4PINA

Ergothioneine-biosynthetic methyltransferase egtd in complex with n,n-dimethylhistidine
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
322
structure length
320
Chain Sequence
HMALSLANYLAADSAAEALRRDVRAGLTATQKSLPPKWFYDAVGSDLFDQITRLPEYYPTRTEAQILRTRSAEIISAAGADTLVELGSSEKTRMLLDAMRDAELLRRFIPFDVDAGVLRSAGAAIGAEYPGIEIDAVCGDFEEHLGKIPHVGRRLVVFLGSTIGNLTPAPRAEFLSTLADTLQPGDSLLLGTDLVKDTGRLVRAYDDAAGVTAAFNRNVLAVVNRELSADFDLDAFEHVAKWNSDEERIEMWLRARTAQHVRVAALDLEVDFAAGEEMLTEVSCKFRPENVVAELAEAGLRQTHWWTDPAGDFGLSLAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine-specific methyltransferase EgtD
publication title Ergothioneine Biosynthetic Methyltransferase EgtD Reveals the Structural Basis of Aromatic Amino Acid Betaine Biosynthesis.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 105
structure length 320
sequence length 322
chains with identical sequence B
ec nomenclature ec 2.1.1.44: L-histidine N(alpha)-methyltransferase.
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10017 Methyltransf_33 Histidine-specific methyltransferase, SAM-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pinA01
3KPYA 5DM4A 4E70A 4PYJA 5DSTA 5C9ZA 4OQEA 1X19A 2NNWB 3F4KA 2CMHA 3OZSA 5FCDA 2BH2A 2ZLBA 3K6RA 3CJRA 2A14A 4E2YA 3BXOA 5KYGA 3I64A 5GINE 4C04A 3I5UA 5U4XA 3WSTA 5CIYA 4QPPA 1FBNA 2JHAA 4RWZA 1XDSA 2G8NA 1RJDA 3UFBA 3PLAE 3EVAA 1X1DA 2PY6A 4KW7A 1EJ0A 3GJYA 4FSDA 3TR6A 2HV9A 3PT9A 3UZUA 5LQUA 3KPWA 5LQRA 2FCAA 3EVZA 3JWHA 2PKWA 3UBTA 2PXCA 4LWPA 2P7IA 3DMGA 2JH8A 1QAOA 5FUBA 3B89A 4GOND 5EG5A 3KKZA 1SKMA 5D1NA 2PSSA 4R6WA 3TKAA 2YXEA 4PONA 4NECA 4X1OA 4DM3A 1XTPA 3UJBA 1UIRA 3LDGA 1BOOA 3UJ8A 3R6TA 3BT7A 3G8AA 1H1DA 3M6VA 2P7HA 1BC5A 3PS9A 4M38A 2GLUA 4QTTB 3SSOA 1JTEA 3TOSA 3GGDA 3HVKA 4P7JA 2BZGA 2P8JA 2JG3A 3IV6A 2P3OA 3CJQA 4GEKA 4GUAA 3KQYA 5HIJA 2PX2A 4AZWA 3PTAA 4O29A 2HNKA 5F2OA 1JR4A 2GH1A 3L8DA 2OXTA 1KP9A 3OFJA 1KPGA 5DX8A 4PYQA 5EIFA 3T7SA 2B3TA 3CGGA 1YZHA 4DQ0A 1JQ3A 2PXXA 2N47A 3HA7A 1IM8A 3BGVA 2YXLA 3EGIA 4MWZA 3UA3A 5LR6A 1RJFA 2PX4A 2FHPA 2ORED 2JJQA 3G7UA 3OFKA 4HG2A 5ICEA 2GA9A 5DTQA 4CKEA 4ER0A 4PGHA 4V0QA 5K0NA 1XDZA 1X1CA 5DPMA 4AZSA 4YUVA 1JG3A 4RYLA 5DTRA 2IBTA 5HEKA 2HR1A 4V0RA 3FPHA 1NW6A 4GOOD 3DP7A 4DMGA 4RTLA 5KS2A 2GB4A 4IKPA 2P40A 4AX8A 2YVLA 3AXSA 3EVBA 5EEHA 1R74A 3T7RA 4C4AA 2NP6A 3LHDA 4BLWA 2P3LA 1QANA 2ZW9A 2CMGA 3HCDA 1R8YA 3LCVB 3KQTA 4R05A 5E1DA 3TKYA 2Z6QA 3OU7A 4FT4A 4HH4A 5EGSA 1YUBA 2IFTA 3EVCA 4IV8A 4PWYA 3OE4A 3P9CA 4DCGA 2PWPA 4M7RA 5HILA 3NJRA 5T6BA 3B7PA 5EHGA 1VP9A 2OPBA 1VLMA 3KR0A 4XUCA 4OBWA 5HFJA 3CJTA 3GRYA 3TPZA 8MHTA 4B17A 4RTOA 3A26A 3KPJA 4YV0A 5BXYA 2FK7A 3UA4A 2EFJA 2IGTA 4MHTA 2OYRA 1TW2A 3NVKI 2HMYB 5EVJA 1WXXA 3S68A 2XBMA 3GDHA 3HA3A 3ORHA 1O9GA 3AJDA 5E9WA 4CKCA 2WK1A 2H11A 3G2MA 4PYLA 3V8VA 1YFLA 2WA1A 2V74B 3JWGA 4GOMD 4IWNA 2VDWA 3NMUF 1XCLA 3OPNA 4PCLA 1JSZA 4GOLD 5GM1A 5DX0A 1WZNA 4LG1A 5C0OE 5E8JA 5ICFA 4Y2HA 3GU3A 2AOWA 2C7PA 1F38A 5K0LA 1M6EX 4X63A 1RI3A 3P9NA 3BGDA 1AF7A 3DUWA 1NW5A 1RJGA 5K03A 3EVEA 1JG1A 3GCZA 1VL5A 3M6WA 3KQMA 5E9JA 1YB2A 3GRRA 3H2BA 2FPOA 1P39A 3KQSA 2IDKA 5HIMA 2CL5A 4U7PB 2IBSA 3HCAA 1HMYA 3NTVA 5EC8A 3EVFA 2G71A 2QRVA 3LBFA 3Q7EA 3U81A 4BP1A 1D2HA 5DXAA 4ISCA 2AS0A 3ME5A 5EHIA 2PX8A 3FUWA 3I9FA 2AOVA 3DMHA 4RVHA 2AN5A 3G2PA 2LD4A 4DZRA 4E2WA 5LQCA 3O31A 2IPXA 2IH5A 1ZGJA 5JR3A 5HIKA 3FTFA 1FP1D 5GIPE 3G5TA 4HSGA 4RVGA 3E23A 3SR4A 3LPMA 4QTUB 1UFKA 4F84A 1VPTA 3DXXA 4FP9A 5DRTA 1MHTA 5EMKA 1SG9A 1I1NA 2ZTHA 4FR0A 3K0BA 2Z6UA 2NP7A 3MCZA 5DX1A 4E32A 3KU1A 1AQIA 3HEMA 5E1BA 2ZBPA 3LCCA 3HCBA 3BGIA 3HVJA 5FQNA 3DMFA 1G8SA 3PFGA 5FHRA 3KQVA 3QOXA 4P7KA 5EZQA 4BY9E 1NT2A 