4PINA

Ergothioneine-biosynthetic methyltransferase egtd in complex with n,n-dimethylhistidine
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
322
structure length
320
Chain Sequence
HMALSLANYLAADSAAEALRRDVRAGLTATQKSLPPKWFYDAVGSDLFDQITRLPEYYPTRTEAQILRTRSAEIISAAGADTLVELGSSEKTRMLLDAMRDAELLRRFIPFDVDAGVLRSAGAAIGAEYPGIEIDAVCGDFEEHLGKIPHVGRRLVVFLGSTIGNLTPAPRAEFLSTLADTLQPGDSLLLGTDLVKDTGRLVRAYDDAAGVTAAFNRNVLAVVNRELSADFDLDAFEHVAKWNSDEERIEMWLRARTAQHVRVAALDLEVDFAAGEEMLTEVSCKFRPENVVAELAEAGLRQTHWWTDPAGDFGLSLAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ergothioneine Biosynthetic Methyltransferase EgtD Reveals the Structural Basis of Aromatic Amino Acid Betaine Biosynthesis.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords Histidine-specific methyltransferase EgtD
total genus 105
structure length 320
sequence length 322
chains with identical sequence B
ec nomenclature ec 2.1.1.44: L-histidine N(alpha)-methyltransferase.
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10017 Methyltransf_33 Histidine-specific methyltransferase, SAM-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pinA01
2OPBA 3KR2A 2P1DA 4EKGA 1QAQA 2QM3A 5K0EA 3R24A 3UJ9A 5EHIA 1ORIA 3P97A 3QV2A 4GC5A 5EVJA 5HIIA 4X61A 1BKYA 1MHTA 4GQBA 2P41A 4GEKA 4L7VA 4U7TB 1FP2A 3A27A 3AWIA 3EEYA 3KQTA 1KR5A 4PCAA 5DM1A 1EG2A 3NVKI 1OR8A 1KP9A 2BR3A 1Z3CA 2OKCA 3G2OA 1AF7A 1O9GA 2FK8A 4KDCA 4PONA 4QTTB 4FS8A 1ZQ9A 3VYWA 4C07A 4M7RA 5JUWA 4OA8A 2G1PA 3CGGA 1O9HA 1F38A 3T7RA 3FPFA 3R6TA 3KHKA 4DMGA 3EGIA 1INLA 5FHRA 3REOA 2HNKA 5HILA 5GM2A 3ANXA 5K0NA 5K09A 2P35A 2PBFA 5K0CA 1YF3A 4GBED 3G2PA 1SQGA 3LPMA 4ISCA 5KYGA 1SG9A 1NW7A 5EGSA 3UJAA 4PINA 5C1IA 2I7CA 2H00A 1HNNA 3VC2A 2ZZKA 4X60A 2AOXA 2WK1A 3HVIA 1R18A 2P7IA 2YVLA 3JWIA 2BM9A 3O31A 3OZRA 3FRHA 3LDGA 2NNWB 3BWMA 3P9CA 4E33A 2ERCA 3DXYA 5H02A 5DLYA 4QTUB 5DM2A 4YUZA 2PKWA 4PWYA 4QDKA 4YV1A 2H1RA 3BZBA 3DMFA 4PYIA 1VQ1A 5K0JA 1L3BA 3HA5A 1VP9A 2GA9A 5HIJA 2GS9A 4PYMA 2VZ9A 3T7TA 4DM3A 4LWPA 5KVAA 4BLVA 4DA4A 2G71A 3OU2A 3T7SA 3CCFA 5D1HA 5E1OA 3CC8A 1JG4A 2JJQA 2ZIEA 1TPYA 4R6XA 5E9JA 3I5UA 4CTKA 3HTXA 9MHTA 3HEMA 1G6Q1 2IH4A 1I1NA 3SSMA 2YTZA 3G8AA 4JXJA 4QPNA 1XCJA 3FTFA 1XVAA 3GRYA 4HGZA 3GO4A 5F2OA 4KWCA 2ZBRA 4RTMA 2P3QA 4OX9Y 1KPGA 2ZFUA 3BKWA 3GCZA 5CD1A 3HNRA 1R6AA 3SSNA 1R74A 3HCEA 3UJCA 4PYKA 5EIWA 3LL7A 2XVMA 4E2XA 1YFLA 4E30A 3O4FA 1PRYA 4P58A 2ZZNA 3CJQA 2UYQA 4P7KA 1RI2A 3QOWA 1U2ZA 4DZRA 1YZHA 1X1DA 4KIGA 1X19A 2Y1WA 1M6YA 5CUQA 5M5BA 3PLAE 2PSSA 5FA5A 5K03A 3V97A 4P7FA 4KVZA 5BW4A 4MTLA 2CL5A 5BXYA 5MHTA 2P40A 3G5LA 1X1AA 5DRYA 4E31A 4R05A 1NBHA 3A26A 5EIFA 5F2KA 5EOVA 5HOQA 3G2MA 1D2CA 5G02A 1G38A 3L8DA 3LECA 3AY0A 3OFJA 2O05A 4MWZA 2AVNA 2PY6A 4V0RA 4RSRA 5GWXA 4F84A 1X1CA 3Q7EA 2CKDA 3E05A 2IGTA 3JWGA 3KU1A 3MTEA 2AOUB 5GOZA 5DXAA 2VDVE 2EX4A 1JG3A 3GWZA 3G8BA 2CMGA 3IYLW 3DLIA 4AX8A 3KQOA 2YXEA 3P8ZA 1DUSA 3JWJA 3ME5A 5ERGB 4FT2A 4E70A 2P3LA 2FK7A 2FHPA 3VSEA 3GU3A 1DCTA 3LDFA 2JH8A 2WA1A 1KYZA 3GRUA 3SXJA 3C6KA 3PFHA 5HIKA 2AOTA 4P7GA 3SX0A 2HR1A 2YR0A 4ER6A 3PVCA 4EQZA 2JHAA 4X1OA 5EMLA 4GC9A 1NW8A 2VP3A 5EMMA 1P91A 1AV6A 1SUSA 1XDZA 3UWPA 4ER3A 3FUWA 3LGAA 3DOUA 3NDIA 3MGGA 5T6BA 3PX2A 5LQAA 1FP1D 3MERA 5DT2A 5FTWA 3OE5A 4RTOA 2V7EA 1RJFA 3ELWA 4RTQA 5IKMA 4KW7A 4PGHA 2ZZMA 2Y1XA 3EVDA 1NKVA 2B2CA 2ZULA 3M6VA 3OPNA 4HC4A 3FUUA 3G88A 3PT9A 1BHJA 1UFKA 3BKXA 1KPIA 4PYQA 3TFWA 4E2ZA 2XBMA 3B3JA 3FUXA 3G89A 4IWNA 5K0GA 3K6RA 3IHTA 1EJ6A 3OZTA 4ATNA 5ICEA 1VBFA 4OBWA 1Q0SA 5B1SA 4PCLA 2NYUA 3AXTA 3BWCA 4R8RA 4CWAA 3P9IA 2VDUE 1B42A 5E1BA 1L3IA 1XJ5A 5HZMA 3EEOA 1VPTA 3MAGA 2K4MA 4C06A 8MHTA 2NP6A 3OZSA 3FTCA 4IV8A 4ER5A 2PXCA 3HM2A 3FUVA 4YUVA 2PX8A 3EVEA 2AN4A 5LQCA 1L1EA 1D2GA 2DPMA 4IV0A 1M0EA 4RTNA 5GIPE 2PXAA 1P1BA 5K0FA 5KS2A 2JHCA 4YMHA 4HRAA 3E23A 2JH9A 3P71T 5LR6A 1QAOA 2ZTHA 4E2YA 3EGVA 2VDWA 5JR3A 1N7IA 3ERCA 3NJRA 4RVGA 5DX8A 4FZVA 4PNEA 3G2QA 1N2XA 1NBIA 1NW5A 1VLMA 3P2KA 1BOOA 3G7UA 2IP2A 3LSTA 4YV2A 2EJUA 4RYLA 5FWAA 1YB2A 1RJGA 4XCXA 2Q41A 3UBTA 3DTNA 4WXHA 3I53A 3MCZA 5K01A 2EJTA 5GINE 2XYQA 1EQAA 1SVUA 3LCVB 3O7WA 4A6EA 3P9NA 3ER8A 1YZ3A 3ORHA 1JG2A 4PIMA 5E9WA 5FWDA 5CCBA 4X63A 3M6XA 2ADMA 3M6UA 3GNLA 2AN3A 1TW3A 3FRIA 3M4XA 1XCLA 1JQEA 3X0DA 1JQDA 3NVMB 1NW3A 2IDJA 4O29A 5EQJB 2ZWAA 2QY6A 3OFKA 5DM4A 3EVCA 2IFTA 4X41A 1XDSA 4CKCA 1QYRA 1XXLA 3DULA 3RIEA 2I62A 3TLJA 3FYCA 2VS1A 2OZVA 2ZWVA 2PXXA 4RVHA 4XUDA 3EMDA 5DXJA 1JQ3A 2C7QA 1M6EX 3KPVA 1JSXA 3A7DA 5E2AA 3C3PA 2FYTA 2PX5A 1QAMA 4Z2YA 5LQKA 1QANA 3C0KA 2Z6QA 3AXSA 3UZUA 1ZGAA 2ZSUA 4RX1A 3DXXA 4UOEA 2B9EA 3UJ7A 2C7PA 3BWYA 3LCUA 2NP7A 3M6WA 4Y30A 4CTJA 2ZW9A 3BGIA 2PT9A 4HTFA 3TPZA 4EK9A 5IH3A 1EAMA 1F3LA 5CVVA 3P2EA 4MIKA 5EEHA 4FGZA 2XVAA 5CM2Z 5T64A 3HP7A 5E1DA 2E5WA 4RTSA 2PWPA 3KQSA 3M33A 2ESRA 4NECA 1RI1A 4FT4A 4QQKA 1VP3A 4RWZA 1G55A 3R3HA 2GPYA 4AZVA 2R6ZA 2ONYA 2B3TA 4AZWA 5E2BA 2NXJA 3FPEA 3SVZA 2PVCA 3BGVA 3G5TA 1Q0TA 2P7HA 2OB2A 2OO3A 3BWBA 5K0BA 5GIOE 2YXDA 3CBGA 5P8WA 4DCMA 4AUKA 3I64A 4WVLA 5DSTA 3TR6A 1FBNA 2R3SA 5CVJA 2H11A 5EC8A 5FA8A 4C03A 3PB3A 1KYWA 2ONZA 3MQ2A 