4PINA

Ergothioneine-biosynthetic methyltransferase egtd in complex with n,n-dimethylhistidine
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
322
structure length
320
Chain Sequence
b'HMALSLANYLAADSAAEALRRDVRAGLTATQKSLPPKWFYDAVGSDLFDQITRLPEYYPTRTEAQILRTRSAEIISAAGADTLVELGSSEKTRMLLDAMRDAELLRRFIPFDVDAGVLRSAGAAIGAEYPGIEIDAVCGDFEEHLGKIPHVGRRLVVFLGSTIGNLTPAPRAEFLSTLADTLQPGDSLLLGTDLVKDTGRLVRAYDDAAGVTAAFNRNVLAVVNRELSADFDLDAFEHVAKWNSDEERIEMWLRARTAQHVRVAALDLEVDFAAGEEMLTEVSCKFRPENVVAELAEAGLRQTHWWTDPAGDFGLSLAVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine-specific methyltransferase EgtD
publication title Ergothioneine Biosynthetic Methyltransferase EgtD Reveals the Structural Basis of Aromatic Amino Acid Betaine Biosynthesis.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 105
structure length 320
sequence length 322
chains with identical sequence B
ec nomenclature ec 2.1.1.44: L-histidine N(alpha)-methyltransferase.
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10017 Methyltransf_33 Histidine-specific methyltransferase, SAM-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pinA01
4GEKA 4HGYA 9MHTA 3O7WA 2UYHA 2C7RA 3HVIA 3LDFA 3RIEA 2NXJA 5C1IA 4FGZA 4E2ZA 5JUWA 4U7TB 5K0JA 2PXAA 5GM2A 2Z6UA 3GIWA 5U4XA 2IBSA 1VIDA 2EG5A 2NXNA 2Y1XA 4IV0A 2JHAA 3KPJA 3SM3A 3DMHA 5DX0A 5EQJB 2OBFA 2YXLA 5K03A 2O05A 5IH3A 2ZZKA 4Y2HA 5FUBA 3X0DA 3LL7A 2PVCA 3PX3A 1SVUA 2C7OA 3REOA 5HIJA 3S68A 1JR4A 5HZMA 3UJ6A 4RV9A 2UYCA 3ME5A 2AOWA 3CJQA 5G02A 3O31A 4XUCA 3THSA 2BR5A 2PBFA 1R18A 4HC4A 1XXLA 4UOEA 3FUWA 5FWAA 2ZIGA 3T7RA 3P9NA 3I9FA 3OE5A 2JH8A 3I5UA 1KPIA 1O9HA 3JWIA 3MB5A 3NVKI 1NKVA 1ORHA 3LCVB 2PY6A 3JWGA 1P1BA 3KPVA 1YZ3A 3PS9A 3EGVA 5EEHA 3NDJA 2R3SA 4YUVA 5HFJA 4PGHA 1RJDA 5B1SA 3SSNA 2NYUA 5LQUA 2G8NA 5DM4A 2P3LA 5E1BA 2PKWA 3BWBA 3KQPA 4CTJA 2IIPA 1WY7A 2P1DA 3BGVA 3MERA 4RTKA 3FTCA 4P7JA 1KPGA 3B3JA 4MWZA 5EMJA 3IYLW 2IDJA 5K0EA 2XBMA 4OQEA 5EVJA 4QPNA 3G8AA 2I62A 3FUTA 3UA3A 1DUSA 1WXWA 1SUIA 2CKDA 2PJDA 5BW4A 5HIIA 3ORHA 4GOOD 1X19A 2ZVJA 2KW5A 1XCLA 2XYRA 4RX1A 4PGGA 5CVEA 5GIOE 5K8VA 4OX9Y 2IDKA 4CTKA 3I53A 1KHHA 2AZTA 3G2OA 3OPNA 4WVLA 3SXJA 1TW2A 3TQSA 3UJCA 1L1EA 3BGDA 1FPQA 1X1AA 3HCCA 4R6XA 3HCEA 2AOTB 2O06A 3CC8A 4FR0A 3DR5A 4X61A 1KXZA 1L3IA 1R8XA 1RJEA 2B2CA 2GH1A 2QYOA 3KKZA 4RTJA 2OO3A 5FHQA 1VP9A 3SMQA 2HMYB 3GGDA 2IGTA 4LWOA 2BH2A 5CIYA 5EZQA 3A25A 4CKBA 3UJAA 3OU2A 3FTDA 5E9WA 2ONYA 2VZ9A 5FQNA 3KQSA 1NW6A 1X1CA 2ZLBA 3KQTA 5LR6A 3BT7A 3TPZA 3C0KA 4U7PB 1YF3A 1Y8CA 4CWAA 4LECA 4YUWA 4EVIA 3EVGA 1KYZA 4QQKA 5K0BA 1VLMA 3HVKA 3EVCA 1JQEA 1ZG3A 4YMHA 1Q0TA 1EJ0A 1EAMA 4FZVA 4XUEA 1SQFA 3R6TA 1RI4A 5FULA 3D2LA 4EK9A 4GOMD 4PYMA 2QRVB 3TKAA 1P39A 1XJ5A 2HTEA 1H1DA 3E7PA 3P71T 2CWWA 3UA4A 1N7IA 4BLVA 4GUAA 4MTLA 2AVDA 5LQJA 2LD4A 3FTEA 3B7PA 4ATNA 5DM1A 2HV9A 1QZZA 5EIFA 4ER5A 3PLAE 3T0IA 1JQ3A 1T43A 3AJDA 1OR8A 3FPHA 3EGEA 4F84A 2OB2A 3PVCA 4X41A 3LBYA 5CUQA 3V8VA 3I58A 2AOUA 2C7QA 3AXSA 3DMGA 3BWYA 3MGGA 3HM2A 5KS2A 2OB1A 1JSXA 3GJYA 4C4AA 1RJGA 4E2YA 3KQWA 4R6WA 4M37A 1F3LA 1O54A 2GAFA 3LX6A 5EGSA 1D2CA 1EJ6A 3KR0A 3MTIA 2Q41A 5E2AA 2OKCA 3CBGA 4RSRA 3IHTA 3UJ9A 3TM4A 4RVFA 2NNWB 4GOLD 2BM8A 3ELDA 1F38A 2PWYA 3HA7A 3JWJA 4CKEA 2ZBQA 3FUVA 1M0EA 3GXOA 3SR4A 2HNKA 1WG8A 2PXXA 3FUUA 1KR5A 3HTXA 2FHPA 3G7UA 2YUIA 3PFHA 1XVAA 1R74A 3G5LA 4KIGA 4QPPA 4QTTB 5E8JA 5K0NA 4GBED 1EIZA 2F8LA 3UJ7A 3PB3A 3GRUA 1ZGAA 4ER7A 3O4FA 3P2EA 5EOVA 3CVOA 4OA5A 2QE6A 3M6VA 5DPMA 3V97A 2QRVA 7MHTA 3GCZA 4C08A 4HG2A 3UFBA 3KR1A 1NW5A 2ADMA 4OQDA 4BP3A 1XCJA 2O0LA 3L8DA 5FA8A 5M5BA 4R05A 2AS0A 5DTRA 3BZBA 2AR0A 2YR0A 4QVGA 1V39A 3BUSA 1EQAA 2AOVA 1UWVA 4GF5A 2IH5A 4QQNA 4HGZA 3HVJA 5CVUA 4P7KA 2ESRA 3MTEA 3G88A 1KIAA 5E1DA 2V7EA 2QY6A 3VC2A 2ZBPA 1PJZA 2VDVE 1NW8A 1NBHA 5EIWA 5GM1A 4EKIA 3EVAA 3GNLA 4XUDA 5LQAA 2PLWA 5K01A 5KQRA 2P40A 1WS6A 2YXEA 4CXMA 1VBFA 3EMDA 1QAQA 2I9KA 2NP7A 3B3GA 4RYLA 1L3BA 3M6XA 4Z2YA 3GU3A 3QOWA 2DULA 4OBXA 3TOSA 3AWIA 4DCMA 2JHPA 2GS9A 2PT9A 5EHIA 3M4XA 2IPXA 4KDCA 3PTAA 3FUXA 3T7SA 2P3QA 3KPUA 2AN3A 5EZSA 2JG3A 8MHTA 5DM2A 4P58A 2ZWVA 4E2XA 3GRRA 4KDRA 4F86A 5DSTA 5FHRA 1G8SA 3LDUA 4HH4A 5DLYA 2C7PA 1Z3CA 2ZZMA 3OZTA 3FRIA 3G2PA 3GWZA 3NWBA 4KWCA 4ER3A 2B78A 5BP7A 5FCDA 1JG2A 4O29A 3UJBA 3MCTA 5GWXA 5FWDA 4AUKA 4PNEA 2UYQA 3GRVA 4PCLA 2XVAA 5HOQA 4DM3A 4BP1A 4JXJA 4X63A 4GC9A 2H00A 4R8RA 3Q87B 1TW3A 5LQNA 2FK8A 4DA4A 1VPTA 4ER6A 4Y30A 3GRYA 4GOND 3NVMB 4GC5A 2FYTA 4PCAA 2ZW9A 1KP9A 3MCZA 3R3HA 2BZGA 5ICEA 5IKMA 2FPOA 4V0RA 4EMSA 3WSTA 2FCAA 5T64A 3LKZA 4BLUA 4E70A 5CM2Z 4BY9E 4KW7A 3CJRA 4AZSA 3P8ZA 5LQCA 2Z6AA 3UWPA 5DRTA 2K4MA 2H11A 5F2NA 3C6KA 3BWCA 3I64A 1L3CA 1L9KA 1TPYA 3MHTA 4KVZA 3LCCA 1R8YA 2ZCJA 2V74B 4RTPA 3E8SA 3SX0A 4PINA 3LHDA 5CVJA 5E1OA 4F85A 4NECA 1RJFA 2AN4A 3IEIA 1VL5A 4ZTBA 2ERCA 3HCFA 3EVDA 5DTQA 5ICCA 5T67A 5DM0A 3ELWA 2JJQA 3A4TA 1ZHFA 4YUYA 1BC5A 3KQYA 2VDUE 3FRHA 1WXXA 3BKWA 3DULA 3KQMA 4QTUB 5HILA 2IFTA 3B3FA 3OE4A 1NT2A 3PX2A 2OYRA 4YV2A 4RTQA 4PYIA 3HA5A 3TFWA 1I1NA 3UJDA 3NJRA 4AZWA 2HWKA 1FP1D 4G56A 3GO4A 1G6Q1 3EMBA 3IV6A 3LECA 3EVEA 