3HVHA 3LGAA 2XVMA 4KWCA 5K0JA 4FT2A 2DULA 4R8SA 1NW3A 3EPPA 4PCAA 3M6UA 3OU6A 4EK9A 1G60A 1EAMA 4KIFA 3G2OA 5H02A 1ORHA 1VBFA 1XXLA 4GC5A 5LSAA 1L3CA 4BLUA 1PJZA 3DH0A 2NXEA 1M0EA 2R3SA 3OU2A 4HRAA 4R8RA 4E33A 2XYQA 5DM1A 1XVAA 5LQAA 4MIKA 5K0BA 2C7RA 1Q0TA 3MTEA 1EJ6A 3UJAA 3EVDA 4GQBA 2P3QA 2NXJA 5EQJB 3ID6C 1WY7A 4C08A 4YUXA 5DTMA 4YUWA 1KIAA 3P8ZA 2PBFA 2EX4A 3CC8A 1DUSA 3AXTA 2ONYA 3KQQA 5K8VA 3SSNA 4E2XA 5EPEA 3DULA 3MCTA 4HGYA 1R00A 3AY0A 5E1MA 5FTWA 4E31A 5IKMA 3T7TA 2BR5A 3MGGA 4KDRA 5DWQA 2AOUB 5D1HA 2OB2A 3AWIA 5C1IA 5LQKA 3V97A 4OBXA 2XYRA 1L3IA 2AOXA 5EOVA 2YUIA 4RTNA 4EKIA 1AQJA 3FZGA 3LSTA 2ZWVA 2O0LA 4RV9A 1N7IA 5GP1A 5HIIA 1JQEA 3HVIA 4RVFA 4FS8A 4RTPA 5K01A 2YX1A 1IY9A 4RTQA 2VZ9A 4CWAA 3ER9A 4ATNA 5DSXA 1YZ3A 4ER5A 1NKVA 1SUIA 4K6MA 3P2EA 5E8RA 1HNNA 2O06A 4AUKA 4HC4A 3A4TA 2AR0A 3JWJA 2O57A 5DM0A 1KHHA 1ZG3A 2GAFA 3QV2A 5JUWA 1RI5A 2AOTA 2FK8A 5M5BA 3G89A 2ADMA 2WA2A 2FYTA 5HZMA 1X1AA 1IXKA 3LL7A 3FUXA 3HNRA 4KVZA 5KQSA 5G02A 3X0DA 3ER8A 2O05A 3KQOA 3C6KA 2P41A 2QY6A 5K09A 3SSMA 4YV1A 2PXAA 3LBYA 2UYQA 3NW9A 2I62A 3C6MA 3MHTA 1RI4A 4RX1A 2BR4A 3M70A 3FTEA 3CKKA 2ZBRA 3EMBA 3KPVA 1BHJA 5E2BA 1L1EA 3KPUA 3PVCA 3VYWA 3ELWA 5P8WA 3HCEA 3OE5A 5K0FA 1Y8CA 4ZTBA 3LDFA 5F2KA 3FPEA 3UJ6A 5EEGA 1KYZA 1NBIA 2B2CA 5EMLA 4XCXA 2ZBQA 1BKYA 4RTJA 1ZHFA 2QYOA 4A6EA 2B25A 3C3PA 1VE3A 4JXJA 3EMDA 3C3YA 5CVJA 5E9QA 3RW9A 3D2LA 2EJTA 5EMMA 3ERCA 3SVZA 5EIWA 3SXJA 3FRIA 5CVUA 4ER6A 3IEIA 4C03A 5CD1A 1TPYA 2QM3A 2OKCA 3UWPA 3FUVA 2PT6A 2ZIFA 5DM2A 3NVMB 5CM2Z 2AN4A 5ERGB 4Z2YA 4Y30A 4AZTA 3M33A 5E2AA 3HTXA 3UJCA 4PYIA 4PIPA 2ZCJA 2PJDA 5MHTA 4HGZA 4PINA 3BWCA 5CVEA 5IH3A 5E1OA 2IH4A 4E30A 2GPYA 3OCJA 5K0GA 1ORIA 3HM2A 2Y1XA 5FADA 1O9HA 1G8AA 1KPIA 3LDUA 1Q0SA 4POOA 3I58A 3OZRA 4QQNA 3GRUA 3BWBA 3R3HA 5T64A 5FWAA 1SQGA 3THSA 5CUQA 3G5LA 1G38A 3IYLW 3M4XA 2NYUA 4PYKA 2ZULA 4RTKA 1PRYA 1VQ1A 3O7WA 1JSXA 2OY0A 4PYOA 3KR1A 3OZTA 3P2KA 2ONZA 5DT2A 4CTKA 4MQ4A 2ZIGA 3HCFA 2UYHA 1FPQA 3CCFA 4PIMA 3T0IA 5CVVA 1SUSA 3UJ7A 4YMHA 3B3FA 2ZSUA 2PT9A 3BKWA 3KHKA 3UJ9A 3A27A 9MHTA 3ELDA 1P1BA 4QPNA 2AN3A 3DLIA 4YMGA 2KW5A 2BM8A 2UYOA 2PWYA 2I9KA 4OA8A 1QYRA 5BP7A 1NW7A 3HA5A 2XYVA 2PV0A 2VP3A 3TM5A 4FSXA 2R6ZA 1FP2A 4KRGA 3GNLA 2K4MA 4GF5A 3UJDA 2VS1A 1XDUA 3FPGA 3DOUA 4YV2A 2HTEA 5LQJA 4PYNA 4U7TB 3FPJA 10MHA 4BLVA 5T67A 1KYWA 1JG2A 3LCUA 1X1BA 3GXOA 4E2ZA 4P7FA 3TM4A 3PX3A 4PGGA 4DA4A 3GO4A 3DR5A 3LKDA 2YTZA 2Y1WA 1NV9A 4XUDA 1YF3A 1JG4A 1YFJA 3REOA 2YR0A 1NBHA 2NXNA 1FJXA 1WS6A 4QVKA 1D2CA 1N7JA 3C0KA 3VC1A 2NXCA 3FUUA 1EG2A 1KR5A 3TQSA 5GIOE 3VC2A 1SQFA 4P7GA 4P58A 3P2IA 1KPHA 3FRHA 3RODA 1R6AA 4ER7A 3SGLA 5F2NA 1M6YA 3KQPA 4LWOA 2OZVA 3FUTA 4CTJA 5K05A 4EQZA 3IHTA 4H0NA 4X41A 1XCJA 2CWWA 1RI1A 2B78A 4FZVA 1D2GA 2I6GA 4X60A 4C06A 1EQAA 3ANXA 2H00A 3TMAA 5LQNA 4OX9Y 3R24A 3PX2A 4GC9A 5DRYA 3SMQA 3RIEA 4YUYA 5EZSA 2QRVB 2PX5A 1I4WA 1P91A 2ESRA 3G2QA 2Z6AA 2I7CA 1F3LA 3SX0A 3R9XB 4OA5A 1G55A 2QE6A 3JWIA 4QDKA 3EGVA 1WXWA 2JHCA 3GIWA 1INLA 2H1RA 2FRXA 1T43A 4M37A 4EKGA 4RTSA 3LX6A 4CKBA 3FPFA 3EEOA 4AZVA 4M36A 3E8SA 5BW4A 1WG8A 5GM2A 3NWEA 3E7PA 4HTFB 1NV8A 1TW3A 3I53A 4MTLA 5FQOA 4RSRA 2ZZKA 2PLWA 4C07A 3BKXA 3ELYA 5ICCA 4IV0A 1DL5A 3NDJA 1V39A 3CBGA 3B5IA 5DLYA 3NDIA 2PGXA 1MJFA 4WXHA 4YUZA 3MAGA 3DLCA 1VIDA 3P9IA 5DXJA 5K0EA 3FYDA 1JQDA 3MTIA 4XUEA 3A7EA 3KQWA 5FA8A 3BWMA 3PFHA 4F86A 4CXMA 4EVIA 2JH9A 3GRVA 1JTFA 3G88A 2ZVJA 5KVAA 2OBFA 3O4FA 1R18A 2OO3A 3R0QA 4PNEA 3DXYA 2HWKA 5FULA 5GOZA 3BWYA 3BZBA 3P71T 4L7VA 1P1CA 2YQZA 2O07A 4C05A 5CCBA 2UYCA 4F85A 5FWDA 4ER3A 1L3BA 1RI2A 2YXDA 1RJEA 3FTDA 2IDJA 4KIGA 2CKDA 2VDVE 4X61A 3HCCA 3GWZA 2P35A 2IIPA 4R6XA 4BP3A 4EMSA 2OB1A 