 4Z5RB 1A7PH 1O0VA 1O6VA 1THAA 3EDJA 1E7UA 3O4LA 4KHXH 3T2OA 1ZHLA 4JN1H 4XN8A 3W0WD 5DU7A 3B56A 5J57B 5KZCD 2IFFH 4HT1H 3G6JB 5HDWA 5K59E 3SDAB 3BUTA 4ZUSB 2Z0UA 1DVFB 2FUQA 3TIEB 5KTEL 1AGBB 1NZRA 2QMJA 4WWKA 2DI7A 2CLZB 5C0CE 2Q86B 4EEEA 1PG7H 3LS4H 3VFUB 1UH4A 4JCWA 4PJBE 2F54D 4WKZA 3WEAA 4BHUI 1MRFL 1MW1A 3RWFA 5IMMA 3ABZA 3CFJA 3D5OF 3FYEB 3V95A 1B6DA 1JGDA 2DDQL 3LN4A 4ES8A 1KENL 1D5XB 1L9NA 2C1OB 2QPSA 3QDGE 4N3TA 3QQDA 4NQEE 2WXJA 1VFAB 1P2CB 2BSED 4W70A 1OAXL 4BFIB 3NTCL 3UGXA 1LJMA 2AEPH 2V5MA 1A4CA 4R8WH 1J5OL 2DWDB 2ICWA 2HFGH 3MNMA 2CJTA 4J7RA 1N70A 4P9HH 4QRRE 3W11D 1I9IL 4DGYL 1SPDA 1BGXL 1BOGB 2QPDB 5I74C 1KC5H 3K71B 2NR6A 3NAAH 5D4IA 1JI2A 2YD3A 3BUIA 4BZYA 1BV8A 1ZHNB 2BFVL 2J20A 5LLIC 3IGLA 1EK3A 5F7MC 5E1AA 1MWAL 1UB6B 3DX8B 1X9LA 3QUZB 1EV2E 5DJXA 5LO7A 5I1LA 2NNCA 4YR6A 4OQTL 1G0XA 4OJEH 4MWFB 2F0CA 4HJSA 3NIGF 4LFHG 1LNUA 1SYVB 1CFVL 2YZ8A 4PG2A 4NKQB 4GO6B 1IARB 4O02L 4B0MM 1IZKA 2JLPA 5IQ9A 3VE0B 5K9OA 1KTJA 3UXFA 4PWKA 2YOAA 4F93B 2Y1YA 2NOYA 4KAQH 4YZWA 1W6LA 2F1BA 5CLWA 1GS7A 3BUPA 2MNUA 3N1QC 4PW4A 3V4PH 1J8HB 1INDL 3G3LA 1JZDC 3RJDA 1VF5C 4L5FE 4OR1A 3BIKB 2BW4A 4OJDH 5D7JA 2B2XH 2FT8A 5J56B 2HVKB 3KDMA 2ENJA 4UT9A 2X2HA 3MCLH 3L9YA 4JFZL 2E74C 3WFZA 1PYWA 4HEPA 2YZ1A 5F0PB 2VM4A 1H3GA 5FFOA 3D34A 3MBWB 4YHPA 1EZSA 2CU9A 1L9RA 1LGVA 3MBEB 5ANMA 3MODL 1HXKA 2CLVB 2UYLA 2E46A 1QUNA 1QVOA 4NQDE 2YXMA 3IJYA 3CFBB 3KYOA 4HFWB 4RSVA 3V0VA 2IOMA 3IDUA 1TCRA 2JKNA 1MJ8H 1RD6A 4DAGL 4PJ8C 1BD2B 1NKOA 1UZGA 2OMWA 4H1LH 3WFBL 2O30A 2H3NB 4RFOH 5DHYB 3W2DH 3S5ZA 5TDOA 4POZC 1AHWC 1YPZB 3PWUB 3ZDYB 4JM2F 4ZSOE 1UA6H 5L7XL 2K4AA 2XIDA 2IO5A 1E0OB 2A9ML 2YD6A 3CUPB 5I9QB 3K2UL 5I8KH 4G11A 1CDUA 1MCRA 1PY4A 1RK1A 2A9CA 2OMVB 2UVEA 2IV8A 4J3OH 1LDPH 3SKNB 2BCKB 5MENA 3COOA 2WKOA 2NW3A 3CLEH 2WQSA 1OGSA 3ATFA 3EADA 1QHQA 4GSDL 3S96B 3PWNB 2EH8L 2XVGA 4LDLB 2VN3A 3BIBX 3SCMD 4XGZB 2ZSWA 3H7LA 3QIUC 4ETQB 3OQRA 2LFGA 3DVGA 2P80D 1RZIA 1I1AD 2NY4B 2A6DB 3QT2A 1N6QH 1JVKA 2DY2A 3H4HA 1AXSA 5IQNA 3BP7B 3TCTA 5DYFA 3IT8D 4PJBB 2EXYC 3FF7A 5HHPA 1MFAH 1WP6A 4AUUA 1PNDA 3DXAE 4AVHA 1NUDA 2ZUQB 2ED7A 5G5DA 3SEPA 15C8H 4JJ5B 4ZZFA 3QDGB 1BQHA 4HK3N 4L1BA 4BKSC 1A7RH 2G5BB 4NQEB 3LKRB 1ZSHA 5CINL 4QKXB 3GUTA 4N24A 3ZT7A 2H26A 4N2EA 2NX5B 4PSPA 2VR8A 3O9WD 4Q9RL 2DPKA 3QUZD 1OSPL 2CDGB 4KOBA 3VUAA 2P46B 4FQJL 5EG6C 4ZNEA 2PYFA 4QRRB 4R7DB 3IS0X 5E9AA 3U46A 1PVHA 3QUXD 4FFWC 4EPSA 2C9UA 3EHBD 3RU8H 4Y9CA 4Z3FA 2X4PA 1ZTXH 2FZ3A 2R4SL 4J3UA 2BP8B 1YNKH 4EE2A 3B83A 3WKML 3QISA 1XEUA 5F7AA 5HD8C 1TTAA 3UBGA 3MLRL 3ARZA 2NTFB 3BWAA 3QULB 4P9HC 5IEKB 1M1SA 4LSSH 1QYGL 4PJCA 1E67A 3S34L 1N8OE 2Z64C 4PREB 3SYCA 2ZG1A 3TIDB 3DO3A 3DV6B 1W8EA 3MV7D 1FFPA 5L8LB 4OZHE 4O5LL 5E6IA 4N8CH 1MNNA 5FA4A 3JBG7 3WHE1 3P9MB 3SDDC 1T7ZA 2VR7A 2ZXEB 3OKLA 4N2KA 1NFDA 5F89A 3RFZA 3EYVB 4PRNB 2G60H 4MCZB 3BCFA 2VMCA 2BO0A 1JG9A 4DT2A 1JSYA 3CFQA 3ES6A 4PJIE 4PSRA 1HX0A 2IC2A 4P46C 3NMEA 2V5TA 4NQQA 1G94A 1IJ9A 3RX8A 3OMNB 5IB2B 2WP3O 4Z7VA 1JXJA 3SE9H 2WBWB 1XZWA 1IGFL 4A67A 4NQDB 1RV6X 4OJFH 5EORH 1T21B 4PI0A 5D2NB 1AFVH 2A9NL 4DN3H 4ODVH 3MLYH 1Y1UA 3GM0A 3TPUB 1WFNA 3ZHNA 1XBDA 2DTML 4UINL 5L4MA 3MFGB 2VXQL 3QUML 3SYQA 3VFSA 4ZI8A 5GS0H 1DJYA 3GZQA 4M8QB 1A0QL 5SX4H 4YQXL 3L4UA 5CO1A 5E4AA 3KYAA 3D2UA 4JO1H 5IW6A 4JAMB 3RTQA 2JXMB 2HX8A 4BSWA 2Y72A 4X6FA 5I8CA 5H37H 4OFYA 5FHBL 2XKNA 3V6OA 4D3CH 2PYED 3BSGA 5D7LA 5TDNA 1UOVA 1HJCA 3I50H 3RGHA 2ATPB 3OG4B 1G43A 5CM1A 3GHBH 5FYJE 1KBGL 4B7IA 2H32H 5C0GB 3UGEA 3IMTA 3FU5A 3RDTC 2MQCA 3WO3B 2XV3A 4J3OC 5M94B 1A1NA 3B2MA 3BEVB 3B2UD 1RUQL 1GRWA 1KTLB 3FZUC 3MX0B 2GJJA 3FQXB 3G5XB 1MXGA 