3KQVA 4P7JA 4FR0A 2ORED 4PGGA 4YUWA 2YXLA 2F8LA 2AOWA 3B3FA 5CVEA 3OU7A 1YFJA 1I4WA 3ELUA 1SKMA 1AQIA 2FCAA 1JSZA 3NW9A 5EZSA 1R00A 1Y8CA 5FULA 2BR4A 4DF3A 4YMGA 5F2NA 2Z6AA 2AVDA 1FJXA 5GM1A 3KPWA 1I9GA 4RTKA 4FSDA 4E32A 1H1DA 5C0OE 1D2HA 4V0QA 2OYRA 1KXZA 2G70A 3TKAA 3KKZA 3EVFA 4ZTBA 4AZTA 2CMHA 3R0QA 4QVGA 5EG5A 5EEGA 3RODA 4QVKA 4CKBA 2PWYA 5HEKA 3FPHA 2KW5A 3CVOA 3EMBA 3QOXA 4XUEA 4PYJA 3LBFA 2IPXA 4RTRA 2O07A 3D2LA 4DKJA 3A25A 3B7PA 1G8SA 1UWVA 1G60A 3FPJA 3HVHA 2IH5A 3MHTA 2N47A 1EJ0A 3KQWA 3NWEA 4XUCA 5ICGA 3SM3A 1WG8A 4AZSA 5KQSA 3I9FA 1VL5A 1TW2A 4FSXA 3V8VA 4A6DA 2EFJA 5K8VA 5CIYA 3ER9A 1NV9A 1XDUA 3LHDA 3S68A 2C7OA 3UJ6A 5LQNA 2OY0A 4M36A 5FADA 4QQNA 2HMYB 5DRTA 3SGLA 3FUTA 1NV8A 2AZTA 2QYOA 2QRVA 3GIWA 4ER0A 3HVKA 4CXMA 4R8SA 3LKDA 5EMKA 1ZHFA 2EG5A 1JG1A 1VIDA 4HSGA 3LCCA 3BUSA 2LD4A 4YUYA 5DTMA 5LQJA 3GDHA 5CCXA 2IIPA 2I6GA 2B78A 3HCBA 4C4AA 5KQRA 1RI3A 4OQDA 4PYNA 3WSTA 3E8SA 4GUAA 3HCAA 1ZG3A 2PLWA 2YUIA 2FRXA 2OBFA 2NXNA 2ZBPA 3KQMA 4MQ4A 2ZIFA 2QE6A 1O54A 1NW6A 3KPJA 3PFGA 4GOOD 2PT6A 5CVUA 3TKYA 1VE3A 1DL5A 3A7EA 3HCCA 4RV9A 5EZQA 2I9KA 4C04A 3GJYA 3GXOA 3SR4A 4QDJA 4RTPA 2GB4A 5U4XA 3NDJA 3E7PA 5E8RA 2OXTA 4HH4A 4RVFA 3P2IA 3R9XB 2NXEA 4Y2HA 5FCDA 1JTEA 2O06A 5ICCA 3EVBA 3EGEA 5DPMA 3T0IA 1RI5A 1T43A 2G8NA 2WA2A 3MTIA 3FYDA 3NTVA 3U81A 3CKKA 1WXWA 1JTFA 4EMSA 4OBXA 2G72A 3B3GA 3C3YA 2HV9A 5DX1A 1WZNA 3ELDA 2YQZA 5HFJA 3P9KA 1ORHA 4PYOA 1AQJA 2CWWA 1P39A 4G56A 2JG3A 4R6WA 2Z6UA 3DLCA 3BT7A 3K0BA 4GOMD 4GF5A 1QZZA 4KIFA 4POOA 2ZBQA 3KPYA 2XYRA 3MCTA 1L3CA 3I58A 3OU6A 4K6MA 2AN5A 2AR0A 3PS9A 4GOLD 4RVDA 5E8JA 3SMQA 2B25A 3Q87B 4M38A 5DX0A 3RW9A 5E1MA 7MHTA 3GRZA 1ZGJA 3AJDA 3THRA 4BP1A 1G8AA 1IXKA 3FTEA 1R8XA 3DUWA 3LBYA 4F85A 1IM8A 5DM0A 2IH2A 2GLUA 3B5IA 5GP1A 5D1NA 5DTRA 4RTJA 4M37A 1WY7A 5EMJA 4F86A 1RJEA 3FPGA 3KQYA 3CJRA 4OQEA 3UJ8A 4CKEA 4ER7A 3EVGA 5K05A 1EIZA 1MJFA 3KQPA 5EKUA 3UJDA 1XTPA 3PTAA 3TMAA 1RI4A 2BR5A 5CVDA 5C9ZA 3OE4A 4HTFB 4BP3A 3PX3A 1YUBA 3FTDA 3DR5A 5DSXA 1L9KA 5LQUA 5LQRA 3UA3A 2O0LA 3EPPA 3B89A 3EVZA 3C6MA 4PYLA 1P1CA 5HIMA 4DQ0A 3HVJA 2ZCJA 4MHTA 1N7JA 3IEIA 5FHQA 1WS6A 2NXCA 1BC5A 3FZGA 4BLWA 10MHA 2HTEA 3DP7A 3HA7A 2HWKA 2BM8A 5FUBA 2UZ4A 2PV0A 2UYOA 4GOND 3LX6A 2UYCA 5K0LA 3VC1A 4FP9A 4EVIA 5ICFA 1SUIA 3DMGA 3HCFA 3IV6A 3SSOA 4LG1A 3UA4A 1V39A 1KIAA 1R8YA 3F4KA 3H2BA 3DMHA 2V74B 4HG2A 4KDRA 4LWOA 3UJBA 4RTLA 2ZLBA 3M70A 4H0NA 4PIPA 2GAFA 3ID6C 2IBTA 3NMUF 1JR4A 2AOUA 3HA3A 1RJDA 4KRGA 5EHGA 4IKPA 4YV0A 2XYVA 3GRRA 1UIRA 3TM4A 3KR1A 3NWBA 3TQSA 2IBSA 4QPPA 4BY9E 1HMYA 5FQOA 3BGDA 3TM5A 3GRVA 5E9QA 4C08A 3OCJA 4YUXA 5BP7A 5LSAA 3KQQA 3LDUA 2AOTB 2YX1A 2A14A 2PX2A 3CJTA 3HCDA 3JWHA 3UFBA 2UYHA 2QRVB 3BXOA 3TRKA 2AS0A 3A4TA 5EPEA 1NT2A 3KPUA 2AOVA 1WXXA 1NE2A 3MB5A 1FPQA 3TOSA 4EKIA 3GGDA 5EKXA 5DWQA 3KR0A 1ZKDA 4E2WA 3EVAA 1PJZA 2IDKA 3LKZA 2BH2A 2ZIGA 2BZGA 2JHPA 2OB1A 4B17A 2P3OA 2PJDA 4OA5A 2DULA 4C05A 2GH1A 2C7RA 2PGXA 4DCGA 1X1BA 3DH0A 4BLUA 4U7PB 5FQNA 3ELYA 1IY9A 1SQFA 1KPHA 2PX4A 2FPOA 3DXZA 5T67A 5BW5A 4HGYA 3THSA 2P8JA 4LECA 3KR9A 2O57A 5DTQA 1KHHA 2ZVJA
chains in the Genus database with same CATH superfamily
3WICA 4RF3A 2QM3A 2X0DA 1OYYA 4J0IA 3OT1A 4GKAA 5HIIA 3PF9A 2JC3A 1L5HA 1CQZA 3UMFA 3U44A 4MRPA 4DLSA 3AWIA 2IELA 2FZ5A 2D5BA 4K9PA 1K63A 1Q22A 1RQNA 4RSHA 4CCYA 1XA0A 1RXUA 1EP2B 2HOQA 2PLFA 3B9QA 2P78A 4B74A 4DILA 2BV3A 3I09A 4Z4FA 2Y1EA 4E5DA 1D6NA 2FMHA 5AM0A 5EY5B 1GKKA 3DVAA 4YH1A 4CR6A 1QG6A 1V47A 1ESDA 1U8EA 4DMGA 5C31A 4KQMA 4JBIA 1IPFA 1WABA 2GI4A 4GBED 4ZVOA 3EUEA 2JF0A 4I55F 2WQ6A 4NCBA 1KDPA 3DMRA 1QB7A 2I4LA 5BPHA 4P1ZA 2B6HA 5K6AC 4I50B 4QEKA 1TEXA 4N39A 1TCAA 1PR3A 4YYEA 3EH2A 1M2WA 4E21A 1CBUA 3DLPX 3LWBA 1GUZA 1R4ZA 1W94A 2J08A 2QGNA 3ROQA 1RKVA 4IJQA 2MOKA 3JWIA 2B1GA 4EY8A 4K3VA 3OZRA 4ZJYA 821PA 3K3PA 3KSRA 1CR2A 1MIOA 4MCIA 2YWDA 2H8GA 3KTAA 4N12A 1B23P 4S1TA 1M8KA 1PTKA 3S2UA 2BHTA 4BB5A 2ADOA 2C9ZA 3OZGA 3PUKA 1TQ8A 3I9JA 3PHGA 1NNEA 2GPBA 1E3DA 1GKYA 1SKUA 1ZVQA 4UARA 5HUHA 5K0JA 4GKBA 4H6VA 1VP9A 5ADVA 2HD4A 2EJWA 3INNA 4HRXA 1OGYA 1KJZA 4C29A 3T9BA 3U60B 1XEXA 4ZICA 4Q7JB 1I6MA 4P9NA 1U6IA 3D9QX 3EARA 2I1VB 3ZWQA 1EDEA 1O0SA 1DX4A 2P9BA 3HEMA 1KZ7B 4GOKA 4NZ9A 4P3PA 4ZMRA 4B0OA 3AL3A 4Y9UA 4L4YA 1F1JA 4EFNA 5B36A 4KAFA 3HPRA 2BFDA 2IW1A 3KSUA 2DLNA 2HMWA 2Q6OA 4JJ8A 4OJYA 1RWKA 2ZR0A 4XCVA 1UXHA 5JH7A 2HHHB 4OX9Y 4I9GA 4G84A 4RF5A 4AVYA 1V41E 3AR8A 1BN6A 1PN3A 1X9HA 3EXAA 4EIWA 2PTHA 3I1JA 2GYUA 1XOIA 2ZCVA 3E1GA 3IPRA 1U2ZA 4G0YA 3HJUA 4JMLA 4M1TA 5HKLA 5M5BA 3TIVA 1EDDA 1UM9B 2D1QA 4RVUA 2FEMA 2IOYA 2W6QA 5EQTA 2PN1A 2CXHA 4BVHA 3LDAA 4KVZA 5LUAA 5EMHA 3GDOA 5K4HA 1J2UA 1IOLA 2ST1A 5DJ5A 1M74A 2XPCA 3NHRA 4DT1B 4F3TA 1KFEB 4BMYA 1IB6A 1FU7A 4G9EA 4RZSA 3SHQA 3VPHA 4MJ7A 5GWXA 2I7TA 4H27A 4PHTA 3EIUA 3GYGA 3JWGA 3ETCA 2Q2WA 5C1OA 3EAGA 5HF5A 4HLDA 4TN1A 3W8RA 3PC8C 3VPBA 4CQLA 1WCIA 1HRDA 1KI8A 4OYHA 4FFPA 3ZC3A 5EJ4A 1M54A 1PFQA 1Y4SA 2JLYA 1KJNA 1XNRB 2BP7A 2Q5LA 2GFHA 5HIKA 4EQ6B 2XF2A 5AESA 3DE1X 2WSLA 2AC4A 1TKCA 4ER6A 1XZJA 1IQ0A 4X1OA 3E82A 4MKRA 1L5HB 4WZ6A 3ZHCA 1Z8HA 4OF4A 4EL5A 5EMMA 1BMFD 4QUIA 