2B25A 4PYKA 1MJFA 2ONZA 3C3PA 3HCBA 1R00A 4MHTA 3NWEA 2EJUA 2G70A 2H1RA 1IM8A 3VSEA 2YXDA 4FS8A 5EMMA 2AOTA 4A6EA 3BKXA 5T6BA 1FBNA 2VP3A 2ZTHA 3P9IA 4QDKA 5FA5A 3A7EA 2UYOA 4DF3A 2EFJA 1QANA 3OZSA 1O9GA 2O57A 3FPGA 3G5TA 4YUXA 1D2GA 1FP2A 3DOUA 3GRZA 5K0CA 3EVZA 1JTFA 4M38A 3NMUF 4OA8A 5F2OA 5DRYA 4RTRA 2OZVA 2XYQA 3SGLA 2OPBA 3OU7A 4RVDA 5KQSA 4H0NA 2WK1A 4FT4A 3VYWA 2BR4A 2IH4A 2PX5A 3LSTA 4PYLA 5D1NA 2QM3A 2DPMA 1JG3A 5ICGA 5F2KA 1PRYA 1YFJA 1SG9A 3TRKA 5CCBA 3ER9A 4WXHA 2PGXA 1AV6A 1KPHA 2N47A 2NP6A 2GPYA 5K09A 4FT2A 5CVVA 4E33A 2PXCA 2VDWA 4X1OA 1NW3A 1N7JA 1XDSA 1G60A 2NXCA 3PFGA 3KPWA 1DL5A 4PYQA 5EPEA 5HIMA 3SVZA 4C04A 1D2HA 2G71A 2Y1WA 3FPJA 3C3YA 3P9CA 1G38A 3T7TA 1VQ1A 1XTPA 1ZKDA 2I6GA 3DMFA 3BGIA 3P9KA 2E5WA 2GB4A 3BWMA 5CVDA 1BHJA 5ERGB 1UFKA 2P35A 3HA3A 3LCUA 1NV8A 2P8JA 3C6MA 5E1MA 5DX1A 2PSSA 5C0OE 3E05A 5ICFA 5K0LA 1AQIA 4V0QA 4P7GA 5K0FA 4DKJA 4QDJA 3LPMA 4R8SA 5LQRA 4LWPA 4PIMA 5LQKA 4PYJA 5E9QA 5EG5A 2WA2A 4DZRA 1YZHA 2IP2A 3E23A 5P8WA 1HMYA 3G89A 3HCDA 3M6WA 3THRA 2ORED 5H02A 3DXYA 3ID6C 5EMLA 3KQVA 2JHCA 5KYGA 3KQQA 5FQOA 5LSAA 4FSXA 4IKPA 4LG1A 3AXTA 2ZIEA 1YFLA 5EKXA 1P91A 5DT2A 10MHA 1SQGA 4X60A 3DTNA 4C05A 2ZWAA 2YX1A 3UZUA 2R6ZA 5DXAA 5FTWA 3G8BA 5KVAA 2UZ4A 5E9JA 4RTMA 4XCXA 1XDZA 2PV0A 5E8RA 2I7CA 3OFJA 1YUBA 3FPFA 1R6AA 1YB2A 3DXXA 2NXEA 2A14A 3ELYA 3TM5A 1JTEA 5EKUA 4CKCA 3RODA 4RTNA 2BM9A 2AVNA 3AY0A 3F4KA 1UIRA 3EPPA 4RVGA 5D1HA 5EHGA 4ER0A 1X1BA 2PX4A 3CJTA 3DXZA 3NW9A 4QVKA 3A7DA 1NW7A 3P97A 1ZGJA 2CMGA 2PX8A 1JG4A 1QAOA 3OFKA 3NDIA 4K6MA 3FTFA 1RI3A 1HNNA 1I9GA 4P7FA 5GP1A 1ORIA 3TMAA 5HIKA 2PT6A 4HTFB 5EC8A 3QOXA 2YVLA 5GOZA 1FJXA 4YMGA 3BXOA 4DQ0A 1NBIA 1RI2A 3EGIA 2PWPA 3DH0A 3JWHA 4FP9A 2EJTA 4PYOA 4A6DA 3ER8A 1IY9A 4RTLA 2XVMA 1IXKA 1KYWA 4RTSA 3G2QA 4KIFA 4E2WA 2ZSUA 4RVHA 2P7IA 1B42A 2ZULA 3CKKA 3HEMA 2WA1A 3RW9A 2FRXA 2AOUB 3LGAA 1WZNA 3SSMA 4M36A 3TLJA 5FADA 2FK7A 4IWNA 2YQZA 1G8AA 4EKGA 1Q0SA 2ZZNA 4C06A 1AF7A 1N2XA 2BR3A 2GLUA 2YTZA 5DWQA 3ELUA 3MQ2A 5K0GA 2G1PA 3EVBA 4L7VA 1QAMA 2ZIFA 3FYDA 2OY0A 5DXJA 4ISCA 5GINE 5JR3A 3EEYA 2CMHA 4YV0A 2IH2A 4EQZA 5DSXA 3LKDA 1NV9A 2O07A 3KPYA 2VS1A 5CCXA 5EMKA 5BW5A 1M6YA 2P3OA 3ANXA 3QV2A 4M7RA 4AZVA 3M70A 4C03A 5BXYA 2JH9A 1JSZA 1U2ZA 3HCAA 5C9ZA 3HVHA 3GDHA 4DCGA 1RI1A 2B9EA 1P1CA 4E32A 4YV1A 1VE3A 3FPEA 4HTFA 3A26A 3B89A 4GQBA 3ERCA 3FYCA 1RI5A 3P2KA 3CCFA 1QYRA 1ZQ9A 3DLCA 1XDUA 4KRGA 5DTMA 3HNRA 1INLA 3U81A 4MIKA 4AX8A 3KR9A 4PWYA 3OCJA 2EX4A 4B17A 1SUSA 1BKYA 2P41A 2PX2A 5HEKA 3TR6A 4E30A 5K05A 1EG2A 3G2MA 3KHKA 4YUZA 1AQJA 4FSDA 3HP7A 5DX8A 3TKYA 1M6EX 1JQDA 2Z6QA 1I4WA 3KU1A 4AZTA 3SSOA 4E31A 2XYVA 2ZFUA 3M6UA 3B5IA 3R0QA 5MHTA 2GA9A 3NTVA 2ZBRA 3LDGA 4BLWA 3MAGA 4IV8A 2G72A 3UJ8A 1BOOA 1NE2A 1MHTA 2AOXA 5E2BA 3EVFA 4HRAA 4POOA 3CGGA 5CD1A 2HR1A 3H2BA 4RTOA 3M33A 3P2IA 4MQ4A 2CL5A 2AN5A 2B3TA 3DUWA 3OU6A 4PYNA 2OXTA 1G55A 1SKMA 1DCTA 1VP3A 3DLIA 4PONA 2IBTA 3DP7A 3K6RA 1JG1A 2P7HA 4C07A 4OBWA 5EEGA 4PIPA 3KQOA 3OZRA 3FZGA 3R24A 3EEOA 3KR2A 3VC1A 4DMGA 3UBTA 1X1DA 3LBFA 3PT9A 4RWZA 3R9XB 3Q7EA 5GIPE 3K0BA 4HSGA 3A27A
chains in the Genus database with same CATH superfamily
3C3DA 2P79A 4W1QA 1M8JA 5A3VA 2HMAA 1E5DA 2YQ4A 3O7WA 2OHGA 1LLDA 4URZR 1OYOA 1RHQA 1A7KA 1S3SA 1QG2A 3LDFA 2F1HA 1B2LA 3RIEA 4A23A 1NVDA 1YD7A 3KSUA 3H5NA 4NHOA 1TI7A 4NCHA 4IHKA 2EHJA 4JT2A 3LC0A 4O1MA 4IUDS 5E3IA 1V1JA 5TPWA 4GXQA 2QL6A 2EG9A 4JK3A 3WO0A 1MB3A 3M6LA 4JVNA 5FUBA 1N5DA 2V7UA 3LCMA 4AROA 5KNDA 2UZ3A 1MTOA 3DDUA 1VMKA 3PX3A 3S68A 3GLSA 2PZEA 4DLKA 2ZTVA 2HPAA 4G07A 4BNMA 2CZGA 2QM0A 3AJRA 3Q3EA 3LWDA 3K5HA 3P0JA 3RRFA 1L5GB 4FHEA 2EHDA 2E49A 2P9BA 4RKEA 1ILWA 3NNSA 3V9AA 4EQ6A 1K9VF 4C7MA 4D25A 1KVRA 1B00A 1OFTA 4HJXA 2ZR0A 4X8MA 1RFLA 3QZUA 1DWUA 4KO3S 4K6OA 1K88A 4Q16A 3VVBA 4RULA 5BRNA 2R3SA 5BR7A 1M74A 2B8EA 4G3XA 4PGHA 5D5QA 5A3JA 3NC0C 3CZQA 4LRXA 2G8NA 3IEVA 3I09A 5I9SA 2XKJE 4LBZA 3TE7A 1TM7E 3RBAA 1WF3A 2P5TB 4IGFA 3JR3A 3BC1A 4AULA 1ND5A 1NPTO 1G20B 2OHFA 3QEJA 4J0IA 2GVNA 2ZI3A 4BNXA 1L7AA 4JUFA 2F3UA 1VJDA 3EF1A 2C5GA 3GUYA 1IVNA 2C3OA 3NBKA 3Q8WA 5C46F 4TVKA 1YR9A 1E1DA 1YHYA 5C7LO 2OVFA 1IONA 4E1VA 4F8YA 3L40A 1JXAA 1U3FA 4L8YA 2LNDA 3IEMA 4K8RB 5P21A 1W36B 4ZYUA 4RU1A 1P60A 4JJAA 3VYSB 1B74A 1C5KA 1R0CA 1Y34E 2RC6A 2V58A 1BD3A 2PWZA 3AR6A 3NANA 5JZSA 1KXZA 1L3IA 3KKZA 4DQKA 4MXDA 2GRUA 4V02A 3DHVA 1HEIA 3VYRB 1D4OA 1GUAA 3IP9A 3PXEA 4OM8A 5EZQA 5GOTA 1PX0A 2JB9A 3SYMA 1T36B 3RVPA 3ZXUB 3TQIA 2GK3A 2XNSA 4EG3A 4PPGA 1ZPDA 4B44A 4K9NA 1K7EB 2Q5HA 3EBPA 3Q9UA 2IEZA 4XJXA 4G1MB 3STXA 4C2BA 1O97D 3OQMA 2GYUA 4OHRA 1Q12A 4UDNA 2FEMA 4B79A 1SCBA 5TQ2B 2WW8A 4WACA 1OWMA 1Z5OA 1K5DA 5EHNA 1ZGGA 4EL0A 2FRDC 1YO6A 1GTG1 1OZFA 3G9TA 5ARDA 5KWSA 4AMGA 3QF4A 3VDQA 1I51A 1U7HA 2FGJA 2VI5A 1E5VA 1F2VA 2ZSFA 4X8HA 1BKDR 1EVKA 2XNKA 3MRSA 2W6ZA 2AHOA 3ANMA 4MIEA 1Z0DA 2XQKA 1WMBA 4UMVA 3ETGA 4ATNA 5DM1A 4W8OA 1QZZA 3WHPA 1K6XA 1EH5A 3CR3C 1HL7A 1JI3A 2FPGB 2FVYA 2HFJA 3O4HA 3ZNQA 4PQRA 3N9IA 4BX8A 3AJDA 3T95A 4D96A 1OIWA 4DSOA 5BUZA 2Z2ZA 1UEJA 1UM9A 4UZSA 3S81A 4J0QA 3ET4A 1RVDA 4I99A 3I58A 2PKYX 3MGGA 2GK4A 4Q4HB 1YFZA 