1RUML 2DYRB 3T6ZA 1L7TH 1UA3A 1HTYA 2WM0A 3IU3A 1J1PL 3KLHC 4G9DB 4HLEA 3DXAB 2NX5D 5ADPH 4Y2OB 5T3XD 4FP8H 5DK2A 3N40P 4Q6IB 4QIRA 4ZMXA 2G4GA 3Q6FA 5LJYH 1F42A 4PJXE 2O5ZL 4U1KA 5LCVH 5E5MA 4DKEL 5BV7B 3WD5H 2Y5TB 2BRRL 1KNOA 3HBGA 2Q6WB 5IQ7L 3MYJA 4IRJA 2LU3A 2NPLX 4I1PA 2L8AA 3ARUA 4LLYB 3HC2A 1N8ZA 4R0LB 2JK5A 2ENQA 1YYCA 3NIFF 3T2QA 5F9WB 3P4MA 2VXTH 3QVAA 2XXFA 3VFVB 4M1DL 4PVBA 2B9BA 1XSKA 5DDHB 5HGDB 1SBSH 4AKOA 4WK0B 3F12A 2PTVA 5IHBA 5T1DL 4LL4A 4LFHD 1GGBH 4F7PA 1F1GA 4LO9A 5DYOB 5C0RL 1T1YB 5ESAB 5DZOA 1KPRA 4O2EB 1AD0A 3BRGC 4RMSA 2KERA 4LSTH 4OFKA 4WJKB 4U1GC 5E2TL 5FKPA 3NBNA 2J56A 2QT6A 1RXLA 3C09B 1QO3A 1X6LA 4U6VL 5CWSB 5A16B 1OARH 1HKFA 4OF3A 2X2JA 4L3CA 4NN5B 4NUQA 5ETUA 1NEZB 1UFUA 4KMTL 4OZHB 4N8VG 1A7QH 3MJ7A 1GGCL 5IREA 4ZFGH 2OMTA 2X41A 4ODHH 3SGEI 4BM7A 4KH9A 1ZA3B 2MWCA 1MHHA 2FIKA 5B1KA 5C09B 1S7XB 1I3RB 1KYDA 3EW3B 4I8DA 5L0QB 1YEDA 2NY7H 3MKKA 2QADB 4B9ZA 1QPXA 4CA4A 3WENA 1G4MA 3VH8A 4GW1B 5HVWA 3FQWB 1BVKB 3PHOA 1U9KA 3TS8A 4JO3L 4CGTA 2FGWH 1K4DB 4NAMA 4EN2A 2FX9H 4QKTA 1F8TL 3NCXA 3EYSH 1DQJB 3C5SB 2XN9E 3MRJB 1S7RB 3PQYA 1KB3A 1T1ZB 2OL3A 1A4KB 4OZFG 4PJDE 1RP8A 1VPOH 3EXJA 1MFVA 3NH7H 3HE6B 1INEH 3VXQA 1AOHA 1WTLA 2C7UB 4Y16C 4K3DL 5ICYA 2EXSA 1MW2A 4NRYB 5I1KH 3MRFA 4KGJA 2YUVA 4NJ9L 1A2YA 4PJFB 4YHLH 5GPRA 3ARFD 4RDQF 5ADOL 2NT0A 1X4XA 1CYXA 4LU5H 2YA2A 5SWSA 1TZ8A 4MXVF 1ZHBA 5GGTL 1IM3D 1OXYA 3PABB 2WLIB 1NEUA 1AGEB 3D4CA 1DN0A 3Q1EA 3O8XD 1XCTA 4FRWA 4PJGB 4W6WB 3VFPB 4Z7WE 1QBMH 1W0WA 4NO3A 2VUOA 1QSVA 1OGAA 4FZ8H 5GS0C 2WKGA 1S3RA 5C6TH 4FI8A 3W38A 1JPTH 2D03L 2WB7A 3BKCL 1DBAL 3QXDA 1FG2B 5I0WA 4F33A 3MLZH 3KPSD 1NM9A 4HUUB 4KQ4L 4JFOA 4BK5C 3PWPD 3P2BA 2A9AA 3EGXB 2F5AH 3FQ1A 5D1XB 5C0ND 1XB3A 2X6AA 4OD1L 4WTXA 3DGDA 3PJSB 1OB0A 2AJVH 4XMUA 5FOBB 2MH4A 2WY3B 1E9QA 1SHXA 4ONFH 1R3LA 4X83A 3DJRA 2BNRB 1QSFE 4HKJA 5C0AD 3VU1A 3TJEH 4I77L 4JLRB 3VCLA 5MHSD 3TNMA 1KPVA 4PWJA 5F0MB 4YXLL 4DP9X 3DO4A 4IYKA 2J4WH 2W59A 2XNAA 2VJ0A 1UJ3B 1D5IL 4PLNC 3DHJA 4G6JL 4GO8A 2YPLD 2B39A 2JB6A 2R27A 3VD3A 4YHNA 3OKOB 4KRNA 1GY2A 1MHPL 4G71B 3HNSL 4GNKB 4XNUL 3GMMB 4N1CA 1Q94A 3TVMC 1AKJD 3BPLB 3QPQD 1BEYH 3G6DL 4PAZA 2KC0A 4GAYA 4RX4D 4HIXH 3X3GL 3P73B 3LYRA 5DJZA 4NP4H 4NPYB 1WZ1L 2ATKB 4X6CA 1G1KA 1J9TA 3HB3D 3K74B 4JPWL 2DKUA 5DJYB 1B2YA 1JERA 2UZXA 3HEIB 3RZCD 4RAUA 2B1AH 3DHPA 5C09D 5AW1B 1UWEL 5B39A 5KG9A 4XN4A 4JUTA 3VNZA 1CS6A 2ATAA 4FLRA 2XX1A 4D94A 3TYGL 1DQML 4Y5YA 4Y4FB 4BK8A 3SGJC 3VXUD 2X6BA 2DZEA 3V7AG 3KPOB 3FN0L 3DTXB 2EXWC 4JRXD 4N8VB 3LD8B 5E1HB 1OAQL 1MZZA 3Q7JA 3SBQA 1I85C 1CXLA 3BWUF 1VJSA 2Q0ZX 1RK0B 3ULUF 2TRYA 1FNSH 3VXNA 3BP5B 5KYXA 4X9YA 4CW1A 1AR1C 1KIQA 4ANVA 4I48B 1XSJA 1EFQA 2BHUA 2FSEB 3O2WH 4ZNEE 3IVKA 2XRAH 1YMHB 3NOIA 1DQLH 2XN9B 3LNIA 1HL8A 1IGYA 2FLBT 1JVLA 3UTSD 3DBXA 3ILPB 4ZMWA 1HHJB 4IKJA 3H0TA 4HXBH 5F9JB 4M6ML 4PJDB 5T3XH 4HD9A 1U8NA 4IJ3C 1T7YA 1EFXA 1COBA 3ELQA 3RNQB 1S7WB 1HINL 4GRWH 2UY6B 3FPXA 4IRSC 1NMAH 5JUEH 2FH8A 2PNDA 2EJ1A 3E6HA 3K8MA 4OZFB 1F0LA 5DO2D 2WQWA 2CKBA 5L9DL 2F19H 2MTAA 3QQXA 5E0FA 3II2A 5FO9B 2MCPL 2PF6A 1H3PH 4PGDB 2DQUH 5T1MA 1NKGA 2GY7B 3D18B 4LCCB 5CHNA 5C08E 5JOPD 3RUGF 4J12A 1BLNA 5B1BB 2B5IC 2ZWZA 1V54B 1QHPA 3T0AA 1NCWL 2AXJA 4AJYV 3VXRE 3CPLA 1R3JB 1WS8A 4Z7WB 2AANA 2YIHA 3PY9A 3ASNB 2X53A 3DETD 1J0KA 3C2AH 2IGTA 4XB7A 5D1XD 2FEJA 3P0GB 4DQOH 3HZYA 4J5VA 2DQJH 3MLXH 1U8JA 3VWJB 2VDKB 3EHBC 2OMUB 2IXQA 3IJ9A 3E2HB 4G6AD 2BNRD 3NK4A 5T3ZE 1RIUH 3SE3C 1NBCA 2PCYA 3O6KH 1CFSA 4HUKB 1V8HA 1FGVH 2OSLB 2QZQA 4QOKA 4IBYA 1S46A 2PWDA 3P69A 2NNAB 4LRIA 4P23B 3L3GB 3T3MF 3N1PC 4LLVA 1QSFB 1NAMA 1V7ML 4NCC2 2A74A 2CO6B 