2E5WA 1I9GA 3DXZA 4G56A 4QVGA 3DTNA 4PYMA 3CVOA 1OR8A 4KDCA 4DCMA 2B9EA 5BW5A 1SVUA 3EGEA 3B3JA 3TLJA 2ZZNA 5KQRA 5FA5A 3P9KA 3EVGA 3A7DA 1QAQA 1U2ZA 2ZWAA 3KR9A 2JHPA 4GBED 2IP2A 1O54A 4OQDA 5K0CA 1QAMA 3MB5A 1B42A 2EG5A 3ELUA 2IH2A 2EJUA 3VSEA 5GWXA 2AZTA 1EIZA 4RVDA 1L9KA 2BM9A 5EKXA 2AVNA 3Q87B 2ZFUA 3MERA 3A25A 2G70A 2AOUA 5HOQA 4WVLA 3TRKA 3QOWA 1ZQ9A 2XVAA 5B1SA 1NW8A 2BR3A 2ERCA 2VDUE 3G8BA 3FYCA 3TFWA 4FGZA 3P97A 1R8XA 1QZZA 3HP7A 5EKUA 2P1DA 3E05A 1KXZA 2GS9A 4DKJA 1VP3A 3BUSA 3NWBA 5CVDA 4QDJA 2Q41A 3PB3A 4LECA 2ZIEA 2AVDA 1NE2A 2G1PA 2V7EA 4A6DA 1XJ5A 2F8LA 2G72A 1ZKDA 2DPMA 1G6Q1 3M6XA 5CCXA 2C7OA 1DCTA 1AV6A 4UOEA 2ZZMA 2AOTB 3GRZA 1UWVA 3LKZA 5EMJA 5ICGA 4RTMA 3SM3A 3THRA 2UZ4A 4HTFA 5FHQA 4DF3A 1Z3CA 3FTCA 3KR2A 3LECA 3MQ2A 2PVCA 4QQKA 2C7QA 3EEYA 7MHTA 4RTRA 1N2XA 3B3GA 1ZGAA
chains in the Genus database with same CATH superfamily
1DX9A 2J32A 5IVDA 3HZRA 1ZO8A 4KAXA 1QF9A 1TAUA 4PN3A 1T4BA 3D0RA 1N34B 2A14A 4INAA 1ZJ5A 4W63A 3KTAB 4RIFA 4Z9XA 4J0HA 1Y0BA 2NW6A 4XGIA 1XDSA 4WN9A 1XAHA 5K3CA 3V2IA 5CEFA 4L1KA 4OHVA 1EE9A 1IZ9A 1Q12A 2VXCA 1TK9A 4FSDA 2HV9A 3U3MA 4Y6PA 1KO1A 4HYTA 3BQMB 2ZU0C 5IKEA 2R5WA 1FFWA 5AM5A 4KVGA 5AKIA 1B6GA 4MH0R 4CEHA 4EARA 1VDZA 1E6EA 2XB2A 2QT1A 4TT3A 2NO1A 2N3ZA 4KE6A 1W36C 2QTWB 1L1FA 3RC9A 4CW7A 3CUSA 3GA0A 5DYGA 4OQYA 1Q50A 1X7YA 3SHWA 5G4KB 2J9XB 3RU7A 3SHFA 3VA7A 3S0JA 1H1DA 3LP8A 1HE4A 5K3EA 1NIJA 1LCIA 1BNCA 1QCZA 2P3OA 3CJQA 3IV6A 3CVJA 3U3DA 3UAYA 5KQLA 4QYTA 1S1MA 3LGXA 2J5RA 3PUZA 4RUKA 4XX0B 1ZJZA 3A04A 2GH1A 3KO8A 4K8RB 1ZOLA 2OBBA 3H99A 2OXTA 5JUWA 3MRXA 4TTTS 3CGGA 1E9SA 2FPIA 3F2IA 3UPUA 3JATB 2PBLA 2XCUA 3AT1A 4N7JA 4EL5A 3R7BA 1MVLA 2RHBA 3BB1A 5JRZA 1RQGA 4C4SA 5BSWA 2GK4A 5DTQA 2IELA 1L9XA 1RKXA 4BNXA 3QUSA 2ODWA 3CW8X 2FUEA 3Q6MA 4PY2A 4LYJA 4GU5A 5EJ2A 4UDNA 1ZUWA 3OLZA 3CF4A 4XOIA 1C1YA 1E0DA 2PUBA 3B12A 4GG1A 3KJXA 3OTWA 1U8YA 4DYHA 5FWNA 2O7SA 3PQ5A 2H06A 3DMRA 1RVV1 4NYIQ 4DVJA 2P40A 1CLEA 3D6UA 4HT3B 2GRUA 2HDHA 2HPHA 2OC4A 3AXSA 4IDHA 4KO1S 1ULZA 3KVYA 4ZI5A 2QTLA 4N49A 4I0WB 1JXQA 8ADHA 2G1JA 4Z0NA 1Z4OA 1MV8A 2HXYA 2BEUB 2P6PA 3FZEA 1OV4A 2VSOA 4Q3LA 4BKUA 1JPVA 3T8YA 2CFIA 4D8WA 4NR0A 4ND2A 3OQJA 2H5IA 3C4QA 4G63A 1AZLA 1E7MA 2W2LA 4WZAA 1FYWA 2TMDA 3M5WA 1U7UA 1J2UA 1LBQA 2XDYA 4RXTA 1KJYA 4L9RA 4NU6A 4WOKA 3MBOA 2YOFA 4M21A 3GG9A 1O4VA 4KHPB 1P1KA 2AG6A 3LIPA 4XQGA 3H7AA 1AS0A 4E1AA 2HMYB 3EULA 3NYQA 4OHOA 3TUIC 1GXSB 1U1DA 4D79A 1GQRA 1F5SA 4DANA 5JS7A 4HB3A 1EQUA 3R09A 3G0DA 3C6QA 2XXAA 1X8XA 1L4YA 3E7FA 2C2BA 4ZRNA 1U0NA 2YNMC 3TD2A 3UOAB 4PG8A 1MO5A 3G68A 5LP6C 1KK3A 3WNBA 3DO6A 5DX0A 1D1QA 3RGWS 2WAAA 4BVGA 5KINB 3H3FA 2C1ZA 3MGCA 1U99A 4ZAFA 1MX9A 1G8GA 5FNVA 3VR5A 4C30A 4ASUA 1WQ4A 4MR9B 1NJSA 3AO0B 1GNTA 7YASA 3FKSA 4FONA 4FZ3A 4I1VA 3BVPA 5EHQA 1QH8B 1P6UA 3Q9NA 4ZOEA 3H2BA 1AT1A 4YNBA 2C96A 1C3JA 4FKZA 3TXXA 3MS7A 5TEVA 1T9GS 3QEBZ 4PX5A 4G09A 3COVA 3EVFA 3LWDA 1L5GB 4CHGA 4CQMD 3WFZA 4U6NA 3NHSA 3RFUA 3L8FA 1D2HA 1GZHB 3VHQA 1QHEA 3EA4A 5AXBA 5WRFA 4E5YA 3NOOA 1AF4A 4LSZA 3WLHA 2QMOA 5JR3A 3B1ZA 1WP4A 3AW8A 1FP1D 2BD0A 2M2IA 2YV3A 1CQPA 2GZ3A 4REQB 5E6SB 2JCYA 1R0LA 1N36B 2F9MA 3WMWA 3V7FA 3NKVA 4R1SA 1F9AA 3NHMA 2NP7A 1L6RA 4PSVA 3IDSA 2DYKA 1JKXA 1IRIA 2A0UA 1QVWA 2QPTA 3GEMA 3LE8A 3O0DA 1V9SA 4WNYA 5CK5A 3CVUA 4KO8A 1YFJA 4UVIA 2VYND 2G1UA 1AUOA 2JHFA 5EZYA 3DCNA 3C6XA 4JOSA 1TECE 3WLPA 3EPKA 2QZPA 1ZXXA 5KDOA 5L7YA 4YRAA 1P1IA 4P7KA 3ZHQA 1ZCJA 4DSNA 4EFMA 2XVMA 2PWZA 3HR4A 2I4RA 5LIPA 5HPYB 3WK7A 1Q1AA 1NVDA 5F9HA 3D3QA 1JWAB 1YQWA 3HBLA 4FCWA 3IUPA 2R4QA 5LKRA 1ZLXA 1FNDA 1WDKA 1VPVA 2V7BA 1XXLA 1K2WA 4Y2QA 3IA7A 4LTNA 5LFAA 3C8MA 3LWNA 3FOZA 4QDZA 4B6OA 4O4LF 