2PWBA 5LZ7A 4AUEA 1BDIA 4R6WA 4YP5A 1NKTA 1LQ2A 4CCYB 4U2GA 1QOZA 2VEOA 4J75A 1CFJA 5IK2D 1Q92A 1RRFA 1SVWA 1XRNA 1PL6A 3VHXB 4Z9FA 5KQPA 5CB4F 3P7MA 4IZIA 3PL5A 2IVFA 4RVFA 4DFDA 4DCVA 2OWDA 4CM1A 2IXEA 1F38A 3B78A 2OO5A 1J99A 2ZBQA 3RABA 1M0EA 1E7MA 4M9UA 2J9FB 3PXXA 1Z9BA 4UATA 1XVAA 2VDLB 1GFSA 3CW9A 5E8JA 3TLZA 3RS8A 4C2AA 1Q44A 5HKKA 4WBNA 3OJ0A 1P31A 3V7WA 1AKRA 2NO0A 3IVAA 4E13A 1MABA 3NPMA 4E88A 4R2XA 4DIEA 4KAFA 3RIMA 4U5QA 1VLHA 1NYTA 2ADMA 1Q16A 2JFFA 3H2JA 3O91A 3S5UA 3G2JA 1W0KA 2GN0A 4R41A 4BMZA 4LYEA 2R84A 1HV8A 2R47A 4ZEMA 1WD7A 1GV0A 1Z5PA 4WFQA 4WUTA 2R751 3FCEA 4MV5A 3PUYA 2FRVA 2LZ0A 4M4SA 4RAOA 2OOSA 5AXAA 3BDVA 1SM4A 5THQA 3D1JA 3ZJVA 3GJ8A 1QQTA 2RK3A 2WJJA 3MWKA 3G88A 4M0EA 2BFDA 2EFHB 2V7EA 4QG3A 4B4KA 1NW8A 2JGDB 2Q5FA 5AVJA 3USES 4LOJA 3NHLA 3OTWA 4AURA 3K5IA 1T6BY 3ZH9B 4WESA 1GKUB 4CG3A 1MC8A 2D0OB 1HYGA 2FQQA 1V1RA 5SYAA 1L4NA 4JYMA 4D3XA 4G5HA 2HWXA 5AK5A 3FCAA 2YVUA 3DV9A 5IYZF 1TMYA 1MQ9A 2ZT6A 5JCOA 4BKRA 4F2HA 3ZWDA 4IX9A 3VXKA 1LDMA 1R9JA 3CUEF 1H22A 4GXRA 2XCOA 1XA4A 4E21A 3ZTTA 4KDRA 1SHKA 4GMHA 3H5AA 3Q9SA 3WSVA 5CLLA 2FPXA 3ZEIA 2KHZA 1LVUA 2XMDA 3GWZA 1M67A 2A4MA 1RXVA 1XEXA 4MTCA 4D9MA 1DWPA 2ZPTX 3Q2IA 4QASA 5BSEA 2MSEB 4D80A 5ESDA 3IVMA 5E3HA 4D97A 4BO4A 3F6PA 4J1SA 1L1RA 4A8JB 4BO3A 3L8MA 3Q15C 1PSDA 3EXFA 1ECCA 2KBEA 4DSNA 3DL7A 1Y4AE 5I7WA 2Q4EA 1P6XA 1VPTA 3V4LA 5B7PA 3EOAI 3LO5A 4IINA 4L0DA 4GQAA 1QK5A 3BD7A 4WUVA 1HQYE 3KUKA 3O4JA 1M3SA 4MCJA 4JKYA 4A16A 2YJ3A 3KLPX 1D8TA 1WU7A 4US0R 4KMRA 2B30A 3H0EA 4DMFA 4AJ4A 2YIJA 4FR2A 4YT2A 2H1WA 1VB3A 5EA2A 3ZIAD 2F4VB 2H54A 3VJMA 1FFDA 1SG0A 4JI1B 2PSHA 3H5RA 3MINA 4M21A 3NQ41 4OXKA 1T5IA 4O3FA 3DCYA 5DNEA 1CIJA 4MA4A 3RUPA 4A4DA 3RT9A 2R7MA 3O90A 4JXXA 2CFOA 2GLXA 4MKIA 2ECQA 3KB1A 1ZJ6A 1GQSA 4G6ZA 4AS3A 2I33A 2YHAA 5BN4B 4NECA 1NVVR 1R50A 1LRKA 2CUNA 1K63A 1ZK1A 3OE7A 4G9EA 4NH0A 1BRMA 1KDVA 1J2EA 3JS5A 3NDPA 4XVQA 5ICCA 3RS0A 1F4LA 1L4UA 5JJLA 3QY0A 4MDYA 1VA4A 4RA9B 2WWIA 2X5KO 3FI0A 5C1OA 2XKBA 5AJWA 2NTEA 3TTUA 3EGCA 1AGPA 1WPGA 1RQGA 2BF4A 1BX0A 1W19A 3UATA 1JGTA 2WY2D 5FBZA 3MT7A 3QLUC 1M1UA 2GYWA 1QVAA 4ARZA 4YONB 2RONA 4MA0A 3C1UA 2QT0A 3A14A 1CSEE 2A9RA 2C97A 4NEGA 1SUFA 4BFSA 1O9BA 3CUWA 4C4YA 4EJ6A 1OYYA 3UT5B 4FGWA 3OI7A 4NESA 3QHQA 3SYTA 4B9EA 1NATA 1VE5A 3FETA 4G1BA 5CA1F 2GZAA 1B2RA 2CGEA 4MPJA 2BD0A 4FGSA 2CFIA 1FBNA 2GD1O 2I2FA 1F6DA 1TNDA 3REQB 2HA7A 2DERA 3TGLA 3OZSA 1F9EA 5C32A 3GGOA 1TXGA 5JJKA 2VP9A 5JO9A 1IHXA 1Z36A 1TC1A 4S2EA 1VZ3A 2M32A 3IO5A 1N2JA 3JD2A 3SIRA 2R4UA 1SBCA 3H1AA 2NVUB 2CSXA 4DBLC 1EE1A 3AJ8A 1N6NA 3LDHA 1O6FA 5JI2E 1CQPA 1M2NA 3V6LA 2CFRA 1YB1A 3MXTA 4WLUA 2B98A 5KNDD 2C7QA 4GPTA 1MC4A 4ZOCA 1J56A 5AK6A 4QYIA 2X8LA 1E6LA 1Q1QA 2WDPA 1GAXA 1C7IA 4FE4A 4D8WA 4WXHA 1RAEA 2MWMA 2IYQA 4WWHA 3TZCA 2IQ5A 3VNQA 2MSCB 1H3FA 1P1FA 2CLCX 4LC0A 2N42A 1T3HA 2VHJA 3GLFB 3UHFA 2WWRA 3GFFA 4JDPA 3BL8A 5K8JB 4LDAA 3FF1A 5IARA 3TOCA 4B75A 4DIKA 4NQRA 3CO0S 3LCJA 3WZLA 1ZKDA 4WVFA 3AUAA 4WBXC 3WL8A 3AI3A 5JISA 2E5WA 2J5RA 2ZJ2A 3BWMA 1UZLA 3E6AA 3FNQA 4KQKA 4J07A 5CVDA 3MG9A 1S2DA 1ZDMA 2FVXA 1DDOA 4HK4A 4Q5IA 3OLZA 5AJYA 2WM2A 5NLLA 4Z8XA 5TLSA 2PMBA 4RADA 1O95C 4Y6PA 5DGDA 5K0LA 1T8RA 5CBPB 3RSGA 5KJCA 3TSYA 3I34X 4QJBA 5D85A 2H4JA 4GBJA 2IGBA 5KCMA 4JGIA 1T2NA 1NXXA 2UUAB 2BM0A 4YAGA 3HYNA 1E1YA 1GV1A 1XLUA 3U3DA 3UAXA 1TLTA 1HURA 3HXLA 2ADFA 4DIBA 1Y1PA 4A8PA 3D8NA 4AB1A 1Y8AA 4JENA 1B3BA 3NVAA 1ZHOA 1NN5A 2WFLB 4ZI7F 4XSGA 5KREA 4YHHB 3WL7A 4Q1CA 3ZWKA 1V96A 2QRZA 3O8OB 4HWPA 5K2OA 3GDWA 5KYUB 2MYNA 3TBFA 1EK0A 4M8NE 1N5OX 4AJPA 4BLTA 2YMMA 3N1UA 5E9JA 3QK7A 2Z58A 4BRSA 2DY0A 2EP7A 4XVCA 2OQIA 4LJAA 1R6AA 2IYAA 3H9QA 4EUHA 5DW3A 1GL7A 3HKBA 3FY4A 4BNDB 4ETIA 4JITA 3AY0A 4AX4A 3K0SA 3H18A 1R7RA 1MO3A 1UODA 4KN9S 4KPUA 1I6MA 3X1DA 1ETHA 1V9LA 2OCIA 2X0RA 2XB9A 3CJTA 3ON5A 4LRYA 1Y3FE 1XZCA 2PZBA 1JG4A 5DO9A 1QCDA 3LVBA 3PFKA 1BIFA 4YROA 4LNUA 5HG0A 1HNNA 2X5NA 5BN1A 3NATA 4JJ6A 1KMIY 2JFWA 3AQIA 2X8AA 1U02A 2PGAA 2YVLA 1DRJA 4LK2A 2Z3ZA 8ABPA 4AWXA 3RS5A 1TMOA 1XLWA 1SAYA 4RTSA 3MSCA 4FGJA 2R8PA 2C3UA 2ZJZA 4Q7KA 4HLCA 3RVMA 5EP1A 1W85A 1ZL2A 1RU3A 2ZSUA 2W70A 4P22A 1PSZA 3ONWA 4BU0A 5HP4A 5GGXA 4AY6A 1YHZA 3ZHOA 3IA2A 3QVTA 1OTYA 1W2WB 3VKWA 5KQMA 1SNYA 4I5IA 3D6UA 3U0BA 1A71A 2X8WA 4TTRA 1NUQA 5ALMA 2FK7A 3UCFA 4HNGA 3T1VA 1H5UA 3G17A 1T5DX 3R7WA 3EF0A 1NG9A 4JUAA 3NDBB 4JBYA 4INOA 3EVBA 4L6CA 1QAMA 1VLZA 4OREX 3LLSA 3BWXA 1PK7A 4MV0A 4XX0B 4MSUA 2GT1A 1YE5A 3BIFA 1VHLA 1L5RA 1TEHA 2XY4A 3GGGA 1DINA 5TGTA 1AX9A 1YR2A 1HMPA 1M34E 1M2VB 1ZN9A 3CLSC 1HEUA 2W2LA 4NL4H 5BXYA 4J0HA 5IW8A 1T4CB 3DDZX 3RUAA 1TO2E 1JXMA 3D3WB 7ABPA 3WDKA 1NHWA 3HBNA 4N3AA 2EZ8A 3PEEA 4J9VA 2MSLA 4G09A 2AK3A 3IPXA 4HNAA 3V4VB 1EFUA 1ZC4A 3DVRX 4JYCA 4YPFA 3ERCA 2WNHA 1K3TA 3DLCA 5G4KA 1HE4A 5GJVC 4PS0A 3KAKA 4ZVOA 1HX7A 3DVQX 1W0KD 3DEYX 3IQEA 2FW9A 5JZOA 3THWB 4BU1A 2JVJA 5ALXA 4D8UA 1RWQA 4PG7A 4EY5A 1RCUA 4ZOLA 3TVDA 4C6TB 2XYVA 3A4VA 4E31A 6ABPA 3BFPA 3R0QA 1LSJA 2C5BA 2HMTA 2ZR8A 3LHIA 4WZ6A 1EUCB 4BFWA 5KNDH 4YBRA 1BOOA 4E5SA 3GCDA 3RYHA 5E4JA 5EKDA 3TTYA 5CD1A 4DMUB 5BMOA 1E99A 1CUGA 2NU7A 4WJZA 