3KBEA 4B5EA 3LXUX 5KYWA 3D3VA 1AZZC 4FA8A 5JXEA 1KCBA 4HMCA 4PRID 4RIRA 1RVFH 3DMMB 1XCWA 1GHFH 4OCSH 4NAQA 4U1IB 4BQBA 4L3EE 4X0KA 1CDCA 4ZODA 3ZQ9A 4EXKA 4A04A 4YZFE 4JFYA 4J3SA 3EKCA 3TFKD 2E6JA 3ISRA 4HP5A 1FNHA 3QR1A 4A7TA 2OXGA 1U8HB 2J71A 2Z91A 4HYTB 4AM0A 4PJEE 2APXA 3OB0H 1B0RA 1CL7L 1FFNB 4QRUB 4GXUN 3RY6A 5IHWA 5IEHB 1T80A 4ZW3A 3OPUA 4TLSA 1XF3A 2PW1B 3I9GH 2NW2A 1DUYB 2DI8A 3QJOA 2RAMA 5JIMA 1BZ8A 4JDEA 4JKMA 1G1OA 4DKFH 4NLHA 3B9EA 4HCIA 5I73C 4TVSa 2R0ZH 3L5WB 4JQVC 3EG9B 3OMIB 5AVUB 1NC4D 3DYMA 3G04B 2B59B 3BI9X 4IMKC 4OCXH 1A7PL 3HG0A 2FBJL 1FZJB 2HMID 3CLWA 4DPBX 4WKXA 1JNNH 4F5CA 4R7NB 4KPHH 4RGMC 2WP3T 5D1ZA 2RACA 2W9LA 3QQ4A 3QIBB 2WV3A 4N9OB 4N2FA 4JPQA 5HYFA 5KSVA 3F6IA 4YDVB 3DPBA 4ESKA 5DK0B 1THCA 1SHSA 4MZIA 1OT1A 2GSIB 1ZT4B 4Q2ZB 3SJVA 2W0PA 4LAQH 4JKNA 4XTRD 1ADWA 3FO2B 3F5WA 3LZRA 3SOBH 2OMYA 1C08B 5T1KA 1U8OB 3LKNA 3D05A 4KKBD 5KVEH 3UO1H 2EDJA 5EO9B 32C2B 4Y2DA 2Z31B 1GIGH 2Z1KA 3ZYIA 5C07D 1FN4A 5GGSY 3WV0A 3QHTC 2AEPL 4GG6F 4EQ3A 4R8WL 1AGCA 4LPXA 4R90L 4P9HL 2HFGL 4E36A 4H8QA 4JY5H 3ECBA 4EBQL 5C08B 1KC5L 5JHDA 3NAAL 5DHVB 3TEXA 2CRIA 3ESMA 4X7DC 3UP6A 3VXRB 1R3HB 1WF5A 5AVSB 2Z6FA 1FNAA 1PZCA 4XN1A 4X7SL 3FULA 1PJ9A 4JY6A 3T0EE 2DYPB 4LQFH 3KPPB 2PXYA 3BO8B 4FG6D 3EO9L 3U9WA 1FLRH 4AVKA 5B3NA 4AVIA 2IQ9H 4XNDA 3QNYA 4DO5A 5F7EH 1SLXA 3RJOA 1EAPA 5C7XL 1XGTA 2BWDA 1Q72H 2W0FA 3WN6A 4KAQL 4ANUA 2ARJA 2D7PA 2X6UA 3LHPL 1SVBA 1QR1A 1IGTA 1X5XA 2CALA 1T04A 3V4PL 3UIZA 4KROB 2YFOA 4BIKA 4BXSV 5JPMB 1QW8A 1IGCL 4UQCA 4FQ1H 2HLFD 5IB4A 4BCXA 3VFGL 2B2XL 5E08L 1AKPA 1U92B 1CICC 4MA1B 2WBJA 2BNQE 4JR9L 5DJDA 3Q0HA 4QRTA 1P1VA 5GS1B 1KXHA 2GEEA 2LVEA 4ICXA 5K9QI 3QZMA 2JFCA 1FHNA 4L3EB 2OMXA 4N5EC 2C3GA 3WEXB 1SGKA 3GMLA 1AQ8A 1JWSA 1KGCE 1S7TB 2IDTA 5IQMA 3T6XA 4R4BB 3PLYA 1XL6A 1VFBA 5A40E 4PJEB 4M4PA 4A2FA 1KV7A 4N0FB 1URLA 1JOIA 2IBZX 5JLZA 1IBGH 4AYID 4KJWD 1MJ8L 4C54A 3C8KA 5I1AB 2F68X 3SZKC 2WO3B 4RFOL 1DYZA 1T7VA 3JYBA 5DT1H 5C2BH 5JHLA 4XHJC 4NBXB 2ITDA 2JKSA 1NINA 1UA6L 3KPQB 3AXHA 4FS0A 2YEVB 4RFNB 4XO4A 3L5XH 4ZS6D 1ONQB 4MMXC 5J11C 2YRZA 4FYRA 4C4UA 5LXGH 4OLUH 1U8PB 3V9EA 3QB7C 5DURD 1XMWA 1OAUH 4P2QA 3GK8L 3DURA 3L3JB 3QZWA 3CN1A 1ZHKA 3EJPA 1KCRH 4TUOA 4XX5A 4PHXA 4B0MB 1IQDA 4BFNA 3ARFC 5E8NA 4LLQB 4CVWA 1BDYA 4HDIA 4MB4A 1FZMA 2X3CA 1IM9D 2CBPA 3DX3A 4KJYA 3MJ9H 2X89A 1UCBH 3P11H 3WDJA 1OCWH 2QSVA 4GFXA 3MNZB 2OYKA 3K6SA 1N6QL 1NGYA 4QT5B 1CF8L 1JMZA 3C5ZD 3IMUA 1GOHA 3HN3A 3H9SA 2BP3A 2I69A 5LAXA 5I1HL 3NCYS 4G43B 4G1EA 3KAAA 4XVTL 1LO5B 4JRYA 1RZGA 2UZYB 4MLIA 5GZOC 15C8L 1IBBA 3RJQB 3CU1A 3MROA 1A7RL 2ZWYA 2E6QA 4PJCF 4B9JA 3OC5A 4UM8B 3NCBB 3VI4F 5F1IB 3RIAK 3WE6A 5HXMA 4KDVA 1CE1H 5C0NC 3PHAA 1CBJA 4X6CE 1JPEA 4AZUA 5IFJA 3WJJC 4FFYL 3W9EB 1BM7A 3OHXA 1ZTXL 4KZ0A 5ICZB 2JNZA 1YNKL 4LEOB 3BPOC 4YAQB 1YY8A 2EABA 3UYPB 1AVAA 1NFDF 1UD6A 1VEOA 3I3DA 3T0EB 4O58H 3IFNL 5DWUH 4OH2A 4UTCA 2YD5A 5KVFH 2D7OA 4UV7H 3QDJB 4Q4IA 2PO6B 1E9PB 4LSSL 4DO4A 3HRZC 4Z0XA 4HWNA 4KROD 4E2OA 1HSAB 1E4XH 1MCHA 4LVNC 3UBXI 3SKMB 4LOUC 4H26B 1EEYA 4EUPA 4Z7VF 1T7WA 3B43A 3GDCA 3ZDZE 5IK3A 4MA3A 2UWEA 3N85L 1MCNA 43CAB 2CMRL 1BVNT 3H1ZA 2DJUA 4YWGL 3DX7A 1PKOA 3QUYA 5CGTA 3DYOA 2AV7A 3IDGA 4JK0D 2V9RA 1XH1A 3HB3C 3L3HA 2BNQB 3OAWA 4HIHA 4OM1H 3R06B 3E3QE 2EACA 3X3FH 3T2PA 1E65A 2YPKA 1Z5LB 2R2EA 4IU2B 3OZLA 1IAIM 4JPVL 2BVPA 3TO4B 4AGNA 3ZE0E 1P7QA 4NZRL 2WCGA 1DQQB 3LRHA 4OJFL 4DGVH 4QXUH 2H4EA 2O93L 3QYNA 4PJ6A 4ABVA 1AFVL 1OAKH 4KY2A 1AACA 1HOEA 4ZX5A 1TF4A 4Z7NE 5JW4N 5A6IA 1KLUA 3CNKA 4X0NA 2TAAA 1J88A 3WNKA 1RZ8A 2PCPB 5GS0L 5H35A 2V2XB 5I75B 1H6FA 2XPZA 5K39A 4UDUB 2ADJA 5CP3A 4FQHA 