2O2ZA 4K2HA 3O91A 5LNK1 4KNWA 3ZGXA 1K6MA 3L7BA 3PFCA 5A6SB 1S4QA 3K1YA 3T7CA 4DIMA 2NZ2A 1WKCA 2A9FA 1TADA 3K0CA 4JWKA 3T9BA 3K6SB 1VHTA 4NH0A 5DTMA 2WB4A 3L40A 4X20A 1U02A 4PC2A 5K8VA 4L57A 2FN3A 1TLLA 3AUYA 2W4MA 2O0KA 3EUAA 4JGGA 3C2QA 4JY7A 2I6TA 3QW4B 3T7TA 1BWSA 1C8VB 1XKLA 1Y1QA 3KC2A 4V2UA 5TPZA 2AK3A 2P62A 2OB2A 1EINA 3NP9A 3G0GA 1UDXA 4OBXA 2XMSA 4I1IA 3KCQA 4I50A 2R84A 5I4CA 3QLUC 3MTQA 3ET4A 5DEOA 1VSVA 2Y92A 3B1YA 4PLFA 3FZGA 5G0SA 3QXGA 4XIFA 3O84A 4CF6A 5DULA 5JBIA 2ZUFA 3T3OA 4PZDA 3HVIA 4M0CA 2O5EA 2I4LA 2GZRA 2PMBA 4DLLA 1P9LA 2GUGA 5TT0A 2P9ZA 3UYKA 6AT1A 3JQFA 5EXTA 1EBBA 1WOYA 3FNQA 4DLNA 1F17A 2DHQA 5KAMA 4AKGA 4C3VA 4GKKB 1FFGA 1YZ3A 3DV9A 2WILA 3FI9A 4JI7B 1RP1A 2J6HA 1V6AA 2RHLA 4HP8A 4Q9JA 4HC4A 1T9CA 3OJLA 2NTEA 4J91A 1YMQA 3RVRA 2OPHA 2HX1A 3OTQA 3QJYA 1JHXA 1CUYA 4MR7B 1C9JA 3HB4X 5C32A 5DTEA 3SC3A 5FAKA 1K89A 1IN8A 1BHO1 3FWNA 5CX1A 1HEIA 3CKLA 3PUJA 3OIUA 1QE3A 2VG8A 4D0LB 4K9RA 2Q2QA 2J3QA 2MSNA 2IDZA 3N6RA 3O1IC 4BHTA 4OUKX 5F12A 4D57A 4DWWA 5ITZB 2Q5EA 2O8DB 1ZK1A 1FS6A 3UTDA 2F1JA 3WJ7A 1K92A 1B3BA 3HM9A 3G9QA 3VZSA 1QE5A 4F12A 3QXHA 3FETA 1XRSB 3I2KA 3ASZA 3WGOA 1PG5A 1Z6TA 1C7EA 1PX2A 5I7FA 3A1UA 1UQUA 2PYZA 1GKUB 3QKIA 1NPYA 1E5XA 2C9CA 3W6ZA 1MUUA 3UAZA 4GX0A 4TWBA 2WHYA 4JKOA 4K1XA 5U9CA 4JXJA 2HQBA 4A15A 1Q2UA 2YMMA 2EJTA 4RXMA 1C30A 5GTDA 3ERCA 2HBZA 4FQ5A 4WK4B 3TOXA 4CV0A 4LJAA 1H4QA 4C03A 4EHLA 4YRPA 2J3JA 1Z16A 4MPDA 1QH1A 1Y1RA 1HLDA 3KOZA 1BMFA 4XSGA 3WL3A 2OCIA 3CSSA 4IGEA 4Z2YA 3UMVA 1E98A 1P2FA 3ORFA 4Q24A 4W7HA 4EJ6A 3LUHA 5MHTA 3VR1A 1BSVA 4JX8A 4PINA 3W2TA 4M83A 3MD0A 1ZIPA 3SPXA 4YAJA 5TGZA 4TTQA 3OCJA 4TV9F 3HM2A 4C7VA 3S8YA 3F78A 1IN4A 3RUIA 1XXHA 3UK6A 1SVOA 4ENVA 1TGYA 3OZRA 2NOAA 5LXTA 4P34A 2BYTA 4D02A 1XZIA 3THSA 1NQTA 1ZM9A 4QUAA 3V55A 4YPOA 2B92A 2YQ5A 2RBEA 3AU9A 3PITA 4IUCS 1VJ1A 4ZHQB 2CLLB 1R5OA 1JSXA 4AULA 4J1SA 2NVOA 5AICA 3URKA 3EK2A 3MINA 4GQAA 1HBJA 1ZH4A 2ZJ8A 5CFQA 3CEHA 1F8GA 5BYBA 3WGGA 5FI0B 3P96A 5BMVF 4CF7A 5E3HA 1JZSA 3EZNA 1QWSA 4LGVA 3F7MA 3MLAA 2GM9A 2KW5A 1HLPA 3CW9A 4YJFB 3SYRA 3NT4A 3G2KA 2JBAA 2OAGA 3C1OA 3K1JA 2DWQA 3JQDA 2I9KA 1NW7A 3HJRA 3HA5A 4OLHA 3OH8A 4R5MA 1SVIA 4IXMA 1PS0A 2P4UA 4NX2A 3FFXA 4X8OA 3RS5A 3U16A 4O3MA 4W5NA 5HFAA 2VT2A 2Q1YA 5BUQA 3MMZA 2R8RA 3LKVA 1E0KA 1W6UA 3ZD6A 4HN4B 1YIOA 3HUEA 4UE3S 2F8SA 1LFAA 5J4HA 4Q02A 1XTRA 2WM9B 3OKCA 5DLQC 4IWXA 5LD2B 4EUHA 1H4TA 3LD9A 5H7XA 1NVKA 1U5BB 3BXHA 1JG2A 1THZA 1H0KA 4QLOA 3LCUA 3ROFA 1B26A 2I6UA 2WMOB 2X5XA 1NYQA 4AUNA 1L5YA 2B1JA 3NKFA 4RENA 4RO0A 2UZ1A 4MRNA 2B83A 3DF7A 4TWZA 4ZVTA 5EUMA 4ZDJA 4HYEA 3RUFA 2H2HA 2QLFA 3NUQA 3I8OA 4EYQA 5KX5A 4GR9A 2F43A 2NTYC 2OG2A 3HWSA 4V0SA 4XUDA 3VR6H 4W7IA 3FDZB 1JG4A 2P9CA 4B7XA 3GGPA 3LCJA 4N76A 4AZ0A 1MMFB 1BRTA 2WT9A 3M5PA 1U7HA 2QL9A 3FUUA 1Y8ZA 3TQSA 1CUVA 1T2CA 3H65A 2QW1A 3WTBA 1NVMB 1R10A 1T8WA 1U7XA 1ZA2A 2EYQA 3AH8A 3G2IA 3KQPA 3KWJA 3MGBA 1GL6A 2DGDA 1XNJA 4F3KA 1EP1B 1I13A 2BSAA 3PXXA 3LG2A 3AYXB 4FZVA 4QEDA 4X60A 4LE1A 3TMAA 4DMCA 3KD2A 4GC9A 2XAUA 5DRYA 4YCBA 2K7ZA 1SCIA 1E9DA 4I4TB 5KYVA 2CF6A 4QX6A 3G2QA 2RKOA 1ZH8A 1QH0A 2FEAA 1Q0RA 2CNNA 1ZL0A 2EP8A 3JWIA 3L6CA 1YVUA 1DDGA 4GLOA 3E9ZA 4XGNA 5KAPA 3BTVA 2Q2VA 2JI9A 4J0FA 3HVRA 3HDJA 3AC0A 4OQ4A 2ZYDA 1VG9B 3L9XA 2BFMA 3JS5A 4MA4A 4WHMA 1HOXA 2RDMA 3GZJA 4R2LA 4XQEA 3B13B 3R77A 2VPYA 4HR7A 4JLVA 1XR3A 4M9CA 3WKCA 3H5OA 3PF8A 4Y9RA 4JJ4A 1XA4A 3BKXA 4HXEB 4FEYA 3GLIB 1DQNA 2GPSA 5DLYA 4TQGA 3EJWA 3M5DA 4NF2A 2C7VA 3QVJA 1X7ZB 1EVYA 4FDMA 3ASUA 1TYCA 1X7XA 3W3AD 1J24A 3PF9A 4D74A 2K6GA 1QP0A 4RLFA 1U2SA 5A4MS 5GADl 2W6IA 3D0OA 1MZVA 3W8NA 4BFXA 3BF8A 2QM7A 4MS4B 5TSDA 2VBCA 3GGSA 4RHFA 1ONOA 1NRIA 5HOEA 