4PIMA

Ergothioneine-biosynthetic methyltransferase egtd, apo form
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
322
structure length
322
Chain Sequence
HMALSLANYLAADSAAEALRRDVRAGLTATQKSLPPKWFYDAVGSDLFDQITRLPEYYPTRTEAQILRTRSAEIISAAGADTLVELGSGTSEKTRMLLDAMRDAELLRRFIPFDVDAGVLRSAGAAIGAEYPGIEIDAVCGDFEEHLGKIPHVGRRLVVFLGSTIGNLTPAPRAEFLSTLADTLQPGDSLLLGTDLVKDTGRLVRAYDDAAGVTAAFNRNVLAVVNRELSADFDLDAFEHVAKWNSDEERIEMWLRARTAQHVRVAALDLEVDFAAGEEMLTEVSCKFRPENVVAELAEAGLRQTHWWTDPAGDFGLSLAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine-specific methyltransferase EgtD
publication title Ergothioneine Biosynthetic Methyltransferase EgtD Reveals the Structural Basis of Aromatic Amino Acid Betaine Biosynthesis.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 110
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature ec 2.1.1.44: L-histidine N(alpha)-methyltransferase.
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10017 Methyltransf_33 Histidine-specific methyltransferase, SAM-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pimA01
3KR9A 3G88A 1L1EA 2AOVA 3EVGA 4PIPA 2NXJA 4YV2A 2G70A 3LX6A 5CVUA 5EVJA 1SKMA 3G2OA 3GCZA 1QZZA 4YV1A 1RI2A 3F4KA 2O05A 1YB2A 4ER6A 1R00A 3V8VA 5LQJA 4GC5A 5FWAA 2P40A 5JUWA 3GGDA 5DM2A 4DMGA 2C7QA 2BM8A 5CCBA 2ZTHA 5GINE 3HCBA 3DH0A 4AZWA 5HEKA 1G55A 1EAMA 1HMYA 1VP3A 3A25A 3GIWA 1G8AA 2ZWAA 1X1BA 1B42A 2BZGA 3KQPA 3UA4A 5FULA 1IY9A 3CJTA 2FHPA 3EMBA 3KQMA 4PONA 5GWXA 3E05A 2PXXA 3OCJA 3MAGA 10MHA 2HNKA 3HVIA 5ERGB 5F2NA 2F8LA 1N7IA 9MHTA 2IBTA 3M33A 1QAQA 3HNRA 4E30A 4G56A 3ER9A 5HOQA 1XDZA 5DT2A 5K0JA 3HVKA 4HSGA 2ZCJA 4F86A 5KS2A 2JH9A 4KDRA 3DUWA 4K6MA 5D1HA 3TFWA 1EJ6A 4QVKA 2PXCA 1O9GA 2NYUA 4OBWA 5E2AA 4RTSA 2B9EA 3KQQA 2P8JA 2B3TA 2P41A 5K0LA 5JR3A 4A6EA 2OO3A 4U7PB 3T7TA 1RI4A 5ICCA 5E8RA 2Y1WA 3M6UA 3DLIA 4QDKA 2YR0A 3NTVA 5EMLA 2NXNA 4FGZA 2G8NA 3R6TA 1VBFA 4RTQA 4PYOA 4RTLA 4EKIA 2Y1XA 4CTJA 4DCGA 4DF3A 4XUCA 3LL7A 3A26A 1RJFA 3Q87B 4GBED 1L3BA 3OZTA 2WK1A 2IGTA 3X0DA 3O4FA 3KPYA 8MHTA 2CMHA 3NJRA 4KIFA 4IV8A 1KXZA 3UJBA 5LQRA 1FP1D 5KYGA 4CXMA 2B78A 3B3GA 3PB3A 4Z2YA 1Q0SA 3KPUA 5EOVA 3UA3A 3UJCA 2ZVJA 4QDJA 2ZSUA 5F2KA 4YUWA 1SUSA 1VPTA 2LD4A 3AXSA 1QAOA 3TRKA 3EVZA 4EQZA 3JWHA 5K03A 5FA5A 1V39A 4GOMD 4PYQA 3TM5A 5DXJA 1XTPA 3T0IA 3SVZA 3FRHA 1NW6A 3GRVA 3BKWA 5DWQA 1N7JA 2K4MA 1X1AA 1YZHA 3FYDA 2HMYB 1ZG3A 5E1BA 2B2CA 2YQZA 5ICFA 3NVMB 2AR0A 4BP1A 3AJDA 3LPMA 4Y30A 3BWYA 3H2BA 3GXOA 5DM0A 3KHKA 2VZ9A 5HZMA 3ORHA 1AF7A 2C7PA 3FTFA 4ER3A 1SVUA 3G8AA 3CVOA 3FTDA 1KR5A 5K0NA 3ERCA 4BP3A 3G89A 3C3YA 2G71A 5ICGA 1WXXA 2CMGA 2PX8A 2DPMA 1TW2A 4XUDA 3P9NA 2OXTA 1EG2A 2OB1A 2GPYA 4BLWA 2AS0A 3C3PA 1XVAA 3FPFA 3BWCA 4RTNA 5K09A 1XDUA 5K0BA 2PBFA 5B1SA 2H00A 3P9IA 5LSAA 1H1DA 2ZFUA 4M7RA 3FUUA 4C03A 5DM1A 2Z6QA 3MHTA 4PIMA 4O29A 3GRUA 4HH4A 2BR4A 2AN3A 3A7EA 3KPJA 1R8XA 1RJDA 4L7VA 5G02A 3UJDA 2PWPA 2FK7A 4IV0A 1INLA 2NP6A 2B25A 2GB4A 2QM3A 2VDUE 4KW7A 5C9ZA 5K8VA 2VDWA 5E1OA 4QTTB 1KPIA 1TPYA 3FTEA 4F84A 3KQVA 1FBNA 1YZ3A 1X1DA 2P7HA 2XYQA 2AZTA 3K6RA 4QQKA 4XCXA 4PCAA 1KHHA 4QVGA 1PRYA 1ZGAA 2IIPA 2AOTA 3M70A 3NMUF 2FCAA 4GEKA 3R24A 3SM3A 1WG8A 3KU1A 5GIPE 1WXWA 3JWGA 1ZHFA 1F3LA 1YFLA 3HA3A 4DM3A 1QYRA 2ZIEA 3E7PA 3ELUA 3PFHA 4M38A 3ELYA 5EMJA 4PNEA 4PWYA 3M6XA 3TLJA 1XCLA 1P1BA 3CKKA 1UWVA 4P7JA 3LDUA 5EHGA 2UYQA 4HC4A 5F2OA 3UFBA 3O31A 2EJUA 4AX8A 2P3LA 3LECA 1QAMA 5KVAA 3BWBA 2O0LA 1KP9A 5CIYA 2PT6A 2YXDA 3P8ZA 2NXEA 3B5IA 4HGYA 5FTWA 1R6AA 3GNLA 3LDGA 3O7WA 4ISCA 4C05A 1UIRA 3FZGA 4POOA 4PYKA 4RTPA 2BR3A 1RJGA 2IFTA 5CD1A 4RTOA 4PGGA 2YUIA 1O9HA 3EGEA 2I9KA 1JSXA 3MGGA 1NW7A 2O57A 2IH5A 4FS8A 3EVDA 5EEGA 1DCTA 4LWOA 4PCLA 1VE3A 2A14A 3KKZA 4PGHA 2FYTA 1ZGJA 4RVGA 5DXAA 1NW8A 2ZBRA 5HIIA 4UOEA 5BP7A 2AVDA 3BGIA 2HV9A 3KQOA 4QTUB 5EHIA 3GO4A 3KPVA 3EMDA 3VSEA 4X1OA 2C7RA 4F85A 1T43A 4Y2HA 3HA7A 4X63A 4P7KA 5U4XA 2ZZNA 3T7RA 4MWZA 1SQFA 1P91A 2XVMA 2O06A 3BXOA 2BR5A 4GUAA 1JQDA 2EX4A 2PVCA 3LDFA 3QOWA 1G8SA 4HTFA 1SG9A 4PINA 4X61A 4MTLA 3AWIA 3DXYA 4OA5A 3MCZA 1WY7A 3AY0A 3OE4A 5FHQA 2V74B 1NW5A 3TOSA 5LQAA 2KW5A 2OYRA 2ADMA 5CVJA 4OBXA 1JTEA 1L3IA 2P3QA 2UYOA 1I1NA 3B7PA 2HTEA 3KQYA 5CM2Z 5E9QA 5HIJA 1UFKA 2OY0A 3ME5A 4RVDA 3FUTA 5DSXA 5E1DA 2HWKA 3G5LA 5FA8A 5K0GA 1U2ZA 1Q0TA 4KVZA 1ORHA 3UJAA 4R05A 3B3FA 5EGSA 2PT9A 1VP9A 5FCDA 3SR4A 3G5TA 4KIGA 1EJ0A 3VYWA 4H0NA 3B89A 4R6WA 2ONZA 4R6XA 1M6YA 5IH3A 4GOLD 5HFJA 2OKCA 1MJFA 1JSZA 2QE6A 2ZLBA 3EPPA 3KR0A 1OR8A 3DLCA 2CWWA 2GH1A 5DX0A 5EZQA 3LHDA 3IHTA 1R8YA 3LCUA 4AZTA 5K05A 3UWPA 3P97A 4C06A 3FUXA 4GF5A 3E8SA 3FPEA 5HIKA 1I4WA 4P7GA 3PVCA 3NDIA 4MHTA 4YMGA 1QANA 3I58A 5DSTA 3R3HA 1P1CA 2ZBQA 5E2BA 1VL5A 3P2EA 2ORED 5FQOA 2YXLA 1PJZA 1JG4A 1WZNA 3OFJA 3FPJA 3PFGA 1VLMA 4NECA 3A4TA 4ER0A 3TKAA 3ID6C 2AN5A 2Q41A 3OZRA 3TPZA 4R8RA 1HNNA 4XUEA 1NV9A 2PX4A 3OFKA 3M6WA 2ZIGA 2JG3A 2EFJA 2H1RA 1XDSA 3JWJA 3OPNA 4M36A 4P58A 4CKBA 3SSOA 5IKMA 2V7EA 5K0CA 3KR1A 2ZZKA 3EVFA 5FWDA 1X1CA 5T67A 4E32A 1KPGA 3DP7A 3THSA 3CCFA 3LBFA 3NW9A 5GM2A 1L9KA 2XYVA 3ELDA 3I9FA 5CVVA 4AZSA 5C1IA 5K0EA 5M5BA 2IBSA 3EVEA 