3QK0A 3JWDH 4PBDA 3OX8A 4JO1L 3RIKA 1LEGB 3QXTA 4WFHE 3ET9F 5C7ZA 2ZOOA 2ENSA 4E41A 4NNPL 2GFBA 3VXMD 2BNUA 3WLBA 1IKOP 1HIMH 2AXWA 1AAJA 3WNJA 2P5EE 3REWB 1M7DA 2AEQH 2C4FU 3GJFH 3I50L 4TULL 3GHBL 3FU8A 3QAQA 1JHKH 1OB1B 2IPKA 4M7LH 4UDTB 4XBEH 4JZJB 4H20H 4QRAA 3BKYH 3ARQA 4R26H 2C3WA 1F2XK 1T0NA 3UJJH 1KFAH 3VGAC 3ZZ1A 4QPEA 4ONHB 4WLCA 4YSCA 3ILEA 2ZWKA 3MTRA 4W9HC 1MCDA 1KB9K 1L7TL 2E47A 2WBXA 2OSWA 3SY6A 3WE1A 4JY4B 4LSUH 5F3HA 4UB0H 3FN3A 4KBPA 2WKLA 1KJVA 2VIRB 1U93B 2ZYHA 1TJGH 4PJ8A 3EJZD 3PPSA 1NJ9A 3VDBA 2AEWA 3BD4A 3WD5L 3V52L 1ORQB 4X80H 3FB5B 1VLXA 1SJVA 4XMXA 4ERSL 3AU0A 2XWJA 4CC4C 2XZQL 2WO4A 5EU5B 2FUTA 1LEIA 5CEZD 5D2LE 3QDJD 4OFQA 3CFEA 4ZFOA 5EZLA 2VR3A 2QV4A 4AJWA 5C0EB 4HS3B 1NOLA 4HAKA 2BJML 5JORA 5KVGH 2K7QA 3FUMA 2NSMA 3O6FC 1DSFH 3QEQE 5DUMH 1R34A 5HDBE 3T77A 5CCHE 1HH9B 2Z7YA 3LPOA 1S4IA 1EIBA 4FA6A 1Z9NA 3MQIA 3STZA 4CMHB 2FIRT 1BYNA 3FC8A 3NN8B 1OANA 4X9IA 1YDPA 3ZO0A 1ROWA 3GXNA 3TCLB 3UFIA 4XCCL 3UAJC 2QQKH 3EYOB 5I5JA 2NYKA 5EZIH 3LDBB 3QIUA 4CNIA 3CJJA 3LS5L 4CMMB 4ZO7A 1OARL 5F21B 3PL6C 1G7LA 1CF1A 3ZDZB 4M5SA 5EF3A 4M8UA 4M7ZC 4YBQC 3VGFA 1F11B 2D7NA 1FO0A 1A7QL 2IBZY 4JQXA 4E0RB 3VXOB 3GRWH 1F3DH 3W3BA 2D31B 4XNZB 2CO2A 1F6LL 4S11A 5J9PB 3MN8A 5DC0A 3DNKA 1OE2A 3QWOB 1T1WB 2YMOA 4YPGA 1NWPA 2GK0A 1JNJA 4FXGA 4HJGB 5I8OH 4NENB 1GAFH 4QDGA 5KBPA 1D5ZA 1CDIA 2EVFA 3MMEB 3UACA 1NBZB 3IRCA 4I3RL 5I6LA 3L95B 3ZE0B 3VI3E 1CLZH 2FGWL 4JB9H 5T5FL 2HMIC 1YHPA 2FX9L 3Q5OA 4XCEB 3TZVC 1JK8A 1ACCA 5CCKH 4Q9CA 3QAZC 3OKDA 1IBDA 5IW1A 2XKUA 4U6XB 2WWNA 4BKTC 1K85A 4Z7NB 2OX5B 1VPOL 2E7MA 4QO1B 2IDSA 3EJCA 3GSUA 4OZIE 4KVCL 1JNLH 4E9YA 4WI6A 1AZRA 2Q3XA 2BSTA 1UWXH 4DF9A 2PTTB 5HGAB 1G6VK 2I7OA 3BLKA 3PNRB 4MD0A 4M00A 4MQXD 1JV2A 2KMWA 4LU5L 4FJ6A 1QEWA 4XTRC 3M1CA 4YBLC 3GIZH 1MW0A 3WELA 1JE6A 3GBNL 2YAQA 1DE4B 2F7PA 1XL4A 2Q5BA 4KKBC 4F2EA 3HC0A 1XGUA 3X11B 1S3KH 1RJZA 1B9ZA 2PN5A 3SDDA 2P5EB 3RWIA 1QBML 3GMRA 1UWGL 2WTOA 1INQB 4FZ8L 3KJ6H 3DBSA 1JPTL 1X5IA 4HBQA 3GM8A 3TT3H 1DR9A 1MG2C 2ZOLB 4YDIH 4HKZA 2XI9A 3JWDC 1XGRB 3MLZL 4P46A 3UP1A 2YA0A 3BP6A 4MVBD 4Y8DC 3ZDXE 4XMPH 4ZMAT 1UM4H 2PPCA 3B7YA 2FYYB 2F5AL 3MTXA 2ADGA 1LK3L 2AJVL 3NIDF 3RGVC 4RVBA 3RZWA 2ZICA 4FG6C 2L7QA 4LIQE 1LQSR 5DCCA 3Q5YA 2HJLA 4GRLB 2FECL 3WKNA 5I1JH 1HK6A 1KBPA 3J07A 3PHQB 3P0VH 3AMKA 4EJ1C 2FD6L 2WYHA 4KOCA 4NQCA 6CGTA 4HHWA 3V0IA 2VQ1A 4WNQA 3ABLB 2JCCA 4DUVA 4JPKH 5TE6L 4Z3EA 4NKIH 4OUOA 2BP0A 5D2LB 2VABB 4LF3B 5F6HI 3TO2A 4C56D 1ECZA 4HXAH 1AE6H 2XWEA 1ZT1A 4HF5H 4H1LA 3QEQB 2P5PA 4ZMNA 4XNAA 5HDBB 1U8LA 2R39A 4XCNB 4BDVA 5GGRA 1L3NA 2KZBA 1GCFA 4KRLB 4C8XA 4HIXL 1L6ZA 4U1LB 4GBXA 1OTUC 5IKCA 2R1XA 4NGHH 4NP4L 5FKAA 1WFOA 3CFIC 1KB9J 2IADB 4LCUA 3SDXA 4HIJB 4QHMA 3RDTA 1DJXA 4JUSA 5DRWA 5BVJB 3S0PA 2XWTB 4OCWL 4BFJA 1EZLA 3ZPDA 1WVZA 2ZCLH 4EN3D 4DZBB 1MG3C 2Q10A 4JO5A 3E9TA 4Y4KD 4WEBL 1CLOH 1HHGA 2VDNH 4JZNB 4OY9A 4FABH 5IZ7A 3FHEA 3G5ZB 4CSSA 4DZ8B 1FL6B 3O45A 3VO0A 2PMZA 1NBYA 3M8OH 3T4YA 2CHDA 3SPJA 2DD8L 1ZVYA 4H5SB 2DOCA 2XJLA 5DZ9A 4EI5A 3I3BA 4OSUH 5DFWH 4TSBH 1FCCA 3TN0A 2CUHA 3NSJA 1DVYA 1NGPH 2G3XA 3O2WL 1L7IH 4XX1G 1KYUA 2XRAL 4KKNA 4JZOB 1DQLL 4LNRA 2NNFA 4C55A 1GS6X 3AITA 3GGWA 1XF2A 3HG1B 5CIPA 4J27A 3L3IA 3QBTB 5T3XL 1LE5A 1U21A 4L4VA 2O72A 1G6RB 1ET8A 4JM2B 3FB8B 4PS4H 2HTKD 4XX1E 4OZIB 1U8CB 2QEJA 1QMUA 3DX9A 3GSVA 4KRMB 3U4AA 4G6KH 2XACC 5IJDC 4LCVA 1DDHB 4FG4A 2ADFH 1NMAL 3LQAH 5E9DB 5JUEL 2ICWI 2GITB 4LAJH 1CD1B 4XO9A 2F19L 4P5KB 2P48B 1CUOA 1K8IB 2DQUL 3U4EB 5CEZH 1KIRB 1S9YB 2IAND 5FO7A 1NCGA 1UACL 2KDGA 3B9KD 3O2DL 1OP5K 3VG0H 3UDWC 2QGCA 3FHQA 4JG1L 4X6DE 5HVHC 1I3GH 4FULA 3TEWA 