5LNK6 5LP1A 1U9ZA 5FULA 4FEEA 4BWFB 4XVHA 3KT0A 3SDBA 3MWEB 4BDSA 5GMOA 1MEEA 1NUUA 1YQQA 2VT7A 3ONNA 2VL7A 2EFHB 1DV2A 1K0FA 3G2LA 4CEHB 3GEIA 5JH7A 3DFMA 3OT4A 4K87A 3ROZA 3E5MA 1I6KA 3HHPA 3ZHUA 4ZIRA 3FTDA 1HSZA 2P2CA 1WDMA 4M6WA 1ZIOA 4AF6A 4RDIA 1UMBA 1CW2B 1Z63A 1CY8A 4IJMA 4UM8B 2EKDA 1R6TA 1NF8A 3QFHA 1OI4A 1R8JA 3QGMA 3GLFA 1J1ZA 1N77A 3JTMA 1JP7A 3F49S 2F00A 3RFFA 1ADCA 5FPKA 2EFEB 2CJXA 2UVDA 3FPSA 3H9EO 4UMFA 3WMGA 1OLOA 4C1BA 4YJ3F 4YGYA 4DCTA 4EL0A 1WMAA 4GOJA 1DFIA 3GNSA 1POXA 1V16B 4ZT2A 1BROA 1ZUNB 3NOVA 5LU8A 5EE5B 4I6JA 4ZCLA 1Z18A 1NUQA 4I9UA 5M29A 3EOBI 3L6UA 1ISPA 4UM9D 4HAYA 2AZTA 2VP9A 1L8LA 2VC2B 3C3JA 3FYHA 2VUHB 4HAVA 1N6KA 2XCQA 1IM2A 3CRVA 3U4QB 1YNSA 2V3VA 3IBSA 2DEUA 2G70A 1E4EB 4KPUA 4H6VA 4BB5A 1LSOA 4M60A 2ZM6B 3MWJA 3FYCA 4RD6A 4Z4IA 2G40A 2WHQA 5BQ5A 3IQDB 4G0NA 4IM7A 3G0CA 3TTVA 1AXEA 2HEGA 3OT1B 3VNRA 1LRKA 1MA0A 3TSOA 2OAEA 4NZZA 3ENKA 4B7CA 1GL7A 1NU8A 4EO7A 5TMPA 4JJ6A 2QD2A 2PYIA 2J1LA 2FE4A 2Q9BA 4R7ZA 1OVMA 4YP7A 3MTGA 5TDHA 3SHVA 3VKFA 4BFTA 4HNAA 4RK7A 3FYTA 5CB4A 4K9OA 1L7XA 2PMWB 1KRWA 1LK0A 2Q5JA 3IESA 3H4MA 1JH8A 2IF2A 2ZSDA 3SC4A 4B4UA 3P52A 3QFCA 4Y67A 1RWKA 4B75A 2Z9BA 3WBBA 1Z3CA 3R0ZA 4JJGA 3EF3A 3UCFA 4GX1A 5C53B 3G8YA 1WBDA 3DFKA 1L4FA 4DUPA 3QE9Y 3I6IA 1I4LD 4EEKA 4PYJA 1VKNA 2FW8A 2PR7A 2HL6A 2CKMA 4HD8A 4I08A 4CDRA 2C4KA 3BSWA 5U1PA 2I03A 1AGYA 1WUHS 3F2VA 3OZEA 4HQNA 2R4UA 3D5EA 1DX4A 2B82A 3GDOA 1PAUA 2DBQA 1W19A 4RWZA 5G1NA 2R1TB 5EAIA 3WSTA 4EB6B 5CXXA 1M74A 4I19A 1X1DA 1BJKA 3ZWQA 3TF5A 2MMGA 3CH5A 2WT8A 4R9VA 4URYR 4DRZA 4QGSA 2QVYX 3ZDFA 4Q4CA 3VMFA 3ABIA 3BD6A 4OP2A 3UWOA 3LQ4A 1X9HA 2MHCA 4RMJA 3IMKA 4HY3A 3JPYA 3VR4H 2HH9A 3L7YA 3M4NA 3ZVLA 3RHZA 2P30A 3AY6A 1FMFA 4R6WA 3L5KA 2WIFA 3BHMA 3OX2A 3GA5A 4GMKA 3FNFA 2RKBA 1JWBB 3SVTA 2DU8A 3OLCX 4JNCA 5EP2A 4B2LA 1Y8RB 1V1MB 3NRJA 4IIBA 4DIKA 2ZRKA 3PEVA 2AZXA 3BT7A 3EZYA 5KEIA 1G0NA 1KC1A 4ZAXA 1WMFA 2A0XA 3C6ZA 4AAYA 3K0FB 2GZ1A 1DT3A 3LT4A 4J0CA 4P2GA 5JRDS 4EY4A 5CH8A 2H7XA 3AB7A 3H9CA 2J3EA 1GLNA 4O29A 1A2QA 4YHBA 3ZWMA 2CV0A 2NU8B 1J21A 1LPBB 4C89A 4I5GA 3DVQX 2Z8XA 4OYLA 3ZU6A 1N8SA 1R0YA 3UBMA 1CZKA 5ECGC 2ZCUA 4H59A 2ZYHA 2JJQA 5SZJA 4ZYVA 5IABA 4KUGA 5HF9A 3A70A 2NVUB 1WCXA 3DKKA 4V0QA 4UTRA 2W6CX 5ENVA 1NJGA 1ECFA 4DKXA 3T7IA 4NFSA 2Y6UA 4EGFA 3W3ZB 4XYLA 5HEKA 1DDIA 4XIYA 4EF6A 1X77A 3FMPB 1ZUHA 3D3NA 4QSMA 5ED4A 4RTLA 5KS2A 1XRQA 3PHLA 5EEHA 3EF0A 3SQLA 1QGZA 3HB7A 1I5EA 4GBMA 2BFPA 5DI3B 4ZCRA 3S8EA 4TL8A 4J4TA 3Q8LA 5DLEA 4C3OB 2Z6QA 2OYSA 1HKUA 2GN4A 3GUYA 2CCGA 3P9CA 1CF2O 1P9RA 1N78A 1MC1A 1I1QB 1ISRA 2H4FA 2MYUA 3AEQB 3C5EA 2JGMA 2NACA 3BFJA 2YS7A 3ECCA 4G1FA 4MKIA 4BS9A 1BDHA 5BY2A 2J7PD 2X14A 4R40A 3ZR4B 4BECA 1GQYA 3ETHA 4L5YA 3HMKA 3ENNA 3F8WA 4JBLA 1E20A 3K9GA 3QPCA 4HVLA 5B4TA 2WKQA 1JDTA 2EFJA 1J39A 1EX1A 2W6ZA 3SHQA 2JD2A 2WD8A 4UARA 2QVCA 1O9GA 3ZJTA 3E3NA 3O3CA 4DLUA 1KFEB 2YXNA 1K97A 3OUZA 4TN1A 3LAWA 3H87A 3K2BA 3DCIA 1ZPDA 4GOMD 5ALZA 3OF3A 1I7NA 4NJMA 2V6MA 1JSZA 1SUFA 3EZGA 2JZCA 4C78A 5E8JA 4MS3A 1ZNWA 2BUAA 3ZCXA 3CH7A 2C7PA 2AZMA 2OXFA 2I2XB 2B4YA 2OXCA 1YVRA 2A67A 3KXLA 4WOCA 3UG6A 4BE7B 1QC5A 3V1NA 4NCXA 2C0QA 3E9NA 2E4UA 3EVEA 1JG1A 1ECBA 1K06A 1Q1EA 1VI2A 1N6PA 3AG5A 3MBIA 4INPA 1JA1A 1Q77A 2VPQA 3WL8A 4BN0A 1Y6ZA 1HFJA 1PLKA 3DKPA 1KYTA 1QHNA 2P0YA 4RESA 4XRGA 4RVNA 5CGZA 2PH1A 5JCJA 1WEKA 1FUUA 1W4LA 3GR6A 5UKDA 4F4IA 1V96A 1YC2A 1N75A 2YCLA 1XTVA 4ISCA 4MKFA 1KF0A 4TL6A 4HWKA 3IS3A 1Y81A 2ZJYA 1JFRA 3BRQA 3IJPA 2GEUA 3L7IA 4QJIA 1H2ZA 3HBJA 4KAAA 5ALUA 3FSRA 5JCOA 3ZX5A 1NI5A 1UMKA 5KSZA 4XDHA 2PMCA 1XKXA 2WJ6A 3GI1A 3K5WA 4N9QA 4HSGA 2HSGA 2YFQA 4QXRA 3WQBA 1T15A 3IAS1 1HEYA 3B9PA 1KEPA 2WP0A 