4URWR 2I34A 2I6QA 3WMGA 3CU5A 1YZYA 1KDZA 4GYWA 1T0BA 1XTSA 2E9SA 3A8TA 4DARA 2W2QA 1NZFA 1DT5A 5CB0A 1GUDA 3VSDA 1L7AA 1HDYA 2IZ5A 4RTQA 5IEJA 3L7LA 3A9CA 1FIUA 4QQKA 4RA9A 1QG2A 3HKBB 1RS0A 3ZHVA 2Q3CA 3BKXA 3N0TA 1PSZA 2JFFA 2Q4RA 4HQRA 2P91A 3TQIA 4BB9A 2QMQA 2C4UA 3QUQA 5K0GA 3AKEA 4Z9AA 4CDNA 2CYCA 2GVNA 4O4LA 3JVIA 1A50B 5DCYA 3SZUA 4IDQA 5FA6A 2OK8A 1VYHA 4UASA 3NT4A 2WJYA 3O8OB 2ZXEA 4HT3B 1H65A 1QFXA 4P4TA 2CBGA 5TB5A 2MMCA 4CIAA 3WX0A 1XGKA 1V0JA 1COWA 1B73A 4R0VA 4K9SA 2R4QA 3T4PA 3EZXA 1LQTA 2ONJA 3ONDA 5JCPA 3KOOA 1JEEA 4QBFA 1TEVA 2QR2A 4HWKA 4TMTA 2QZPA 4IV0A 3RANA 4CKZA 2X15A 4AKEA 4A9AA 1PGQA 4EOGA 3DLTA 5GY7A 4EENA 5TJHA 3TTVA 3LLMA 1OBHA 3MWFA 1VL2A 3RVBA 1MJNA 1RMYA 2Z09A 4RORA 1QE0A 4BCBA 4CI9A 3TFOA 4Q24A 1H6CA 2VLBA 2O3JA 4ZVMA 1B8PA 5GZ3A 2XW6A 3ROPA 4MS1B 2G40A 2Q1WA 2MDTA 3IBTA 2VR1A 4JHLA 4OFBA 1DFIA 1G98A 1GZ5A 2DT8A 3EWAA 3RWOA 4C0KA 5I7FA 3TZCA 2ALJA 1E2DA 2GN9A 3AHDA 1MN6A 4IZ6A 5COAA 2EP5A 1E59A 3HKEB 2ZJ7A 2DQ4A 1B1CA 2YUTA 3GLIA 1X9GA 4L5JA 1LPAB 2E55A 3O91A 4RE5A 1BEUB 4U7WA 2V1UA 1N2IA 3A2KA 1CRPA 1QWSA 4EYGA 4FGWA 5FUQA 5JW6A 1Y3BE 1YRLA 2D06A 2GXAA 4IFIA 2O7RA 3GJ7A 3GNLA 1VG0B 1Z06A 3VZRA 1NBEA 3MELA 5D3MA 2AW3A 3FNBA 1CG6A 2AUNA 5CH8A 2CBZA 1N6IA 3I62A 5EVCA 3R0XA 4R9SA 1B16A 1KJWA 2HBRA 3SHOA 2ZRAA 2E6UX 1U28A 2FSFA 8MHTA 2ZYSA 1XDSA 2MSKA 5C3UA 5BVGA 2AN9A 2ZTVA 3M5PA 3HYTA 2QAGB 3DMPA 2CXNA 4OLJA 1QU2A 1LFDB 1PZGA 2D5LA 3EY4A 4DQUA 5FX2A 3ZKAA 5LD2C 4HPXB 4CEJB 2VPTA 4GFDA 1OASA 2IZ7A 2WTEA 3LUAA 4IO0A 4DQXA 2QNIA 4M7WA 2BFCB 3IQHX 2B9EA 1VIVA 2X7XA 2C61A 4AC9A 1M5UA 3K0AB 3LCUA 4RY2A 4XYGA 2NP7A 3AY3A 1N8SA 1V2GA 1NG9A 1NQWA 4FYPA 4G0QA 2WB2A 3D54D 1R5BA 2XRFA 1WCIB 2GCEA 4GZ5A 4RZ2A 2VHYA 2F90A 2Q6TA 5JYEA 1ZVKA 1TMGE 2EX1A 4OX9B 1E64A 4ZHSA 4FCTA 2ESRA 2V55B 3S7ZA 2YMLA 1M2GA 3T1TA 2JIDA 5JLJA 2CJWB 4RESA 3SNHA 1MW9X 1CRLA 3OICA 4N47A 1R0RE 2PVCA 4F6RA 4UTOA 1OWNA 2NG1A 3BWBA 5HF8A 3K70D 3HUDA 3TLKA 1H2ZA 5JRZA 1OH8A 5K4GA 3L6CA 5IWAB 4WVLA 4KXLA 3GARA 1UMDB 2GBCA 1NM5A 2OQVA 1IJBA 4C03A 4YPVA 2GOYA 3H5TA 1KYWA 4FR0A 4Y1RB 5JMPA 4LMRA 5LZ5A 1CVLA 1H6DA 2FR8A 1XKXA 4JENA 4D9IA 1DRJA 1DAFA 2ZVPX 3G5MA 5CVEA 3ZCQA 2FCAA 3QLVC 4DSNA 2I4IA 2ZK7A 4JWTA 1TB4A 1EMDA 2IY8A 1G5IA 1NVUQ 3U7JA 3EGOA 4U7HA 3AFOA 1I36A 4RTKA 4CM1A 3O9MA 2WMNB 4G07A 2J45A 4JCOA 2FE1A 1S8AA 2Q8PA 4KC0A 3U2QA 1U8CB 2QRPA 3A2LA 5EE0A 4PCUA 3BBPA 1JIVA 1JSLA 3AU8A 3BS4A 2LCQA 1LCIA 3BSYA 4ZVNA 4JLKA 1Q92A 1BRMA 3FMVA 5CTJA 4KPYA 4RDCA 1PFWA 1G5TA 2XE8A 2Y0PA 4CLRA 4N6OA 4X1IA 3L8EA 3RAGA 1GU0A 2CMFA 3Q85A 4ZVQA 1I2MA 2OD2A 2NO6A 4DMCA 2GDJA 3ROGA 1UXJA 2SCUA 1P73A 1UKAA 4L5IA 3PWZA 3DVRX 1UMCB 3NWEA 4J0FA 4J0CA 4XUCA 2G3YA 4EDFA 4KP7A 1NZJA 2QE7D 1XDUA 4L5CA 2OGZA 2IZOA 2XGOA 4YONB 2FEWB 5J1TB 4WNCA 1H66A 1EWRA 2JIPA 2VJNA 3TQFA 3UN1A 1Z6QA 4LF8B 5CB4F 1O8BA 2OBLA 3ED5A 4JXXA 3U3OA 1GNRA 4H0FA 3NYRA 3NHLA 4R8SA 1P6XA 2QQFA 3RU7A 3ZE8A 5EMKA 2GRJA 4X7BA 4ZJUA 3UWKA 4IJWA 4F97A 3TTYA 3ZX4A 3V4ZA 3GLIB 2QSJA 1BXRA 2ZSJA 3FYUA 4W82A 4XIJA 3OF2A 1LSJA 1ATIA 4XYBA 5CR9A 3U3KA 3GPDG 4B81A 1SVNA 2O2HA 2HU7A 1QTIA 2JGAA 4RNDB 4GUAA 4Q39A 4K0KB 3PV0A 1DJQA 4MWEA 3KYDB 3LWDA 4FU0A 2Q7XA 4U5XA 3MYYA 2Q4DA 5IG2A 5HRAA 3PHLA 1U7TA 1YBMA 1ZSYA 1UPTA 1X7YB 3QA9A 4L3VA 1OAAA 4H0CA 4BE7B 2Q7OE 2C9DA 3L8HA 1L4FA 1T8TA 3M83A 4ZV7A 1KETA 3ZPXA 3QPUA 5B7NA 3PC4A 3IR7A 1UM8A 4W6QA 3V5NA 3BJZA 1EWKA 4JA0A 4DMFA 4Y2HA 5HZMA 1OGIA 2W6JA 3HGQA 3L8GA 4PLWA 3EGEA 5AHOA 3U7FB 3FKJA 5LJLA 3ZJVA 4K9NA 1HX7A 4D1YA 1ATZA 1WXWA 4ARZA 2Y92A 1GZUA 1KSFX 4G5YA 3NNNA 3DVQX 2YHUA 5KCZA 4F1JA 3UAYA 3ZGVA 5HFJA 1C8VB 1EH5A 3GYBA 4IDEA 5IUJC 5IN5A 5JSFA 5DP2A 3PDUA 1CR0A 4FXPA 4BGIA 1RP7A 2A0KA 1XAHA 4LF9B 4S1VA 1USIA 2YCBA 4AB1A 5F21A 3VR5H 2UXCB 4XQ0A 5IHPA 2CN1A 3RW9A 3GCXA 1PQPA 5BWLA 1P3Y1 1UODA 1V4VA 1XBTA 2OFOA 3GGCA 3VGPA 3WOVA 2P77A 4JJ7A 3VOBA 5BUCA 5CFQA 4WK2B 1SIBE 4CKYA 3JD2A 1QUEA 3EE6A 3K96A 4YRAA 2YDYA 4BZPA 1XTRA 3I1FA 3MJ4A 4M0CA 3O38A 1PS9A 3MAAC 5I01A 2P75A 2BLLA 1JHZA 4CLOA 4JC4A 1W4RA 3VVMA 4D02A 1N4AA 2XI4A 1MJFA 3ZHBA 4M9CA 3AF1A 2RCNA 3IP7A 4PRZA 1NTRA 2FMFA 3M34A 3OQJA 4RVNA 2HHLA 4INPA 4OU5A 1QF7A 4PLTA 4DWOA 4EP1A 1CK4A 4XJXA 2WIGA 5F4ZA 5F23A 1YHYA 5K0TA 1YB1A 2VQSA 1Z0AA 2H16A 1K7FB 2E6KA 3H5RA 4M9UA 4Z0PA 2C92A 2Q99A 1P1CA 5HIMA 3U6BA 3PXEA 1VI5A 5E38A 5M04A 4JT8A 4JYPA 1TECE 2NXCA 3FZGA 10MHA 1DHTA 2QW1A 2R6GA 3V00A 2HWKA 4ZU1X 4R83A 5T6MA 3NAZA 4A82A 3HB1A 4MV7A 4A03A 1MO3A 2A86A 5ICFA 1GTZA 1J09A 1X1SA 4M88A 1G9TA 3PHBE 1BJKA 3LX8A 3G0DA 4GM4A 4R2JA 4C6HA 2IXDA 4QDZA 2Q29A 4ZP1A 5B3LA 1RZRD 4GMFA 4KX3A 3TLCA 3TL3A 3JXEA 2AOUA 3QMMA 2WKWA 5INTA 1GNLA 1VRCA 3D8SA 3GRRA 4TVKA 3C1OA 3RROA 4MUYA 4WN3A 4YBRA 1DEHA 4Y6PA 3QJGA 3KR1A 3ZG6A 5KJ1A 1C1XB 2JGIA 1YFZA 3E6AA 4NV1A 1NNSA 1A8HA 1YQUA 2DBQA 2P1RA 4FHGA 2J5BA 1XTUA 4GLLA 5G0TA 5JXJA 4TYNA 4KXVA 2R6FA 8ADHA 2EWMA 3N86A 4DPKA 3EMVA 5JMOA 5H68A 2WRZA 4OQFA 4ZKEA 3U3JA 4KODA 2HMVA 1L5WA 1MA3A 3MTAA 1M2OA 3GJZA 2PMKA 2YWHA 3DOJA 4E2WA 2JIZA 4D4KA 1QKJA 1ZYUA 4I4IA 1DKLA 5HQJA 5CB6A 2OB1A 1G5RA 3KDSE 1LBEA 3H1BA 4HAUA 4QJ5A 2QTGA 3UG7A 3WK6A 1OI2A 5K3EA 