3OR7B 4JN2A 4TSAH 3DGGB 1JZFA 2DW5A 4HSAC 5BQDA 3QORB 4HMDA 4AEFA 3RDJA 1I53A 2DQJL 3IAQA 3MLXL 1ZY9A 3UC0H 5B38A 4IIZA 1E50A 5AZEH 3ZDXB 4N6RA 1S8DA 3CVDA 3TJPA 2R1YB 1AC6A 1WE5A 1RIUL 4K5LA 5IY5B 2EYRB 3B6SB 4I2XB 4N86A 5CGMA 1HKLH 1OHZA 5ESVB 1FGVL 2E9GA 3F58H 4C83B 4HUWB 1ZVSA 1OT4A 3P77A 4HUCA 2VLKB 3ME0B 4F8NA 3HW7A 2W5PA 3QJVB 4PW3A 5BMFH 3SGEH 1WS7A 3SY0A 5B8CA 3IKCB 4MNQD 3CFMA 4YSRA 3BLPX 2EICA 1JD9A 1FZOA 1WRFA 1LP9F 4Y16A 3AREB 3LZQA 5J8OA 1RVFL 4G8GA 2F1AA 3KH3A 2JIXA 3ZGHA 1GHFL 1MIEH 2JLLA 2DMKA 4PRDA 4GY4A 3WIFA 2B9AA 5IMLB 2EUVA 4ZAKB 1FZKA 4IU3A 5JZ7C 4WFFE 3GSRB 5JOFB 2HCZX 2EZ0D 2PPEA 2WO2B 2BWIA 2GW5A 3QQ3B 1BG1A 3W5MA 4LCIH 2VWEE 4P5SA 1H5BB 5D1QE 2LU5A 5KN5B 1H8SA 3RWJB 2FQFA 3DX6B 4YSQA 4AEHH 3TLRA 1KJ3H 2X0UA 2KZWA 4J2QA 2R83A 2N7AA 1PD1A 5EH1A 1HHKB 2WTPA 5EPMA 4OD3H 3K46A 3KL0A 2VDRB 1LK2A 3WNOA 3GZPA 4DKFL 3MRIA 5KS9A 4OF8A 2EADA 4OGQC 1JZJA 4WHCA 4HBCH 1WD9A 4HJIA 5LB1A 4HWBL 2Y25A 5FDWB 4RGND 3U30B 3QH3B 2P8PB 1VFMA 4JFDD 5E4IA 4WHYH 5BW7C 5SV4A 2H32A 3UTPE 5FM5M 1K5WA 3LMJL 5D5ME 4H0LC 5DI8A 1Q8MA 4KPHL 1Y07A 3DIVA 3V0WH 4W1TA 2IPUG 1M6OA 2IV9A 2K70A 1KB5H 1VZHA 2CIIB 2FO4B 1GA2A 2J8UE 3HG1D 4GMSL 3U0PB 4NN6B 5GIRB 3FO0H 1KLFB 3NZUA 3PAUA 2ZPKH 2BSRB 4JM2D 5BOPA 3L4XA 4RAVB 5D6CA 2C9XA 2J2ZB 2EO1A 5LCVA 3TVMA 3C6SB 4LAQL 2Q7YA 5E9DD 1OE3A 2X2UA 3IAGC 2WZ6A 2V3EA 1T66C 3PV7A 2EDMA 4KO6A 2H6UA 4JFFA 4WUUD 1QSED 1YEIH 4X98A 2ICEC 4L18A 2OJEA 2YRPA 2AXHA 4XMZA 4LL1A 5KVEL 2J1WA 1QLFB 3D1MC 4PMFA 2OBGA 4J1UA 4ZPVB 5ID0B 1GIGL 4Y5XB 5HDOA 3HR6A 4M5TA 4IOIB 3N5AA 2P5WA 1R5IA 4BRJA 1ZT7B 3HS0A 3NCJL 2FATL 2Z8SA 4JY5L 4NKOA 4DUWA 3V4UH 1R3KB 4TVPD 5J5EA 2VE6B 5DJCA 1NUFA 2C4FT 35C8L 2YR3A 5HYJB 4X6DB 3SGJA 2ZXCA 5HDLA 3LQAC 1QA9A 2CDFA 3HMXH 4MAZA 1NC2B 3ZHLA 4K71B 3UOAB 2G75A 4XBGA 1N5YL 5IB5B 1I85A 1IC4L 4IRZL 3H9YA 2IQ9L 4IGBA 4N0YH 4W9EC 4ZDHA 2VLKD 1H6EA 3JTSB 1Q72L 3S9DB 3OJVC 2FHFA 4NRZB 2P7TB 3HI6H 3WNIA 5E7FA 3WSQH 3L3DA 2FQDA 2K6ZA 2VO5A 4PJAA 4IW4C 3SBWA 1QSZA 2R0LH 1MLCB 2ZOTA 1JDAA 4GW4B 3SE6A 3MCYA 3TXAA 3UYRH 4BGLA 3MRHA 4B9GA 1CGSH 3NIFB 3Q5TA 1BZ7B 3U1QA 4Q4EA 3KPRB 4IRSA 4TXVB 1SLUA 1ZDSA 1G87A 4RA3A 1RJLA 2QQLH 5F96H 5GGUA 3SPIA 1SJXA 1SDDB 1VDGA 2E27H 3DUSA 1MLBB 3QJZA 5L2KB 4HX1A 5I6MA 4LDCA 4P07A 5D1QB 4LHUD 3HCVA 4JANB 4OV5A 1IBGL 2YGPA 4R4FH 4AM0Q 4TUKH 1AQDB 1MFBH 3IDYC 1G1YA 1ZANL 3MGTA 3SPVB 4UQDA 5HGBB 3ZE2F 2ZX9A 1XF5B 4ISVB 2WPGA 5DT1L 5C2BL 3TV8A 4F20A 2G9HB 3NGBC 5HGHB 5IVZB 5C9KA 3SE3A 1A7NH 2CR3A 3RFRA 3CH8A 1AYRA 5B1CA 5T33H 5LXGL 1EHLH 4KZEL 4L37B 1PEZA 1E5YA 2Q8BH 4CVZA 1TZIB 1ES0A 1WCBA 3KYNB 2UX7A 3QI9D 5JDSA 4DK3A 5D5MB 1T20A 4E9WA 2WXMA 4MD4A 1KCRL 2APFA 1F6FB 4IIQC 4U7KA 5EU6A 5BJTA 1CMOA 4ZFZB 3NP4A 4AE1A 3IS1X 1RU9L 2ZAIA 4WUKL 4NQCE 2E76C 3ETBJ 5H2BA 2Z1PA 3OJ2C 1YMMA 2HKAA 2EDBA 1WBYA 2J8UB 3RIFF 2QKIC 1HYSC 5FDYA 43C9A 5CILH 3QNZB 2A6KA 2GAZB 3T4AB 4F7CB 4LEXH 4NIKB 1S7UA 4TLKA 3QCUH 2EEFA 3BP4B 4LB8A 4MKTA 3ULVF 1VKXB 1YEKL 1AIFA 4LPTA 3PAVA 3WS6A 4L8DA 1FSKC 3EYQC 1BW8A 3AQYA 3FRPA 4LCYB 4Y4HC 3G5YB 1K8DB 1NDTA 2UXVA 3QCVL 4KRPC 1IC7L 3T04D 2H0EA 4PWGA 2R1WB 4HCRH 1I82A 5JA8B 1T4KB 4MVBC 4MMYB 3HNTH 4P5TB 1ZAGA 1S7VA 5DEGA 4N25A 1KBKA 5EU4A 4PS7A 1ZCRA 4X5WA 3VWKC 1CE1L 1NSNH 5HYJD 1IQWH 2YD0A 2Y07H 2BERA 3GD1C 2YD2A 3DV4A 1ZV5A 1K2DA 3WJMB 4MMZA 3X2QB 4OCRL 1I7UA 2ZTBA 3R4RA 4B97A 2UWEF 1PY0A 3T2NL 3VDCA 2NZ1A 25C8H 4IMKA 1PCXA 4OM0L 5JW3H 1FAIH 4ABQA 4YFLF 5GSVB 1MSPA 2NLJB 4O58L 4QHLA 2VLRE 3CVHB 1A9BB 1UQSA 4N2MA 2J72A 4G9FA 5KVFL 4X7TB 2GSGB 4NFBA 1BXXA 4L8SB 3EH1A 4LEBA 1ZIAA 3FTGB 3KLAA 4S10A 2Y7QA 2HT3C 1OF0A 1JPFA 1I8LC 1FFQA 2ZUTA 