5HIMA 1JG1A 3C6KA 3UJ8A 1BOOA 3BT7A 1TW3A 2YX1A 1IM8A 3HEMA 3UZUA 3EGVA 1D2CA 3D2LA 2C7OA 3NWEA 2H11A 2UYHA 1VQ1A 5D1NA 2YXEA 1XJ5A 4OA8A 1MHTA 3BGVA 3PTAA 1YF3A 2I6GA 1FPQA 4OQDA 4DKJA 3FPHA 4CKEA 1I9GA 5EEHA 1FJXA 2JHAA 2AN4A 5EQJB 3R0QA 4EK9A 1YUBA 3G2PA 3TQSA 3OU7A 1AQJA 3GRRA 2PY6A 1X19A 1G6Q1 4RVFA 2QY6A 2QYOA 2PX2A 2YVLA 1KYZA 4HGZA 3CBGA 2GS9A 1BC5A 5DPMA 4ER7A 2PLWA 2OPBA 4GQBA 4E2YA 5T6BA 4E2WA 4B17A 3K0BA 5DX1A 3LCCA 3G7UA 3DOUA 5DLYA 3EEOA 2PXAA 1NE2A 2ERCA 3HCFA 4RTRA 4FZVA 5T64A 4ER5A 5K01A 3DTNA 5CUQA 4KRGA 4DZRA 5DTMA 1BKYA 3P9KA 4R8SA 2EJTA 2JHPA 5HILA 3SXJA 3T7SA 2AOWA 4DQ0A 2E5WA 2I7CA 4RV9A 2UZ4A 2YTZA 5EPEA 4U7TB 3RODA 3SMQA 4ZTBA 2ZZMA 3OU6A 2G72A 2CKDA 3LGAA 3PS9A 1JQ3A 3UJ7A 2QRVA 5FADA 3P9CA 4LWPA 3FTCA 5EMMA 3RIEA 4C04A 2IH2A 2XBMA 1VIDA 4GOND 2AOTB 2FRXA 5LQKA 3NVKI 2P3OA 4AUKA 3EVAA 3HVHA 3KQTA 3MTIA 4MIKA 2NNWB 1Y8CA 2ESRA 2FPOA 3OE5A 3SGLA 3HP7A 3BZBA 4PYMA 2PX5A 2VDVE 4E70A 1NT2A 2NXCA 4X41A 3HCAA 3WSTA 5DRYA 2VP3A 4KDCA 4EKGA 4V0QA 2IPXA 2I62A 3U81A 2FK8A 2PGXA 4E2ZA 7MHTA 2ZIFA 1KYWA 4PYLA 1JTFA 2IDJA 3EEYA 5EKXA 1AV6A 3LCVB 1DL5A 3ANXA 3TM4A 2OBFA 3BKXA 5EG5A 3GDHA 2QRVB 5E1MA 3HVJA 2IH4A 3IV6A 5P8WA 2ZW9A 4V0RA 3MERA 3OZSA 1D2GA 1KIAA 3NWBA 4WXHA 2P35A 3TR6A 4LECA 4YUZA 4LG1A 2N47A 3FUVA 4FSXA 1WS6A 4GC9A 4YUYA 3SSMA 3P2KA 3DXXA 3DULA 2HR1A 3BWMA 2OB2A 1RI5A 3MCTA 4YUVA 1FP2A 3DR5A 3M4XA 2JHCA 1SUIA 1RI3A 1ZKDA 3LSTA 4DA4A 3SX0A 1JG3A 1NBHA 2PWYA 5GOZA 3CJRA 4RVHA 4CWAA 1ZQ9A 3GU3A 4OQEA 3PT9A 4AZVA 3E23A 4JXJA 4RWZA 5FUBA 1Z3CA 3LKDA 2EG5A 4GOOD 4IWNA 1JR4A 2WA1A 4HTFB 5DTRA 1XCJA 4QPNA 5EIFA 4FSDA 3KQSA 3G2MA 4DCMA 3B3JA 4E33A 5KQRA 1IXKA 3UJ6A 3KPWA 3REOA 3C0KA 2XVAA 2P1DA 5LR6A 3HTXA 1M0EA 3QOXA 4FT2A 3FUWA 5CVEA 2ZWVA 1YFJA 2PV0A 3FPGA 2GLUA 3AXTA 3UJ9A 3UBTA 2DULA 3LKZA 3PX2A 4P7FA 3I64A 1M6EX 3IEIA 2OZVA 1F38A 3OU2A 5MHTA 1G60A 3CGGA 5GP1A 3GWZA 4OX9Y 1ORIA 4E31A 4RTMA 3P2IA 2AVNA 1R74A 3A27A 3HCEA 3I5UA 5FHRA 3RW9A 3THRA 4EMSA 1NKVA 4CKCA 3BUSA 4PYNA 5LQUA 2UYCA 1KPHA 5GIOE 2PSSA 3EGIA 3SSNA 4ATNA 4E2XA 5DX8A 3LBYA 3VC2A 2NP7A 3G2QA 3G8BA 5CCXA 2GAFA 1N2XA 3KR2A 4RTJA 1JQEA 4A6DA 4HRAA 2Z6UA 4IKPA 5BXYA 4YV0A 5E9JA 3PX3A 3ELWA 5EMKA 3DMGA 4CTKA 2JJQA 1EQAA 2IDKA 2O07A 2PKWA 3GRZA 3MQ2A 5BW4A 4BLVA 1L3CA 3IYLW 4RTKA 1NW3A 5DRTA 3HA5A 1P39A 3EVBA 3TKYA 1D2HA 3V97A 3HCDA 3BGDA 2GA9A 5FQNA 4YMHA 2Z6AA 2XYRA 4MQ4A 5ICEA 1G38A 1JG2A 5E8JA 4BY9E 5EZSA 3ER8A 2AOUA 3M6VA 1BHJA 4EVIA 2BM9A 2R6ZA 1R18A 3L8DA 4X60A 2JH8A 3GRYA 3QV2A 5H02A 1O54A 4C4AA 2WA2A 5KQSA 2G1PA 1AQIA 1DUSA 3C6MA 1NBIA 3MTEA 3NDJA 5GM1A 4PYJA 2PJDA 2BH2A 2ZBPA 5E9WA 4RYLA 2CL5A 4QQNA 4FT4A 3DMFA 2ZULA 4RX1A 2AOXA 3KQWA 4WVLA 4FP9A 3Q7EA 3S68A 1RJEA 2IP2A 4M37A 3DXZA 3FRIA 3A7DA 4RSRA 3JWIA 3DMHA 4C07A 5K0FA 3R9XB 5EIWA 3HCCA 3VC1A 3GJYA 4KWCA 3EVCA 3MB5A 2ONYA 5CVDA 5DM4A 3TMAA 4HG2A 3I53A 5BW5A 4QPPA 5DTQA 5EC8A 4BLUA 4YUXA 5C0OE 2AOUB 3P71T 4PYIA 1SQGA 3CC8A 3HM2A 4FR0A 1XXLA 1RI1A 2P7IA 4C08A 1EIZA 5EKUA 5LQCA 1NV8A 3FYCA 2R3SA 3PLAE 5LQNA 2VS1A 3CJQA
chains in the Genus database with same CATH superfamily
1NZJA 1GTMA 2CBXA 1TYEB 4OJNA 4TKZA 2O2IA 2VAPA 2ZYTX 4XQCA 3CNEA 1YR8A 4YJHA 2ATCA 3CVVA 1NOKA 4GYKA 3U4AA 4QVIA 1I2BA 1I4OA 4HS4A 5A9SA 1DRKA 4MQBA 3SD7A 1GRNA 1I30A 4UTRA 3OIGA 3IDQA 1GGNA 1JIKA 2JGAA 1YC2A 2ZDQA 1HZJA 3DFIA 4GC5A 5AJHA 3RAGA 3ZGYA 2BKXA 3ZWYA 4A8JC 3IKTA 1OPXA 2W2MA 1ULZA 1GITA 5GINE 3ONVA 1DOAA 1J8QA 3BXXA 3LJKA 3JR7A 3O8LA 4BQFA 1KJ8A 4BNDA 3KOWA 1JFFB 1GOTA 4AWAA 1XL0A 2NWQA 4F4DA 1CUGA 2ZPTX 2AFHB 2DAPA 1C2YA 4TUYA 4XFJA 3G5MA 1RRGA 1NY5A 1O94A 4FBLA 4MR7A 2IE0A 5KSWB 2VXBA 2I6FA 3O8OA 1D0IA 4FX5A 1F60A 2B7BA 3N2KB 3NT4A 4IX1A 4UCWA 5AVKA 3KKMA 1VCNA 2NG1A 3PFCA 3OLXA 5TEVA 5FWYA 4YY3B 1M54A 2VTVA 1R15A 3UMFA 2XE8A 4ZZ1A 2WSMA 2C4VA 3VPHA 1M8FA 4RPIA 1FRNA 4C14A 1PLKA 2WB2A 4BO7A 2ZCJA 2XV1A 2X2EA 4HGRA 3TFWA 4BMVA 1P5FA 5JO0A 2GPSA 1B8UA 1DPGA 2GEFA 2IV7A 4HVTA 4W8GA 2CBZA 3O1JC 4L0MA 4M46A 4OFZA 4H2DA 3EFBA 1BAPA 1D2NA 1Y7LA 2D1FA 4O1HA 3ANSA 1P75A 4EW2A 3OJXA 721PA 2JI7A 4MVJM 2NXNA 3PVZA 5I7AA 4Z4CA 5KNDA 4CF3A 1O8CA 1N2CB 4QECA 4CTJA 1UFQA 1YRWA 2ZUFA 4D9BA 1S8OA 1HE1C 2WYUA 1NYTA 4RHXA 2G1UA 4Y6OA 2A9VA 2CMHA 3RQIA 5ITWA 1EXWA 4KIFA 4F93B 5KWEA 1PR6A 2H7YA 4LJ6A 4IRUB 3X1XA 3FIJA 1E6EA 4YJKA 5K8LA 1ST3A 2FSPA 2WINI 4O0MA 3ITDA 5JALA 1OXUA 1FE8A 4CKZA 1I4DD 5JWHA 1G21B 4OP2A 1GWNA 3LTEA 4LXTA 4N49A 4RA6A 4NY1A 2O54A 4WJLA 1JKJA 2TMGA 1LBSA 3FWHA 3GEGA 4GOKA 4URYR 3D2BA 3KTDA 1QP7A 3FBGA 2NOAA 1FTWA 1BA2A 4LVUA 2MSEB 2IZ0A 1M34B 2WOOA 3AUTA 4J3FA 2VRWA 3ZDEA 4ZYYA 2O3TA 3TB4A 4KXFB 4B9AA 1UPFA 2Q3MA 1LZLA 2W90A 2C7BA 3L18A 4UJ3A 5ICFA 3QE0A 5BV1A 3D4IA 3NVAA 2R0QC 4N03A 4DBVO 5CP8A 2UYGA 4Z7QB 4L9SA 4MQFB 3H2SA 1MIHA 1HE2A 4XB6B 4K9QA 1Z12A 4ZAYA 3COWA 3G68A 1B4DA 4ITUA 1L8LA 2YUTA 3QG5A 5IN5A 3JZIA 5CDUA 2NT3A 5AJZA 3UKJA 2PKRA 1YB6A 4JS0A 2G71A 4F5ZA 1AK1A 1P72A 3G2KA 3OBIA 3WWZA 2XMQA 2ODNA 5HHTA 1TW2A 4GVPA 2OXTA 3QXSA 1MA3A 5TQVA 2R6R1 1BWQA 3G0DA 2GK4A 3H7IA 1XDUA 4N9QA 4D6PA 5CX1A 5JH7F 3I30X 2ISSD 2YJTD 4O63O 2KLHA 2RI0A 3ZZUA 2A86A 5AK0A 3GRUA 