4NE7A 3TB6A 3RU3A 3KO8A 3PXGA 4EYKA 2W8ZA 4JL6A 1SVSA 2D3WA 2XJ9A 4RLQA 3KYDA 3EXIA 4HX9A 5E6UA 2ZRPA 1OC2A 5CBKA 5I9SA 1FNMA 1F06A 5AJTA 2WAXA 3O0TA 4QKQA 1CUGA 1DLJA 4X84A 3MRTA 3QU5A 2NXWA 4X8MA 1FRNA 4ID9A 3RK4A 4AZ0B 5BVHB 2C5GA 5IVKA 2QL6A 3AEYA 4GEKA 2XUKA 5BSRA 3KQTA 3WQBA 3K6SB 3L4BA 2C8VA 4WV3A 3DLBA 2CV1A 4YDRA 1XO1A 1R0YA 4OHXA 2B4KA 1E3LA 1OR8A 3DQQA 3JAWA 3HCPA 5HQTA 2ZJ1A 3QIAA 3PE3A 1APBA 3I9KA 2IKQA 1IHPA 3VYWA 1Z6XA 3U4CA 1PG5A 2FQQA 1XRRA 4ND4A 1TYEB 4D45A 4EBBA 3TGPA 3CRVA 2FUNB 3M81A 2RGYA 3JQ7B 5CGZA 5AVJA 2BDEA 5M29A 2D1TA 5BN3A 1STOA 2NUPB 4A2PA 4AP5A 4QUJA 4NNPA 3C4VA 2BSAA 1I4LD 2CVZA 3HDQA 2R6R1 3EWSA 4BGVA 4CF4A 4JKIA 3UYKA 4EJSC 5TNXA 1CP3A 5DKFA 1UPUA 4AJKA 2O5RA 4F4IA 4UM9B 3HO8A 5FUXA 4G0OA 1M7BA 1S2DA 3CB4A 2I7CA 3NYWA 1K5PA 3OCYA 3TNDA 4OHBA 1KAQA 3WGIA 4Q3AA 4PC3A 2VSQA 2YC2C 4TLEA 1SVIA 4KQJA 2FG7C 3CH4B 2D1YA 4XR9A 4YCBA 2ZM6B 1E7QA 2VRCD 4MXDA 1Z5ZA 4X90A 3TZBA 5I4KA 4BMDA 1AUXA 3BWMA 4PZPA 2VKQA 2OYSA 3DXYA 4XLZA 1KJYA 3C3XA 1XQ6A 3W2TA 1XQXA 3QWBA 2QVYX 1K6JA 2A9KA 2NZYA 2WE7A 3DEJA 4PWYA 4ALJA 1ZH2A 4D6YA 1HA3A 1G20A 3PD1A 3AHJA 5F12A 3TW0A 4BNGA 2XQIA 4S12A 2ZRQA 3U4QB 4C0JA 2YY6A 3AJRA 2FGJA 1TLFA 1CUXA 1FSSA 2QLJA 3D8BA 2PA3A 3OZFA 2G71A 3GUZA 1ZXBA 2QTWB 3OU2A 1KJ9A 4IH9A 4R6XA 1M2EA 1V4BA 3SYTA 3AVYA 4CMEC 4X62B 1M1ZA 1PWXA 3RV3A 2X7JA 2GCPA 3P1JA 3WL5A 1NQ5A 2Z04A 3FMPB 3RTGA 2PQ2A 1O96B 3PQ2A 2GF0A 4GNKA 4O4IA 5A9RA 3DZ8A 5JXGA 4FJ2A 1MH9A 1W93A 3SSNA 4YB8A 1JAIA 2IS1A 1HV8A 1GG2A 3CZ5A 5ALQA 1LVGA 1O5TA 5IT5A 3O82A 2G9VA 5K8LA 4I6JA 1XQ1A 1MJHA 3AJEA 1T9KA 1LDBA 2C4WA 2VH1A 4YY3B 2VYFA 3VNBA 3I8XA 5C7YA 3BF7A 3WHLA 1VCIA 2L2QA 4EUFA 1IYZA 4PZ9A 2C59A 1N3YA 1V96A 3AEZA 1RLJA 1WXDA 1XVLA 2CNOA 4KR0A 4JC0A 4ABYA 4AJ9A 4BLTA 4UD2A 5DNYB 2WLTA 2O05A 3EIOA 3GF4A 1R64A 4LJ8A 4V0RA 3SHFA 4R01A 1YDEA 4JB0A 1ZGBA 3ZDAA 1M3SA 3PSAA 5HOQA 1QLJA 1QQAA 1RIIA 1W88A 2Q3HA 3BXZA 3T6KA 4OM8A 1KI4A 3TSZA 3WLHA 2DHEA 1NUQA 1QDEA 3TE7A 2HXYA 4E70A 2J9YB 2QL9A 5KWSA 3DBVO 3PUYA 5ESXA 2WYIA 1N2JA 1Z2NX 3GW8A 1Y82A 3UHAA 4D56A 1C9JA 2GN4A 4BZZA 4G85A 2RGBA 3KSBC 3VM6A 2ENWA 1Z07A 4TZ0A 4PSVA 1XELA 5E6UB 3DQPA 4O3FA 3PA6A 3QVGA 1UOQA 1NTOA 3GEEA 1JAXA 4J6FA 1NW8A 1Q2UA 2H6EA 1ZXLA 1M67A 2JHFA 3PQ8A 3SQOA 1FP1D 4FFSA 3MJHA 5DT2A 4R41A 2TMYA 5FTWA 1RWQA 4XAQA 2GKSA 4XFKA 2FPUA 1GZ7A 1XLTA 1VMKA 5JD6A 3L8MA 4HPJB 2RGNA 1W4CA 3C6ZA 2MR5A 3DCJA 4EJ6A 1XL0A 3D0OA 3WYBA 5KHLB 4JKYA 3RRMA 1NYLA 3AKCA 1EG7A 3VR4D 1HURA 4DR4B 3OZTA 3GOHA 1CUWA 4JLAA 4ATNA 3JZIA 4MKIA 4BP8A 1V6AA 1PGJA 2AV6A 4IXMA 4KV9A 4DSTA 1WKCA 4A1FA 1E9CA 1P72A 5EIOA 1SUEA 1QHGA 3C7KA 4C0QC 4ZI3A 4FBLA 4ZQHA 1X6VA 2CV0A 2CJXA 4G63A 3I0NA 3T0FA 2HF8A 4PPYA 1X7ZA 2GZ1A 2OE2A 2QTCA 3AV3A 3HJBA 3GCGA 5I7WA 1Z38A 1DP4A 2QAGA 3NJ8A 5ECWA 1WBDA 4WH0A 1OSNA 4DSOA 5C4MA 4K6FA 4WPGA 2Y0BA 2DY1A 2MSLA 1X77A 4YQZA 3RABA 5KKNB 2PXAA 3E9NA 3HZOA 2VIIA 4L4UA 4OATA 1E96A 3IB3A 4TTJA 1U2PA 4UFPA 4YMHA 2EWWA 2HEIA 3E23A 1Y98A 3ETGA 1OI4A 5HRUA 4D2IA 1GXSB 1PR2A 1L5FA 3QVMA 4UBOA 1XWFA 5ESDA 1QC5B 2ZTHA 4WKBA 3FSGA 3WHPA 3OHMA 5JSKA 3LQ4A 4KU4A 3N2GB 1UANA 2PRZA 5DBFA 1CJVC 4BRWA 1KC1A 5I7RA 5TVGA 3G7UA 3RBXA 2C1EA 1TVMA 1Q1EA 5FWAA 1J0XO 2OZKA 3ZGXA 5F51A 1SQ5A 5REQA 3EH1A 3K16A 4FFRA 4U7JA 2O8DA 3B1WA 1B8VA 1J0DA 4GRDA 3ESRA 2R8ZA 3LV8A 4JXZA 3M7IA 1S8OA 2JZOA 1PBTA 1V3UA 1G17A 5LZ4A 1KZGB 2W6ZA 4PZZA 5BWNA 1OC4A 4GSLA 4NAVA 1YT5A 2FZKA 3RE1A 3RU2A 3M4XA 3JAMA 1KNXA 1XCLA 1SB8A 1XXHB 5LPNA 1JQEA 3CX7A 2IEGA 4HXFB 3FTQA 2C2HA 3KYJB 2QY6A 7GPBA 1Z0KA 2IFTA 4MZXA 4R2IA 3SQWA 2AJCA 2RGCA 2ZGVA 3O73A 3NEYA 4C6SA 4ENUA 1PWHA 4RYDA 2A5YB 3CPJB 3BIXA 3KS9A 5JD4A 3GLGA 4B09A 1PI3A 2WT4A 2W2NA 2KBEA 4F60A 1ML4A 5KTMA 5TQJA 4Z4EA 3KX2A 2CMKA 4NG5A 1W9HA 1JJIA 1QANA 4YRJA 4KMMA 5AW4A 3NALA 1IUNA 1HDRA 1L7BA 3B1YA 4J0DA 3S8MA 1YQWA 3UKOA 2W2OA 1YDFA 1IRXA 4DV6B 3U3XA 2JW5A 3H6KA 3VZPA 2BHSA 2R1TB 5IFKA 3WNCA 3B3QA 4GX2A 2H2HA 1TM7E 1H3NA 3GVPA 1AT1A 2XVAA 1JA9A 3BEDA 3CKMA 2FZWA 3L46A 5T64A 1CQJB 3G7NA 2E5WA 4DHWA 4X3OA 3U56A 4RTSA 1Z7GA 3HP1A 5JC1A 4NBRA 2C4MA 1RI1A 5ES3A 1W35A 1VP3A 3N8KA 3BC1A 3QM1A 1BDIA 1L8LA 1Q0LA 1FTWA 2QA5A 4CBVA 3B2QA 2G82A 5JS1A 2HJVA 5I9MA 3E9MA 5D5PA 2G04A 3IQIX 1R3DA 2ZB8A 5HKOA 1PP4A 2WD9A 1UP4A 2BRUA 4D5EA 1G4HA 1OXTA 1TA4A 3C39A 1P44A 3KYBA 1JE1A 3V8BA 1WKBA 2NX2A 2FUG6 4PSKA 4TV8A 5JQWA 1WUHS 4ZAGA 1ZD5A 2V5UA 4ZDIA 4C2UA 3HPQA 3TEFA 4WUVA 2VVTA 1P1KA 4S0XA 1TM3E 2XA1A 2AOWA 3B3FA 2WYOA 3V7YA 1SN7A 1M2VA 4MB6A 4R2MA 5H4GA 3HB9A 1F9AA 3AF6A 4ZYVA 3N70A 3AKDA 3GLVA 1DXHA 1R10A 1UT5A 3P2MA 2X86A 4CM7A 5JCJD 2PCJA 3AEQB 1RHKA 2ETXA 2QLBA 1PEDA 2O20A 1PV4A 4FPXA 1T2UA 3N6RA 2UAGA 2WHXA 3W0LB 4EJSA 1VLHA 4D4MA 1CS0A 1OWLA 2XY4A 3DEAA 3TCNA 3ANMA 4QVGA 5EEGA 1BYUA 2IDMA 4TMVA 5EG5A 1B14A 2DUWA 1V7CA 3EG9B 4ARBA 5KOYA 1Q17A 1QTRA 3RSZA 4UUMA 2ZJOA 3D1VA 3EOZA 4J4BA 4C2TA 4GRAA 3C4QA 5C51B 2H4XA 2R1VB 4EUEA 3HDTA 4QJBA 3PD0A 5K8CA 1KK1A 3LUFA 3REQB 1U02A 2ZTLA 3I6IA 5ALDA 4KMRA 3BA1A 3B51X 5ALFA 3WG9A 1Z3IX 4A8JB 4EA8A 4MRAA 4HYQA 1DC7A 4OKSA 4LHVA 1NN1A 4MW9A 2ZATA 1IUKA 5CXSA 3RVPA 1KA9H 1NV8A 2AZTA 4TYWA 1GU7A 