2A6JB 2UZIL 1DZBA 1XGYH 4I0PA 2G5RA 5JQ6L 2NY1D 2G2PA 5I1CH 5HI5D 4ZFFB 1J1OL 2VSMB 3KPRD 4LPUA 2VNCA 3UBFA 4LDEB 4ODBD 2QVTA 3DSFH 1MCQA 2X70B 3CDYA 4JL1A 4BFGA 2ZX7A 1Q9OB 2BY3A 4QF1B 4WWID 3BIAX 4OZGA 5E1IA 5F1NB 5L2KD 3SGDI 3GEWB 4EN3C 2J44A 1W72H 4G70B 1P6WA 4Y4KC 1MI5D 1XVSA 3FTYA 5DD6A 2W9DH 2YAMA 4BQCA 4IBSA 3BQUC 4I9WD 1CLVA 2IGFL 4NN7C 4QXUL 4K7PX 3PUCA 3PWLB 3S4SG 2XBDA 2FEDC 3GS4A 3F3HA 3WUWA 4C58B 1PS3A 3TYFA 4DJMA 1B4TA 1VEMA 3BXNB 4GP8B 3HZVB 3PUUA 5KSAB 4P99A 3AUWB 1M1XB 4YSPA 4RGOH 3DDFA 4TRPH 2IAMB 5GRVK 1X4YA 2H1XA 3D2TA 3TNNA 2QFPA 3UTPD 4KO5A 3UL4A 3MUGB 1G7JA 4JG0H 2Y69B 3U36B 4QLWA 3LKQA 4UTBA 3FO1A 1P1ZB 5CN2A 1QRNE 3V10A 2AK4E 3JWDL 3QJSB 3WEOA 3FSVA 3UX9B 5ALBL 1TXKA 1IAOA 2MEJB 2W91A 1HIML 1G9EA 3FQ2A 1MCFA 2AEQL 3KGUA 2HPOA 4AEIH 1CICA 4XPFH 2Y4SA 3BPNB 3FCTA 1I31A 1G7IA 2VDOB 3PAZA 3U0TB 4OLEA 1JHKL 4M7LL 5KBKA 1E3XA 4XB3A 3QFJA 4S1QH 3CX5K 2XTJE 3IJHA 3M07A 4MAYC 2X4UB 1OP3K 3F7VA 2VDMB 3HHSB 1EX0A 4R26L 1SJHB 2CBMA 1VAHA 4KKAC 4W4NA 4ZQKA 5K9KA 3VFRA 3VRLE 5JNYA 1AY1H 1QFWI 4PWFA 4WNSA 1AS8A 3AWGA 1CGTA 4UB0L 4XVJH 3C60D 2YO3A 1K5NA 3GMPA 3LEXA 1W8NA 1TJGL 1C8QA 2EVIA 5DTFB 5T1LA 1ZK9A 3GJEA 4FC3E 4X80L 1TIUA 3QQ9D 1IGIH 3BVUA 2F8OA 3TURA 2J5LC 2WTRA 1BIIB 2I25N 5TE7H 1B3JA 3HJ0A 1CR9L 2Q3ZA 4MMXA 4JFHD 1FRGH 1ZSDB 1ZS8A 3RWGA 4BE6A 5F7YC 2XX0A 3B4NA 3NRPA 3RB7A 5KVGL 5DUML 3BT2L 4PRHE 2VLRB 4YPJA 2BMKA 3HI5H 5BXFA 5I1DA 4TVUA 3G5VA 3X1FA 2BIPA 1LD9A 4LP8A 1HDMB 3FSAA 3RPIB 1KCWA 3EAKA 2QQKL 2NYZA 3S3PA 4D7PA 2ODIA 4OF7A 5EZIL 1NGQH 1XHHA 3VX1A 3T3MB 2RBLA 2DWEB 3K72B 1NFIA 1IAII 4PIBA 1I9JL 2ESVD 1MCLA 2MJWA 3DUHA 5BS0D 3S5LA 4GG8A 3L3OB 4HUVA 3A4DA 2OQJB 1B4LA 2C3VB 3ARDD 4W81A 4EZMA 4P2OD 3GF8A 5D71H 1Q1JL 3V5HB 5GZOA 5LDUA 4GS7B 4AITA 3L48A 1JGEB 2FO8A 5B7EA 5LNDA 1QTSA 3BPCB 4U3CA 4ZOEA 3RVVD 4C57C 2R2CA 4QRSA 4RGNC 4GKSA 5HJBA 4XMTA 2AW2A 1KELH 1RK7A 4N0UA 4HV8B 4APXA 3CH1A 1CLZL 5EULV 4JB9L 4GINA 5KSAD 2VRQA 5CCKL 1P4IL 4B5ZA 4M4RB 4ODWB 3SDYH 2NZIA 2C9QA 2FT6A 1C16A 2J57A 2RFXA 3QEGH 5EHFA 4POUB 3U82B 5EUOA 3ARBC 1X5MA 4PR5B 4K5MA 1C12B 3LIZH 4BV1A 5KOVC 3WUZA 4FNPA 2EECA 4AGLA 1JNLL 4Q14A 1A3RH 5IROC 2ALWA 3HRZA 5AALA 2WLZA 3S4SB 3SOTA 3VGDA 1WK0A 4MQ7A 4UAHA 1KGJA 4GP5B 3ULUD 1Q0XL 1OPOA 4URTB 2HSIA 3GHPA 3Q9QA 3RLSA 1U95B 4MDJB 1O9VA 1QRNB 1CIUA 1HSBA 2AK4B 3D51A 1VCBC 3D12B 9PCYA 5CJOH 2R69L 4PP1D 5FO8B 2P3YA 3PU7A 5DA0B 3SDAC 2EYSA 4NNYA 3UIYA 3VD0A 5LGHH 1DVFC 4WTZA 1RZPA 3D39A 1BYOA 1LO2L 2NY6B 1OY3B 5HHOE 2Z35A 4NXKA 2D3LA 2XUWA 2JCCF 3QRGH 4Y5VA 2XTJB 1UZ6E 1TZAA 2DIJA 1MH5A 3VFNA 5I6KA 5HHQB 1FFTB 4JO4H 1PD6A 1V7NH 3JTTB 3UTTA 2NUTB 1BFOA 2BIHA 4FFZL 2DQFB 1TLKA 3DSNB 4HGMA 1FYTB 4MX7A 4R96B 1EWHA 3N43F 1JN6A 3MFFB 2DEWX 4LLDA 4NLAA 5HHNA 2BZDA 4WJ5A 5I1JL 4ZXBA 4YSEA 2XJKA 4GG6B 3P0VL 5F7HA 3M88A 4QRQA 3AAZB 5C0IB 1XR9B 1U30A 2HG5A 1E28A 4K07A 3SDXF 1EHXA 1BZ9A 2AFNA 4LKCA 3RWHA 1WUZA 1FDLH 4J3OF 3MJ6A 4JPKL 4QWWC 3A21A 1D9KB 4V1DA 1N2RA 4LBEA 4PP2A 1J8RA 1HXMB 2IEPA 2WXKA 1OAYH 5AKSA 1D5BA 3WJLC 3A6BH 1WWAX 1LWRA 1CFNB 4L9LB 2CNZA 1A1OB 4JPIB 4HF5L 1N0LA 2GI7A 4L5FH 3X13A 3BAKA 1WT5A 3F2LA 3JWNC 3CX5J 2JJSC 4PRHB 4Y1AE 1IGML 5E70A 1QRKA 3WN5A 1DJGA 2X2YA 4HG4K 4K8RH 3I9IA 4TOYH 4X5XB 2VQUA 3B5TA 4FNQA 3TBWB 2BHFA 4YJZL 4WW1B 5EU6E 1WZKA 3WTWA 5DFVC 1YQVH 5HDQH 2KQNA 5AYUH 4FTVA 2J1KA 1YMME 2GT9A 3MRPB 3TA3A 3SGKA 3T65B 3FF8A 4F1SA 2DQGH 2ZCLL 4UQBA 1FHGA 4K7PY 5KOMC 1G5AA 3H2QA 5F93C 3VXSD 3VYOA 4FHKA 1KIUA 3HG3A 1FBIL 1CLOL 2VDNL 4FABL 5I0YA 2Y1ZA 2EDKA 4YHOL 4W9KC 3WU1A 1A65A 4GKZB 3QFDA 2CO1A 2AGJH 2AKRA 1H0DA 1PZ2A 3MJ9A 2YWYA 3Q1SH 4XNQA 5D1ZI 5HI3C 3WMQA 1YN6B 