2B20A 4EDHA 4DR3B 4FDTA 2FMUA 2PWPA 5JFTA 2JGIA 3OM9A 5EJ9A 3VMFA 5IHPA 4U9IS 2B9VA 4NULA 2FSIA 2ZDGA 5E1OA 4ZAXA 4BNYA 1C8LA 4E14A 1TEXA 3GJSA 5H7XA 1VRVA 2QQ5A 3RIYA 2XYQA 2Y66A 5HA5A 4XX1A 3H17A 4FCWA 4D4JA 4GDFA 3NMUF 2EZ4A 2JGDB 1B74A 1A8HA 1B14A 2IODA 4MMZB 1GNSA 2YJ4A 4R0NA 4V0LA 4ALIA 3NOQA 2J09A 3P27A 2ZBFA 4BP8A 4ZN6A 1ILEA 4QQRA 1Y8AA 2EKPA 2AK3A 3T5BA 1R12A 2ZI6A 3GVHA 3V7YA 2QF7A 3ZLUA 2I3DA 4KQGA 2ZRJA 4U7HA 3SEZA 4A1FA 2X5JO 2XXJA 3P2JA 4ZRNA 3RAJA 2P9CA 1PJ3A 3ZQ6A 1FYEA 1M2JA 2IUEA 4FGKA 4ILEA 4CUKA 1LPAB 4PCUA 5LNK6 4K9OA 3B1WA 3MFYA 1U5AA 2JCGA 2JJ2A 2QE7D 2UKDA 2VCHA 5IMBA 3OCUA 3TWOA 4CT4B 5AP9A 2F8MA 3M6MD 2GKGA 3AP2A 3TD6A 3UB4A 5ITVA 4Y6PA 1JBQA 4PC7A 1BW9A 2P78A 4I81A 2CFCA 2ZI9A 3AVWA 3G2JA 2ON6A 4KDEA 2N0SA 3SIXA 3VH2A 1FFDA 1VPVA 3UICA 3N58A 1UF9A 3DAYA 2QW8A 3COVA 3NORA 4MB0A 3HXPA 4P7BA 3L77A 3N87A 1BROA 3D1VA 4YMSA 1DB3A 3H5TA 2UZIR 4ZVMA 2CEAA 2CCKA 5C31A 4BVLA 2EYUA 3A9SA 4PICA 3U3XA 3NIBA 1ZI9A 3NQ41 3EWNA 4GPTA 4O1MA 4E46A 3K73O 4E7PA 1P91A 2AJCA 1U8UA 2E55A 4JWKA 4MW0A 2ZJ7A 3JQGA 2IIVA 4GUAA 2DZDA 2GEDA 2N3ZA 2HA6A 3IERA 3GAZA 1KDPA 2QMQA 3UCFA 3KOYA 1P2FA 2QTMA 4KODA 2ZJ1A 2BISA 5T6MA 3V34A 1RZRA 5T41A 3RRFA 1JPNA 2FA9A 3UK1A 3M2PA 2FZLA 1MO3A 4H6PA 3AZPA 1C30B 4WOBA 5DULA 1CK4A 4HZUA 1YU9A 3WWEA 5E9QA 5AOCA 1NI5A 2RHHA 4HWKA 4JL8A 3CPHA 4PNZA 3ASZA 1TTPB 3UJAA 3W9BA 5AJUA 1G7RA 4V0SA 2JC3A 2YIMA 2H0RA 4PC3A 3S1AA 1LNZA 5KPJA 1F9AA 1Z08A 4OXXA 1YBHA 2C9BA 4BLOA 3BRCA 4FYKA 4IIXA 3COJA 2QU8A 2YMMA 3T3PB 1ZYUA 3GL9A 3IOEA 3V1UA 2JKYA 3FPLA 4M0FA 3DZGA 3HCWA 3UB3A 2H1HA 3ON5A 3JD1A 4B44A 3THXA 1XQ6A 5I7SA 3ZCQA 4P81A 3M6FA 4R51A 5C8VA 1VYHA 2XUQA 1EH5A 4KNWA 4RIIA 2PAAA 2IJGX 3FPJA 3LRXA 5H59A 2EBHX 1JHYA 1H2WA 4IXNA 4L22A 4EO9A 2KBEA 1FVXA 3K94A 3OKPA 2RCYA 5DFAA 5GOTA 4C4SA 3MCAA 2Y1KA 2TMKA 5KU1A 1RWNA 3LHSA 2H17A 1P5HA 1VMEA 3UT0A 2DT8A 2IY9A 5LYJF 3M9LA 2EDCA 2EV9A 2XUPA 3IB6A 4JEIA 2DY1A 3RG8A 2EFJA 1L6IA 3JWJA 3T7DA 3U3MA 4Z4HA 4R31A 2BT4A 3SSOA 4I14A 1M76A 4KE7A 5I9LA 1ACJA 5FWDA 1QZTA 5TARA 4ETIA 4IHKA 1GFZA 2FUG1 1GLNA 1RFGE 3HE3A 4JR2A 3TZCA 4DS3A 1OJ7A 4L1KA 4UAGA 4YAGA 4UM8B 3DE7X 5JBIA 1IY0A 1XF1A 3K1YA 3W77A 4KLNA 2VVTA 5NLLA 1P6QA 5B30A 4FGSA 2VJNA 4KQFA 5EZYB 3GPCA 1AO3A 1QC5A 3F47A 2ZAIA 2F1IA 3DFKA 2IOYA 4PAOA 4NPHA 5F9MA 3O7MA 4OQDA 4JP8A 1PE0A 2BPOA 1X15A 2C0QA 3H1PA 5KYVA 1R0XA 2AW5A 4UATA 2NV6A 3ZDAA 4XGIA 4RY0A 4EJMA 3U49A 4BN5A 2VDPB 4Z1MD 4UDOA 2AFRA 4QXPA 1KYZA 1NMYA 2E7ZA 3JARA 4YAKA 1BOFA 3WJ2A 4BMYA 4NMHA 5JSZB 3SVLA 3CEHA 4W5NA 5T6BA 3ZDZB 2ZSFA 3MD9A 4F8YA 4DREA 5AVWA 3AERB 4Q66C 3AU9A 2GZHA 4AP5A 4ESOA 5A4DA 4RU1A 1XMQB 1XD8A 2CVQA 3K9QO 4UTPA 3Q2OA 2DU8A 3DTNA 3T95A 3BB3A 5IYZB 4KB5A 3GLHA 2KYRA 4TLMB 4Y6GB 1IN7A 3WMXA 3CKMA 3K0EA 3L1UA 4B3IA 4HN2A 3ENVA 2ZAMA 5BWNA 2Q5HA 2B98A 3RODA 4F3TA 3UBMA 1AK9A 4OSOA 5TPZA 4R71A 4YCMA 3VA7A 1L0BA 1Q77A 2E21A 3FTCA 4YBRA 2C1XA 3W2FA 1Y0BA 2Z1NA 3QU2A 1LI5A 4WKPA 5ARCA 1SUBA 2YOFA 3MTIA 1T10A 1QHYA 6ADHA 2NNWB 2WPDA 1RP1A 1OI3A 1Y8CA 3OE5A 4LMRA 3I09A 2GWHA 3B3QA 2P9YA 3C2QA 1QH9A 1GPJA 1T2DA 1U94A 3NT5A 1H3NA 3EFOB 5IBPA 4V0QA 2YXBA 4U2GA 2CFIA 4EA9A 3VVLA 4N7BA 1GTRA 3TCKA 2DB3A 2PQMA 1BHQ1 4HB4A 4TV8F 4NG5A 1GKUB 2HSEA 3U81A 4D4LA 1EESA 3TSAA 5H70A 4DYDA 1JH8A 5EKXA 3P52A 5F3WB 1BFUA 3BKXA 2WTEA 1QDUA 3FKSA 1JJVA 1DC3A 4KGVA 5E3HA 1EK1A 1DQYA 3O8RA 3DKPA 5HF6A 5B3JA 5P8WA 1V3QE 2PQ2A 1E0DA 4A2QA 1LF5A 3V4OA 1JFTA 1TXGA 4OTZA 1H3FA 1G3QA 4A91A 4H6XA 1VZ2A 1A88A 2Z5VA 4V0ME 1H5QA 1Y8RA 1UFVA 1SVNA 1E8DA 1NURA 3HH8A 2HPVA 1JBKA 4XAQA 4BGEA 3ETEA 3RCBA 3EPJA 2Z2ZA 4Q01A 1RI3A 1DTWB 2FZVA 3MZ0A 4KBYA 1XROA 2H9AA 3DZBA 1DZIA 5EYPA 1H2RS 3SIPA 3SX0A 3N07A 1YS7A 4OQ4A 5K6RA 3MJ4A 3K9HA 1Q0UA 4IVNA 4ENQA 1NJ1A 1M2KA 4S2UA 5H3LA 1J97A 3LKDA 3WBBA 2GFIA 4IWNA 1JR4A 3K0HA 1M5UA 1PR2A 4FWIB 1PGPA 1XCJA 1Z16A 4HMQA 4HTFB 4L6CA 4MKRA 3STXA 4BX8A 1CXZA 4I4CA 4FLFA 3B78A 2DG2A 5L53A 3W34A 2X7JA 3J80A 2Y4NA 3NV7A 4PAQA 1E1CA 2I71A 1LZKA 1O08A 2GHQA 3EG9B 3G9UA 4FT2A 2R7KA 3CVJA 1PQYA 3FUWA 5A5FA 3QBJA 4LZOA 3Q9NA 2SCUB 3DD1A 3FCCA 2PTHA 1Z8NA 2DTEA 2ZJZA 4EMBA 3DL0A 5EI5A 1P0FA 1UMBA 4HWOA 4M9QA 4D4KA 5CDFE 1K8ZB 2Z8ZA 1MEOA 1S7CA 4N5IX 5BWCA 8ADHA 1DJMA 1DCMA 6GPBA 1WCIA 1RKUA 2P27A 3AHDA 4Y9DA 1DQZA 2BP7A 2LR0A 4IMIB 3SYNA 3MRVA 5AW3A 4PX2A 3LBYA 4IIYA 3I2KA 3M2TA 4F3KA 2H7VA 2CB0A 3TH5A 3IPXA 2O2CA 2PO5A 2NV2B 2PQ0A 2ROQA 2C96A 5ITZA 4LF9B 4GMKA 2XGJA 3MQ2A 4JUDX 4FYXA 3ICWA 1IIBA 3IYLW 3LC7O 2QL9A 5DRTA 3BQMB 5C5IA 3D8TA 2OZLB 4FMCB 2QR5A 2D0OB 3S29A 4ITVA 3AB8A 4BAUA 3KLOA 4M2LA 3R9XA 1WPGA 4AQYB 2EC5A 5G1OA 3C6YA 3K30A 2YHIB 5LP6C 1AN0A 4EY5A 2PA3A 4K6HA 3VR4A 1XA3A 5CLIA 3GH1A 1TO1E 1Z4OA 3UEOA 2CXUA 3QHAA 3SXUA 1GKKA 1SCJA 4C4AA 5EIAA 4QL3A 2Z9BA 2DWOA 3FR7A 4Q3CA 3TINA 4C2BA 5KJFA 1E1RA 1DUSA 1C4WA 2JIBA 1M33A 4HFJA 2FP4A 4H7FA 2DY0A 1F8UA 1XK7A 3DL4A 5TSDA 5K8JB 5DASA 1WP9A 3PHJA 2J3QA 2AOXA 5KDOA 1LGYA 1GAEO 4L27A 3A7DA 4C07A 3DMHA 1HDXA 2P9EA 4G0PA 4KU4A 3PTZA 4S1WA 4X8OA 4EHLA 1V47A 3MB5A 2ONYA 5DM4A 3VR6H 1HXHA 2VHXA 3ZEIA 3KT3A 1QYWA 3BE5A 2IOHA 2BTOA 3WMGA 4DLZA 4O2RA 1K4KA 2QTVA 