1S0UA 5BQXA 2D8AA 3LKDA 1C4WA 3SYLA 1V9SA 1ICIA 3N0XA 3L6DA 4DSAA 4HB3A 2PS9A 2QJWA 2H48A 2PZLA 1TZJA 1X7YA 1CB0A 3HC7A 1JR6A 1MBZA 3QX3A 4C4AA 5AKEA 1GQFA 2EDAA 3SM9A 5F64A 1NQXA 2BFFB 3HCAA 1O6GA 2ZBPA 2NUAA 4Q7QA 2JEYA 4NYMR 5LQMA 2AJDA 4AN4A 3ZCTA 1ZA1A 3K94A 4OXKA 3K1TA 5DYTA 4DG8A 1VE3A 2AZDA 1DBQA 2CJWA 1CJMA 3FCEA 4BQSA 3NHYA 4X8LA 4RPGA 5C80A 3LA8A 4CKCB 4RC9A 4ZRMA 3ETDA 4U02A 3NTVA 1QONA 3PFIA 2GXSA 3PEYA 4LJYA 1JKIA 4EMSA 4RABA 3EZ6A 3L79A 1EZ4A 3OJOA 2CY0A 4ZAXA 1AM4D 3A6FA 4OI2A 3U3RA 2BHRA 3PQFA 4LVCA 1B8UA 1HETA 1TCVA 5FR1A 1TVCA 1KKUA 2FY8A 4JC8A 3Q11A 1JFVA 1Q7BA 1Q83A 2DF8A 2FV8A 1L1RA 1W0KA 2RB5A 3MMPA 3PUWA 4FGUA 4NJEB 2YW2A 2ZKIA 2FTKE 2QE7A 3I58A 4DMUB 3F6BX 3V1UA 3CKYA 2FPMA 1CRQA 2M1ZA 2QQ0A 2VPYA 2P9EA 4QICA 4QT4A 1YK0A 2GNAA 4WY8A 5ADUS 1AG9A 2YOGA 3L7DA 4YAFA 4WBNF 5HZGA 2PFSA 4UU0A 3P0RA 3FTEA 2HF2A 2VRNA 2I67A 3A3YA 1C9MA 5ANRB 1FVFA 3C41J 4CJXA 3JTEA 1G0OA 3UUGA 4LDRA 1Q0UA 1GCGA 3UOAB 1QV7A 3LC0A 5D3KA 4AKTA 4NHOA 1U11A 2OXFA 2CHFA 2Q5QA 3NC0C 4Q19A 1KQNA 4F5ZA 2P30A 1NRIA 2I4MA 3ICEA 4GKVA 3DE5X 2NSJA 5JNVA 4IUDS 1WLYA 2X5KO 1NMEA 3EVGA 1C0LA 5ILQA 5JCXA 3OJXA 3IAAA 4HZUA 1RZUA 2IXGA 2IYPA 2WF9A 4UE3S 2HLDD 4XDZA 1PJLA 4D4JA 5AVZA 2OCPA 1G291 4EAQA 1P1JA 3NPMA 1YQEA 1YUBA 2RHRA 1RE0A 4G6ZA 4QBHA 5EXTA 1OXBB 3WGOA 5ARBA 4W5HA 2H4ZA 4KNYA 3MRSA 1Y6GA 2CLDX 221PA 4UTXA 2P2ZA 3SR0A 1EFPB 3LIIA 1GNVA 1OFHA 4OVKA 2VTVA 3R7WB 3KKLA 3VRHA 4FZRA 4O2AB 4IMPA 3RYIB 4DLZA 1MVNA 3PNLA 2XMDA 5JXHA 4IEFB 4XIGS 3PEUA 1J2JA 2BM8A 3FNGA 2VQEB 4V0NA 2C5LA 4FP9A 4ZVPA 4PZCA 1DIGA 1TQ4A 4D25A 3KHSA 3DWIA 1HKUA 1PFUA 3DMHA 4A0HA 5CDGA 2VHXA 5JZBA 4Q05A 4O8ZA 4B34A 1I2BA 4YS6A 4WN9B 3LUCA 2FA9A 5E2IA 3INTA 3AVTA 3BGWA 1A71A 1NPYA 2RI1A 1CWUA 1GPWB 1NXXA 1PJRA 3PQ7A 4LV8B 2SICE 5KYWB 1T8YA 3HZHA 2WMDA 3F4BA 3JATA 4N3AA 4ZT6A 3RS9A 1LJUA 2WWIA 1F2UB 1NOIA 1J1IA 3GRVA 4YUXA 4RZIA 2PRJA 4BN5A 3PZRA 1OE0A 4HK4A 3EEFA 3N7UA 5LQSA 4E1AA 1M7HA 2V3VA 4GPAA 2F3UA 3ONFA 4P8RA 2C4VA 1YB5A 2W11A 3KPUA 3UG6A 3ZWDA 4EI7A 2BGRA 4DB4A 4EKIA 5CH5A 5JAUA 4BMCA 1PHRA 3AI7A 1ZCFA 2ORVA 3O8LA 1DIAA 3Q8XB 4HB2A 3EVAA 5JJIA 1F8GA 2B4AA 3G1TA 3D5TA 4PSCA 1WZEA 3IAUA 4R68A 4RK6A 1WOMA 4B17A 2WT8A 4HFMA 4NV3A 3I04M 4TMKA 4TWJA 1X3LA 1WEKA 3CZCA 4XH9B 3AHGA 3OAAA 1PDWA 3O3NB 3RVKA 2QVXX 1F8UA 3BJIC 1Z8NA 3DH0A 4NCJA 3MRXA 2GYVA 5MFZA 1SELA 3UANA 1IY9A 5IS2A 1KPHA 4ETNA 5JAZA 2OR3A 3R3WA 3QWIA 1KMIY 3QU2A 1TAHA 5AW2A 5KTRA 1UPCA 1H2HA 2BGKA 3CBGA 2CD9A 3KKQA 3ONNA 3S44A 3MLAA 3PQCA 5K0EA 3ZI7A 1U7WA 4JLBA 1WTCA 4PQRA 3RIYA 2DWPA 2QX8A 1BWRA 2HDNB 3IXLA 4RTRA 3BHIA 4YALA 4CM5A 4KR3A 1EGMB 3WQSB 1KEVA 1EG2A 3FOBA 2PMBA 5B57C 3BN3A 1GEGA 3EYAA 2OKCA 2AN1A 2QI9F 4HH1A 3MOSA 4JASB 2FMIA 1F2DA 1S2OA 3V4PB 3ZDEA 5A5DA 3GJ3A 4M7RA 2GERA 3T7JA 2Q9CA 3H65A 3K20A 3DDNA 3M89A 3BH6A 1QIEA 2P9CA 4HEJA 4PXYA 3T7RA 3FPFA 4B46A 5C7LO 2EJCA 4RSGA 1ELOA 4OJNA 1H94A 5COBA 4A91A 4F21A 3GH1A 3EIQA 1P1RA 4P4NA 1T5TA 2B7CA 4YACA 1TXGA 2FFRA 1BG6A 2O1XA 1X8KA 2DKFA 2I4NA 3TZ6A 2QNRA 1V95A 4E1BA 1QOQB 5HCIA 1MIOB 5ETJA 4PLZA 4XI9A 5LCXA 2J5XA 2O59A 4DSUA 5AM2A 9ATCA 1XN4A 5KQMA 4HEHA 4J4TA 1YRHA 5AHKA 1AD2A 3TSAA 5A4MS 2DLCX 4PBTA 1P0PA 4AROA 1L8OA 3IJ5A 2C2MA 1A7UA 2VRCA 3FNRA 3K9CA 3GEPA 2PLNA 4E33A 3GFFA 1BS1A 4R2XA 2Y71A 3IAS6 3ZLVA 6LDHA 4B3CA 2R68A 4IIFA 1A9OA 4LSMA 2BEUB 1VQ1A 1C4OA 3MLBA 3CNHA 1BGVA 4GR5A 4MRRA 5AM5A 4KGZA 3DBRB 4XWKA 1OQAA 3LH5A 1KY4A 5JZVA 3T9AA 1JJBA 1YRQA 2O4UX 4YJ2F 4YJGB 3HZRA 2ZIWB 3EQ8A 4BLVA 5BN5B 3BH0A 3KV1A 5JAOA 1GZ4A 1XDGA 4EKDA 3PDIA 2A4MA 1WBBA 4GPIB 4CMBA 2EHJA 1CNEA 5KNCH 3M82A 3EQ2A 3ZU5A 3IKLA 3FWYA 1XVAA 3FGZA 3PRJA 2ORIA 1GO2A 3EIFA 1TZKA 1AKMA 3H1EA 2BTOA 1MV8A 2NZXA 1CJKC 3A37A 3GJ0A 3H3FA 3I37X 3KUDA 4GW3A 4RANA 1KRHA 4XLTA 4YMVA 3A4IA 1DC4A 3I6QA 5CD1A 1L4MA 3RAFC 2QTBA 3I8SA 3ZH9B 4S1OA 4A0RA 4YA6A 1DV1A 1VC2A 2G1UA 3N0WA 4OAQA 4YRKA 4HNUA 1YFLA 1LLUA 2HA2A 4MWDA 1YZHA 4D9NA 1X19A 2Y1WA 3PLAE 1YD7A 4DR5B 2PSSA 4PRLA 3IELA 4ZC1A 1UBKS 3B53X 2YHIA 4TQ9A 3AK4A 3PR2B 2OP1A 1X1AA 4G5GA 4L6AA 2I66A 1AQLA 1UJ5A 4I7EA 3ABOB 3P26A 4AF7A 1NRXA 1NVDA 1QNFA 5B1DA 5HUJA 3LECA 2GAAA 1LI5A 2PY6A 5LA6A 3ZDDA 3K0EA 4Q4JB 4RH1A 4UAVA 1ZHHA 5GOZA 1SVOA 3RJTA 1K6MA 2R6DA 3I72A 5DTEA 1TU4A 4URFA 3DLIA 1Y6RA 2GUWA 3V7NA 3Q9NA 3AC0A 1KP2A 4GWKA 2Q5FA 5A3VA 3OJ0A 5LIRA 2Q49A 1U3CA 2B5VA 2VHWA 2IYXA 3ANNA 3DO8A 3ZN2A 1PD1A 1UUFA 5JNSA 1D4AA 3H3JA 3IVMA 2YBEA 2ZITA 4MQ6A 3RT1A 2G7MC 2OO5A 3CKLA 1R3UA 4N0DA 4OBBA 4EMUA 3AVUA 2NU6A 2Q0XA 1Q7CA 7ADHA 5FPYA 3IQDB 1XZGA 3K8YA 3PSHA 1SNYA 1JHMA 1A7AA 2R1VA 4GC9A 4RPCA 5IULC 4UMEA 1QGYA 1DS6A 4MK4A 4BGDA 1HDOA 2ZT7A 4AX4A 1IVNA 2JK1A 1PEYA 2Q6LA 2GD0A 5HRCA 3KKKA 1I9CA 4F92B 2FPPA 3VYVA 4FCWA 3U4IA 4OXNA 2GILA 2O2IA 3QE4A 1PK7A 2ACVA 2GN8A 3HN2A 2WD8A 3OPNA 1NL3A 1QGDA 1X7WA 1KPIA 1GKIA 3DUFA 4PYQA 3MT8A 1YUNA 4LYAA 4ZOQI 1HEIA 1IHYA 3L9XA 1DKUA 4GEGA 5F9MA 4KITB 4B2YA 4GM1A 5DBGA 1USUA 2WIFA 2ZJ6A 4D9BA 1J7KA 1R4MB 4O63O 4IGEA 3DMNA 3OPYA 1JLLA 4RCVA 4WXRA 1YE3A 3HJRA 4PCLA 1EBFA 1KMNA 2ZYTX 3CZAA 4U63A 3FZQA 1ONSA 1ORVA 4J1TA 4L4ZA 4ZD6A 1IQUA 4ZEVA 1IY8A 1E4VA 3SYMA 3UY4A 