1MIMH 4M3HA 1P4BH 2RHEA 1KCVL 3CC5A 4HOWA 4R97C 4CC4A 4XVUC 4JVWA 2XFGB 2CK0L 4WWKD 3TEZA 1RULH 4FKHA 3LPGA 3CQQA 1L7IL 5EEVA 5J1AB 2Z92B 2I5YH 1MCPH 3ZKSD 5JMOC 1OTSD 3BW9A 4YEFA 1K4CB 2IH8A 3O6FA 4FQQA 3CSFA 2CLRA 4FHJA 5AD0B 1HWGB 1JP5A 4H0GA 3DJSA 2IF7A 1ZGLB 4G6KL 3UAJA 1W6WA 4P4KC 1JGLH 2ADFL 1LEKB 2OR9H 1A6AB 2YPVH 2APVA 5HYQA 4S1DC 5EFIA 4APQC 1YECH 1SDYA 2N4IA 3CXDL 1IKFL 2YSSA 5CEZL 1ADQH 2NR6D 4LVHB 4MJ4A 3QEHA 3NJJA 2J21A 2JJVA 3K1KC 4OJYA 5CLXA 1CFTA 5DRZB 5HHVH 3BAEL 1FNFA 2N0KA 1XEDA 3ARGC 3KS0H 5DZNA 3AS0A 4FL4B 2ZF9A 2X87A 2OZNA 4YHZH 4TSAL 1PPIA 3T0WA 5HHOB 1I7ZB 1YA5A 1BLIA 7FABH 3NG5A 2X4PB 1RHFA 3KD4A 3LTVA 4OKDA 1FYTD 1GH7A 2HVJB 3F83A 3UC0L 4OZGE 1M42A 5AZEL 2A6IA 4M61A 4NCC1 5EUKB 3QDMA 2IPTL 4V2CB 1HKLL 3GO1H 1UZ8A 3EOAA 5I66A 3TZVA 3F58L 4A6YB 2A9DA 1BX2B 1TJHH 2WINB 3VI4B 1I8AA 5KWYC 1RJCA 4NZUH 1GZPA 1FV1B 3FYIB 4S0TD 4BZ1L 3MI6A 1MCJA 3GBMH 4LRNH 3OGCB 4NPKA 1BZQK 5EZPA 2NY1C 2Y24A 1R1CA 1SMAA 1T5WB 3NQIA 5BRZA 1JDCA 2F7OA 5IJKC 3AU1B 3U2SA 2Q7AA 3WIAA 4Z8FL 2Y6SC 3LZFH 3S88H 4YGVB 1E9OB 2VC2B 4LSQL 3LX9A 3JTBA 3CDGA 4RSYA 3TBYB 2NY3D 4Y1AB 3IDJB 4TSCL 1JGUH 1I9RH 4ILDA 3HLKA 3FS9A 3A6OA 2YC1B 4AEHL 3JUYA 1KJ3L 3VGHA 5BOJA 4XCFL 3EUDA 5KW9H 1U8QB 1X7QA 4PM1A 4NM8H 3GSWA 5CBEA 1A14H 4OD3L 2VN4A 4X5RA 5IOKA 4O00A 1J8KA 1FVEB 3FOMB 1XDTT 4N28A 4XOCA 3UEZA 4X4XB 4K8RC 4G8EB 3RI5K 3FO9A 3GJFA 1YUHB 1OWWA 2GJZA 5ITFB 4M62L 1QATA 1M2VA 2LR4A 1S5IH 3IGAA 3RGVA 2DIEA 2GIYA 2NY5C 3BGAA 4O4YH 1FQ9C 2QKSA 3NEOA 1C7TA 4S1RH 1CK0H 1TMCB 4IBLT 3V0WL 2BM3A 3F64A 3D69A 3N42B 2ZWNA 1U8MA 1KB5L 4AJ0A 3WNLA 2A73A 2ENPA 1BZEA 2MOGA 2EC9U 5E8DH 3GZOA 5B4MC 2XYCA 4HG4J 1K3IA 4HIIA 3DWTA 4BSVB 2F53E 3D0VB 4J3VA 3V79C 3BVVA 1BJ1H 2ZOUA 1URIA 1L5GB 4LP5A 1UWFA 3PG2A 3LKPA 5E00A 3S2AA 3CBJB 4R3SB 4TS6A 4ZJ9A 4FYQA 5GSRA 5C0DA 4JRWA 3R0NA 3SD2A 4CSTA 3GB7A 1YEIL 1NMCC 3MRGB 4WO4A 3S8WA 4DK6A 3BDXA 1JAEA 5FYJH 5D9SB 4AQ8C 2VL4A 5E95B 1QBAA 3HAEH 4X9GA 4AIZA 3F7LA 2FJSA 3H7BB 1EHAA 1KTDA 4RZKA 5IESH 2DRUA 5DQDH 3CVIH 4EDXA 4DGWC 5ACZB 3WTVA 3V4UL 5BQ7B 5KANI 4X6BB 3C60C 1SN2A 1JD7A 3ISWA 4S0HA 2HFTA 2MKWA 1CVSC 4PJAF 3GSOB 2DKMA 1TVDA 5CBAB 1BQLH 3TT1H 4X9HA 2ZCKL 1G4RA 3QQ9C 2CCWA 4QCIA 5MEPB 3H9HB 5LWYL 2VLLA 4WTQA 4KNSA 5MEQB 1BIHA 2HXAA 3V4VB 3UG3A 4D8PA 2O61A 3GRWA 4RH4A 3LEYL 1Q4NX 5BZZA 4L1DA 1NFKA 4LGRB 4Q6IC 2HLAA 2WXIA 1NLDH 1PAZA 2YSTA 4BBWA 4XXWC 2XQYG 3KS0J 5EBLB 3FCSA 5E6ID 5I19L 1JXDA 3MOQA 3VFMB 4U1SA 4YFLI 1PCSA 4XXCC 5BCAA 1U3HA 5AUMA 2EIBA 2WLYA 3NEEA 4UQ2B 1XIWB 5TE4L 3UYRL 3SIKA 2BHZA 2PW2B 2Y36H 1AS6A 1NDMA 5F9WC 1SUJA 2H41A 4D0BB 1F4WH 2AQNA 1VRSA 2QQLL 4JHAH 2EIZA 2BP5M 5FXCH 3T6VA 4M93B 3EOTL 2E3VA 1SEQH 3MNWB 2F08A 3EZJB 3H3PH 5DMKB 4Y19E 4KUZH 3QR0A 5IVXA 2UXFA 3VFTB 2XG5B 3WY2A 4ZW7A 1PEWA 2J12B 3CHSA 3MUY1 3O6LH 4R4FL 3FKUS 4TUKL 4U6YA 3RVVC 1LO0L 5J6HA 2Q20A 1MFBL 1AP2A 1JV5A 1Y6NR 2LT9A 4NN5C 3CFKB 3MOAL 1CU4H 5T5NF 2YBGA 2ZQKA 5I8EB 1CDBA 5I24A 1MFDH 4KZCA 3B9DA 3E38A 2E56A 1A7NL 2J6EA 4HUXA 5T33L 4YDLC 1EHLL 1A1MA 3QJFA 4NSKB 3UYOD 2MHAB 4NB7A 4HJ1A 4NWTH 3BN9C 4OFYD 1PLGH 2CJSA 2D8KA 4UU9B 1MJJA 5D7LD 1MWAB 1U2HA 4WI9A 3QPXL 3BWUC 3DRQB 4IBVA 3A3YB 4Z6AT 5CN1A 4ZPTB 4QXTB 4OT1L 4WI8A 2ICCA 3HE7A 2MQGA 3HJEA 4YDNA 4AG4L 4CBPA 4DP1X 4D9RE 5IB1B 4O02B 1YNTA 2F53B 3NDZE 5EOQH 1E6OH 2WIMA 3MRRB 4HKBB 5LBSL 2P47B 1IGJB 3QCUL 2ZKMX 4GRMB 5GRXG 4QXGH 3SPHA 3W39B 5EU3B 2HRPH 3DARA 3FFOA 2QPEB 5IGXH 3MUJA 2R29A 4PV1C 5CLTA 5JIKA 3CHRA 1EUUA 2A0LD 1IC0A 2XG4B 4UT9H 5A2BA 2IH1A 1VADA 4F1ZA 1XB6A 4IRJD 3I2CL 2Y07L 1DANU 1KLGA 4AGQA 1UM5L 4FTVE 5FECB 4MNGA 3TJHD 1WAAA 4HHAA 4RMBA 2QGDA 3CZNA 