2DBVO 3S7ZA 4G6ZA 2QLBA 3TCNA 4QLBA 1R0RE 1CVRA 4KO1S 2RHJA 1NV8A 3Q6NA 4I2VA 3UOWA 3ZS9A 4DLYA 4EGFA 3BEDA 1HNWB 3EZFA 1AQ6A 2EX1A 2GZSA 4EKYA 1KVTA 4RACA 1NG1A 1J42A 1DELA 2PGIA 1BGVA 3DXFA 3RU9A 3OPMA 1LB1B 4Y0AA 4DQDA 3BS4A 5FTLA 1N5RA 4ZYWA 2O05A 3T1YB 2ZR0A 4IDNA 2JIZA 4LXHA 4NBWA 3HGTA 2P40A 1XWIA 2H0QA 2V7XA 1M2NA 5CLJA 5DM2A 3SP1A 3OZCA 3WLFA 2C4MA 2RGDA 2UXDB 3K9FC 2DHRA 1L4UA 1CU1A 2ZPAA 1X0XA 3K6SA 1X8LA 1XTIA 3NBKA 4J2OA 4M0LA 1ACMA 4BO3A 4EJSC 2O6LA 4PC2A 4RDIA 3EDMA 1HMYA 2OXIA 3HZZA 2NO0A 4KXXA 5FKJA 2VH1A 3JVUA 1E1KA 1OBCA 1TIKA 5F73A 4OXIA 2JS7A 3FCEA 1E4VA 3K9CA 4JIGA 4ZRDA 2FHPA 3KVVA 3T4UA 1CF4A 1IYZA 3W7BA 4PC1A 4V1CB 2ZB2A 2P2CA 3HXKA 2FSUA 3F4LA 4HEJA 1WXGA 3QHQA 4DLUA 1DG9A 4NFHA 1OQAA 1LLQA 2WHYA 1DIOB 1EJBA 1QQ7A 2ID4A 4KEAA 1C9KA 4E30A 1F9EA 2DPYA 3GJ6A 3OKCA 3VC7A 2EKBA 4E11A 3ER9A 1BDIA 2VNSA 2WF5A 2YW2A 3ZBUA 2XOEA 3ESQA 3PKJA 3O90A 1KI7A 2D2EA 2FW0A 2AQ8A 3E8MA 3EMKA 4S1NA 5CIQA 5ELMA 4JT9A 3SZMA 4DIKA 1OAOC 1VJTA 3X43A 3B52X 3R0XA 4PX3A 4N7MA 4AKIA 2Q21A 2VHEA 2QN3A 2B3TA 3U44A 4D0SA 3WQQA 2HZ7A 5AI4A 1Z56C 1X80B 1XXHB 2FPWA 2Y2VA 5U1PA 5JYBA 1M2FA 3BFPA 4JLNA 3HA2A 1O95D 1PGQA 1WZ2A 3OO1A 2ZKIA 4KI7A 2A9RA 2YR0A 4O0LA 4DILA 3CUKA 3T9EA 3SC2B 3O3CA 5FD8A 4PHCA 4N47A 4RTQA 1Q50A 2H1IA 2J45A 3FNBA 3UAWA 2FPGB 3JALB 1QV6A 2FAXA 1T3ZA 1T36B 3B9PA 3SN6A 4H7IA 5LUBA 5KWIA 1XNHA 4LHWA 2WAYA 4Q19A 1ZVQA 2CL7X 2IV2X 1VKHA 2CZGA 3WJ7A 1EAYA 1Z82A 5F23A 2VHYA 4OHFA 5LLTA 2G28A 4BDTA 8ATCA 3BMNA 1DDOA 2XGGA 4QDJA 4IQ8A 1XK6A 1VLQA 2W43A 3FPAA 5K7SA 1AO0A 1IZYA 1NYRA 2NU9B 3AVXA 3TN7A 3SYTA 1JF8A 1MNAA 5IMSA 1L4BA 2D5BA 3ZW7A 4BLTA 2ZJ8A 3FNRA 4PX5A 4LUCA 4TLAA 2GZ1A 1N7JA 5E1BA 3UK6A 4HVCA 2QZ4A 2GUWA 2FJUA 1ODFA 1AKUA 3GQBA 2O7QA 3GJTA 2F9LA 3L4BA 4FE7A 4LCJA 2ZJ5A 3IRVA 3IX7A 4HK4A 4Y2YA 1MC5A 1N8NA 1OYYA 3AJ9A 4LI3X 4RDHA 5BWLA 1E8NA 1YAHA 1NXSA 3DYBA 3QXXA 1PYGA 3AUKA 4TV9B 3ERCA 2DT5A 4LRYA 2GD6A 3OX1A 1P3Y1 4RZ3A 3CX6A 3N2YA 4ZCRA 4CKWA 4RTLA 1FZTA 4ID9A 3RJ5A 4EA7A 3X1MA 1WIWA 4UMFA 3DMYA 3BJIC 1XTVA 1FDVA 2E37A 2WWXA 3WO0A 5K09A 1KSGA 3VC3A 2GPAA 2BLNA 2HU5A 4OAPA 5CHEA 2MR5A 1DQPA 3WK6A 2C2MA 2YJNA 5IJ9B 1OLXA 1L7NA 1G8PA 1XCPA 2PUTA 4DB4A 1DFHA 2F3TA 3SIRA 3M1IA 3WLKX 1RZUA 2AG1A 4HQ6A 3ZDDA 3NKFA 2B25A 2GB4A 4I4TF 3V9PA 3BHIA 3K2EA 2JFNA 1Z6TA 1KF0A 1OTYA 4CMEA 1KPIA 2FXVA 3LP6A 3OCXA 1DIHA 3GFFA 3VKFA 4QICA 4X62B 3I52A 4S2EA 2EKDA 3L8CA 4ZT5A 5TV2A 1J8VA 3G7NA 1YJXA 3HDHA 3V46A 2BZ0A 3KU1A 3OQIB 3KLPX 3O2JA 4OKNA 4RPKA 2XY4A 4J91A 4ZHQB 2OC9A 2R25B 4IKEA 3R76A 2A8YA 2R96A 2YWDA 3WMRA 3E7PA 4M38A 2B5OA 3O21A 3MEQA 1K9VF 5YASA 1T6YA 4NYIR 1XCLA 5C1BA 2J46A 1SHLA 3NWJA 3M4NA 4H1TA 4F6RB 3D7SA 1T1EA 4TTTS 2WSSA 4LSZA 4KTTE 3ZD9A 1EJ2A 1C3JA 4Q9DA 1UEIA 4YP0A 4GWGA 1OBOA 1I4TD 5KYYB 5J2TB 3CLRC 3R5SA 2Q2QA 3SS8A 4HGYA 1I6MA 3AKDA 4UEOA 1QOQB 4PYKA 3AESB 1RPAA 3IVMA 1TC2A 4Q4HB 4I55A 1T6NA 2I9KA 3P9PA 1NW7A 4K6CA 2NVUA 3ABRB 3IQGX 4U00A 1B6RA 2QJWA 2QL7A 3UH0A 4AROA 1BU5A 5BN1A 1VE3A 2R8XA 1QYIA 3OUZA 5IKEA 1BN6A 3E9DA 4BVJA 1N2HA 2VXYA 1COZA 2J3EA 2NVWA 2ZBRA 3DMDA 3EZ7A 2O2SA 1ZGHA 2WIFA 3VR2A 2HUNA 5JQWA 1YH3A 1MABB 4UBKA 4G9BA 4GH5A 1ES9A 5EHIA 3WGNA 5JBNA 4M7PA 2RC5A 4EY8A 3BIXA 1E0KA 1Q17A 4PBTA 3EDRA 5CA0B 4W5QA 4X1OA 3WNCA 4TS4A 2RKBA 4L5AA 2GO7A 3AEXA 4W63A 5AJWA 4JUIA 5JD3A 3U37A 5ELXA 4OHUA 4RANA 3FKJA 2I76A 3D7RA 5F77A 3EAFA 4CIWA 1TM1E 4JELA 2B30A 4ZMRA 2C4NA 3OZXA 5KOJB 3A4MA 5IAGA 4WLEA 2ZXUA 3EPLA 4W9MC 1ZUD1 2EJBA 4ND5A 1R5NA 3HPRA 4TMKA 5DBOA 5KYKA 1D6NA 1M72A 2VI5A 4KFRA 3ACDA 2YZMA 4IJKA 2JI4A 2GD1O 1Z7GA 1IJEA 1DKPA 1SCIA 2JK1A 2QSZA 2XF8A 4OBXA 1KA9H 5CBPB 4QASA 1HZZA 1QWOA 1R50A 4TWRA 4EL0A 1KFKB 1PFGA 5DI3A 3FDJA 2RBEA 4FX2A 1FSZA 5DSXA 2NUBA 4Q1AA 3MWDB 2B36A 1FW8A 1GVHA 3B3FA 3S1LA 1X2EA 2DBRA 1WW3A 2ID7A 2R1VA 3BX1A 4JZKA 4WECA 2YZNA 1GM5A 2O8EA 5ALPA 2PV7A 3UW3A 1NSYA 4R6XA 1E5XA 3KRTA 3VNAA 2ETVA 2ZLBA 2I8CA 2BE7A 5DYYA 2LIPA 1ESEA 1IDOA 2D5AA 2IZ5A 4FDMA 3LHDA 3IHTA 4JFRA 1E9DA 4Q3LA 1WSWA 1GN9A 1ZLXA 3D59A 3MINB 4WZAB 1V5EA 5F5LA 4CG0A 1SWWA 1AE1A 2Y76A 3JQQA 3G5UA 2NN3C 1YXMA 4RBNA 2WZBA 4US1R 4X24A 3SS9X 1J2UA 4R8LA 3RS4A 2AF3C 2G80A 5BW8A 1NDQA 2FOIA 3KD3A 4BNKA 3H5LA 3WADA 2IW1A 4MWOA 3P9YA 1NLZA 2IHUA 1JG4A 1LK5A 4XE5A 1ENZA 3AR5A 3IKLA 3WK9A 3ND5A 5B4UA 4D74A 2AN5A 3DDUA 2QZZA 1E60A 2YH2A 3TOVA 4ALKA 2C04A 3BZWA 4UFPA 4YRKA 1J2RA 4DN6A 2B1JA 2DFDA 1JPJA 3AEUB 4BO0A 1FUEA 1EDDA 1ZH0A 2Q46A 2NO6A 3DQZA 3SNKA 4M36A 4JL5A 4RK6A 3KR1A 1OJLA 2ZZKA 5CEJA 5FLXA 1E6MA 5B6JA 4ZVQA 3HJRA 1IBSA 3KKPA 3RJZA 1AA9A 2IKSA 4IJWA 4JA2A 3VPAA 4DNXA 3IODA 1T24A 3QQPA 3C6KA 1QIGA 1DARA 3EE6A 2VT6A 4ZXFA 3AF2A 3O2QB 1KO7A 4AWXA 1GSIA 2VZEA 2FGKA 1KK2A 2WV9A 3D2LA 3DOCA 5EN4A 1IN1A 2JEYA 2OFWA 3OSUA 2E4VA 3IMFA 1M83A 1XU7A 5D1NA 4ZA2A 3IEUA 2HU8A 3H84A 1U28C 1YS1X 3L05A 3MT0A 2Z8XA 3PYXA 4WOJA 1Y82A 3M82A 1J8DA 1W94A 4XDGA 4LNAA 1SUWA 3GLFA 1RQ2A 3E5HA 5F4ZA 3TLKA 3VKUA 3W78A 1H5UA 1ODJA 1Q84A 1YL6A 1T91A 1YAJA 3KALA 1CUXA 3DZ8A 3EAGA 1QO0D 3FJ1A 2OHJA 3DVSX 1ZQ1A 1WP4A 2HRDA 4TVKA 2YVLA 1C7ZA 1C0KA 2HA3A 4D8VA 2AMLA 2EGGA 5DPMA 1Q12A 5A3VA 4ABTA 4EVSA 