3R6WA 4FWIB 4IEIA 3QKWA 4ZO8A 3AETB 5F1PA 4GYWA 4P82A 4U7HA 3SF0A 5DYNA 3K0BA 4CTNA 1VDMA 3MCZA 1KARA 2XZOA 2H07A 3DSRA 2YJZA 3NAGA 1OCEA 4OU5A 5BSEA 4S12A 5A9TA 2KX7A 3TCXB 2Z5GA 4O5AA 1M5UA 1UBOS 4E11A 4GECA 5J43A 3OO1A 1RQ7A 4JROA 3OHSX 4XFKA 4KN8A 3PDHA 4O2AF 1GUDA 3E58A 5P21A 4E15A 2UVPA 1ODIA 1S89A 1UL1X 2XD9A 3FHOA 4MDYA 5IUKC 1K8QA 2C3OA 3UAOA 3MVEA 3ZZNA 5BNIA 4GVPA 2GBFA 3P0EA 4IPTA 4A7PA 4GD3Q 4GPTA 4H60A 1XK6A 1BAPA 1F4PA 4AKTA 4KFRA 1UDCA 3DOHA 3MWDB 3RKSA 1ZN7A 2DFNA 4MIEA 3BXPA 1MQAA 3N7TA 2AR7A 1W73A 3LFUA 1F6DA 2QAJA 2XOKD 3KBOA 2EQ5A 4XDZA 4II7A 5LMUB 4FFRA 3T54A 5BN3B 2XKKA 3EOZA 1MU0A 2A5LA 2BKVA 1CLUA 2J8ZA 2Y1FA 4GQBA 1QV6A 3ID6C 1IY1A 3LZCA 3PQ8A 3PR2B 3PPVA 4JOCA 1FDSA 1NJ8A 2QD5A 5SY6A 4YR9A 2JI8A 4ZAVA 1K7EB 1TA9A 2BFDA 1NY6A 2C1EA 4B0PA 1P74A 6YASA 4YCNA 4MUKA 2ZUUA 3OEHA 4Q4JA 1CDDA 2GK3A 1IAQA 5BSTA 1I32A 4HGRA 3RLFA 5LKAA 4GE3A 4PLYA 2WYHA 1W5BA 3C39A 3TIXB 1JN0A 3ZV4A 1AKVA 1G17A 2E4VA 3LPLA 4RV9A 3OBIA 2A9PA 2FEMA 1GAEO 2YDYA 3JAWA 4NCNA 5EWLA 5HIIA 3TX6A 3LI2A 4C4TA 4EJ2A 1U0FA 5THQA 4HZUB 1KKMA 3DBRB 1KZ4A 2D0PB 3L8MA 3AOGA 4EPVA 2WYIA 2A7XA 4ATNA 1DPFA 4OHYA 4G5FA 4KSCA 4LKRA 3AUSA 3RDPA 3P2EA 3A32A 1Y3FE 1H6DA 1LTHR 1QIDA 1U2GC 3LFTA 3OFSA 5DM0A 4XWGA 3GBSA 3X43A 4DQUA 3MK31 2PZKA 3QV2A 2R4TA 2AOTA 2XPCA 3KKMA 4YP6A 1JL3A 4MQ6A 4D4IA 3K0KA 4Q1DA 5BOSA 1U94A 2FWBA 1V2GA 2G25A 1Y89A 5EI5A 1FXUA 3GFOA 1PYOA 5EZ5A 3O95A 3BL8A 3AHJA 4JODA 3LBYA 1EDEA 3JYHA 1VMAA 2I62A 4BQNA 2BR4A 2FW7A 5AKEA 1QX4A 3B5JA 4Q9IA 1JIXA 1U1GA 3AERA 2IYVA 3KPVA 5F4BA 2QVLA 4L8LA 4AZ0B 4ALIA 1R0SA 3J81k 5ARCA 3AM1A 5A2GA 1Y8QB 3SWWA 3HEBA 5JXIA 4N41A 3WHPA 5A3VA 5IDQA 2SKEA 1FLNA 4YGXB 3RAGA 2HQOA 1E1LA 4NFYA 3UMYA 1KGDA 5CVJA 3KJHA 3Q4GA 4OJTA 5EMMA 1EK0A 1P3Y1 1QMPA 2H08A 3UUFA 2X1HA 2V59A 4YJGA 5CVUA 1UXKA 2QTNA 3ZBPA 3H9QA 5IJZA 1PR0A 2AN4A 1IBCA 2I7VA 4WCFC 4TKLA 3FWZA 1YUNA 4Y30A 3A4IA 3VO1A 4AZTA 1FEZA 5C1IA 2JS7A 2D7CA 2NU7B 2XUZA 3L6RA 4M54A 5EWJB 2ECOA 3I2IA 3D59A 4ZVRA 3TZHA 4CI0B 1DOAA 3TW4A 3T3NA 1WDTA 2WD9A 2Y1XA 5FADA 5CXQA 1JPNA 2VIIA 3CE9A 3FSEA 2OQVA 1W87A 1YE8A 1N9KA 2A35A 3VZBA 4MULA 5CLJA 3SZUA 1SQGA 3I73A 4HNQA 4BQPA 1NUPA 2JD1A 2ZATA 1S2LA 4B8ZA 5I3ZA 3JAMA 1G38A 4B2YA 2ID9A 2EF1A 1EZZA 3DTVB 4ITRC 4CLRB 4EPWA 2FSGA 3SKVA 3O8LA 1G2QA 3CG4A 3M6LA 2FG5A 3V8NA 1KI2A 3I8XA 4NV1A 5MFPA 3W5AA 4IJQA 1QRTA 2CB0A 4GP7A 2CNWD 4HH0A 5ULLA 1R0ZA 2GPBA 2PT9A 3K71B 2QX9A 1FVFA 1N6IA 1TM5E 1Z6ZA 2WUFA 3V32A 2DCUA 4LE2A 4WLNA 4PO9A 4NCIA 1XNQB 3O8OB 3KKPA 2VVTA 2VCHA 2RCNA 1JDUA 3B1WA 4KVAA 5J23A 1MIOB 2QZJA 2YMLA 1K9SA 3BAZA 3N3BC 4WKNA 5CTAA 4JBNA 5JDCC 3TBFA 4A0SA 4K9LA 3BG5A 3DEAA 2ZE6A 4N01A 4KRGA 1DKQA 3H0CA 1G8KA 1GZ6A 4FOOA 4IJKA 3TSCA 3V8RA 1UP6A 4TXMA 1MX1A 1FTYA 3FPGA 1IUNA 1MP0A 3K6JA 3D3WA 3HV2A 1ZHHA 4GXRA 1NFQA 2FKAA 2V7QA 2MIIA 3OZXA 2ZM5A 2RAPA 2WZDA 5CB8A 5J40A 4MQLA 1JYFA 3GDWA 1H8ED 4MUJA 2BEWA 1N0UA 5J2UA 1K6XA 5EQTA 4ESEA 1E6LA 3MMNA 9ATCA 2ZJ6A 1NBME 4ZYWA 3WQSB 3I04M 1USIA 1M76A 1MA3A 4MUIA 1FVHA 3RU9A 3RT9A 1J8FA 2C1XA 4WUVA 3ZCRA 1P7CA 3DUFA 4QVKA 1QHYA 4DWVA 4ZAYA 3SFVA 3VHXB 4MQBA 2X4IA 3HFGA 1QF6A 1E3QA 4MGYR 4GAEA 1DC7A 5D8DA 3U60B 4MUFA 4WL0A 2X9GA 1P7YA 2PH3A 2A92A 3QPVA 4RVUA 1NKTA 4KPUB 1PT5A 1WQ1R 2Y9MB 4PANA 4QOHA 4JJIA 4UU0A 3VPSA 3TTUA 1BCRB 1PYDA 4NNJA 1QFJA 3NMUF 3V8EA 4V0OA 3N58A 4QQ8A 1ZGBA 1I3NA 3FM9A 3N3AC 1C7RA 3IAS6 1AHHA 4ZDWA 3NJ4A 5A3RA 3FDXA 2ZRIA 1OJ7A 3B82A 3MXTA 5EIEA 2YRXA 4EW3A 2OSVA 1RMTA 3LS2A 1X3LA 1A2OA 1XYVA 5EFZA 4XVCA 3D6FA 3V8BA 2ODPA 1Z35A 4JLPA 1RRPA 3FWYA 5LQDA 2PZJA 2WIGA 1RC1A 4PFKA 2QX8A 3V4OA 3WLJA 4JSRA 5BVHA 4GLFA 3TLZA 2WYWA 2DH5A 1U2PA 3DPIA 3FCYA 4R2KA 2NU6A 1CTQA 4AWXA 