2I29A 4AMBA 2ASEA 3UMRA 3DBRB 1Z18A 4LDQA 3DL0A 2AC4A 2C03A 5JANA 5LDDC 3PENA 2V5AA 4ZMRA 3J80A 3WICA 1P5RA 2I4TA 4I6GA 1V37A 2WT4A 4Z7QB 3MJDA 5B6IA 3P2MA 4I0WB 4Z9XA 2DHDA 3IEKA 2B2NA 2P0AA 3RKUA 3LQKA 3ZXXA 4HSGA 3A9RA 3L1HA 3RV4A 1EB8A 4RE6A 4BKQA 2A5LA 3WNCA 1RLMA 2XUOA 1F12A 1P80A 2PGLA 3HSYA 1QB7A 1G17A 2RHLA 2I4LA 4XVHA 4DNXA 2HCBA 3JQCA 4YI5A 5B7GA 2ZREA 1YZYA 2JFBA 1QZUA 2FXVA 4JIGA 3A9VA 5AWFC 1W73A 5U4XA 3T3DA 3U37A 2BN4A 5BN3A 1VSUA 1Y42X 3HYLA 2O2SA 3R7SA 1OD6A 4EDHA 1VPWA 1UMCB 3L0CA 2J6IA 2JZOA 1F0YA 3JV7A 4CTOA 4PHHA 4QXPA 3J81A 5EPOA 3EIOA 2GBLC 2V0CA 2I2DA 5KOHB 1C9DB 5LXTB 4JNKA 3K32A 2ZTMA 2Q1TA 1TA4A 3BQMB 3LFTA 5HJEA 5KHLB 4J2TA 3Q8KA 2ATIA 3S1SA 5A05A 1STOA 3WIVA 1UOOA 4F5EA 3FOCA 1A69A 4OM7A 2FZGA 1AZLA 1JH8A 1GQQA 5JEEA 2FWMX 2BOVA 1Z6YA 3GOQA 5AVWA 4ARUA 1D1SA 5JCJA 3ZTYA 1Z5NA 3FCOA 4CMEC 1IQPA 1BSVA 5B1YA 1XG5A 1O9HA 1OZGA 2OESA 2VSQA 5CNKA 4U5XA 4XAQA 5CLGA 3QSYA 2GYYA 4U2BA 3PS9A 4B8YA 2IW1A 1ZSVA 4NICA 3UGJA 4PLGA 4IGEA 3WLAA 3WWDA 3PA6A 1CJBA 1TVKB 2CYCA 1XTUA 3HU5A 1MGPA 4NCJA 4ZAGA 1QVZA 4UDYX 2VJQA 3OE7D 2TSYB 4MWCA 3OF2A 5AXCA 5AI5A 4GM0A 3CV3A 1BGXT 2G9RA 5KUTA 5B53A 1QNLA 2JIDA 3I5AA 2OEPA 3QBTA 5EHZA 1KBQA 4B6RA 1ZNYA 4GOOD 2YWGA 5TX7A 4RX1A 1P5FA 1R0WA 3N2KB 4RVCA 1QX3A 4K88A 4L5YA 4AT1A 2SHKA 4X92A 4GPIB 5A9RA 5KYKA 1R66A 2N1MA 1RT9A 2JGJA 3S29A 5B7NA 3OCCA 4JI4B 4RFSB 1ZWLA 3RF6A 1SC9A 4D8VA 5BR8B 5JCZA 1P1JA 3ORFA 3GVXA 4RJJA 5JDCC 4CVNA 2WWYA 3CNBA 4FYMA 5BWOA 3AVQA 4BZXA 2VPZA 2KQUA 2IPOA 4LYHA 2PMCA 2HM7A 2EZ9A 2X13A 3A25A 3N58A 1AB5A 3HY6A 3C85A 5CG1A 3I01A 2H51A 1EK1A 4RMIA 2BE7A 4Y6QA 3DAOA 4PSAA 5FF9A 4JC4A 3IMKA 3OJCA 1JHQA 3B20A 4C6SA 2XNJA 3IT2A 4X6LA 1V1MA 2JBAB 1Y8CA 4N0QA 4E46A 4G0VA 4EVIA 2PKQO 2D1TA 5DASA 3PWZA 3OEHA 5DOVA 1E9BA 1VJCA 5HFNA 3B38A 1IBCA 4UE2A 5FAXA 4J0JA 4XUEA 4EF4A 1H2ZA 2IXGA 2Y2VA 3D2LA 3NOQA 5AI6A 3SJUA 3ST7A 4RM3A 2BHLA 4C89A 5CDHA 4R8MA 2R6JA 2JS7A 1VRWA 4B4DA 3W2IA 3QWHA 4EOGA 2JJ8A 3ICQB 5A4JA 5ITWA 4CW7A 4KQ9A 4QLBA 2IEIA 3WK7A 1U1EA 5DNCA 2J08A 3I2FA 4IJWA 3ZW9A 1RACA 3VYUB 4ZZ1A 4YR9A 4JB0A 5FB3A 3JATB 3MD0A 2XE6A 4C0LA 2DETA 3QKRA 4A15A 4W5QA 2XMPA 3V8VA 4DARA 3WRYA 3CKLA 4KBFA 2B8TA 2XUQA 5CM9C 4Z3KA 4CF6A 4B0PA 3FMGA 3JQQA 5BQPA 2DY1A 3QWFA 4V1CA 1RJ9A 1X74A 3IHWA 3TAHA 2WIFA 3C5VA 4EY6A 3GLTA 1Y3AA 2P27A 4LFAB 2E87A 1WXFA 3NHPA 5NULA 4A0HA 4GOLD 4KOEC 1HT2E 2HDOA 3RJ9A 3VC7A 5K0SA 2Z2YA 5IUKC 2PJUA 1EESA 3IS3A 2WKQA 2IYSA 1UPCA 3FUVA 1BS2A 1ISIA 3M5CA 3DBLA 3VO9A 3DB1A 5KTKA 1J06A 4WA8A 4GR9A 4M1OA 4ZVSA 4B87A 3KELA 3PICA 1WKBA 1QYDA 3N75A 4NBLA 2ID8A 3GRUA 1E3JA 1UBFA 1ZGAA 1P75A 3HY3A 1NGSA 4M99A 1W9MA 3AB8A 2Q7DA 2GAIA 1K7SN 2A58A 4IO0A 1NW5A 3L93A 4OQDA 8OHMA 5IT4A 1T1JA 1USVA 4FDMA 4QFDA 3DC2A 4IDAA 1D2MA 4I55A 1AK9A 1JTVA 5M5BA 2QMZA 2W90A 1AGNA 4JL5A 4WIAA 2VQSA 1V39A 1W581 3FRJA 1JWBB 5DU2A 4HUQB 5DT9A 4BRUA 3L7AA 1N3YA 3ORYA 4HR7A 3WVNA 4JQOA 4MLCA 4X84A 2XMSA 4FN5A 1KIAA 1Q6ZA 1TECE 1PJZA 4HDNA 3VVMA 4R98A 3AHHA 3T3IA 2PZFA 2B7CA 2BSXA 3VZSA 2JEOA 4BY9E 2XVXA 4XSHA 5KQRA 3REGA 3PCRB 2ATXA 2OFWA 1SCKA 5PNTA 3ZHRA 3B3GA 2IDZA 1Q21A 3EUWA 2Y1GA 3ND9A 3LX5A 1YJQA 2PQ2A 4PX2A 4D8XA 5FX2A 2JHPA 1RWMA 1UPUA 3L84A 4FEYA 4J6EA 4LGYA 4UM9B 4RKRA 3D6HA 3D81A 3CEMA 4N7RA 1NC1A 4YAOA 2YFQA 2FPSA 4EJMA 3L7YA 1DELA 4IKOA 2QI9F 3RR2A 2W2MA 1A4XA 2R25B 3ENQA 1A4RA 1Z4LA 1WDWB 3OY2A 3EIHA 3Q0EA 3SAJA 3W6NA 1U7XA 4ER3A 2E3JA 2PAAA 2YJ5A 1WDKA 4FZ3A 1CVRA 1KQFA 2CV1A 1NNUA 1E3DA 1S6YA 2XHEA 1AJEA 2ZTLA 3GRVA 3NHKA 3JQ6A 3NCHA 2DLNA 4GNRA 1UINA 1JKMA 1MXFA 1A72A 3G9UA 1JXQA 3T3NA 1TVMA 2Y1LA 4HEA1 2P8SA 2FK8A 3IELA 3DMTA 2XE4A 3RRMA 1L8OA 1PV1A 4M22A 4N6GA 1NP6A 1QDEA 3H4IA 2C82A 5JH7F 1H23A 4JJGA 3GN2A 1T9AA 3GEHA 3U2QA 2W2LD 1DTEA 3CJRA 3O3NB 1NU8A 2VKTA 4MIYA 2QJRA 1OU4A 5LMZA 1THTA 5U4QA 1A8UA 4QGFA 4H4DA 2P9YA 2EBUA 2OP1A 3HLYA 3SJBA 1Q3KA 3MHTA 3I9JA 4MP8A 2R0QC 1L7MA 5EXEA 2G28A 4DM4A 3GFRA 2PT5A 5DVZA 1N8KA 1O8CA 4JY7A 2IY8A 1AM4D 1XTVA 3KDPA 2FN9A 1FDOA 1X80B 1FTGA 1JQKA 1WV0A 1B26A 3DBIA 4R68A 3U26A 3UXMA 4ZI2A 1NYLA 4L3WA 1IJBA 2ZJ7A 4ZA2A 1W35A 3BK1A 3H3JA 4LZZA 1IPHA 5CYPA 3MS2A 2IXFA 3MLEA 4BAGA 3HKCA 4LJSA 2PCJA 1B8NA 3BULA 2IEDA 2A0KA 1W0CA 1BE0A 3KOUA 3C6ZA 3GB9A 3VSDA 3BERA 4QOSA 1ORTA 5AW9A 4YV2A 2HQOA 3OE4A 4C3ZA 2XB8A 2QW0X 2G5CA 2AXNA 1PT5A 3NG1A 5C3MA 4IXDA 3WAJA 2JFUA 4MUEA 1JB9A 4RJKA 4OHCA 4E07A 1VZ2A 1XEWY 3BM5A 3HCBA 1JWLA 1DSSG 5U1PA 1GU7A 1TJPB 2E0IA 1M6VB 4TRRA 3TQRA 2F17A 1NQOA 3UUFA 3BFJA 5BYKA 4R51A 2B99A 3GHHA 2QZZA 1DAEA 4KKXB 5TNXA 1W8DA 5L7WA 4BAUA 3E9DA 3O95A 4O4IB 3E9NA 1QTIA 1MQAA 2W2QA 2C04A 2GO1A 2GHIA 3BCHA 3D8TA 5DH9A 1Z0JA 2O57A 2JF0A 2RARA 5FPSA 2EJBA 4E5VA 3QUQA 4M38A 4MR7A 1T36A 2HPVA 1VHJA 2GWRA 2ZRQA 4MUIA 3VR4D 4FUQA 4TLBA 3U7RA 5HBGA 2Q45A 1YZLA 4O4JF 1C8VB 4M83A 5IPFA 4JI0B 1DPGA 2GPWA 3KJFA 5K3CA 2BSQA 3FWHA 4GX2A 3GLGA 3VOSA 1FW6A 1KIMA 4KYUA 5M2QA 4DV4B 2QG4A 3MM4A 1Y63A 4XDHA 3LUJA 2VF8A 4WNCA 2PTGA 3IBFA 5I3CA 2GPYA 3C98A 4KAXA 2J0EA 5LZ5A 5JCJD 2QZSA 4QX6A 2PT7A 2CYBA 2XQGA 3ZWNA 2Z56A 2QRPA 4PLHA 2J0SA 3G6WA 3P9KA 4TTJA 5FNVF 2QLJA 2M2IA 5AQ1A 2DR3A 3NBXX 1AOXA 