4RIGA 3L7BA 2PPLA 4JLOA 5LVAA 4WI1A 1BS2A 1N9ZA 1GRRA 1EVKA 1U65A 3DOUA 4DWVA 3ZH9B 5C32A 4YHHB 5TT0A 1PVVA 2XTNA 4W1PA 3QE4A 1KP3A 3V2GA 4GRDA 1BKYA 1K4YA 3F2IA 2OV4A 2A9JA 4FC6A 4MQLA 3PR2B 4UU0A 3U31A 3CNQS 4WLOA 4TTQA 1W76A 3UANA 2XLCA 3GNQA 4RV9A 3AY7A 3H6GA 4QFDA 3RTAA 3T3IA 1Z5VA 4U6QA 4Y1FA 4DPKA 1G3IA 2G72A 3BSYA 2PRIA 3LO5A 1VCHA 3UJ7A 3CW8X 3RFXA 4LPSA 1QG2A 2XBMA 4H7DA 2OYCA 1CZUA 3PE4A 3WOHA 1YDWA 4ZVSA 1UP4A 4PFQA 4Q16A 4UM7A 5MF6A 3DDHA 1S3FA 4JBXA 3UVEA 4AG3A 1AQUA 3HVHA 5G0SA 5TF4A 3G2IA 4MO9A 2AKAB 5JU6A 1A96A 1FFWA 1QCZA 2CMKA 4PYMA 3SJBA 2OA0A 2VDVE 5GPBA 4X41A 3WICA 2C2OA 2VUSA 3TLEA 2CV0A 1DC7A 1OIWA 3Q12A 1ZD8A 2YVUA 4QU5A 2AI2A 2ILVA 2Y71A 2B1RA 3I42A 2JATA 1RVDA 3GFGA 3OY7A 1GFWA 3EUWA 4UZFA 4FONA 3ZJ4A 3PITA 1X70A 5IBCA 1WUHS 3C5WP 4TXNA 4G0NA 4R8VA 1VPLA 3GDHA 5LC1A 4F9TA 3V4FA 1QQ5A 1O94C 2AXNA 2L2QA 2DBZA 2XVXA 4RXTA 3L1JA 1QVZA 3STUA 1ZUHA 1L7OA 2VHJA 4Z3KA 3T1HB 3U5ZB 4M8NE 2ODQA 2DSTA 5DWDA 5HKBA 2QPTA 2VF8A 2X0RA 4CFSA 2GJ9A 3KYJB 4OIMA 4RS3A 1IHXA 1Z2PX 1EE2A 2HEGA 1ZM7A 3DOOA 2Q8PA 1T2AA 2LKDA 1G8MA 4RZHA 2JB9A 1WBDA 2AG0A 4NBLA 2J3KA 1V2HE 1ENYA 1XALA 4NCJA 2H16A 4ON9A 4DSOA 3LW7A 3OZAA 5DNUA 1JG3A 4XM0A 5AVTA 4WLVA 1QPBA 4B6EA 2WRZA 1I0IA 1QBKC 1QCDA 3E23A 3QU9A 4AD8A 1VLHA 1EG7A 4CIVA 4G0ZA 3WGUA 1G21A 3O9VA 4HKTA 4JLPA 3ZGLA 1C3OA 2G1AA 4BMCA 5EIFA 5IWAB 2WYHA 4E33A 4L8WB 2SNIE 1IXKA 1I2DA 1D7OA 2W4IA 4N3GA 4ND1A 2O50A 121PA 2J87A 2YNMA 3AQIA 4RGQA 2C4UA 5J4KA 1UIMA 5SY6A 4LNUA 4OB7A 5AKXA 1UXHA 1J21A 1Y5IA 5HCNA 1NZFA 2K5UA 1E63A 2OHGA 4E51A 2GPNA 1ADFA 4DLKA 2L0XA 2ZBGA 3GYBA 3LI2A 4RQAA 4B7CA 5H9WA 3K2BA 4S1VA 3EEIA 2W2KB 2FEAA 4Z8YA 1KH2A 1ORIA 3BWXA 4P35A 1TAUA 2QW0X 2E48A 2P2ZA 4WKOA 1EBBA 1IHDA 3L07A 3RVSA 1D4OA 3BRWD 3QIAA 4YROA 2OHFA 3X1WA 1E66A 1E5TA 1N77A 5EE1A 1KO4A 3BXGA 3H3XA 4YS6A 1FX1A 2YICA 5K8CA 2PSSA 4E2XA 5TS3A 5JDIA 3LZ6A 4HDCA 4O3FA 5F51A 1GJRA 1WZCA 4NE7A 3TI7A 4DGSA 1LY1A 4IIGA 3P9RA 3OIYA 4NFLA 3CT6A 1QK3A 5C5EA 5LD2B 3L8YA 1OFIA 2ZYVX 4YK7A 3QPWA 2UXBB 2JVJA 4P83A 5AO9A 1T5OA 2JIPA 2JDIA 5AOVA 1GFSA 2BY4A 4OHOA 5SY9A 1F2TA 2Y1OA 2XA9A 3EVBA 3A6HA 3AONB 4MYUA 5JEEA 2F1RA 2DX7A 5EXSA 1H9CA 1NPYA 1YRLA 1YVRA 1O2DA 4MV3A 2BMWA 3BGDA 5AFSA 4IF6A 3CE6A 1GQQA 3VTFA 1DX4A 4F2GA 5TC4A 1IIRA 1TQHA 1XZHA 5J5CA 3TLGB 4CF7A 5CPBA 6REQB 2WWGA 4I3HA 1IEWA 5J1SB 1XNRB 2QGFA 2QMEA 1U81A 2ZQYA 2ZUBA 4K46A 3CZ4A 5HVNA 3N5CA 2VA9A 4BB9A 1IQ0A 2WD7A 4B33A 1KNXA 4MB2A 4G5HA 2E5LB 2Q4BA 2Q2NA 2H63A 3NDJA 4K6FA 1T9KA 3W8EA 3BFKA 4YIHA 2I3BA 2ZULA 1NBME 4TLBA 2RD2A 1Q15A 3D7MA 4QQ8A 3BERA 5DU2A 5IJAA 3W1VA 1S5PA 1OZ0A 2XRMA 3JWIA 4KVGA 3PEYA 1GEEA 4ZU1X 2OQRA 3EVCA 4AW9A 3OLVA 2X5XA 4JX9A 5C37A 4M3NA 3QV1A 4UTXA 5FOVA 3WDKA 3PJDA 4UVHA 3PDHA 1SBTA 4FR0A 4W5WA 1EIZA 3IBGA 4TLEA 2XOKD 4RFVA 2WU1A 1OTHA 1PO7A 3C3EA 4D9MA 3A9CA 2EZ8A 5M3BA 4PIPA 3DEJA 1Q6ZA 1HTWA 2R00C 2DHDA 2WVAA 3WRXA 1JVBA 1LW7A 5BQXA 2B7CA 2JLUA 2CBGA 3K4PA 3OEHA 3II6X 2XB6A 3GHHA 3L1HA 3MS7A 4J4BA 5NULA 5K3EA 2I7XA 4UUQA 3QWHA 3U7GA 4YLGA 3KXPA 4RLHA 4X6UA 3RJTA 4Y18A 3WJ1A 4G5RA 1K0FA 2X9LA 1ZJ6A 4DMGA 3ZI0A 2H1OA 2FPPA 5AICA 1IVNA 1MX3A 3PC7A 1D5CA 1U1GA 2ZYDA 5AJTA 1WXIA 4R9VA 5AVYA 1E2HA 1Z5WA 4LXXA 2ADFA 4URHA 3ZE7A 1JKXA 2Y2UA 4IGIA 4MB6A 2VBCA 4MV1A 1RRFA 3AUYA 2PFGA 3DPIA 2VAMA 3EVTA 4TWIA 5EPOA 4D81A 4Q9KA 4P2GA 2G09A 4PEVA 3EMBA 1L5ZA 3F46A 4Z1MA 1RWVA 3PPIA 4LTNA 2D5LA 1P0CA 4ESVA 3UMGA 2PWZA 1DAHA 4QXAA 5A6SA 1OAAA 3EWIA 3OPVA 1GPUA 3HNRA 1E3JA 3I6IA 3NBZC 4UARA 5HJEA 1FFYA 3L6BA 3B2NA 1HFEL 4KI0A 1KO1A 2BEVB 4YFVA 3PXUA 4JHLA 1ISHA 2JH9A 1G20E 3DWGA 4QU9A 4YXWD 4DGQA 1CIJA 4QVKA 5CXQA 1G8YA 2PSDA 3MG9A 2VJOA 2XDYA 2YFHA 2Q5OA 1FDWA 3M5DA 1SXQA 5EHZA 4IP0A 2VNAA 4D9FA 2QN2A 4MW1A 4ARIA 4LYJA 3JWEA 3RC3A 5JXIA 3SBEA 4J7UA 3W4KA 5K0LA 4MWEA 4XQGA 4Z3OA 3IAUA 1KMMA 3ZCPA 4CR8A 2GCOB 1QE0A 2AC4A 5A9TA 1ISMA 4E1BA 2WP8J 2OPHA 1A2KC 3ITKA 1EA7A 1E79D 1H22A 3IVGA 3EN0A 4IUYA 4BRZA 3LSYA 3ODPA 4DDMA 4PG8A 4MDHA 2XTAA 1Z63A 3F4BA 2SKDA 3PEWA 3TRIA 1EM6A 1QYVA 3OM0A 1S9DA 3GUZA 3FUCA 4JA0A 4JSTA 4O2BA 5U4QA 3NJRA 3B6EA 2WP0A 4DDHA 5CEEA 2QV7A 3LBHA 1RQXA 3MJDA 1FP1D 3LUAA 5T57A 5LQRA 5LQMA 2PUEA 5IN4A 3A70A 1NNUA 3FE2A 4WOCA 3T3DA 1J0CA 3V8NA 2X23A 2Z2KA 5EZYF 1XELA 3PDIA 1ZXXA 4W5HA 4ZOLB 3HADA 1QHGA 1SUSA 4QGFA 4R7TA 4DCSA 1BE8A 2ZXEA 3H9EO 1RIFA 4DR6B 3QF4A 4GOMD 2QIOA 4RHUA 3T0IA 1NXXA 3M89A 3GRVA 2DLNA 1NNLA 2R5NA 1R6TA 2CWDA 2K4MA 3QOYA 3GDGA 1ZO8A 1C0PA 4IFBA 3S81A 3A6EA 2IT1A 1BEEA 2FF5A 1P7YA 4Y3UA 4K9RA 4LX0A 3UIEA 4AMUA 4I6EA 4OQXA 1Z5OA 4GZ3A 2V9PA 3G8AA 3SJUA 2CXQA 5BNZA 4UAUA 4FILA 4OMDA 1EGQA 1ESNA 2F3SA 4CPDA 5CH3A 1QQBA 1H0SA 3PQ8A 5A2QA 4F91B 2IEIA 2WIKA 3IBCA 5D84A 1NQUA 1CV2A 2M32A 1J0DA 1SZDA 3OCCA 2A0YA 4IS3A 1NF8A 3R0ZA 5IYZF 1U5CA 4DEVA 5JSZA 2O0HA 4WKGA 4KE8A 1C0LA 4LS3A 4MKHA 5KVQA 3N0VA 3S99A 3QSYA 4GGPA 2Q5LA 3L9WA 3ZD6A 4AJ2A 1A97A 1WLSA 2ZS9A 1TGVA 4NEGA 3LA8A 2QUAA 3D6JA 5BNTA 3E5NA 3GJ3A 4CEHB 3TTSA 1P7CA 2WHXA 3FZEA 1NVEA 4BO4A 1AUOA 2PE5A 4R2KA 2XUFA 3M83A 1G8FA 5HTKA 2FQWA 3LQFA 1NVVQ 2VPTA 5I4BA 1W4AA 5DK6A 3JAKB 1EFKA 2YXPX 1UBHS 4KQHA 3B48A 