1VHQA 4KQIA 2O59A 2YFKA 4Q1VA 2Z2ZA 4UE2A 3L7CA 4QIHA 1DL5A 3CBGA 3HYCA 3STWA 2QTGA 4WBNF 4H7HA 4MVXA 2WTAA 1M6VA 2ISCA 4PM4A 4US2R 2YRFA 1U8UA 1VIDA 2WG0A 2AQ8A 3F3SA 4B3XA 5JZSA 4I55F 4D4GA 1A5ZA 1A9RA 1FYXA 1Q22A 3MWLA 3RVPA 4AU1A 2JCSA 1T3LA 3KOWA 3DHEA 3SJAA 5TVKA 3WGIA 3B1KA 1CJCA 1X3SA 1N0IA 4LQLA 3SS9X 5IK2D 1KQPA 3BWYA 1TGVA 4XWOA 1ZRNA 1P1CA 5EJMA 4G5YA 1C9NA 2NU9B 4DA9A 1WBJB 3I28A 1TYAE 2VQDA 1N3YA 4H1HA 3HZHA 4L9AA 3W2EA 3KSBC 3V9AA 1HZZC 2XNSA 2JLBA 3EE6A 1VJ5A 2DFLA 3OQIA 3UC9A 4YDSA 3QWHA 1IXRC 2YOHA 4HNRA 3ZJUA 3DHNA 4IHJA 3JYQA 1H8HA 2VWHA 3A11A 4R6XA 3U9LA 4MICA 3TSWA 4D9CA 1CX9B 3CU5A 4IRXA 4QVGA 1N8KA 4IMPA 5I9IA 3ZWCA 3DNFA 3LY7A 2B9EA 4J16A 2QMQA 2WJPA 5KTNA 4KXQA 5FA5A 3DAYA 1QAQA 2BCJQ 4X44A 5EKTA 4L0MA 1AQUA 4ZI7F 3SQWA 2WAMA 1CRWG 2LNDA 1R2QA 3BMNA 4IICA 4QBIA 3FVQA 3F5MA 4J0KA 1KJJA 3DB1A 3BHNA 2D5IA 3HO6A 4YONB 3SFZA 1E3JA 1SKYE 2X41A 3OZFA 2XCOA 3PRHA 3OP4A 2V8BA 3MTAA 1NJ5A 1NUHA 2O4CA 1YR6A 3A2KA 2IYZA 3T5TA 2BE9A 1ZICA 1S9DA 4TLDA 3PGLA 1RBZA 4BVBA 5DN6D 2YL2A 2G9ZA 8AT1A 1T5HX 3DEHA 1YR7A 4GKVA 4RCYA 3VPBA 4I99A 5JATA 2WTNA 3QTBA 2LV8A 4LECA 4D9JA 1F8XA 4CKWB 3BCSA 4DRXA 1JV2B 1EP9A 1NE2A 16PKA 2YWFA 4X85A 2O3TA 4E4TA 4RA6A 2HCRA 1EK2A 2CB9A 1HDZA 4KNVA 4DLXA 1B23P 2BJVA 1E9FA 4MRRA 3FLAA 1UADA 4JAVC 2IW3A 6Q21A 4YRZA 1L8XA 4RTMA 1SOAA 4JBWA 3L8YA 1CIPA 5ADVA 4NPCA 3LECA 4QQKA 4OHZA 1RWWA 2UUPA 4YRIA 3OQMA 4KNYA 7MHTA 3CNQS 4TSRA 1QUFA 3W05A 4BUZA 3NI2A 1XLUA 4KPFC 4F5YA 5LYYA 3EA5A 4JUCA 2QGZA 1U28A 1UDRA 2Z57A 3CM0A 1X19A 3ISJA 1PQ4A 3C8DA 1GTMA 4J76A 5K8UA 5MFZA 3RFTA 3GCGA 1EKXA 4CNQA 2ZBEA 2QQEA 3EQ9A 4AX4A 1A8SA 3OZ7A 4J4HA 1G291 4GIBA 4QYIA 4C04A 3WB0A 3LP5A 4QPPA 4C1NA 1XVIA 1SXJA 3OIYA 1DHTA 4F04A 3PLAE 2IHUA 3EVAA 5DGHA 1NG9A 1CVLA 2D1RA 3LPCA 4YRSA 1QG4A 3FA2A 4UZEA 4F5WA 3S2GA 1J8YF 3GNQA 2PKWA 1OBFO 3NBFA 3IUYA 1YHYA 4MEJA 4UEKA 3DL0A 1Q44A 4KXXA 4IX1A 1UKBA 3QKRA 3TNJA 1C0PA 1YIDA 2FP3A 2FQYA 3CR3C 3LBNA 3PZBA 2X0EA 3TLGA 2AIRA 2G36A 4C87A 2VPPA 3LDGA 5CFOA 2OV4A 3TOSA 1J99A 3G0OA 3A6DA 3J81A 2P8JA 1BW9B 3HJNA 4YEDA 3TYXA 3KG2A 3WRWA 1NPTO 2C5LA 5KJFA 2YYYA 8GPBA 1P44A 4F06A 4KLZA 4NSNA 3TPFA 1GGVA 2WU0A 1AGXA 5A04A 3BRWA 2AMFA 3JQGA 1ZUIA 3HSKA 1MB2A 3L7JA 1FX0A 2KWIA 1RXEA 3K9FC 3FOFC 4JK3A 4MWZA 1V35A 1KE2A 1Z0SA 2RAVA 3JQEA 3OSUA 5LZ4A 1QOQB 3BIXA 1RWMA 3V42A 4M8SA 5KQPA 2VCEA 5IRCD 3GFSA 4BNJA 3FVVA 4YUVA 3VPDA 2XZTA 1NTRA 1C9DB 3IUMA 4QBTA 3QIVA 2VUUA 5TMBA 2QXUA 5T57A 4D4LA 4C2UA 4EFDA 1KQGA 1DOHA 1J6UA 2NP6A 4MITA 4MV9A 3AR9A 1GA1A 5JMTA 4HDNB 2G83A 3GOQA 3HKDA 3DL2A 4IHKA 4E03A 4E7PA 1JFSA 4FT4A 1ZD2P 3PFNA 4JD5A 5EHZA 2IA5A 2NIPA 2FDXA 1T9ZA 4D81A 4WXRA 2WD7B 5ILGA 1WCWA 1OLXB 1P5JA 4QKQA 3KR0A 3AHEA 4GYJA 1VBMA 3PNKA 4M89A 3WYNA 2VF7A 4CGYA 4ROSA 2OBMA 1M1XB 4RTOA 2TRSB 3A26A 3VI4B 2VAWA 4FMBB 1N2HA 2FX3A 4G89A 4J4BA 1U0SY 2EZ4A 2HRCA 2R8XA 4NOLA 3C3DA 1KZHA 3VZRA 3JQ8A 1VMEA 1WOMA 3FAZA 3KQLA 1E2EA 4KUHA 1R6BX 1WSWA 2YHBA 1DT5A 3TRJA 4TV8B 4RSMA 3UC5A 2V74B 2C07A 3C6BA 3E03A 4EIWA 2Z1DA 4IWNA 3R3XA 3F47A 3LUBA 1DRJA 4F45A 2D5AA 1FDVA 4NG5A 1BCSA 2Q1UA 1WKBA 3A1DA 3ZK7A 4AFNA 5LMZA 4IH9A 3DLHA 3IVRA 1IZ8A 1IHYA 2IZ5A 3BB3A 1AC5A 1VL2A 2OORC 2QQ0A 3TZ6A 5I3CA 1OWMA 1X6VA 5K45A 4B4KA 3BCHA 2ZJ1A 3UJ3X 4KMMA 4Z53A 4RPKA 2R1ZA 1RXUA 1TO6A 2HF7A 3CEPB 1GWNA 5HYVA 2FQWA 4H7EA 2QPOA 4HX5A 4KFUA 1UPAA 5I7VA 3RWBA 4N5NA 4AG6A 4GKJB 4PZAA 4KV9A 3ZWWA 4ID9A 1XZKA 2GCIA 4JJFA 5AI4A 5B58T 1PBNA 2JKZA 2ZUDA 1E1YA 5JNUA 1RCFA 2ONKA 1M6WA 2V5AA 1HDRA 1BQ4A 4WCFB 5AHXA 5I8ZA 4ZCTA 4JI1B 4F21A 1S2GA 4LZLA 4HGOA 2C8JA 2QDXA 4U2DA 3VOAA 1RYNA 4ICIA 4AVYA 5AKKA 2Y6VA 1WDWB 3GZTB 1U1EA 3D0QA 1R0WA 3AY7A 4Q18A 2QRJA 2QTBA 