2ABWA 3TXXA 2VAXA 1PVDA 1QU3A 3CCCA 5KSPA 4Q7LA 4Q4HA 1UPFA 2WICA 3K16A 5ADWA 4P7GA 4YLGA 5DGIA 4W6QA 3H1PA 1VPEA 4CCYA 2GCEA 1UT8A 3VHXA 3TLAA 1S4QA 2HHJA 5CH3A 4XGNA 5F7ZA 4Z0HO 3SZ3A 4QICA 2RB4A 3S44A 5DNUA 4GPD1 1HMYA 2XUJA 1U2QA 3TZ6A 2ORED 2G67A 3LQ1A 2VAMA 1FP4B 2O7NA 3DXYA 3E5MA 3KQVA 4FYHA 3R44A 2Y8EA 1UMKA 1GUDA 1RRVA 2J9FA 4IKPA 1BS1A 2JKVA 2FDRA 4Q9AA 1GZ4A 4C2TA 4RELA 2EFGA 3PIIA 3DEFA 1R37A 1MC5A 2UZ0A 1IM5A 1FUIA 4PC6A 5EAIA 1SULA 3EBLA 2JATA 4BLRA 3AFIA 1GCUA 1L5ZA 3OIFA 3LF1A 1G3IA 3ZDRA 4TTAA 4EUFA 4LYYA 2G07A 4HFRA 2OZKA 3T3EA 2Y93A 3KO8A 3DPUA 3V48A 4DG9A 3KLNA 3PLNA 3RU2A 2JHFA 1F2UB 1UIRA 3EPPA 2IZ7A 3O8LA 2YJZA 4MUNA 4ER0A 4U7GA 3A36A 3P97A 1V5FA 4B4WA 2NN3C 3U40A 1NVMB 2QD1A 1I3OA 3P9YA 4E3WA 1T4MA 1KP3A 2JGDA 2RH9B 3ILHA 1SURA 3OEHD 2C5SA 4X24A 3TMAA 1JSRA 3ZHQA 4EF6A 1OXSC 2V8BA 3IIIA 3AKCA 1JLLB 1L8LA 3E1KA 4GPAA 3WNDA 2OCPA 3BPSA 4D4LA 5IZ4A 2QAGC 4I5DA 3Q3HA 3OZ7A 1A50B 1XN1A 4J4BA 3N2NA 3ZYCA 4JEMA 2QTRA 3VZCA 4EG8A 1ECLA 4UD6A 1OWPA 2OYCA 3ISVA 2I76A 2YIDA 1TT5B 3TCXB 3HBLA 1VI6A 1TEVA 3PXBA 2ZRLA 1KZHA 1RXSA 3UK7A 2CC2A 2FRXA 2O50A 2XCQA 5F33A 1IMJA 2GD0A 1TVCA 3ZX4A 1ZGZA 3A6JA 3VR5H 1FMFA 5LOVF 2QJTA 4OVKA 3CTPA 4UU7A 1J9ZA 1M1YE 1QQ5A 2VBCA 3KG2A 3B70A 3SE0A 3T4UA 1C14A 1FX0B 4XIJA 1Z26A 5ALJA 4EI9A 2PUVA 1W4AA 1IOLA 1CRZA 3FCUB 1DIAA 2CB0A 2GXSA 4ZAZA 2JIPA 3A4YA 4A8JA 5I5EA 4BCBA 5FA6A 4AMVA 5KMGB 4W4TA 3T5GA 3AUSA 3K9CA 4AFNA 2P9ZA 5H1YA 1QR2A 1BHQ1 1BVUA 5EMKA 2AF4C 1PK9A 2NT3A 4UQOA 4XPZA 4AZVA 1V9CA 5AUNB 3DONA 4MV7A 1BAPA 3HCAA 4W1SA 3RGWS 5LD2C 1K66A 2QORA 5C31A 4ZHQF 1SXJA 1CY1A 2ZI7A 2P2ZA 1GP2A 1HUQA 1LFDB 4IDOA 1VL8A 3PE6A 4DC9A 4RK7A 2ZDQA 3BS4A 4QBFA 2NTYC 3PBKA 2VATA 4HMQA 5CB8A 4H1TA 4K3VA 3B9RA 3TIIA 2HTFA 3LBNA 3MMXA 4ZI3A 5KOHA 3NIWA 4AX8A 5HKLA 3JW8A 3LZCA 4DZZA 2PAFA 1USGA 4PF1A 1DC7A 2OVBA 1XR3A 2J6HA 5ALQA 5JAPA 3H1GA 4N41A 4I6EA 5K05A 1A9SA 2VNJA 3VR4H 1JVNA 1PJBA 3AKDA 3KU4A 1I4WA 1Q0RA 2PNJA 2DP4E 5BN4A 2HF2A 5IDVA 2LE0A 1P2SA 3QA9A 4MQFA 5FNZA 3ROZA 4C7XA 4OAOA 4DPLA 3TO5A 4HRAA 5AVZA 1HFJA 3DR3A 2SKCA 3MN1A 3OM8A 3ONFA 3ACBA 3EGOA 4HWGA 1Z75A 3A3OA 4RA9A 4TM8A 3AUFA 2ZG6A 3SFVA 1WVIA 2G5GX 4L50A 4PYNA 3V7NA 4NBKA 2GESA 3NBQA 5F77A 4DLYA 3ZBTA 2PSDA 3ADPA 4Q3OA 3I45A 1U3DA 1UOQA 1UBRS 2RIRA 3CLTC 2RCYA 2G63A 4KTTE 5JCPA 2R2GA 1GTMA 1KAOA 1M8FA 1J0CA 1G8PA 3NBZC 4H1VA 4MNTA 6Q21A 2CL6X 2EKDA 2QLBA 3UT5A 2BTOA 1KERA 4Z0PA 5KYTA 1FVFA 4OBBA 4RL4A 3ZKAA 4CLRB 2QUJA 4LQCA 1FFWA 1Z6GA 1AS3A 1EX1A 2PQ6A 4BX3A 3P32A 4HDMB 4B9AA 1YRYE 1ARZA 2C7RA 4FYXA 2NVWA 3PNQA 1P2GA 4KWEA 3IXMA 3REQA 4AJ9A 2PXAA 3K1AB 2IS6A 1Y80A 1L9XA 2MJLA 3BFXA 1XF9A 3BHIA 3I04M 1DC5A 1OUMA 5AKYA 3UAYA 2D8MA 4H1WA 3KPJA 2V6GA 4F9GA 1YA8A 4TV9F 5JECA 1J39A 3HR4A 1PR6A 4L3VA 1A2QA 1GLGA 2NVUA 2H65A 5K03A 4DA8A 4CM8B 1YOVA 4TXJA 4D0RA 4F04A 3KBOA 3WY9A 2XEXA 3AYZB 1C0LA 1Z82A 3REOA 4HDKB 1N5JA 4L57A 1XZBA 2XVYA 4BXOA 3MQFA 1K7YA 4B3JA 1ZP6A 4P31A 2HPZA 2ODQA 2OECA 4DCUA 2Q07A 3ME5A 4K6CA 3D3EA 4YRNA 4RZXA 1KAHA 1RYEA 4XUCA 2NZYA 3EEFA 5TS3A 4FXOA 4PRLA 5KWJA 4HC4A 1AE1A 2P6PA 4UCWA 4UHEA 1BN6A 2K87A 4G84A 4GYJA 3PNYA 2B4KA 2RGNA 3QENA 1ESZA 3GLFA 3UAOA 3D3KA 3HXPA 5FPPA 1BW9B 3QBDA 4L8VA 3ZVLA 4F7DA 4LRTB 2NW6A 3DNMA 4FMPA 4IMRA 1YZ3A 4OTZA 1RPZA 4GI2A 3OO0A 4P4UA 5EWJB 1TTTA 1M2HA 2Z57A 4N18A 5HFJA 2ST1A 4EG0A 2ZQZA 2BFOA 6NULA 5KQGA 2A1TR 5LQSA 2AUTA 5E6UB 2XKKA 1W4RA 3IX7A 3SQXA 1PAUA 3BGWA 3TOVA 1YR6A 2Q3CA 3BGVA 4IZ6A 1WHTB 4MV8A 1KEVA 2RBEA 2DLCX 4UUPA 3FTCA 4QO7A 4YT8A 5CBPA 2EC5A 4M89A 4Q9NA 1C7FA 1X7XB 3F8TA 3KRTA 4XQ0A 5KTPA 1H69A 1JEQB 1FYXA 4BNHA 4EYKA 2J9XB 2C96A 4N0MA 1PTJC 1FNNA 1T9CA 3NHRA 4I46A 4N0DA 1ECGA 3EPKA 2O2IA 5CAEB 1OA1A 1RXYA 2IX9A 4G4JA 4Y18A 2GKGA 5IBRA 1A1VA 2YWXA 3PDUA 2AZTA 2AMFA 1WCV1 1AQUA 4OHKA 4QU5A 3BGDA 1E66A 5IEJA 2XA1A 4R6XA 2WQ7A 3UTCA 4EIWA 3O8OA 1W36D 3N2LA 1RJEA 5KYUA 2XMCA 4PO1A 2OLKA 2PKEA 3OPVA 5JZBA 4ZMBA 4MRRA 1GA4A 1A5BB 1BS9A 4JBWA 4ARVA 4F8JA 4KI0A 2NPOA 4R3NA 2WAYA 3GVCA 3LK6A 3TIVA 4X6YA 4BNDA 3UPDA 1GDDA 1JW9B 4C21A 4KO8A 3M3PA 3ETLA 3DLBA 1JA0A 4R8LA 1KI8A 4MRSA 1BOFA 1B0UA 3BB3A 2P67A 1A82A 1JYEA 1KI1A 3S2EA 4MP3A 1EJ0A 4FZVA 4HBZA 1O08A 3NAGA 5JYEA 1RJWA 3QVKA 2QRVB 3COZA 1XOIA 3DKVA 3HUFA 1C2TA 3ABRB 3TBKA 4HGQA 3GA0A 5C5EA 2FAXA 4TYPA 3GRKA 2QNRA 2NPFA 3WQHA 1OYWA 1ZQ1A 1XMPA 2IT1A 2OD9A 2RBKA 4KZPA 5EL0A 2QBYB 3MPOA 5KX5F 1WB4A 1SCUB 3F3KA 3QE0A 5DBIA 5E3JA 4B3SB 1WXQA 1QG0A 1UFVA 1R0XA 3CWCA 4HWOA 3BSYA 2C0CA 5A7HA 1UWCA 3TH5A 1YMUA 4R69A 2RHHA 4Z49A 3FB4A 3EQ8A 3EXEB 1FSZA 2CD7A 1V8BA 5B4TA 2C8LA 1ESCA 2ZIXB 1R88A 3AXSA 4RH3A 4HZIA 1XMJA 4TKMA 2GA8A 1S02A 3T54A 4ZQBA 4TWAA 4WK2B 4GXTA 3BAFA 5EJFA 3UJ9A 4D8TA 2Q6IA 2XI4A 5J9FA 3QFFA 3O03A 3HRHA 3TQOA 5F1PA 4JQSA 3LQ2A 4N8SA 4K1XA 2QKYA 3VHLB 1EK6A 3TRJA 1GZVA 4HTAA 1DXHA 2YUIA 3G7UA 5EJ5A 3C39A 3G5LA 4IXWA 5JAOA 1R6TA 1T8WA 1M2VA 4KJZA 1TK2A 1T4CA 1CHNA 3D3WA 5EOVA 3JQ7B 2EFDB 1P2TA 2BCGY 3CRVA 3LZDA 4JB8A 4C3UA 2VDMB 6GPBA 1YQXA 3GFBA 4H27A 2XUPA 3IA7A 4KQCA 4R4JA 1PL0A 4UAVA 3KR1A 3ZH2A 2WBLC 4G2TA 1TYAE 4Y1EA 4ZEXA 2O0LA 4C4OA 4U9UA 4IWXA 5ALOA 4OXXA 4I5GA 