4GFDA 4L75A 4UCQA 1YA4A 1F6WA 1SD2A 3RHTA 5AKGA 1GPBA 1PRYA 5EIOA 4TKVA 3M70A 3QEMB 2FCAA 4GEKA 4UXIA 4LFCB 4OPMA 3V4ZA 1IN6A 5IX8A 2C97A 5TQ2A 3E7DA 5JSKA 4CLEA 1EDOA 4EGCB 3HWRA 3OVMA 3S1SA 3LIPA 1QYRA 3QLUC 1AZLA 4RH1A 3DZKA 1HPLA 3KKLA 1QDEA 1K6IA 3QFSA 3M6XA 4C1NA 1SCUB 2BVNA 2IYLD 2HK6A 4G5YA 5A7HA 3FN4A 4B4DA 4DSNA 1JDJA 4EW3A 5HR5A 1U0BB 3IOMA 3AL0C 5IC4A 1B8PA 1NUUA 1VDZA 2GLTA 2EJUA 3FYSA 4DLPA 4EARA 5JCXA 1FLDA 4URUR 5KVAA 4N5LA 3OBBA 2ZUDA 3R0JA 4D3YA 2BMFA 1EBFA 2FW9A 4FYJA 5HGJA 1SC6A 4QLOA 3NEPX 1ODSA 4C5AA 4DJ5X 3ONNA 4IO1A 4B3RB 2BR3A 4DOMA 1XPRA 1TRKA 4NONA 1L7RA 3HB7A 3WTCA 4H59A 1PNOA 1UJNA 1UUFA 2XUIA 2FQ1A 1CJMA 1RP7A 1U31A 2WNHA 2POCA 3TXYA 1E0JA 3MA0A 3KQOA 3TOXA 4YONB 2O2ZA 5TGTA 5SYNA 1B26A 3GO4A 1JA1A 4CL3A 4EOGA 2W4MA 4BFLA 5MDHA 4UREA 5C52B 1TLFA 4KO2S 4F85A 1T43A 1EWKA 2VBGA 2BCGY 4FFDA 4G8JA 4I8IA 5DO9A 5AVXA 1PR3A 4FB5A 3AI7A 5EFZA 5B3JC 4M8SA 4YFYA 1N5MA 4HTFA 1CDDA 3ZXUB 5IVHA 1Y9JA 4DCCA 3AWIA 1B3BA 1E6CA 2VUHB 4Q37A 1EXMA 4QBGB 4U9UA 2A9KA 3FCAA 1YRQA 4PLGA 2CNOA 3LUHA 4KMOA 1UBFA 5T4BA 1JPUA 2KW5A 1VRCA 2QBYB 3EG9A 3BOSA 2HI0A 2Q9CA 2C9MA 4ZCMA 1NHWA 1ONBA 4WRRA 2I55A 2P3QA 1DPFA 3NYIA 3OIWA 3UK0A 1VDMA 1RZ3A 2SCUA 2Z2IA 3HY4A 3M4YA 4CQMB 2QSYA 1GA6A 2C5FA 3UTDA 5JCJA 5FCDA 1MXFA 4P2BA 2OCIA 2Z95A 5CHYA 4YECA 4CUZA 5ITSA 3IQFA 2FX2A 4YMIA 3D0KA 2TS1A 2VOJA 3IP9A 3KG2A 5JCPA 2W6IA 5IULC 1E58A 2YZGA 2X77A 3B85A 3KR0A 3K0SA 4W5TA 3WGLA 4E5DA 4LHZA 2XMPA 2C99A 3KJHA 2V8OA 3DQPA 4ZT3A 1PX0A 3Q7TA 5LOVB 3RS5A 2OZKA 1XB2A 1C5KA 1RD4A 4Y2QA 5E9AA 3U3RA 5FFMA 4B3HA 3OESA 5C1DA 2RB4A 3MTJA 4QZVA 2OWEA 2ZSIA 3IBYA 1B0PA 1K8YB 4DHWA 4F2HA 4LJ4A 2Z3WA 1XHEA 2FMFA 1R5JA 2WVJA 2ZKLA 5E2BA 3T1OA 4YDQA 3BM5A 1ZH4A 4QWWA 5FOXA 3K0AB 4RJLA 1ISPA 3A4TA 3Q7QA 3W6UA 1F2UB 4XUEA 1LU9A 1ZVJA 4R01A 4EJ0A 2OZLA 3EJWA 2GPBA 4RD0A 3TAUA 1UBTS 2IBMA 4ZODA 3RO7A 1PJSA 2HK9A 3M6WA 4I3GA 3GFTA 2EWWA 2AR7A 3OPYB 1F0PA 2IEZA 4O4JB 3IEPA 1ZICA 2R86A 5D5QA 4ZEXA 3BN3A 4DSTA 5REQA 2IHJA 1Z2OX 4N0EA 2J33A 5HQJA 3T5AA 1EHIA 2B94A 2CJWA 3AHHA 3NUQA 2BM1A 3RSSA 3S27A 4AQ7A 4OX9Y 5FBLB 4YT2A 1YFKA 3NHUA 2BCJQ 4PY2A 3KVNA 4EEXA 4U2EA 4CGYA 3RYFB 3UJ8A 2MMGA 4Z8XA 2QLLA 2XRFA 2XKBA 2QN6A 2ZT7A 3DW1X 3PYLA 3ZU3A 3OEWA 3RIXA 4TVOA 5ALKA 2YY7A 5KYUA 1JFSA 5KYWB 3JZDA 5IUJC 2DWQA 3DB1A 4WWHA 1YBFA 1EFLA 5AHKA 3L0OA 1R7RA 2BHLA 4GXNA 2M6KA 4CKEA 4ZEMA 3FBTA 5JECA 1TT5A 1D4AA 2JHAA 4QA9A 1YWGO 5BN4B 1FJXA 1XKLA 1EX1A 1QG6A 1YU6A 2HA2A 4DAEA 1G6Q1 4HFRA 4RVFA 1R6BX 4KZPA 3RUAA 5LJLA 5AHRA 3GJQA 4CQMD 4IDHA 3ROZA 1E2FA 4X20B 5JJ5A 2F3QA 4JT4A 4EYEA 1U90A 821PA 2DGDA 3MMPA 1FCJA 4XWWA 5COBA 5I7FA 5K01A 2WV7A 3UUFA 3B82A 2WTAA 5H4HA 2BI4A 2P6OA 3AM5A 3FFBA 3QFHA 2P9QA 4J0KA 3KUXA 5HILA 4EEKA 2OG2A 2I54A 1QCYA 3GLHE 4XGQA 1N5JA 1LRLA 4DQ0A 2Z43A 1CNFA 4L07A 4V2IA 2VQFB 1N2EA 1EUQA 3Q0EA 2CKDA 2QX4A 4DLVA 2Q3FA 1D1QA 2Q3JA 2QN1A 3IIJA 4YTEA 4E13A 1SUCA 1Y3IA 2IRWA 3TW4A 1TO6A 3I2FA 4IGAA 1YRBA 4H6WA 4W1RA 2BZ1A 4Q9NA 3CA8A 1DC6A 3FNGA 2WU4A 4V1CA 2AMJA 4URFA 4QAJA 1JIIA 1KDYA 4BMPB 5E4YA 4YACA 3ZCXA 4PZPA 1Q1QA 5BSVA 3TTXA 3UUWA 2VNKA 2WJWA 1E96A 3B1FA 3D4OA 3H1AA 3KHSA 2FFQA 2VP3A 3IKJA 1DJPA 1SD1A 3KYDB 4EKGA 1KWKA 2C82A 3LUKA 2HLDA 1FUYB 5IAOA 4OH1A 4E2ZA 3I2YX 2HCRA 1PD0A 2EHDA 2F59A 3L43A 3QLTA 3R3SA 5A06A 1VG0B 3WG9A 4V02A 2JRCA 3U9SA 1DL5A 1YZGA 3ND7A 3CF4A 4BGDA 1PLLA 2JK0A 1P1JA 3BDAA 4MI3A 1XU4A 2ZATA 3HVJA 2REOA 5L4SA 3NS7A 1ZOLA 2JLCA 4ARBA 2DKFA 2CXTA 1UK9A 2P35A 3MBKA 4GE3A 1T8SA 1BXZA 2XJ4A 3FIUA 3BK7A 1FQWA 3FUVA 4Y2PA 3NBYC 3OJLA 4L5CA 3KZVA 1KGDA 2WFAA 2OB2A 5KYXB 2PZKA 1HFKA 4MV9A 1K3UB 3B9BA 4ICIA 5AM4A 4OI0A 3FHJA 1SOMA 5ILOA 3JALA 4YNBA 1CQJB 4KWHA 2IZZA 4W8HA 1OBFO 3ETNA 1YMVA 3HGQA 3KWFA 3W1EA 4CRWB 1YR2A 3CPSA 3PFIA 4LWQA 2QMUA 3QPAA 4Y6LA 5HCIA 4B6PA 1F5NA 1Q1AA 2IHZA 3KJQA 3H4MA 4GPD1 3FKQA 4DT1B 4M83A 4AKEA 3ZN2A 2W11A 3DONA 4ZI2A 1K7XB 1NVAA 1QGYA 4MWTA 3FPSA 4ZO9A 2BDUA 1QKIA 1US8B 3OWOA 3REOA 1WUIS 4B45A 4AZ0B 3HI6A 3RTDA 5LR6A 2HA7A 1AKVA 4QSHA 1RKQA 4AY5A 1E4OA 1W1UA 4LOAA 3VX4A 1YFJA 3FPGA 4WK2B 1A1SA 2P2NA 3ODGA 3UJ9A 2CV2A 3I04A 1V7PC 1HT2E 2BDEA 1LEHA 4IGKA 1ID8A 1MJ5A 1O89A 5GP1A 3A3KA 5CEFA 2VKTA 2IUSA 1LDMA 2V7VA 4ZYTA 2AVNA 1WUYA 3A27A 1VKJA 3HCEA 3ZUPA 4KSYA 1W36B 1RBZA 2WE8A 3TQTA 3VSCA 1DBWA 1RCTE 2XBLA 3QJYA 3A6ZA 2IEYA 3DZCA 3IS3A 1LRKA 3U7EB 3THOA 5GJBA 1K6MA 2PSEA 1U99A 5DX8A 1QBGA 1BFKA 2ZE5A 1RAGA 3VC2A 1EFTA 3O74A 1SKYE 1TU4A 4A6DA 3OA0A 4FNAA 1U8FO 5BXYA 2Q6KA 1O8BA 1YZLA 5DE3A 5EMKA 4BNVA 4CTKA 2MU1A 2O07A 2IDKA 5ADHA 4ZAZA 2NZJA 3RC7A 4BLVA 4PBSA 2P0YA 2W6ZA 3A1UA 1FYVA 1F8FA 4YJ2F 5LBTA 4D9HA 2CZQA 3KTFA 1F7UA 4HP8A 2O2XA 3WGTA 3O1IC 1OH5A 2RHRA 3ZJTA 2BFEB 2HBRA 2HJHA 1B0ZA 2GEUA 5F98A 2HF8A 5JH7A 2P9HA 4Z49A 4HGPA 3VU3A 2XYRA 4MQ4A 3N6XA 3UWMA 3IXLA 4V0NA 1FJ2A 1XHLA 2AXEA 2XCRB 3WYFA 1X7ZB 2HQRA 5AI0A 1L4YA 3OQIA 3SYMA 3F5DA 4D9NA 1B8VA 5F64A 3QU4A 1T2FA 4UUBA 3HJFA 3B70A 2X1HA 3IAS1 5KQSA 1V16B 2JLRA 3M1LA 4XJTA 3C3JA 1PS9A 3MTEA 5CVCA 1L7AA 1X7GA 3P19A 1KDOA 4BV9A 4K6OA 2KB0A 4BX2A 1EHYA 1Q1ZA 3EW9A 4TZ6A 1AS2A 3L6EA 1RMYA 4RX1A 4AIIA 2WIJA 3AKEA 