4B71A 1LRKA 1MOZA 3A6HA 1HE8B 4R2LA 3IMKA 2WQZA 1ORDA 1HMPA 4EGSA 1KY2A 4LDQA 3PIDA 2HQBA 1JEDA 1JXOA 3BG5A 3ECCA 2ZE5A 3F3KA 3RUFA 3W5VA 2AN4A 2EZ8A 1VHTA 2X2EA 4KMOA 5HBRA 4F12A 2VQFB 4ZANA 1FSPA 1MOQA 3NIWA 2AFIA 1XQYA 2G36A 4J91A 4TXHA 5BQ5A 1ZESA 1RQXA 5KYNA 4KACA 3PGXA 2XZPA 2X8AA 3RARA 4DLLA 3SOPA 2O8EA 3RUIA 3EGVA 1XZFA 3PYLA 1QVAA 4DG5A 4CT0A 4DR1B 3RYHA 3TSCA 3OEEA 2DFDA 2YOHA 3ADBA 2OXEA 1UBUS 3MG9A 3BCHA 1VLMA 3EBPA 2ASEA 3ZQ4A 2JLWA 4B73A 3G6KA 1MAWA 3NGLA 3EASA 2FDXA 1N75A 4RLHA 1XCGB 4B43A 1IBSA 2ZJBA 3WC4A 3WKDA 4BPRA 1E3EA 1IZ7A 4D0NA 2P2YA 4ME6A 1MAHA 5CXXA 2HK6A 5FO1A 3IERA 3MWJA 3AERB 4TL9A 4E5PA 2XQGA 3ORYA 3LL4A 2CJFA 1EX6A 2W5UA 4BAUA 4WXMA 1JWBB 4QOSA 3NBXX 4CGYA 1YZ3A 5KNDD 3ORHA 1TTPB 2JRCA 3M6XA 4XJTA 4OSEA 1IZ9A 4HGRA 1EK2A 1W5FA 2AWOA 1L0BA 4JP2A 1E3QA 1EM8A 1KO5A 1F17A 1HYGA 1BSVA 3GLTA 4QOEA 4TRNA 2NNLD 1JQDA 1CETA 1RAEA 2J0EA 5EQJB 3H0EA 1R1DA 4KB5A 1OXVA 3W1WA 1GEEA 4U2KA 1TKAA 2E4XA 4ESHA 1X9IA 1BD3A 4BJ6A 5I7EA 4RXTA 5L3VA 3B6ZA 4KQIA 1GPH1 1SG0A 3BWVA 4MWOA 4XUDA 5GVRA 1TA9A 1L4HA 1Q12A 4FOTA 4UVGA 3RVMA 4D9FA 4IVRA 2J6IA 2VNAA 4G1CA 1AJEA 4W9MC 1QVVA 1ULSA 5AKXA 5C8ZA 3JV7A 1MB3A 4FD2A 1MRNA 2M1XA 1V1RA 5LZ7A 2NVUB 4X71A 1TJ3A 1Z75A 1J0AA 4ALKA 3OZWA 1A04A 3MD9A 2C5FA 2PVPA 3ESBA 4G5SA 3TSYA 1UWLA 2ZW9A 2FRVA 4UZFA 3R41A 3HH8A 5D7NA 3TR5A 1C3XA 1F3LA 1GAJA 3OHPA 5CVVA 5H4HA 3VZDA 4DN6A 4ENSA 5JIBA 2P9JA 1OKKD 1IJFA 1KVUA 1FFEA 1P18A 1VE6A 4XDGA 1NW9B 3SQLA 2IU4A 3A2MA 2HLDA 3DPSA 4JIMA 2O23A 1YR2A 5IYZB 3STYA 5HDQA 2D0DA 3RV4A 4LZZA 3H11A 1F8FA 1OFTA 5IJAA 2X8JA 4BO9A 1XD8A 2VF8A 1FP4B 2XADA 2XX3A 2DM6A 3KOZA 3GP8A 1CU1A 3IMGA 1CYEA 1V1JA 3BGVA 1UJBA 2GCOA 2A0UA 2C5AA 5FNZA 3DP9A 4FYMA 1U0RA 2EIHA 1B43A 1OYWA 1KQOA 1HM5A 3IAEA 4HZUB 3ZU6A 4DMKA 3K0KA 1QZXA 3BTUA 1JR2A 2VBGA 2VNSA 3RUDA 3WLRA 4F3YA 3H83A 4TKVB 4YAKA 1HG0A 3OQBA 3GLGE 4BNFA 3W4JA 3ESZA 1NVFA 2R25B 4XIIA 2YXLA 4YCCA 3C1AA 2H06A 1ZVJA 4EF5A 3BDVA 1SZJG 1ZGHA 3GT3A 3MVEA 3NHFA 3OU7A 6AT1A 1HNWB 4XSGA 4KQEA 2BR4A 2XTNA 2UV8A 1L7OA 1XEFA 2C83A 2HB6A 4FNOA 1TCBA 4AKSA 4EPTA 5K6AA 4CIBA 4ZVTA 4TOIA 3MA0A 4JEIA 4D9MA 2G70A 2Q4OA 3ACDA 3K0CA 4FLFA 4KRFA 3DAGA 3JZAA 3RODA 4FYJA 4IH4A 1A8PA 3NOXA 1O2DA 1SCKA 2BONA 1VA4A 2W6MA 1EXDA 2JIOA 2QP3A 3VU8A 2Z9DA 3K9NA 4JGGA 3MTGA 3N2KA 4RFSB 2GN1A 1Z73A 1JEYA 1OJ7A 3VU3A 5DM60 1U0BB 3L4SO 3ZVKA 5J2UA 4GP7A 4H1TA 5KKAA 2H2DA 2FNAA 2QM0A 3DYIA 5IKXA 5AK5A 3U4GA 1H2EA 2UVDA 1A2OA 1CW2B 4RD0A 3SG0A 4F9EA 1QFYA 4LZLA 3V8VA 5IF9A 5KTTA 4LNHA 1MGPA 3ED1A 1JZQA 4ML3A 4UVEA 3MGKA 4A3SA 2A5GA 2D5CA 2I7DA 3QG5A 4BBAA 1ULBA 5IZCA 3PQDA 4HDRA 5TF4A 5CITA 1S2IA 1K08A 1A72A 2AG5A 1UKYA 2PQ0A 4GNRA 5ARCA 1ZHFA 2G9QA 2GAJA 1MP0A 1XK7A 2BSXA 3HKCB 3HRIA 1J9ZA 2XUOA 4IQGA 4R8MA 1EVYA 3MMSA 2QUKA 2QN3A 2GAOA 5CFPA 2QTLA 5KQRA 1XG5A 1G20B 5BN4B 3SQNA 3KJEA 2FX3A 3A9RA 3LKBA 3CRZA 1C3OB 2A9QA 3SHVA 2QN7A 4HQOA 3FWNA 4H9GA 4FCVA 5EHNA 1Z5OA 3WV4A 4KO2S 5JAMA 1Z4PX 4NPAA 3T15A 3TKYA 2NWQA 3T1VA 5EZQA 4OD0A 1JPUA 4A4DA 1Z18A 3GJYA 3T5DA 1SXJC 2D6FA 1WTAA 1QKKA 3PNQA 1ONBA 3LF2A 4GLJA 4PG7A 4YK7A 1UBTS 3SKXA 2WPDD 3GJQA 1DKRA 3OCVA 4MVJF 4UU8A 2EV9A 3H2GA 4JJKA 4PAWA 1D2AA 2NAPA 3RKUA 5B3JC 2CNWA 5BRJA 3KTAB 5EJ9A 4BNVA 2G72A 1E5XA 1JPVA 2G06A 2XDWA 3PJDA 4L02A 1ECFA 3NHSA 4TXMA 4ENWA 4BO2A 4JOSA 4U9UA 3B5EA 3P9KA 4ANFA 2G9ZA 1NI3A 1GKLA 1RHRA 1U0OC 1M6NA 2DT5A 4V38A 3R8FA 5KTKA 5JYCA 3OQNA 4C7OA 4UNSA 2Z6UA 3QV1A 1Z34A 3H2JA 3DMTC 1I4EB 4IMJB 3PFFA 5E8JA 2P2NA 3ND6A 3BSSA 4L9RA 5H83A 3T3GA 3UV7A 1T2DA 1KDYA 5LOVA 1YR3A 4C4XA 2IYTA 1A9XB 1NUUA 2R1TA 4PAOA 4BP1A 3IOYA 3K7EA 1IN4A 4O2BB 3UQZA 3Q40A 4F85A 2WPNA 1IM8A 1B3BA 1U3UA 1TEZA 1UMKA 2QUZA 4JDPA 5EP1A 3EBLA 2H0QA 1R6VA 3LCMA 4K1XA 4DWWA 5BUSA 2WYVA 5EWLB 3QMVA 4C0AC 5M34A 4RULA 1PJBA 1WY7A 4M1SA 5KBYA 5AW0A 1N2CE 2WHYA 5TMBA 2I22A 1KEZA 1P74A 3W77A 1W25A 4BKOA 1EVQA 1OOEA 3EK2A 2PHZA 3UJ8A 4B7UA 2GK4A 4QOHA 5J4HA 1OWMA 3E5RA 3SYRA 3QE3A 2XQFA 3CF4G 4H60A 1E7MA 2BSQA 1RW4A 5AVUA 1T0IA 2QTRA 3CIOA 2D2FA 2HFKA 3HBLA 1ZIXA 1PKXA 4M0MA 2TRSB 1I8TA 4UC0A 3M9LA 4N65A 3JAKA 2FPXA 4PSAA 4AI6A 4MI3A 5GZ1A 2GYYA 2NUPA 3DGEC 1AKNA 5TARA 5TEVA 1WHTB 3TYXA 1QH1B 1BXGA 3L82B 4MHTA 2AEFA 1ZMXA 4K6GA 1NOJA 4R8RA 3RUEA 1E1QA 5SYMA 1CJBA 4ALMA 3W5SA 1S8FA 2WJPA 5CX4A 3PHJA 1X3SA 1CQWA 3A32A 5D3MB 2HA7A 3G2HA 3PX7A 1UOOA 4D80A 3NWOA 3RASA 1YA6A 2Z95A 4GPTA 4QUEA 4P0PB 1YS6A 2IYNA 1V6CA 4HS4A 2DH6A 3WGLA 3ZDQA 4YRZA 1W0KD 4WKGA 5JARA 4RTLA 3BEOA 2E7ZA 2YQ5A 3ND5A 1J56A 1RRGA 3IR5A 4LYFA 4PV7A 3K6SA 2O8BA 3DR3A 1DV2A 4KRGA 4P2GA 3FWPA 4Q66C 3D0QA 2FPIA 2JJMA 1RZ3A 2FZLA 3WL4A 1ILWA 4PTLA 2YFQA 3QVLA 4ZV9A 1EWYA 3QU4A 1SWVA 4M9QA 2D7DA 2YZ7A 4Q3DA 5A9SA 1KTVA 1YDHA 2IXEA 3N74A 2QRZA 2BRUC 4P54A 5LN1A 5EQFA 1NLZA 3DKRA 4N5MA 4MIOA 1UXIA 1D03A 2YJNA 2FOIA 3K1AA 1LTKA 2VP0A 3ND8A 5EPEA 1WCXA 5TQVA 1H4SA 3IOMA 4YAJA 3P4XA 1PL0A 2AOVA 5AOCA 4CM9D 3LQFA 4HWRA 4NYJR 4RZXA 1O77A 2JLBA 4B3XA 5MN5A 1G4AE 3TECE 1SCDA 1BFKA 3KIPA 3K9WA 1UKCA 2C03A 4WT7A 2P6NA 1UJ6A 2P3OA 2PJDA 3LF1A 5CH3A 1Z0JA 1FQWA 3MGBA 4BFVA 1FNCA 1JDNA 3AINA 4I99A 1ITZA 4E12A 3ETEA 1I94B 4BLUA 4RMIA 