4PS8A 4ZOBA 4QRFA 5DJAB 1X9RA 5FFGA 4N2NA 3WXVL 1ZWIB 2F74B 2Z4QB 5JW3L 2B0SH 4MAUH 2YBRB 2X1WL 3PYCA 3C6LC 4XXDB 1F4AA 2WYIA 4IQHA 1UXWB 2RCSH 4N9GB 4PJHE 5JO5B 3N41F 3T2LA 1I1CA 5B3JE 2E7HA 1XGYL 1XGPA 2DF3A 1U3YA 2XQBL 2A9BA 2BY0A 4A68A 2BOCB 4WIQA 4XE0A 4XAKE 1CD0A 4GRWF 1LP9E 3TH4T 1KCSH 2IQAB 5KVDE 2Z93B 4U1HA 5ISZA 1JVOA 2ICEA 1RUPL 3MLTA 5J0BA 2Y3AA 4F15C 3AXIA 3NJXA 3Q8AA 4W68A 1MOEA 4XAWH 4TLTA 5E2WH 3O3DB 1SMOA 3RKDD 1CE6B 4FX5A 3C87A 1SXZA 4MJIA 1ECYA 5GGQH 2W9DL 3U1SL 1A3QA 4Z7OE 3QG6A 4XVSH 1NGZB 4P57A 4J8RA 3KCPA 4NQSB 3EUUA 1ITBB 3PP3H 4Y19B 1IL1A 1RERA 3IJEA 2AVFA 3PQYD 1XSIA 3L9RB 2YWZA 2YHGA 1BWWA 3VYPA 5JHMA 3P4OB 2O5YL 1DO6A 4RGOL 1YN7A 4TRPL 1H3UA 3OR6B 3C5JB 3EBGA 4JG0L 2EKJA 4KNQA 4K3EL 4I5BB 5IBUG 1H3XA 5F3BB 5K9JH 5MEOB 2WZ5A 4HUMB 1SY6A 1XH3B 5SWSD 4A7UA 2CGRH 3CZUB 3QDME 4O9HH 3SKOB 4AZ8B 1HEZA 1EJ6A 1TVBA 1WWBX 4TVPL 1DVSA 1O6SB 3B3IB 3GIVB 5GISH 4PV9B 4M7JH 5C0JA 3T5WA 5C3TA 2BVUA 4EZLA 5J7CC 1CT8B 3QNXA 2B4CH 2DBLH 1OGAD 2XPYA 1TU2A 2N0MA 4XP9L 4YO0B 3MRDB 3U6RA 2CO7A 2VDQH 4X8JB 1G5GA 5DFTA 5IQLA 2FT7A 1MEXL 4B53A 1BLNB 4NUJB 5EO0A 4S1QL 1QNZH 1ZD6A 3KWVA 4LCWA 4TKWA 3IDMA 1G9NH 2AJSH 1LE9B 4HISA 3INUH 3WS3B 3AC0A 5FWRA 3W56A 3BZFA 1PDKA 1AY1L 4HLZH 4XNYH 4BKLB 4MA7H 2OS7A 1M6UA 1QKZH 2OTWA 3BGMA 4XVJL 1DQTA 4XNMB 1KJ2L 4FE9A 2X4RA 1U33A 3NDYE 2IDCA 4BFKA 2KHAA 2QLVB 2NZ9D 5DJ8A 3BHBB 3EBHA 1FG9C 2FJGB 4A66A 5JPNB 1IGIL 2NUPA 4EZJA 1I8KB 3GXPA 4HJTA 2AEOA 4QHPA 3K2KA 5CD5D 2Z8VC 3OF6A 1M3JA 4YNYB 5TE7L 3LKSA 2QFRA 5TH2B 1ERNA 3DROA 4NHUB 5D7JC 5FGBA 1H15A 3EGDB 4FTDA 5D70H 4Y9BA 1ZGLP 4KFZC 4P3DB 3U2JA 4OLVL 2WN2A 3VM5A 3VWJC 4CSZA 4J4PC 3HI5L 4M7KH 4WI4A 1Y0LB 2WVVB 2VJ8A 4GMTL 5E8OA 1OV8A 4CC0A 4Q52A 4CC1A 2Y22A 4AEEA 4BFBD 1AGFB 2EKSB 2IH3A 4L2LA 1W80A 4X6EA 4P23C 3LV3B 4PJHB 5I6NA 3GBEA 5DK3A 3QUMB 2W07A 3KNBB 1QEXA 3JV4B 3NCWA 5ECGA 1J5DA 3UZVA 1CTOA 1Y6MR 5E2UH 1A9VA 2X10A 3F8UB 5I5RA 5A2AA 3M17A 1LP9B 3VFWA 4Y4HA 3SKUD 2Q76A 4X5QA 2DQCL 1HWHB 3QZWG 4M7LT 5D71L 2OMBA 2OZ4L 4ZUUB 1H8OA 3K91A 4L9DA 1ULVA 4ZNCD 1B90A 1F3JA 4UTAL 3SB3A 2H8PA 1TTGA 3FL7A 4AQ1B 4IS6B 3VWKA 5G4NA 2YEZA 3KGTA 4FF9A 4LGPB 4KNTA 2ICES 2V7NA 3QXAA 4DP8X 3CZFA 3KDPB 1G7QB 2HRHA 5B3SB 1JZGA 4G82A 1UUNA 3GS7A 3DECA 5BZDA 4PVNA 2DYSB 5E94B 2ZP9A 2FSDA 4IKIA 3II1A 5I82A 4WDIB 3MRLA 1EFXD 1I1FB 2EYTB 1B2WH 2HLEB 3Q8CA 3OZ9H 3RVTC 3S3SA 5HPMB 5ANHA 3B1TA 3VRJB 4IOSD 2VUYA 2YAOA 2BVYA 4DVBA 3IXAB 1IC5L 1KXVA 4PLJC 5GZNA 5FR3A 2PR4L 3ABGA 3L54A 2ZP0T 5I71B 3HMXA 2FJFA 4PGBA 4JJOA 5TK4A 2X4SA 1GCYA 1EXGA 1I4FA 1IFRA 1T3FA 3QUHA 3QIBC 2EIMB 5IBUB 4X4ZA 4F92B 5LGHL 2BLFA 1QACA 3CD4A 4X5PA 4MB3A 2EC9T 2WLMA 4NJAH 1JYXA 1TJIH 3KBFA 1BBJB 4U31A 1BVZA 4MD5B 4Q6KA 5ERWB 1U8IA 2OMZA 3O4OB 2WSKA 2MRYA 2P8LA 3T0VA 2IAAC 1OW0A 1V7NL 3HNVL 4JY6B 1U6AH 2LTQB 2W1NA 3FH5A 4GLRI 3KPMA 1U91B 2H5UA 3RHWK 3FT4A 2B4CC 4P49A 3KYKL 1RZKH 4QOKD 3F05A 4MSWB 3GI9L 4Y7MA 4JG9A 1UH3A 1WBXA 3CFDB 4OFDA 2NY2D 4XWGL 1G9NC 3AG1B 5AOKA 5IVXE 3D3VD 3V55A 1KWKA 1OCCB 1T83A 3T8VA 2O5NA 1NOFA 5JXED 1JCVA 4O51B 3ATEA 3PJNA 4J3WA 5IMKB 3QO0A 3RWEB 5IT2H 4JM0A 2QHRL 2K4WA 4OGXH 3SGDH 1OAYL 3VM7A 2ITCB 3WOVA 2WBJB 2AJUL 4Z76A 3S2CA 1U58B 4M02A 4ZTOL 4F2MA 1NCUA 3QWRA 4MNHA 4PJ9B 3RFZC 1QWUA 3EFFB 4NZ8A 3IETB 1O75A 4KK8C 1T1XA 4I1RA 1MCWW 5SX4I 1I8IA 4AH2B 2P8MB 3D09A 3DJZA 4YLCA 4V11A 2NY5L 4D9QD 2V3DA 4OLXL 3H2WA 1R4XA 3BH9B 2VB5A 4MAYA 3CFCL 5AYUL 1ID5I 4RMWA 4FNUA 3UADA 1HI6A 4Z7UA 3ZSSA 1IZJA 1X3DA 3D08A 1R5VA 4LLUB 4MA1C 3MACH 1XF1A 1AO7E 4ZS7H 1BJ8A 1P0SE 1XWVA 3UTQA 3WKYA 4AQOA 4MJ6B 1X5ZA 1OAZH 3QJUB 1MWOA 2AGJL 3GSQA 3Q1SL 1ZLUK 2CHZA 3L4YA