4OYRA 2XMDA 4CU5A 2Z4TA 3K0KA 3AW9A 4RSRA 3AL2A 3TBFA 5EIWA 5J2TA 3HCCA 2W8BA 4MO2A 1QO7A 1CD5A 3L1IA 1Z07A 1DO8A 2ADOA 4LZJA 4UDXX 4GL4A 4N54A 3UNXA 4XWTA 5A3JA 3IPCA 1Y6GA 3H2JA 4UE3S 5AM2A 3HLYA 1SQGA 2F9MA 3MGKA 3NO4A 5A0FA 4B3JA 4QM7A 5EKDA 2QNRA 3LPAA 3VNUA 3PLAE 4RFLA 1O97C 1VGVA 1FX0B 1GU1A 1PG5A 1YCHA 3BFVA 2ZRFA 1QFMA 1Z0ZA 2ZROA 3NT2A 1MABA 4CF4A 5LNK1 4H9GA 1G3MA 2FR8C 3K09A 4I36A 4PXAA 1M9NA 5CA0A 3TR0A 3QUTA 4P32A 4YV1A 2R1TB 4HDAA 3U3KA 1NF9A 2XJ9A 5JCOC 2GCEA 1PKEA 1W36D 2JGEA 1HQYE 3FPBA 3OZDA 4NL4H 3UAVA 3LU1A 1TVMA 3AJAA 4LXYA 2JD0A 4YRSA 5IH7A 3WQHA 1YS9A 3FTPA 4WD3A 4BVEA 4L57A 3LRTA 3QTBA 5CYOA 1P7VA 3H86A 3NB0A 3AKZA 5CJ2A 1KS9A 3PC6A 1F06A 1E69A 2R8ZA 3GVIA 3WLNA 3ZBQA 4MCJA 5I4IA 3DTVA 4MDEA 3WTBA 2BZGA 1DV1A 2VCYA 5CYGA 5LA6F 3EVNA 4MYTA 4BQSA 4D6XA 3ESDA 5CBPA 4LBYA 3T1NA 1HQDA 2DBYA 3OF3A 3HB0A 2PXXA 1LX7A 1XZIA 5BV7A 5LDHA 4E0BA 1JHUA 3MWDA 4FD2A 1W46A 2RK6A 3E2IA 4NNPA 5ERGB 5K8TA 2F8LA 5MN5A 9MHTA 2CHGA 1DP4A 5BN5A 4P54A 3DLHA 3KCNA 4B3FX 1OLSA 4NATA 4WERA 3CX7A 2H4FA 3GAMA 4IFIA 3WP1B 2AB0A 2HHCA 4JJAA 4OVKA 2VWHA 2HJGA 1CJKC 4GPBA 4WZAA 3MINA 3G59A 1NI4B 4OU5A 3TBHA 4C30A 1Y4DE 1G8GA 5AW7A 2PH1A 3RKRA 2OO3A 2F4NA 1A7AA 1Z5GA 4LSMA 4WN3A 3KUDA 1XRLA 1P0PA 2XSZA 5F9FA 2Q1UA 4BZXA 1G16A 1M1UA 2DOKA 4ZCTA 4XZ3A 1AZWA 4PYOA 3RRMA 4I9HA 4UFNA 2YHAA 4ZKDA 2JI8A 1IVYA 4PYRA 2EERA 2QG6A 3WL6A 4IHAA 5JHGB 2RGEA 4FJ1A 3PQ2A 4GT1A 3QX9A 2IOFA 4XJVA 3M49A 1ECCA 4KXUA 4D9GA 4TROA 3LT4A 2AG8A 4DMCA 2EVWX 2PL1A 3DT9A 1DHTA 4N82A 1SPBS 1X86B 3PB3A 3VDRA 3KPUA 2HBQA 4XPIB 2XYHA 1DIRA 1RRPA 2FN8A 1OWPA 4XD7A 5DYNA 2CUTA 4D9JA 2IF2A 3OAAA 5ELLA 3FOWA 3AXSA 3WIEA 3F0TA 1LVHA 1OC2A 3KYCB 4JBWA 5IXJA 2OGTA 1U6JA 2QMOA 2JFQA 2VZ0A 2WJZB 4UCXA 4NDAA 1X42A 3QE9Y 1NW6A 2HF9A 2VH2A 3AFNA 3D4LA 1EK6A 2X9NA 3A6FA 1DC4A 3A4LA 4Y1RB 1N6LA 4Q6BA 1TTTA 1HDZA 4N3CA 4KE6A 3OZUA 5CTAA 2ZB3A 5EJMA 4Q7KA 4PSCA 1EUCB 4H4CA 5HS4A 2YV4A 5CT6A 3CSSA 2I78A 3ED1A 2VSYA 2I7DA 3NKLA 1QHSA 3FTDA 2J0UA 1T0IA 1XQWA 2O1SA 2OFPA 3RWOA 4Q4CA 5IJ0A 1QK5A 3G89A 2DKNA 1U7ZA 1OXVA 1VYTA 2QVGA 2X0KA 4FZRA 1AIPA 2LDXA 4J16A 1RADA 2DPMA 4QPDA 5D7NA 4D8XA 3C87A 4EHIA 1QUEA 4CKCB 4JYAB 3OTQA 4KPGA 4L72A 4BLWA 3FPFA 3BWCA 3F67A 1L5NA 3DM9B 3NONA 4BV2A 4LFAB 1FDUA 5B1SA 1ADCA 1O5TA 1H1DA 1DRJA 4ACAA 3IUYA 3L3BA 4O2AB 1HNZB 3DKRA 4GKBA 5L6LB 4QXQA 4MEBA 1PU2A 3L5KA 2QRNA 1GU0A 2GERA 5G02A 4BIIA 4Q3KA 5DTEA 3HYSA 3V2HA 4YAIA 1GU7A 5EXTA 1SVMA 4INAA 3MGBA 4ZQBA 3F8SA 3FNEA 3VYTB 4X84A 1XT6A 1LPNA 1W5BA 3CH4B 4RDCA 4B4WA 5AVQA 1Y9EA 2VHZA 3DFUA 1WBBA 4DA6A 3SG0A 1K4MA 3FFXA 4JB2A 1X1DA 2AZTA 3HBJA 4QQKA 4LF7B 4HB2A 4OXKA 3MBOA 5GADl 4PSKA 3O2SB 4BMOB 4WCDA 4MARA 3SM3A 2GUGA 4KQIA 4QG7A 4DIUA 2XGSA 1RLJA 3CEJA 2VQ3A 1Z33A 2VP4A 1IUPA 3PUXA 1UJCA 4OMCA 3HZHA 4K2HA 4FI3F 4IJMA 4CM6A 4DM3A 1FK8A 3H9GA 3P0RA 4BYMA 1UP6A 2WHRA 2W37A 1QZ3A 1JGTA 3HN7A 3HYLA 4DPMA 3H9JA 1OPRA 2VQSA 5DLQC 4HC4A 1MFZA 3ZWVA 4XYLA 5IXYA 1TA9A 5J43A 2WF8A 4L4SA 3O31A 3UFBA 5JIBA 2PR7A 1DIBA 1IPFA 2QUJA 1QAMA 4PG6A 1V8FA 4PE5B 4JSRA 2C9YA 5JI2E 1K5PA 1ZKMA 3B5IA 2PS0A 1YDGA 3V7NA 3G02A 3FZGA 1TKRA 1FXWF 1MV8A 2A0WA 2R6AA 2WJPA 5J9FA 4RJ2A 3EGEA 3MGGA 1PQWA 5ECGC 5G0TA 4KBFA 4NARA 2C3MA 4C0QC 3H2GA 4NV3A 4PGHA 1U02A 2ATXA 4GUDA 3HC7A 4TV8A 3R5TA 1NMSA 2XQGA 3RS8A 1E1QD 4AF6A 4MLPA 1NYQA 3AHEA 3WC4A 3AB7A 1XPOA 3MJRA 2EZ9A 2FW7A 3VSEA 1ITZA 2NU6B 2VSNA 4KREA 2O7NA 2VT2A 3K8QA 4R16A 3ED5A 5LQSA 3HJNA 2PJUA 3DNFA 4FR5A 4UU7A 1CRPA 1RHQA 4MWZA 2VYVA 2DPGA 4EP1A 1WA5A 5TS2A 4OSEA 2KLBA 3WL3A 3F6RA 4L95C 1CFZA 3AM4A 4G1FA 4EB0A 4EB6B 2IHNA 3OX3A 3TRHA 4EGQA 4WTOA 1DUIA 1M1YE 2A1UA 1WY7A 4R3UC 4BQIA 1KK3A 1TOAA 3OE4A 5EP2A 3RWMB 5K6TA 4DV1B 2DERA 1NIJA 1DJLA 2XIQA 2J31A 2PVPA 1WPQA 2CLSA 3KB6A 1MJHA 2R84A 2X2PA 4DSZA 1YTLA 3RKUA 2PCLA 3D0OA 4GVLA 4CYMA 2XOKA 2QP4A 2VHVA 4L73A 3L40A 2YS6A 1Q0TA 2DBQA 3AEQB 2GD0A 2JJ1D 4R05A 4TLLB 5EE3A 2PT9A 5AXAA 4BFWA 1JEYB 4A0FA 3IP3A 1A9RA 2W2KA 4MW4A 2ZJOA 3V4VB 3VYWA 4W8OA 4KLRA 3E18A 4LDQA 4HI0E 4XI9A 3FAZA 1NR7A 5KMGB 3ADOA 4XR9A 2F8SA 1Y42X 2I8AA 2QRLA 2XKJE 2P0EA 5CM8B 4AZTA 4EEZA 1IULA 4GYWA 4OYLA 1ECPA 2YY6A 5IU6A 3EY9A 3AR3A 1OV6A 2NNLD 1FUKA 5HIKA 1XR3A 1UAYA 5D51S 7YASA 4BWFB 3QFRA 6NULA 4R98A 2BFMA 5CD9A 1EVIA 4LV8B 1OZGA 3OFJA 1E18A 1GGJA 3ES9A 2GNOA 3GFQA 3M4ZA 3D64A 4MV8A 2Q41A 3BPSA 4BEJA 4MP6A 5AM5A 2AQKA 2RH5A 3QXCA 1AMNA 2V45A 4U1RA 2ZIGA 2VTBB 3H4TA 3TLGA 4C7VA 4MRVA 4YCLA 4B43A 1JU3A 2ZXFA 1KE2A 3RSZA 1K3TA 2HA5A 3EVFA 4S05A 4WQMA 1UINA 2O8BA 4RE5A 4KJZA 3FFTA 3TD2A 2LZ0A 5FTNA 3THSA 5JAPA 4P0PB 1L9KA 3I9FA 3ENQA 4XQ9A 2J3MA 1A9TA 3AUUA 3L0YA 2HIGA 5HIMA 2ACKA 4F0JA 2CJXA 4EG3A 3KETA 1GY8A 3N0RA 3DE5X 2ZB8A 4YJDA 3NWOA 1K0UA 2M2IA 3HEMA 4NENA 5E95A 3ZWXA 5FOWA 3TBKA 2PD3A 3WK4A 4AF8A 3MOSA 5B12A 3WIOA 1Z0AA 3ZD8A 4DR5B 1T0JB 4EG4A 1AXEA 2A88A 2GSWA 4JZYA 1E79A 2AH5A 2ZJYA 3EGWA 1G9SA 1PTJC 2BEWB 2JFHA 1AKTA 2QZSA 1P80A 3EQ2A 1ELOA 1KBZA 4KV7A 1CJSA 3LDHA 2ZIUB 4RK7A 2DETA 1TM7E 2II6A 2R65A 4EI7A 4ZQFA 3ZVMA 4OKSA 4IH9A 3HRHA 2A5FA 3BAZA 4OGGA 4S1PA 3NDBB 2PX2A 5GGXA 1K8RA 4XYEA 2H92A 1SRQA 1R6UA 2OPBA 2B8EA 