2Q2VA 3C5CA 3QLTA 2PX4A 2CLFB 4F4JA 2DWOA 2C00A 1NQTA 2JBWA 3QHQA 4IX1A 4S2UA 5DGTA 3S2GA 3LX5A 4HVCA 1Z68A 1YCHA 3VAZA 2BH9A 2DUUA 2HC9A 1LU9A 3WQQA 4WESB 2QBYA 1GGMA 1W5TA 3OLYA 1CERA 2QZ9A 4X61A 3ZE9A 5HKKD 4R1MA 1JG7A 1ODIA 4N4AA 2PPVA 4HN9A 3R44A 4FW9A 4XARA 2EW1A 1DMSA 2HREA 5DM1A 3ZXYA 3OKFA 4TQUS 4HL6A 3I6YA 2IYQA 1U6KA 2I71A 4PONA 4UMVA 3QJYA 1ZH0A 4UTPA 3SS9X 3ROFA 2D1RA 4YCDA 3SJ7A 2ATXA 3FKQA 4XLLA 1QIFA 1H2WA 1LBSA 3F1KA 3QKRA 3WZ2A 3UWMA 3R6TA 2VHVA 4I19A 2PZJA 4KKVA 3T3MB 1FLVA 3B82A 4B48A 2O5CA 3REOA 3SJCA 2J1LA 5K0SA 2Y0DA 2VDPB 3GT7A 1PNOA 3RYHB 5A04A 4IIJA 5LP6B 3VH1A 2QMZA 3A6PC 1DZIA 1SOAA 3A31A 5BSEA 4AO6A 4DDUA 1U3WA 2EHDA 3CBQA 1HSOA 5EYPA 3M6MD 5FPPA 2ORWA 4DMMA 4DUGD 2B30A 1HNNA 4F8JA 3KBOA 3QEKA 2ZI3A 3Q4GA 4C20A 3C1UA 2O8CA 4YJ3F 1DTWA 3IQXA 4XWTA 4X45A 2XKAA 5L45A 5E95A 4BEBA 1GPUA 3BF8A 3AH8A 5DNAA 2XTZA 2X0NA 4RJIA 1KSHA 1HYQA 1E2LA 1NM5C 3GZTB 4NR0A 4GZ3A 3WNQA 1C9NA 2X0KA 1PSDA 3DGFC 5KZMB 2CXRA 1PZHA 3RNLA 4YR7A 2IEAA 1SEPA 1Y81A 1HFEL 3G2KA 4NCHA 3AJ8A 3BZBA 5EWMA 2CUNA 4NULA 3EXFA 4ND3A 3HA5A 1KI1A 2X2FA 5E6RB 5K3CA 4AM8A 5IM5A 4JUDX 4DM3A 2V59A 3ADOA 2XITA 4I2NA 4L1KA 1X42A 4G24A 4EO7A 4O5OA 5KYUA 2GNOA 2IPAB 3QNMA 5LBTA 4ARUA 4F9GA 2CDCA 2JJQA 1G7CA 9MHTA 1TPYA 4MQFB 1G6Q1 1H9CA 1I1NA 4QPNA 1GPNA 4M1ZA 3N8DA 1XCJA 3HVUA 4MICA 5AJHA 3SP1A 2I5PO 1U63A 4U7GA 5GTDA 4KYUA 1G16A 4IDHA 1KSGA 1QRSA 2VT7A 5WRFA 4B6RA 4CN9A 4EW6A 5J4KA 2BW0A 4UDYX 2OC9A 2OHXA 1A8SA 5FV7A 3TTTA 4YP0A 3U37A 1N5IA 4D41A 1XPRA 4P58A 1GYPA 2ZANA 4M8LA 5T3UA 3LYLA 4NK4A 3SBEA 3SBDA 4CLRB 5I7SA 1HK7A 4UREA 4DV7B 1D6JA 5FP0A 1OJLA 3WGJA 4M83A 2Q62A 4OUDB 4IOJA 1V4NA 3GNQA 1OKKA 2GSDA 5BW4A 3V1TC 4I55A 1KFJB 5DNCA 1J1ZA 4UQLA 4CUJA 5BSKA 3GVXA 2PS0A 2VNHA 4MINA 2OXRA 3PC3A 1R6UA 3B1VA 3ITEA 4JVNA 1JYFA 3TUZC 1MD9A 5LDHA 1KY3A 1LPPA 2M6SA 3EDCA 5C34B 2EX4A 4OYYA 3QXCA 2ZYUX 2RIRA 3RJ5A 3T5GA 1NXTA 2NPFA 1UPAA 5JVDF 1LK5A 1Q19A 1ZLXA 2HNBA 4OHMA 4NH0A 2AFHE 1J4AA 1SU8A 2QI9C 1N2BA 3JQPA 5FTMA 4B32A 3D59A 2C07A 2Q3EA 1T2AA 1S4QA 4JZKA 3ZQ6A 2FUG1 4YRGA 3OSUA 2QTMA 2CLIB 1O95C 1P4JA 2P6RA 1HG1A 2R79A 2A7QA 4CL2A 3VQTA 2PFKA 3NM4A 4M0FA 2XXAA 5G4LA 3SCZA 1DDGA 4AL4A 4AKHA 2E37A 3ZWVA 4O4JA 1BJTA 4P5EA 4MVJD 3VBEA 3VZCA 3ZE0B 2IU3A 3P19A 3MGGA 3GRFA 1H3FA 1YA4A 3CNOA 2WKQA 4CCYB 4W7HA 2JD2A 4B3MB 1TUEA 3AETA 4PGHA 1RJWA 3UTCA 2JI7A 3A2NA 5IYZF 5LKAA 3FUUA 2GBPA 3KQKA 3Q8LA 2X0JA 1YR7A 2CDNA 1NAIA 4H3SA 5B30A 1UEXC 4TGLA 1K6IA 4CTMA 3F5FA 1MT0A 3W79A 3DBRA 3H1PA 3DBHA 3DEIA 1SD1A 1K7EB 2P4SA 3WO0A 3N8HA 4MRSA 3I04A 2XYHA 2C0QA 3WMWA 1FX0A 4KO3S 2CUTA 4M3NA 3B6EA 3AFNA 3TBFA 5EE1A 5CNMA 2OZPA 1BDJA 4HJXA 5DI3A 1XMQB 2E82A 3DOIA 5TV2A 3F6CA 3V8EA 3TW8B 3AUXA 1OZHA 4OLFA 2Q4BA 2C78A 5BURA 4B5LA 4R7ZA 2IHNA 1N1DA 1SQSA 2VHEA 2X8JB 1D2MA 1K4YA 3D1LA 3EG9A 1SXJE 1AKQA 4C1BA 2FKAA 3K2QA 3QYPA 2ZAMA 4MQUA 5C3MA 1RNLA 4BMOB 4LUCA 2IS6A 3I92A 1D2GA 3AEXA 5KB3A 1FFXA 3AUKA 3QF4B 3RWBA 1L4UA 1KIFA 3ASUA 4I1IA 4YP7A 3BXXA 3LCRA 2GJ4A 3NZEA 4CCSA 3GUVA 4HRAA 2V1XA 4DDTA 4BBPA 3IAXA 3K09A 3NP7A 4UUOA 3NETA 4AYXA 4DCSA 5LR6A 5K3FB 3QXHA 4E2YA 3Q72A 1Y37A 2EFEB 4D9CA 4CFZA 4N1AA 1EI9A 3N6XA 2EP8A 4KE9A 2XXJA 1MQ8B 3Q3VA 3AGQA 2WP0A 1SBTA 3AEKB 4ALLA 2CLCX 3LZDA 1XKQA 4YPFA 1AHIA 1TLLA 2VAVA 3FCXA 1QFZA 5AFSA 2KBFA 2F8SA 1I2ZA 4V0MA 2OV1A 3CUUA 3NBFA 4XASA 3ZWPA 1YB2A 2AC2A 1YZLA 4TX1A 4YO8A 1JLKA 3LE8A 4AK9A 2CCKA 3A1VA 4R1PA 3DTNA 3VVCA 2PL9A 3KE8A 1WETA 1DXQA 2GETA 3LKVA 2EGUA 2XYQA 1T0PA 4OFXA 3S55A 4BPBA 2GPJA 2JFUA 4DCOA 4M87A 4DNXA 4EO4A 2J9RA 5BW6B 1T0JB 3OETA 1PJ4A 4KXFB 2ZT8A 1FMTA 1OI3A 2ECFA 3MWDB 4GMXA 4MVJH 1G5FA 3V1NA 3QFCA 2FWAA 4C0XA 4I1PA 3LOPA 1DQPA 2G4CA 4G5HA 2E85A 4IV5A 4R1OA 1EIWA 2OV2A 4O29A 5AICA 2ZRHA 3L6RA 1EPUA 3QVGB 2UVPA 3LQYA 3OFKA 5JE8A 3R9IA 3MJRA 1L7DA 3ILHA 5HE8A 3DULA 4C0HA 4K6CA 2YKGA 3FYCA 4Y2PA 2OD9A 5ENZA 4U1RA 3WNZA 1LVHA 2HU8A 3A1EA 4R1TA 3Q6NA 4FGLA 1K7XB 2RE8A 1CE8A 1JQJC 1T4DA 2R4UA 3C3PA 4IMIB 3U3ZA 3ZGLA 1YZUA 1MNAA 5F78A 4YX9A 5LQKA 1OBFO 4K86A 4BJ3A 1Y1PA 3DXXA 1E3IA 4UOEA 2RGGA 2JA1A 3EULA 4BVAA 3ENQA 5BT9A 4C3VA 3E2MA 4QPZA 2FWRA 4W5OA 1A96A 2JASA 5CM2Z 2CSXA 5A4AA 3KNZA 3L84A 4MAAA 4FQ5A 3HR4A 3IQGX 3WL8A 2WTAA 3W06A 3DZFA 1WRBA 2GPYA 1Z7BA 4YTEA 1S89A 3GA7A 3JRXA 4PNPA 4BE4A 1BGWA 2ONYA 4XWAA 1Y7IA 1P2BA 1KR2A 1P0MA 2LTAA 1TM4E 1EB8A 1XCBA 1NBAA 1FRQA 2KS6A 4L51A 1EINA 3H5WA 5J1SB 5DNVA 1WZCA 2ERYA 1PR1A 3R6LA 3V34A 5KNDA 4IFTA 5DSTA 1KH1A 1FBNA 2ZB4A 3PVSA 3E4DA 3RC2A 1D2NA 4LXIA 3ZZ1A 5BNWA 4QJ4A 1KJIA 3FLBA 4KQGA 4GRIA 2V7QD 1Q3KA 2XD9A 3CLTC 1MX3A 1GNQA 1XTVA 3CINA 1XHEA 2DSTA 3CEAA 3HP4A 1I4WA 2C95A 1N9ZA 2Q5HA 2VUTA 5CFMA 2AHOA 3NW9A 4EY4A 2EGHA 5F7JA 2MTBA 2CNNA 1M2FA 3CLSC 4HOYA 1T9GS 3AHFA 4P08A 3KPWA 4KPEC 2Q2OA 2R84A 3CUYA 1ZRMA 2K6GA 2H2AA 4WOBA 5BNIA 2W6ID 4FHZA 1J22A 1F48A 1A9QA 2QT9A 4LOAA 3UUWA 4BXOB 1PX0A 1C3EA 4BQPA 3L4EA 1B6SA 5FO0A 4BVFA 2WT9A 4CKBA 3BTVA 1ND5A 3QVJA 1XTKA 4G5FA 5T4BA 3O3CA 1MC4A 1L4EA 4KO4S 2D0PB 4GX1A 1PCXA 5D84A 3WYAA 1W36D 4MPJA 4QGFA 2AZXA 2VTKA 3AF4A 3A70A 3CVJA 3ND9A 5LDGA 3VH2A 3ZU2A 4BNXA 5IX8A 5JROA 2DERA 4N7BA 3CO5A 