2KB0A 3H6KA 1Q1GA 1XJQA 2QENA 2R66A 3THWA 4K6GA 5FL7A 1PJ4A 4ZCRA 2IH5A 1I14A 2Y1EA 4MQBA 4IYRA 3TZQA 3RHZA 3WYCA 3E9QA 4BZQA 5A0VA 2AN9A 4ERXA 4LJRA 1BEZA 1ZUNB 1TUBB 3AZQA 5E1DA 4C6TA 2Z3VA 1I36A 3THXB 4LVOA 2N46A 1EUCA 4WOJA 1G19A 4JFAA 5FI5A 5FOXA 3ZDBA 2EZ4A 3RU9A 3SG0A 4Z6KA 4WOCA 5DGTA 4DIDA 1U0NA 4DUPA 4CXMA 2WE7A 4UTXA 3L9XA 4W9MC 1MP0A 3DHWC 3OKCA 3QEBZ 4RYLA 1G5RA 1UAGA 3FFTA 4L72A 4Q01A 1GPLA 1ZUHA 2XAAA 4TN1A 5A4IS 4RMHA 3LVFO 4KWTA 3NT5A 4ANFA 3HO6A 1I7SB 1M0WA 4M76B 1T4GA 4BJ5A 4ENVA 3SX2A 3B2QA 2NZUG 1Y5NA 4U2FA 4UHHA 5D3KA 2EARA 3TUJC 1K08A 1CUCA 5FHRA 1TCCA 2WT9A 3NJ4A 4P86A 1IN1A 2OR3A 4N7BA 5C8DA 1OSNA 2FA9A 4IOMA 1Y9JA 1NXWA 2QDXA 2Y77A 2IXDA 2NU8B 4CMIB 1YZVA 1K0FA 3K15A 4LJ7A 1KOFA 1BN7A 2QTZA 2V98A 3HVRA 5A1JA 3ZHZA 4RFLA 3VQTA 5KSWB 4LTNA 1BDMA 1W46A 1EFPA 2VOEA 1E5TA 3DO8A 2W42A 1UMCA 1F51E 1TDJA 3TTSA 2EKBA 3CF4A 2G77B 1SBYA 4IGKA 4GLBA 1JLSA 5CXUA 3L1VA 2WKRA 2DX7A 4O4LF 1GPDG 4H4EA 2VWGA 1X7WA 3CY6A 1XHFA 1Q15A 2AYYA 3F3MA 3HADA 3JQDA 3MCZA 3H2GA 3TJZA 3ZU5A 4F2PA 3LKZA 3K6KA 1SY7A 2E4UA 2BMFA 4AZSA 3X1JA 1SXJD 2ZDHA 4OXRA 1YJAA 1N6OA 2G9VA 3ENKA 3VC3A 3X1YA 3EC7A 2A1IA 3KWJA 2WNSA 1JJIA 1YQGA 2JARA 4MWGA 2ZUVA 3RVJA 1DS6A 4N76A 4GZ3A 3PPVA 3DBHB 4XJTA 3CIFA 1IXRC 1ZJZA 2OCYC 2V4UA 2DAPA 5ECGC 1GTSA 1EM8B 3MGAA 5EUCA 2PRYA 4MZDA 4Y9SA 5BQFA 1LI7A 3SKYA 1HDRA 2IYTA 3UHOA 5B2FA 2IV3A 1NJFA 1TVKA 3L92A 1UK9A 5BSVA 5KYXA 2UKDA 1C1DA 4RZUA 3EXG2 4Q1EA 4BJ1A 4HGNA 2VRBA 4B6EA 5C1BA 2E5FA 5F9FA 4BFLA 2AYZA 3UWOA 1T9ZA 4AJ1A 4N5HX 2DQKA 5JU6A 3KQYA 2VDUE 1RKVA 4WN9B 4C5BA 4DV3B 5JMWA 2EGGA 7MHTA 1XMXA 3BHNA 5HQ3B 5B12A 1XJ0A 3LUCA 5D3MB 5L4SA 5MN5A 1L7VC 4Z53A 2JH3A 5AESA 2GFQA 4BMVA 3N2KA 1BQ4A 3IBSA 4XLTA 4PYKA 1MX3A 2WLSA 1E0JA 1X3SA 3MUNA 4N5DA 5D5HA 5DNWA 4A1FA 1T8TA 4AO6A 2HGSA 3HMQA 4IDQA 3O0TA 5HF9A 1IIBA 4BPRA 1IUPA 1LEHA 4BFVA 3D5QA 2YC2C 2P0YA 1F5SA 4M0KA 5CVTA 2JPDA 4IMIB 1SXIA 5T6BA 3RC9A 2REQB 4KQWA 3TS1A 5B2EA 2PO7A 4PHFA 1Z47A 4I36A 4IJQA 3QUBA 2JCSA 2PEZA 4EJSC 1D2GA 1FP2A 2QRGA 2CF6A 4WLEA 4ALJA 5K0CA 4WBNF 3OEWA 3EVZA 3ABOB 4J8PA 1WDMA 2PUTA 3E84A 1BWRA 1WMDA 3T5MA 4X8OA 1WETA 3N39C 2JBAA 2H07A 2O1XA 3INRA 2Q4TA 3JYQA 4ILEA 4TLAA 4DR2B 1JR3A 3VDNB 3RB8A 4EEKA 1SK9A 3LBHA 4GWGA 2IUYA 3JQAB 3K1YA 1BWQA 4GSKA 4RE5A 1CX9B 2V0GA 1KEPA 3P9XA 2FEPA 2NWQA 3O0DA 3QLTA 1Z2CA 4BQOA 4CGYA 2GJ9A 1O96A 1ODJA 2R7NA 4GWKA 1D04A 1VXOA 2FN7A 1ZI9A 1Q1ZA 1C30B 3KUUA 3OIVA 4NRDA 4YA6A 1U90A 4DL9A 4ML3A 2GB4A 4KE6A 5JNTA 2CBZA 2R85A 2IZZA 1VOTA 3JATA 3ONVA 4Z4CA 3IIJA 2GVZC 1E9SA 2P8JA 4QU8A 4KPFC 4DJJA 1NPYA 3ET5A 5E38A 2IIVA 1U9JA 1AKWA 2XOXA 3KKMA 4F4JA 5JCXA 4HQRA 2R5NA 2LWIA 1SRQA 4PG6A 4PIMA 3RK0A 3WA7A 1K4YA 2AF3C 1N34B 3SBEA 1M7GA 5B3JA 3U9LA 3T3GA 2D4HA 1QBKC 5I9TA 4XD7A 1YUMA 3X1MA 2P2NA 4K5QA 2D3TA 4HWRA 3W4IA 3UFXB 3MTAA 4Z0NA 5H82A 3F9RA 3LNTA 3VR2A 3AIMA 2BFEA 4ZYXA 3IB6A 1TRKA 3PTLA 2ENUA 1E9VA 3KZOA 1JX6A 4OKIA 5KOIA 1XYYA 4FNOA 2PSEA 5KWEA 2PMFA 3WS7A 2R6ZA 2H4FA 1EA7A 2CEKA 3D8RA 4NZ9A 5FTWA 1K6JA 4XI9A 5TGDA 4LHWA 4E09A 4HY3A 3HV0A 1G16A 3ROGA 5CXXA 5KKNB 3M0EA 2NXEA 4KFRA 1L4YA 3HHPA 1ZI6A 2QSJA 4TL9A 5AM5A 3UW3A 3L4KA 4XDZA 2W00A 4HUQA 3G02A 2VHWA 4GOXA 4X7BA 5K3DA 1R1DA 3TJRA 4LGCA 2DBYA 1YB7A 2I9PA 4TYNA 3O2QB 2ZKIA 2VYFA 4D5EA 4RPLA 1Y7HA 4I4CA 3U3KA 3LT0A 1MR3F 3KSZO 5GOZA 2YFHA 4CU5A 4P08A 2Q5EA 1ZCFA 3WGGA 3O92A 1AZTA 4WAUA 3N70A 3ZPXA 4YJ3B 2N3ZA 1YGYA 4EITA 3QYJA 4PR3A 4E2WA 3W2TA 4QGSA 1VKRA 3A05A 1FTQA 1LDNA 2OMKA 3M4ZA 4KGDA 1QO0A 2ZULA 4R0NA 4NFLA 2O2GA 4Y6RA 4DDHA 4ZDIA 3HJFA 4G41A 3L82B 1NLZA 5HUJA 1GFWA 4G63A 4JI2B 4XVUA 4BNIA 3F2IA 4KSCA 2X7JA 3LLCA 5D7BA 3AGQA 2ZAGA 4G0UA 2RGDA 1PWXA 4D57A 2C3MA 2YL2A 4B09A 1P3JA 4RF3A 5L6MB 2OV3A 1Y6RA 3ELUA 3QPWA 4URWR 3FYSA 2I3AA 4Z7JA 3AP3A 1H5QA 4L7VA 2RAFA 4QXOA 3WYEA 4DXDA 5FTMA 2A3RA 4YT4A 5AM1A 3QU4A 2ID9A 2ZYGA 1J2TA 1XRQA 3SM9A 1F8FA 1MO4A 2VOJA 4HUJA 2W58A 1NLYA 3KVNA 3H16A 1SBIA 4DMLA 1JSZA 3PKJA 4DLTA 2G9UA 1NKSA 2B83A 4EW3A 3T1TA 4Z9AA 1MNQA 1RQPA 1WOYA 3G2IA 4PBRA 4AMUA 1JA1A 2WKPA 4YAUA 5KCZA 3SHTA 4HDCA 3B89A 4OFWA 3VISA 1RI5A 5A7FA 3ZQ4A 3AW8A 2YRXA 2HA3A 3VH4A 4OP1A 1IQRA 5AKHA 1XXHE 4KGXA 1R6BX 4YCNA 3ZJUA 3R40A 2X3YA 3U7EB 1ZISA 1FRVA 3CSUA 4GQIA 3G2MA 4J7AA 1KR2A 4Z7NB 3PQ5A 4CLXA 1N6KA 1XZJA 3CEPB 4N1AA 5FL7D 1NIPA 2MYPA 3VDMA 4IMPA 3RFFA 3NTVA 1Y81A 4CQLB 2A30A 3BGOS 2A1UB 2FWRA 1ATZA 1NE2A 4UXHA 1Z4OA 3BMOB 1MOQA 1GCAA 1E4OA 1MV8A 1B6GA 1WM1A 2QY9A 4HGRA 3ZC3A 4B3HA 5BRJA 4NJMB 1T6XA 1H2YA 1N8TA 2B3TA 2WTBA 3DUWA 3KLBA 3OQIB 4IG9A 1JP7A 2ZE8A 3GEIA 1RHMA 3O4VA 4Q3CA 4RGYA 4PZDA 4WKNA 3B82A 4L4SA 4NZPA 3TB4A 1TB4A 4UVIA 2HF8A 4RWEA 4ZQCB 5AVVA 2XZOA 4D8YA 1VYTA 1O6CA 5FPQA 1D2AA 1MO2A 3B8EA 4EMUA 3EEOA 3UXEA 1UDBA 1M6VA 4U0KA 1IG0A 1GN9A 1X15A 2N0SA 2RSLA 3OT4A 4OHUA 3W6ZA 4CV3A 2FEXA 1YE8A 5LQMA 3A06A 1T5OA 3HVIA 2WEKA 2I99A 2R8ZA 2SKEA 2FWAA 3GH3A 2KMLA 3EUFA 1NI5A 4O4IA 2YWCA 1R6VA 2FOIA 1HLGA 1SVIA 1WHSB 2Y1XA 4MS4A 1TUIA 4FMBB 4A0QA 2YXNA 2G0AA 3OIYA 3Q6NA 5GPBA 1OZAA 3RVLA 3C5EA 4MVXA 1T5SA 4R9NA 4PLVA 2HUPA 5AVOA 3K6SA 1LLUA 1WL8A 5M7EA 4LF5B 3BVPA 2ZJYA 4PQYA 4HX2A 1UXGA 2LPMA 