4L6AA 3U61B 4K6KA 3RDPA 4BFZA 2PUFA 1DOHA 2QNIA 2FZ5A 1CUUA 4EI9A 3F5FA 3OE7A 1GUYA 1NRWA 2ERCA 2HCBA 2QRJA 4JBHA 4U0KA 4D7AA 4ZYVA 3RAFC 3R7BA 3UC5A 2AL7A 3T06B 1F12A 1W2WB 4PHGA 4HX5A 4R8SA 1VECA 4BKOA 1I6WA 4MUGA 3VU9B 4B84A 2COEA 2I7CA 3ER6A 2VXCA 4RWEA 3SLRA 2HA0A 4EG5A 1QIIA 3PNSA 1DT3A 1OUMA 4LWPA 2BCEA 4OGFA 4P4SB 4RKWA 2G40A 1VIDA 2IH2A 3OG9A 5LCXA 1GAXA 3PPXA 3PKIA 4JHXA 4JVMA 3WRXC 2AFHE 1UMDB 3FWPA 2C8JA 3CW9A 1VJ5A 1BX0A 3MNFA 6LDHA 3NP7A 1ZM4A 1FYDA 4O4IB 1LQUA 1GVNB 1X8KA 1E6LA 1NT2A 1QCCA 3I6MA 4AVYA 2HKIA 4HSEA 3DAGA 2PM8A 2UAGA 3CRVA 1V1RB 4IF4A 2BEVA 1W5TA 2QVXX 5BQ5A 4F5DA 1TD9A 1A3CA 1D0SA 1MC1A 2VSQA 2FFRA 2J4FA 4RK1A 4W6QA 7MHTA 2HIHA 1BCSB 2I99A 3PWTA 4MUHA 3ADBA 1DCFA 3ANXA 2QMZA 1SHZA 4S0XA 3O4VA 1B23P 5IZCA 4H15A 1UK8A 2QZPA 3OY2A 3WB1A 1TCVA 2D74A 4YYZA 4DG5A 4TTIA 4CI9A 5C8YB 1DC8A 2JAOA 3QPDA 1TYAE 2QK4A 1Q7RA 3KB1A 3F7MA 1CP2A 1JBEA 2OCPA 3QVGA 1D09A 5CLGA 4RKEA 5BSTA 2FW1A 4F96A 3MCTA 1NVTA 1XZNA 2P4QA 1E2DA 3C24A 3DQQA 2BGIA 4Q7EA 4XDYA 5CT4A 4XPZA 5AI8A 5ALJA 4IYRA 4ZV4A 3ZQJA 4BWGA 4AYWA 4KRXA 3TGPA 1P2DA 1KJIA 1ZCZA 2DFVA 1UT6A 3EULA 4MUIA 3O95A 4RA9B 3RSHA 1GDTA 1CRQA 3ENKA 4ZAWA 3ZDCA 4IGFA 1SB9A 4JLKA 4CIXA 1ZH6A 2WBLC 4OCZA 2RAUA 1U1FA 1QORA 1IAVA 4ZOLA 2HRQA 3HVRA 1NUTA 4NBUA 1G21E 1YCFA 4REOA 3MWKA 5JAQA 4ZICA 1P1RA 2YZ7A 1QDLB 1IB0A 3NEJA 3WSVA 2H52A 1F14A 3A05A 2XVAA 3WL8A 4DDVA 3K70B 5IDXA 2WKSA 3BDIA 3MHPA 1M34E 1FDTA 4KN8A 3A1EA 2ZE8A 4P22A 1XTBA 3M9XA 5DGIA 1ZR2A 5I7RA 4LBZA 2QHXA 1P77A 2WKPA 4KC0A 3HY3A 4RH0A 1JAXA 2QXYA 1K7SN 3ZK8A 3KYBA 3BD6A 2XHZA 1NRIA 2ZIZA 2XB4A 3DB2A 3DBHA 1N7GA 3AGPA 2I1LA 3V4LA 1COWD 1Q1GA 5BSFA 4BKPA 1WPRA 1XPJA 5FHRA 3U48A 1TC1A 2HRRA 4IL5A 1JU4A 2XD9A 2YJZA 2W2XA 5EWMB 4ZT4A 1E2LA 1QRRA 1T9GS 3DHYA 3MXOA 4RVSA 4K3VA 5DNEA 3V4SA 5L9AA 4I4IA 3HUFA 4IO0A 4F1KA 2VYQA 4M9RA 3O0TA 2BI7A 5SY4A 5AM3A 1PGJA 2ZOSA 1ZRHA 3NPAA 3M4JA 1OXTA 1CVIA 3LX8A 1WVMA 4MKZA 2FRDA 1J2YA 4K5QA 2Z6UA 3W5UA 4FW9A 5PGMA 2J7PA 3L46A 3PX3A 1QP4A 3JYOA 3RYIB 1NY6A 5BW4A 2PKWA 1KEUA 4D46A 2XT9A 1EFPB 4A16A 4CEHA 2RG7A 3IR6A 4EDFA 3G2NA 3LBNA 3Q0TA 1WAMA 1W5EA 4A6XA 5B4VA 1RC8A 3ADDA 2E87A 1CYDA 1D2HA 5TJ9A 2JEOA 1H2XA 5LMNB 4S24A 4ZAVA 2GA9A 1V4NA 2FPIB 5FQNA 4DQKA 3JAKA 1C0IA 4H31A 1YRHA 4MAFA 2UZ3A 4M49A 3GZ4A 2IYNA 2VQ6A 5ALUA 2V7TA 2AOUA 4II3A 4G01B 1VM6A 1EX9A 2OOSA 1ZHHA 2H8KA 2X1MA 3QUCA 1PEKE 2VN8A 1NBAA 2JH8A 3GRYA 3NHKA 4I4TA 1UKVY 3BA1A 1Q22A 3P4XA 5GVSA 5KC9A 2CLCX 4L08A 4E12A 4HWPA 1L5YA 4RYLA 1HI9A 1SU6A 2CL5A 4BNIA 2GD2A 4TS9A 5BOSA 1F2VA 2RSLA 3MAAC 5E7MA 4FHFA 4GMGA 2PCJA 1SGWA 2G76A 1EFVA 4H27A 4R2XA 4UPVA 1BXRB 3ZJUA 5HF9A 1V4VA 3LVQE 3OCZA 3F6BX 2BUBA 3LY9A 1YDHA 2Q6LA 4P3OA 2ATIA 2EF1A 2IX9A 3K70D 1I10A 2Q0XA 4BLUA 1SY7A 3BTUA 1IHPA 3C98A 4IOLA 5EIXA 2AC7A 4D0NA 1EGVB 2VFAA 4BXOA 3FRJA 1BE1A 4ZVRA 4DR1B 1KOGA 1QMGA 1E7SA 2FWBA 3IBTA 3FF1A 2H5LA 3L0IB 3HGMA 4HLUA 5CPFA 2DLCX 2OVFA 2RI6A 1HL3A 4EHAA 2WF7A 3P4UA 1K89A 2PS1A 4LDRA 1L8OA 3E3MA 1V8PA 1I94B 1T5LA 4MA4A 2PPVA 1WB4A 1MTOA 3AM3A 1NVVR 3VUFA 4TYPA 4UEQA 1KBQA 2A6PA 2XNHA 5HF8A 4AULA 1I7NA 4B3CA 4M1OA 1F51E 1NKSA 1OVGA 3R7DA 1MVNA 7GPBA 1ZUWA 4BFYA 5J23A 2E4YA 4Q5IA 2WFLA 4AZWA 2UUBB 4BE7B 1TQ4A 5J5VA 4Z0NA 3UM9A 2FR1A 4JB3A 1IFXA 3NI2A 3WDMA 4BEVA 2QBYA 2WI8A 2H8GA 3V6MA 4FYIA 4PTYA 4UUAA 3UWKA 4C3OB 1TU3A 2IEBA 4AX4A 5CB4F 1DS6A 1RFLA 3H4IA 3Q5GA 1YS4A 2PZMA 4RF5A 4Y1EA 1Y1SA 1NP6A 1TLLA 2ATEA 4YJGB 4KQXA 3BCSA 4PGAA 4G0MA 5ERYA 1ZEJA 1N8SA 2AN9A 3SF8B 1M10A 3JD2A 4P5PA 3QEBZ 2PX3A 4O4HF 4HDNB 2Y93A 4BPRA 5CVTA 1RCFA 2UU9B 4F72A 3C4VA 4ZI7F 2HSDA 4C05A 2G4LA 3TL6A 3QK7A 4Z3DA 5J3JA 2GVNA 5CLHA 1QP8A 2RE8A 1XPUA 5EJ7A 3KQHA 1SQ0A 2H4XA 3T7TA 1DAFA 3DMTA 3FLBA 2ZI4A 1XQVA 4RETA 5CURA 2V6GA 3DBVO 1O1YA 1F0KA 5LB2A 1I3LA 2FPKA 4P36A 1NOIA 4LGCA 3I92A 4Z0HO 5H80A 4JEHA 2IOFK 2Y1XA 1Z74A 2Q5FA 4L5JA 3OT1B 3V4RA 1RJ9A 3NG1A 1QGDA 4QFCA 4M0KA 1SK8A 5LIPA 4GI5A 4DR4B 4B6FA 4C7OA 2QW1A 3UFXB 3K96A 3HYRA 3FDXA 1TADA 4FYHA 4LQLA 2QAGA 2IGBA 2YZ2A 4I66A 5EZ6B 3IXMA 5HQ3B 3NYWA 1A9QA 1EUZA 1ZXLA 3BE4A 1IRXA 3B9RA 4IWXA 5EOVA 4BMNA 2ZVJA 1GCGA 4WXMA 2AA3A 5FA6A 2XDQA 1I4EB 2LD4A 3C7KA 3TRKA 5CFQA 1ZM2A 3OH8A 4AN4A 1JFLA 1SXJB 3PXXA 1VXRA 3JWHA 5BUZA 1EZ1A 4D43A 1QU2A 4PNHA 5JXWA 2X41A 2ZRIA 4WESB 1HE8B 3BKWA 4WJKB 3CO5A 3W04A 3BQNB 3O91A 2MYNA 4G0UA 3JSXA 5DN9A 1F1JA 3H87A 3RBZA 2K2QB 3M1AA 1QTQA 3VVCA 3Q6IA 2JCXA 4YASA 4Z54A 4PXYA 4N0PA 4URWR 2ZYRA 3I5XA 3CF6R 1K75A 1ZOSA 2RI1A 4RZSA 1IAQA 4GSKA 1WR8A 5BW6B 3AP3A 4QUKA 2IP4A 2Y9PB 3Q8WA 5ALIA 5BN4A 3FH0A 2Y0BA 2A59A 2REQB 2GT1A 1UDCA 2H57A 3AZOA 2V54A 3TNLA 4YJ3B 4FFBB 1FYFA 4PSVA 2OMEA 1FFBA 2ODAA 3QLVA 3JYNA 4UC0A 1IOVA 4PFSA 4E07A 1J49A 4DLBA 4B40A 1YR9A 3QRWA 1Q7EA 4J03A 1O95C 2BTQB 3EHEA 3KC2A 3UH1A 2YWEA 4B6JA 4BCBA 5DM1A 3B9QA 3ZW9A 4YX9A 1QGUB 1U8AA 1UQUA 1R8QA 2YASA 3R77A 4OU4A 3UPDA 1QIEA 2J1LA 3GEMA 3RE1A 2BFPA 2RDMA 2FK7A 3RC8A 3CIOA 5JMOA 3LF1A 4Q3EA 4BO5A 5BY2A 2XQIA 4BO1A 3TX6A 4GP7A 2K7FA 1ILWA 1NBEA 1XTJA 2ZSEA 5H81A 3M6IA 3O8NA 2ZWOA 5E7QA 4J0JA 2NTJA 1ZK2A 4HO1X 1YV9A 1W47A 1FBNA 1O6CA 3FZNA 3KQVA 3RASA 5CH5A