3GLKA 2XZDA 1P31A 3SEAA 1U4OA 1J49A 4PS0A 1E8DA 3IO3A 1XVTA 2Q0HA 3N2IA 1ZI6A 3LHDA 1ZSNA 1ZCAA 2IE8A 4PFJA 3DWEX 4YRRA 3WLFA 4Y6QA 4HWGA 5C5IA 2OY0A 2V7VA 4LMBA 5DRTA 3I2KA 1WLSA 3PCXA 3W90A 1SOVA 2A78A 1I3MA 5DBEX 3IP3A 3ZLTA 2J9FB 1U9IC 2A3RA 1P9WA 1ABFA 1MXFA 1NR5A 1U8YA 1H1LA 1G66A 1CY1A 2ZVDA 3M4YA 4PXAA 4O1MA 5GONF 3TLGB 3ZZ0A 4YUYA 1IMJA 2AL7A 3T94A 3PGKA 1Y3AA 2P4QA 2X58A 5IDWA 1N1GA 2IHKA 3BAFA 1G42A 1KWGA 1NLFA 2PLWA 3G23A 4X00A 3NDRA 5AI8A 1X0VA 1RWVA 1T1SA 1U3FA 1XU4A 4J03A 2OC4A 1KDTA 2HJGA 4MKGA 1PW5A 5EZYA 4C2AA 3L1KA 2I9KA 2G9UA 5AVRA 3FFXA 1LRLA 1JKJA 3FWZA 5D01A 4RTPA 3C3CA 2QIOA 4YIKA 4KL8S 5BVHA 1YHZA 3SDSA 2FUCA 4IICA 3UWSA 5HOEA 3R9XB 4TTVA 5IZ4A 5HIAA 3QBDA 2HHJA 5EXPA 1RI5A 1SCJA 3D4BA 3WQHA 3FYDA 2Z3WA 4BJ5A 4OGGA 1I7PA 2YBDA 4MO2A 2BKLA 4X7PA 3KUCA 4MNTA 4ZZ1A 1FVOA 2J9ZB 5JSYA 4EEKA 3QEBZ 2QRHA 3IOEA 4DQKA 1N33B 1NN5A 1NVXQ 4CV0A 3EXHB 2JAHA 3FY4A 1R8SA 3ROMA 3WWZA 5CFRA 1ECGA 1V7ZA 2P4HX 2QLMA 5ALPA 1AQJA 3JYNA 5L7YA 2XKKA 4LE1A 5FLXA 1Z08A 1N0IA 2CXQA 2VJMA 3OA2A 3QEJA 3TXAA 1G3UA 4EABA 3OU6A 5F98A 3LHKA 2EDCA 3BGOS 3I9V1 4E6PA 2EF0A 1ADCA 1BHSA 3Q87B 5DX0A 2CDRA 4DCJA 5IDXA 3KZMA 3THRA 4W99A 3TMKA 3QVTA 4LDZA 3Q6IA 1IXKA 3UMYA 5ECDA 1RKQA 4CQMB 1MOPA 4ARCA 2O14A 3FBWA 1Q6ZA 4ZTUB 3VH3A 5HJ5A 1N32B 3T3OA 4TT3D 1OFUA 2QZSA 4EARA 1VKNA 4I1VA 1SG6A 2R7AA 1U7XA 1RJEA 4JJEA 3KZXA 1PNTA 4KZKA 1DDIA 1HQCA 3A1NA 5ECYA 4YROA 5K20A 1U9JA 4O33A 1UMDA 1RP1A 1T3TA 3AESB 4HEA1 4PQEA 3JVEA 4OQNA 3SFVA 1EIZA 2VEDA 2R8BA 3D8NA 4EVRA 1TF5A 2I55A 1NPTO 3GQBA 3P5BA 1SXGA 3OE4A 4IVPA 1C0PA 5FUMA 1FL9A 2P0AA 2AKYA 2ZYDA 1IONA 3MUOA 5EWJA 4YP1A 2OGWA 1PX2A 4ZGGA 3SZOA 2X6RA 1TMYA 1WPQA 3EPPA 3EVZA 4Q82A 4RUKA 3P4YA 3ZCPA 1Y9DA 3K6JA 4KQ2A 4EX7A 2PL5A 3OJEA 3RTCA 3G5AA 1ZDMA 3KJQA 3EQZA 3VKVA 3OMLA 2ZCJA 1Z56C 3FW1A 5H3HA 4AWXA 5LP6F 3CF0A 4LC0A 1IN5A 4ZAZA 1T3SA 5JV5A 1FZTA 1CZHA 4GSKA 1T5OA 2GVDC 2XUHA 3MYRA 4UOQA 3DP7A 5COQA 3WQRA 1AMOA 4LBVA 1QK3A 1WUJS 1F7UA 3WSWA 3WXMA 3BD8A 4YRTA 2E48A 9LDTA 5DISB 4ZCQA 5LLSA 1W2WB 3RK1A 3HK2A 1K3TA 1JDPA 4L74A 1KIAA 2HQSA 2ZI5A 2LE0A 2BFBA 1Z5NA 2FN7A 3IVCA 4EG8A 2ZLBA 5DIZA 4TYMA 4Q4CA 5DZSA 5J47A 4YV0A 5E7IA 3WXBA 4QOGA 5DGIA 4KN6A 1RRFA 2BFMA 2IF2A 5BN1A 3NWBA 3TQSA 2IBSA 1IMOA 3AV0B 1C8BA 3IBCA 1ZCBA 2E1RA 4M0KA 1N92A 2PA0A 2QJTA 3ZH2A 4DKXA 1JDZA 1P5RA 1J8MF 5CYPA 3JWHA 2GFQA 3BK7A 2XUPA 4JSRA 3F8SA 3QRWA 3R5TA 2H8KA 5CB4B 2GHRA 4JT4A 5A9SB 3C3MA 3MWLA 2X2OA 1L7VC 4XYEA 1V37A 1NUAA 3JVDA 4NH4A 2XEDA 1R8JA 2O54A 1ZL2A 1FSZA 1ZKDA 2XJ4A 4HY3A 5JJLA 2QM8A 3IODA 2BZGA 2GARA 3ICPA 2Y2UA 3ENNA 1E18A 2DBZA 5IJ0B 5LZ2A 4K9MA 5EUCA 4X64B 5K3AA 5HX7A 1AGYA 1IXYA 3LA6A 4CIYA 4F46A 1JI3A 1BROA 1BH6A 2ZS9A 4ZO6A 2JLVA 2VI5A 1RYZA 2ZRLA 4BFZA 2ZS7A 521PA 1SQFA 5B55A 3ZD8A 3IEXA 2JH3A 1G21E 5EI5A 2Q27A 1DBIA 2GEVA 3ZK8A 4O4JF 1E4YA 1E2JA 1TT7A 1CCWA 3DW1X 2RHOA 2WJ3A 4JB8A 3WYFA 3BX1A 4B84A 2QTZA 4YCLA 1XU9A 3SJBA 5EVJA 1QBKC 2B94A 1EYZA 1LDEA 4GQBA 2OM6A 1KTIA 4DM7A 1N3BA 5ENVA 5J5CA 4PCAA 1AGRA 6ABPA 3C43A 4EVQA 1NBME 2YNMD 4KXMA 4QDTA 1EX7A 1O9GA 3GX1A 2E3JA 3SNKA 4NQZA 4F4UA 3VVLA 4KIUA 2V4ZA 4TUYA 2DPHA 2K87A 3WKBA 1BOFA 1OWPA 1MC5A 4CL3A 1FFBA 3Q7RA 5I5GA 4UXIA 1IC6A 3RSCA 1KEEA 3WA7A 1TOAA 2CZQA 1QTNA 3OPYB 3PR3A 2X9LA 4AS3A 1N8KA 2GTIA 3G2PA 2ILVA 4BLRA 1ODCA 5BOSA 1N57A 1Z88A 4G0VA 4LRXA 2YZ2A 1SG9A 1GAEO 4NAHA 3GOQA 1QHHB 1Y80A 2A5JA 2H1WA 1UJNA 1DINA 2DPGA 4LPKA 1CR4A 5D00A 3OLXA 3TLAA 5BR4A 1NI4A 4NP6A 2NZ8A 1MT3A 1PZEA 4YCJA 4ZQGA 3ZXXA 3HMQA 3MMZA 2Y1CA 1T29A 2MT9A 2F00A 2O2XA 1U04A 3MWDA 4QJ3A 1HLPA 2OZLA 1U0TA 2YQ4A 6CHYA 3C7TA 1G5HA 4C43A 5EFZA 1P75A 5K0ZA 4JJ6A 1ZJWA 1UDAA 1UCFA 4IJMA 1PT7A 3ZQJA 1J07A 2H1RA 3BMOA 2OCYC 4PYIA 4DNPA 3THWB 3PRHA 2IY9A 1G21B 2HQ1A 2FRDC 3QFHA 5AWFC 1VKRA 2O2YA 2QF7A 3RQIA 4CQMD 4QNMA 3OOWA 5C18A 5LBIA 4NIMA 3VR4A 2B36A 1U3GA 5CLIA 3W3AA 4TM8A 1E92A 5BYKA 4KLAA 4WEQA 3CW2A 2BFEA 2QGFA 3KLBA 4HAIA 5TT0A 3S8EA 3AUTA 1LDMA 1YOVA 2VG8A 2Q6KA 2Y9MB 3GRYA 5DW3A 4UQPA 3V8MA 2RH5A 3GAFA 1CUJA 2QRGA 3UGJA 2CXOA 3FHLA 1IJKA 1TZMA 2CK3D 3TD9A 3W6OA 2WSSA 3WAKA 2E2WA 2QTHA 1OBCA 4H7DA 4CG2A 4OB7A 5EZYF 3I5XA 3GCZA 4NU0A 2GWHA 1CUHA 1VLVA 3E9RA 1OU4A 1F6WA 2R8YA 3UJCA 2XVMA 5JFTA 1PRYA 1ANKA 3EFBA 1G2PA 3LC7O 4DLPA 5IXYA 1U94A 1HZJA 2Z1NA 1TAQA 4FMDB 4MB2A 4MWGA 1KWKA 2O2CA 5DI9A 3RYFA 5T57A 3T7EA 2OLKA 4TRJA 4DQDA 4DZTA 1C9KA 2NQTA 4BAGA 3ZS8A 5JCJA 4H7IA 5DTJA 5HYVA 5EP3A 2C99A 2I76A 1WXQA 1DQYA 2CHGA 1DDOA 2LDXA 3R7BA 1JH9A 3H7IA 5F9HA 2ZI4A 1YB6A 1FE8A 4GMDA 1VMIA 2Y67A 1Q0HA 4KLZA 5FORA 4ZIRB 5A3QA 4L8VA 5B4TA 1XEWY 1NVKA 1YS7A 2VSNA 3BRWA 4LS3A 4DC9A 4WBXC 5ABPA 3PUZA 4NCAA 2CYBA 1U8AA 2WBLC 2GM4A 3UH0A 3BD9A 3H8SA 4LTMA 1IEXA 4O4JB 4XM2A 5GVSA 1KI3A 4GYYA 5IXJA 2QXYA 3NPAA 4O0MA 3SXJA 1EVKA 4DNFA 1DNPA 2AOTA 4AAYA 1FRFS 3BILA 5I8WA 5C8YA 4JD5A 4OOFA 1Z5GA 4JI6B 2XT0A 2JHAA 4F1KA 2DFKB 8GPBA 2A94A 1B0AA 2PH3A 3DBIA 5FPQA 3SYKA 4KFRA 5FPKA 2ZOSA 5IK2A 1AV6A 2V7UA 2FVXA 2JKVA 1D4ZA 5ER6A 4ZJPA 4HAXA 3LRPA 2PGIA 3N2NA 1PZXA 4HDCA 1R6DA 1OI7A 3NASA 3ELWA 2GTHA 1ZGGA 1G8HA 2QJRA 3OC0A 2ZULA 3U7GA 5BSFA 3G88A 3ZGZA 4ADSG 1F14A