1O5OA 2QDKA 4NONA 4RK4A 3TAUA 1UADA 3UJ6A 4BO0A 3SVTA 1WO8A 3K3PA 3PNSA 3WI7A 3ZWOA 3TFOA 2NUPB 3HVUA 3DVSX 5EFZA 1AGXA 3RYIB 1QGED 3L4BC 5U9CA 2VQFB 3FI9A 1NVFA 3LPLA 1K4KA 4HXGA 4QJ5A 3GBSA 4PC7A 2XWJI 4XVRA 1AZSC 5HSGA 3UWSA 2I71A 1MAUA 3V4FA 3JWGA 5HTOA 1M2OB 2P4UA 3M49A 3FCCA 4OI4A 4WW0A 3TEFA 1VDMA 1CBUA 5ILGA 5HDBB 1JBKA 2GR9A 1DGQA 2OSVA 3A1VA 1CR6A 2H0QA 4GL4A 2Q9BA 4RV4A 1KJIA 5EMJA 4W5WA 2JHGA 1AY0A 4UULA 1DKLA 3ZY6A 3PSHA 2FWPA 2LGJA 3EA0A 2ODPA 4NYJR 4QU0A 4TLMB 3UMJA 3PQ7A 2YOFA 1XZPA 2Z8YA 4BBJA 3EK2A 1GYRA 4ZN6A 2WIBA 4RKWA 5CLQA 3FSEA 2KW5A 1XZEA 4X7PA 5AHKA 5ECDA 4EF5A 1PGOA 3CS3A 3TNDA 1QRRA 1RC1A 4IJUA 2IY7A 3U1TA 4HH3C 5GIOE 1E1QA 4WKGA 2IDKA 1UAAA 1WZUA 2A3NA 4WXRA 4NABA 1IBLB 3DT6A 4RM2A 3PFFA 2I2XB 1FPQA 3OHSX 4E5YA 5HXAA 1VHWA 2DUNA 2F59A 4JUCA 2O7QA 4ZVQA 3SI7A 2JI7A 2GH1A 4S12A 2QD2A 4RTJA 2NO4A 1G3QA 2X9GA 3KTOA 2X8JB 3ZCRA 2OCDA 3LGXA 3MLAA 4OSPA 4WXPA 4AWAA 1IY1A 1G5FA 3E9CA 4TLEA 1RR6A 2FR8A 4B45A 3U6KA 3ZDYB 1PNVA 2WDZA 4CKEB 1JRLA 1G2IA 4IIYA 1XRJA 3PNKA 1XSEA 3KSAC 4B4OA 1IY2A 2YRFA 1F2UA 2PMEA 4RA6B 5COBA 3STHA 2DWUA 3T15A 5J4LA 2V6JA 3CRW1 2AMVA 1GRQA 1ZNZA 1AO0A 1ZJWA 2KI5A 1J42A 1QORA 2F48A 1NBAA 3DZFA 2W9XA 5LFAA 4A8TA 1PS9A 1E20A 3WISA 4DVJA 1P0FA 1SQFA 2CL0X 1JR3D 2AG5A 1P7WA 2I8LA 3GFTA 2PVPA 5KYVA 5A3RA 4CMKA 3L6BA 5GTDA 3NC1C 4NR0A 4ZOLF 1JLLA 2JLZA 1QIMA 3JZDA 1N4DA 5EWLA 4CNBA 4K6KA 3HZHA 1GG9A 2ZRJA 4HN9A 1G1MA 3F8SA 3CE6A 3MTBA 4ER5A 2Z09A 4BFCA 3VGPA 1XDDA 3GEBA 3FLBA 4QU9A 1PQUA 1OZ0A 2CUKA 4FNGA 3FPHA 1A8PA 1GCIA 1GLNA 1OBOA 2ZJ1A 2OGSA 3P5BA 3PC8A 3WJ7A 4EARA 4HUTA 4Q9HA 1WAMA 1ST3A 1ECJA 3ROXA 2QS9A 2H59A 4D02A 3KHUA 3N7AA 1BXKA 1FF9A 3IE1A 3C2QA 2BM1A 4M37A 4NF2A 2EX0A 1O54A 3COWA 4LEIA 2ZJ5A 3KR0A 4LRQA 2J32A 5JATA 4BE7B 4GZMA 2O59A 4M2LA 5HDQA 3DZCA 3UPUA 1Q57A 2RKWA 2QU7A 1FY2A 2EKLA 4DZTA 4M3NA 4ZT3A 5F7XA 1ZX1A 1ZHHA 4KAJA 2OD2A 4OSEA 1LPAB 4XD7D 3E2IA 3UO8B 1G5TA 2X2OA 3H4TA 3UANA 1N2BA 1WVMA 2O6HA 3AF0A 2D7DA 3LA6A 3W9BA 3Q41A 4YRTA 3TYXA 3VR2D 4UBMA 2FI1A 5D00A 6PFKA 5LJIA 1TLFA 1OREA 1KWGA 3CUYA 3GUZA 5TE9A 3AVPA 2FDXA 3RRBA 3O4FA 3CVOA 3U17A 1GZDA 1YH3A 1FYEA 3I23A 1G3UA 1Z4IA 3C7DB 5DPMA 5AOVA 4NK5A 4HATA 3B9QA 1C4KA 1JBEA 1MA3A 2QV0A 3B52X 2A67A 2JA2A 4G8BA 3NVDA 4EYEA 1W6UA 4IHJF 4I9FA 3S2FA 2ODEA 2VUUA 3BTUA 1NDQA 1H2WA 3U1VA 1DMRA 1TZBA 4CKCB 1PK8A 2HMWA 4KNVA 1U7DA 3HDYA 3D6VA 2H8KA 2PJZA 4HGZA 3TL6A 4MW9A 3MTEA 3T0GA 2CCJA 4M1QA 1IZ0A 3GGJA 1BD4A 1KRWA 3E9MA 1U6KA 1LFAA 1RPTA 1A98A 5K3BA 1Y6QA 3NC4A 3MT0A 2OGTA 1A8HA 4C0SA 2C2XA 4BO8A 3UK2A 4WD3A 4WE3A 4UUBA 3KNZA 4NZOA 4GECA 4CDGA 1FNSA 4JXZA 1NSFA 1I1QB 4AJIA 4J16C 3PTAA 4C7OB 5AVYA 1OJLA 1E2MA 2Q49A 1VCHA 2CJYA 3LL4A 3ONNA 1QFSA 3OOSA 1QS0B 3T1OA 1NRXA 1CY8A 3DAGA 2DH6A 1QO0D 4DYVA 4F6LA 2O52A 3Q7PA 4CV1A 1OFIA 3I73A 5AJZA 1GCGA 2R68A 4NWIA 4BVGA 1GGFA 4HDMA 4K9KA 1QFXA 3KFVA 3IVCA 1R8JA 1XZLA 1K1EA 3H8WA 3C8MA 4R1TA 4RVUA 4DREA 3K1AA 3B1JA 3MXOA 5DNVA 1DAOA 1SHTX 1PEDA 4GC9A 2OL4A 5EMHA 3U5ZB 4FFPA 3E0QA 3IQFA 5EFOA 4GP9A 1Y3HA 4XFKA 4FI3F 4QEDA 3ZDCA 1M5RA 3GRYA 3UB3A 1I0IA 4FC7A 1B6TA 4HDKA 1I80A 1JLKA 4JHXA 4UKDA 3K9FC 5IKMA 2DFPA 1XTIA 5DTEA 1U2EA 3QHPA 4NULA 5SZHB 1AGRA 2F7SA 1SU6A 1OV6A 3WLLA 2F1KA 4TTTS 2GHRA 5EJMA 3I92A 5HWSA 2H11A 3FYHA 4EW2A 3BWCA 2OCXA 5AO9A 3IBYA 2IZOA 5JDIA 3WBBA 4KVAA 4Z9YA 1E3WB 3W1WA 4DDWA 4KO4S 2FR1A 1BW9A 1PYOA 2BRUA 3E8SA 4LOAA 5DBFA 4DRZA 3FHTA 1WE2A 2FR0A 2O19A 2OAEA 3GPDG 2AN4A 1NI4B 1I1OA 2PL1A 4MRPA 5EWJA 5AOBA 3STWA 3WKAA 5KOJB 1VE9A 3A4LA 4JBIA 4NX2A 4E7OA 5T67A 2IHVA 4L4ZA 4XH9B 1MKYA 1MO5A 3WJ1A 5CPBA 5AW2A 1RRPA 3AUKA 1WHTA 2EKPA 3HI6A 3D7NA 1N92A 3L8GA 5HS6A 4AXXA 4RZQA 1RP7A 1X7XA 1Q0UA 4II3A 1XD8A 3SHQA 1JEQA 4IY1A 2VDQB 1LSUA 2VF4X 3C7CB 1HDCA 3TWOA 1SBTA 2VNHA 4GRDA 3QU9A 4KXWA 4ME6A 3UJDA 3WYBA 2E4AA 4CTNA 4LBYA 3UBMA 2Z1DA 4CG2A 1FFCA 4S04A 1I33A 4ZZIA 5CPFA 1MJFA 5HF6A 3FBWA 3NIGB 2H57A 2NV0A 1P7VA 3A1UA 2BGNA 3IV7A 2V6IA 4UBKA 2FSGA 2YWBA 3TRIA 2C4UA 1EQUA 3T9FA 3K9HA 1FP7A 4UNSA 2FSVC 2VP3A 3QYFA 3EQZA 3P9IA 5HJ2A 3UOGA 1GM5A 2FWNA 4JEUA 5DN6A 4XCVA 1G42A 2F43B 3PQEA 3JQPA 4FI3C 1Q11A 1E1LA 2G1JA 4ZV9A 1OXMA 4CDMA 3BSFA 1GKKA 3PQFA 2Z2KA 1NMZA 4ND4A 4XTRA 2ZRNA 3RRNA 4DCSA 1J07A 5JVDB 1OASA 1TAHA 3I83A 2PV7A 1XZQA 3GG2A 3E22B 2QVBA 2BH9A 1ENZA 2DOKA 2OZLB 4I55F 4PNZA 1HTWA 1M5TA 3LGSA 1CNFA 1BDHA 2QP3A 1SG9A 2QPTA 2SECE 3R3UA 4BKMA 1KFBB 3VKGA 5L3SA 3TF5A 5JPIA 4Q7QA 3K0CC 2L69A 1YS1X 4QA9A 1KDZA 4WY5A 1A4IA 1PUJA 3HFSA 2IPLA 3M2TA 3PFGA 4RH1A 1U2DA 2ON6A 1J70A 1JDBB 2QBYA 1U0EA 3FPJA 4M1ZA 4KQHA 1YB6A 5CURA 1KS9A 1SCUA 3G13A 3IKJA 3EDCA 3RRXA 2FZLA 2D0IA 1R5NA 1E2LA 4J3NA 3CYFA 4PSKA 1T2FA 1FVOA 3GNQA 4ZRDA 3T7JA 2FSFA 1NV8A 2QTMA 2HSZA 3EXEA 2D2VA 2AG6A 2ZIXA 2BFCB 3IMCA 3OY7A 4LN1A 2ONKA 3RUDA 4UTZA 4YWHA 3KJEA 1CEXA 4UCQA 4DKJA 1N1DA 2VK1A 4FINA 5LQRA 5BW8A 3LUKA 2YHIB 3WRYC 2J3EA 1CZHA 4PYJA 2O5CA 1EFLA 1K92A 5TVKA 4QEZA 1P7ZA 4P5PA 4DV0B 1WUHS 1Q0QA 1L0BA 4MVJA 4NATA 5P8WA 3RYTC 1E6MA 2QU8A 1CY7A 1A2BA 3AL3A 3C45A 4F6CA 1RBQA 1YASA 3ID6C 2RGUA 3R5SA 5JALA 2O2DA 5FQOA 1DHTA 4H17A 2QQ0A 4KUHA 5I8ZA 1UJBA 1NM5C 3DM9B 4CGZA 1RLJA 4Z54A 4W5JA 1E1QD 2HIHA 4PZCA 3DTNA 1Z56C 4BKPA 4DABA 3BTVA 5JLJA 3WL5A 1J8QA 1TCVA 2ZQYA 1U2TA 1PS8A 2VPTA 2YIVX 3MWEB 2XDWA 1TQ4A 3BIWA 1Y33E 1QR6A 4CDNA 1V43A 4KI7A 3AMVA 3PT5A 4JZKA 2A14A 1J1ZA 2TMGA 3LS2A 2B20A 3SQNA 3QFRA 4X7RA 3WXMA 2B6NA 4QTYA 3PE4A 3D0OA 1QG6A 3I2IA 4KVGA 2BGKA 2ZB2A 4D26A 2PX4A 1F9AA 3KSBC 4EUEA 3A7DA 2UUBB 2CMGA 2SBTA 1ZUNA 3I6MA 4D56A 2GO7A 2CXSA 1A9YA 3AR5A 3F4LA 5J47A 3THXA 1PS0A 1YS6A 1ZUWA 5AVQA 1ZC3A 3W90A 2VWQA 1CJUC 1OGYA 3E5NA 4UUAA 4LNHA 2FF7A 2W6CX 3A1TA 5A6SB 3WWEA 1SUCA 3HE3A 5A4KA 2AQ8A 3ZK8A 1U98A 5IVKA 4Z99A 1ISHA 1TF2A 1U2PA 4XDGA 4Y67A 4E3ZA 2AL7A 4KL8S 4TGLA 1I6LA 1LWOA 2X1MA 3CM0A 3HWSA 1MX9A 5A9TA 4ZRNA 4YRPA 1SOAA 2XITA 2BWJA 1JKJB 4KNWA 1QYWA 2IYLD 3WSWA 1SZJG 3VJRA 2ETXA 2AW3A 1LPBB 1C1YA 3HEMA 1G18A 4EY3A 5EE5B 2A9VA 2A78A 3C3WA 4MLZA 1UPBA 3Q5DA 3H5TA 3UMYA 1KAGA 1HSOA 3A9SA 3EA5A 1DCFA 2R1UA 4NY1A 3W6UA 5DI3B 2NU8A 3S40A 4CMIA 2ZZNA 3GLKA 4C06A 5DHFA 4AS1A 3ZU3A 2C4WA 2BCEA 2ATVA 2W0SA 3R41A 5A0FA 2V4ZA 3X1XA 3U4QB 3ICCA 2YBEA 3WDSA 1HTTA 2YOGA 2A7QA 4WEQA 4EL5A 2GHQA 3VOBA 5B4UA 3AR4A 3B60A 1I6KA 4B3IA 3T9BA 3NRCA 3KPYA 3RVBA 1YRQA 1Z12A 1XL1A 2ZIAA 2QVYX 2UAGA 4JKOA 4AUMA 3TUZC 4L5JA 1U2ZA 2QD3A 1KK3A 1N3IA 3AU9A 3Q9NA 1ONSA 1UJ4A 5TY0A 4BHTA 1PLLA 4N65A 1L1FA 4A2WA 1VE3A 2OV1A 1N5RA 1Z2OX 3JX9A 1L4BA 5C53B 1RM4A 1RCTE 4WKCA 1YBFA 2OHOA 3ZDAA 3GUUA 1DCKA 1YXMA 4CM6A 3EIXA 1SUDA 1T3LA 4GMFA 1CRQA 4OHFA 3DBHA 3W5BA 2YV5A 3ANYB 2WB4A 4U8GA 1EM8A 2JKZA 3L8FA 5EP3A 4C7JA 5GV7A 1N1MA 1XP8A 2NYAA 4LQLA 3QVOA 5H83A 3SPXA 3TVTA 4AL4A 5HX7A 4EGQA 3ETHA 1E3MA 4YO7A 2I6SA 4UDOA 3RC2A 3SOZA 3IQWA 2HXGA 1Q19A 5CVCA 4POOA 2HR1A 5TDHA 5T4EA 2F3RA 3ZHXA 1CEQA 4PXAA 3L4SO 1CUHA 2GBCA 2WU4A 3QGMA 2GGSA 3FN4A 3SP1A 3H97A 2WKWA 3LPDA 3PJGA 3BSWA 5FYDA 2YW2A 4WN9A 1RE1A 5G1OA 1NONA 3SS9X 4RSGA 1UQTA 1XLTC 4BMSA 4NENB 5BUCA 3VTKA 3VPFA 2V6BA 3FZNA 5L3RA 2V54A 3QLEA 3VO2A 3T5TA 3UOWA 3HXOA 2MDTA 3R24A 4GG1A 1CR1A 2P2LA 1N1EA 4GYKA 3K0BA 1L7EA 3U09A 3ILSA 4LZAA 3NWOA 4CUZA 2REQA 4FGZA 4KUGA 4YBZA 2CMDA 4JI3B 5GM2A 3NT2A 4D99A 4MGZR 3VKVA 3GIWA 2DWQA 1VIDA 1ZNWA 2I4NA 4MB6A 2NXNA 1GRNA 2HAEA 1E9FA 4QUBA 3SM3A 4P1ZA 4LF7B 2YXLA 4FDAA 5IT9A 4QXAA 3STUA 3IR6A 2N1BA 3KXLA 1DQPA 2QVCA 4A6XA 2R86A 3DEZA 4QYTA 4RLSA 2QIPA 5KU7A 1ZMXA 3FVQA 5DE3A 3WC4A 1RMYA 1ZOPA 3QBJA 4C0JA 1JR4A 2RGYA 3GCWA 3N53A 1WMAA 3SC2B 4BC0A 4CRWB 3BJMA 3JQAA 1W34A 4KIJA 1ZGCA 1NUUA 2B0JA 2YRWA 2PBFA 3IB3A 1L4MA 3DZJA 4JBHA 4QDTA 1QO7A 5AIAA 1WCWA 2NU9B 1DEXA 4OK6A 1JZTA 1XWWA 3FUWA 3EXG1 1MAWA 2ZIGA 4D3YA 2ZYDA 2YWFA 3OZAA 5TEWA 3LJKA 3C7KA 4UJ3A 1I3LA 2JH8A 1FLNA 3ADKA 4UU1A 4EAQA 2JLWA 1CC1S 1HRDA 2HL6A 2OT3B 4KO1S 2PY6A 2X0FA 1TK3A 2OXRA 1C30A 3ZE6A 4WNYA 3R3JA 1JT9A 2YZGA 3KQUA 1OFHA 1OT3A 1XVVA 3C3KA 1TPZA 2GPNA 2Q3HA 2R96A 1T9GS 4JELA 1IPEA 3M9LA 3TR5A 4B71A 3DE0X 2VEDA 3OMXA 3QI2A 5KTSA 1TYZA 1NVWQ 4JU8A 2IDJA 4TZ0A 5F98A 2PQMA 4S0ZA 2IUSA 2I62A 1JJFA 1E63A 1M8GA 3A10A 3G8AA 4I7EA 1SXHA 4LDRA 4NU0A 4YI3A 3SIWA 3WLOA 5A3QA 5HUQA 1NY6A 1R27A 4URXR 2WWFA 4EX6A 5IMSA 3SXPA 4EY8A 1Y7IA 4EEXA 1MDBA 3UFXA 1P0CA 3NI2A 1DP4A 4MWEA 3IAM6 821PA 4B8WA 4OX9Y 4ND5A 4YRDA 3H6HA 1C0IA 3UJCA 5TQ0B 1PW5A 4CKXA 2DHCA 1JG6A 3HCCA 4Q02A 3QLVC 1S2NA 3AP2A 4IEIA 1USWA 2VTBB 2BONA 3CW2A 4UNPA 5JWOA 4LVCA 3VR6A 2R7LA 4TM7A 3BJZA 1SKYB 4Y6GB 3H2YA 2I7TA 5CIYA 1FU4A 3ZD6A 1KK0A 3S6JA 4RLFA 2W2XA 3PHLA 5E4YA 3UN1A 1E3SA 5DN6D 4Y1GA 1E77A 2JGNA 5FV7A 4B32A 3L4JA 3DOEA 2NPIA 1YV9A 4CM4B 4LBVA 3IDAA 3OQPA 2Q8NA 4EMBA 1SGWA 1JUDA 1TFRA 1Z5WA 3E7WA 3I37X 4NMHA 3DWFA 4PO8A 3INNA 1EAMA 2Q6KA 4YUWA 2GXUA 5D6OA 2PUBA 1Z5VA 4Q0MA 1I7LA 4G2NA 4K2HA 4PV7A 1P7CA 3FTEA 2Q0XA 4YJ3A 3PLAE 4Q9JA 3G0IA 3IOYA 2X40A 3JVEA 3W5SA 3FCXA 4UU8A 3WIEA 2J31A 2WF5A 4OUKX 1M0TA 3NTLA 2X0DA 1UZAA 2C8JA 2OB2A 4AECA 4CLDA 3L8YA 5AVUA 4GO1A 1SVNA 3LM8A 1EJ2A 3B1FA 2RIPA 5I6DA 1QG4A 1RJGA 2BEJA 1II9A 1M73E 2BGJA 3OQBA 5K3OA 3I6BA 2PBLA 4M1MA 1JI0A 1O94C 3FMPB 5CT5A 2JDIA 4K6HA 4UJ5A 1JG7A 5EQTA 5FD8A 4Z51A 3RSSA 4XYMA 4IDFA 4YMWA 1N0IA 2DFVA 4K05A 2HIAA 4MVJD 2ZOSA 3V8RA 4EY7A 2FETA 4KRYA 1AK1A 1YC2A 1WG8A 5K4AA 1KTVA 5JC8A 4JBNA 1TIPA 2BGUA 1A5ZA 2CXHA 1PEYA 4KIGA 4QPPA 5BV8A 5EP2A 5IJ9B 1Q7RA 2EIHA 4XIYA 4G0ZA 4ACAA 1IRXA 3HGMA 4BN5A 3FB1A 1A7AA 4P9NA 3CLVA 2CFSA 1Q17A 4O02B 4Q6BA 2IYWA 1XVLA 4LK3A 2FE1A 4DSTA 3LAWA 4KE9A 3T52A 3SS8A 1X94A 1UPXA 4MRVA 5HZGA 2VWPA 4R05A 5BSUA 5AW8A 2PE5A 3AHGA 1V8ZA 3FTPA 2LBPA 4HB4A 5DHQA 1J0EA 3CE9A 2C2OA 3B8HA 4ZGWA 4PG8A 3IIEA 5AVSA 4HYEA 2D0PB 3DVAB 4X64B 2C5LA 1BTOA 5F7JA 2QY6A 3OT1B 3ESYA 3F98A 2C9BA 4BKUA 1KFCB 4QGBA 4C6RA 4CQLA 2A1UA 2L2QA 3GLVA 3K70C 4J7XA 3BMOA 2PLWA 2BKEA 4R2JA 4TV8B 4CI9A 3DP9A 1SHZA 4ZFNA 5JTUA 4FHDA 1ONPA 3H9BA 4NJMA 1W88B 5A5VA 3BREA 1FQJA 3JD3A 1RAGA 5HCIA 1G20E 1N57A 1D6JA 2GPJA 1MNAA 3EC2A 2FU5C 3LX8A 3M4XA 1QPGA 3TW4A 2AN3A 4CG0A 1MJGM 8MHTA 2FB9A 1U0GA 2QZJA 3FZQA 1H94A 3GRRA 2KJQA 4W6ZA 2PR2A 2C7PA 4M9RA 3WB9A 3KB2A 1I7QB 3FPKA 4PZLA 4YP1A 1CRPA 1DIHA 1UEIA 3ISJA 1KL7A 1P0PA 2ZR7A 5KJ1A 5FWDA 4J7CA 1CD5A 3IEPA 3IJRA 1F8YA 1T0IA 4MULA 1KRHA 2AN1A 1MG5A 4UQLA 4RMNA