2WICA 1RQPA 1B43A 2Q3BA 5HE8A 3B1JA 3RRYA 1W59A 5H4GA 1KNQA 1E0SA 4DDKA 3DKVA 4YT4A 1QU3A 3IC5A 3PDUA 1SG9A 1Z38A 1A27A 2PGJA 3AIIA 4M9SA 1KMMA 2HSEA 5IARA 1XZFA 3G6WA 2IYFA 4DQKA 2HW8A 1DLJA 1TMGE 3C98A 2MYPA 4PCUA 1PV4A 3WK5A 1SKQA 1H6BA 3PFGA 4M1ZA 3VYRB 3KHUA 2CJWA 3LXRA 4C43A 9ABPA 3KQVA 1NX6A 3DDUA 1I6MA 2VAPA 5JSQA 3MOIA 4PCVA 1LLQA 5AJYA 4NBNA 1NVFA 1NW3A 1XOIA 2OMKA 3RADC 3UGKA 1YH3A 1YHZA 4KIFA 1FTQA 3ASYA 4JELA 1EBFA 2XDWA 5F2EA 1CY4A 3JARA 2O2DA 1GTG1 3EEFA 3WBFA 3FNHA 3OPQA 3WQRA 1QCYA 2PBRA 4CL3A 1PHPA 3AVPA 4BFLA 2C7RA 2EL9A 5FTNA 3ZKAA 4NBVA 3OMWA 4G4SO 1USGA 2PFSA 5M3BA 1KK1A 2IZOA 2OK7A 1NKSA 2X3UA 1KIAA 3K9CA 1BDIA 2ZUSA 1FFXA 3AR2A 3NRBA 4PPYA 2RD2A 2FEXA 4G6ZA 3OHMA 4XCQA 3KCNA 3N1UA 4P86A 3U7GA 1BFDA 1ODKA 4ZQBA 2VQEB 2RH5A 4DCVA 4KDRA 4JMLA 5BV8A 4JYAB 1P45A 1PDWA 4NQZA 1F7UA 3T4UA 3AR7A 1MN6A 3LUCA 2FZCA 2J46A 4FU0A 5ES3A 1S9HA 2GPNA 4RYDA 3RS3A 3HCWA 2PS0A 1MGOA 1K7FB 1MPXA 1T6XA 4NYIR 4S2UA 1O1YA 2QN1A 5DNWA 2CXXA 2GBLC 2XGSA 3L0OA 1VCMA 4BNZA 5FUMA 1Y1SA 5IS2A 3DWGA 1E61A 1E2NA 2FUKA 1XJWA 5AK0A 2OKGA 4Y6SA 4IDCA 2VYNA 2W6PA 4JJKA 2QTFA 4K9MA 1CK4A 3L4BC 2W8ZA 4I1RA 3K9LA 4E08A 1HNNA 3ER8A 1M7HA 2QRZA 1HGXA 3U7IA 3UH0A 2VHUA 2IYAA 1CUGA 3D6TB 1X7GA 3UIEA 3ADPA 3MFQA 4OQLA 4DOMA 1XPRA 3F5DA 2YOGA 4RXUA 3NB0A 5M5BA 4JVOA 1CUUA 3CIOA 1C80A 2P65A 2JFNA 1RPTA 3K8ZA 2VJBA 3SQNA 1GTRA 4WERA 5A2QA 3TLKA 4M3NA 3GBPA 2DE0X 3R4VA 1XAIA 1EGVB 4YV1A 2F2TA 5KDDA 4Z54A 4D3XA 5HMLA 3Q3CA 3CX6A 1XTIA 1D4FA 1Z74A 4FMCF 3CX4A 2IU0A 2RE8A 3PVCA 2GPWA 5HX7A 1A76A 3A0RB 3L5OA 4HMOA 2CUTA 2Z2IA 4ZOCA 3A9RA 2VHCA 4P3NA 3WNQA 5A71A 4U2FA 1K7SN 4IS2A 3BPSA 3DZBA 1QIIA 4Y18A 1A9OA 3DE0X 4MRPA 1LI7A 1O95D 2CVPA 4Z49A 4DLPA 2UAGA 5IZ4A 1GNLA 4ZKDA 3I9JA 2XWSA 4XGRA 3G9TA 2PUDA 4RLHA 1N2CE 4XWKA 3PA8A 3GFBA 4IV5A 5F3WB 3NVMB 5D6NA 4ZC8A 4LFAB 1TFUA 3KU4A 2EZ9A 2QLTA 4E7OA 1D5CA 2A59A 3O8QB 2W6MA 4EZEA 2AFIA 2PLNA 3KDAA 3M33A 2YZ7A 4YO8A 3K7EA 2AUTA 4OUDA 4Q9DA 4LJLA 4RKFA 4RMHA 5DNDA 3ULKA 3BZWA 3ICCA 4Q7JB 1CJMA 1U65A 2PA3A 2VEOA 3L0IB 5C3UA 2K87A 5FI1B 1U2RA 1GFIA 2DVMA 3QP9A 3SC2B 2ZRHA 1DCKA 3AF1A 4BBJA 5LDDC 2ZI9A 1ZGCA 1TJYA 2WKPA 4NEHB 3M82A 3H04A 4IL5A 3R5TA 4CV2A 3OURA 3IAM1 2WUEA 3EXHC 3HXLA 4FOTA 4DGSA 1PRYA 5IX8A 4RE5A 2GEFA 2OC9A 1IEXA 3OZTA 1QX3A 2B8NA 3ND8A 4ZANA 4KQGA 3HCFA 4QQFA 4V0MA 2R8PA 5TARA 4AN1A 3AG6A 1VCIA 3D43A 4NQRA 4OFXA 4JI6B 3UCXA 3RV4A 2WY2D 3HKCA 3L8ZA 4DUZB 4G26A 1U98A 1V8PA 9MHTA 1OT3A 1T29A 3ABQB 3WO1A 3EZLA 3THXB 1UBTS 1OREA 4QPNA 4JX9A 5SY4A 3TNYA 3TR5A 4KPYA 3O1HB 4KQCA 3LLSA 2AFHA 4GMDA 1RPAA 1YI0A 1AU9A 2MINA 3KE9A 2WSSA 4TQUS 4PE5B 2V7PA 3R8XA 1CUCA 3U4CA 1W47A 2EFCB 2J0VA 1JIQA 1KS2A 2PLRA 1XVVA 2PSDA 1TL7C 4AJJA 3JR7A 3AINA 1M5TA 2V3WA 2YJGA 5TPWA 4AXXA 5INTA 4PICA 4WJZA 1GUBA 2QSJA 2ZI5A 3B9BA 4X7BA 5IBPA 2I87A 2QHXA 3LXXA 3DQZA 3PRYA 1BGXT 1HK7A 2F1KA 4IHJB 3GLGE 3QWBA 4QE3A 4MRSA 1WCV1 2A1UA 2FJ0A 1X87A 2Z2KA 3A8TA 4PQEA 1PN3A 1RDFA 4D9HA 1OFVA 1VIMA 3H86A 4M8LA 1DIRA 5FEUA 4E2ZA 1NM5C 4BTLA 3VR2D 3W1VA 2A5DA 2DSNA 4JLMA 3PYXA 1NV9A 3OCXA 3WYDA 5FL7D 2A0YA 3V8PA 3H11A 5KOJA 4FYVA 4N47A 1WS6A 3PDIB 5DTJA 3LX5A 5BMVB 3M9XA 4PZPA 3VO8A 5HKAA 1KR5A 1PL0A 1YOVA 4P7GA 4W5QA 2YNMA 2VR1A 1MJGA 2YBEA 4QWMA 3EEIA 5LP6A 2DERA 3ND7A 1T0JB 3N5KA 4X41A 5IPFA 4E46A 2JAUA 3IBGA 3CT4A 4N5IX 2V1UA 2WFAA 1NSTA 2D1TA 2XEDA 4GMXA 4WKOA 1LPMA 1W75A 4L73A 1YB7A 2PJUA 4PVDA 4S24A 1S6YA 2FGKA 4LCJA 4NYJQ 2JVJA 1QK5A 4DRXB 2NZUG 1IHPA 1SUEA 3KYCA 1FYVA 3O2QB 4GHWA 4OA5A 2FQQA 4LHSA 2CCKA 4QSHA 2BUBA 4Z4CA 3DG9A 2FFHA 3VTKA 3CVXA 3HJFA 2RI0A 1MV5A 2WPDD 3I5AA 4M22A 1D2EA 4AZVA 3CZ4A 5B64A 3NHYA 3UUEA 3X1XA 1V41E 4K46A 1MEJA 3GAFA 3SLKA 1Y6JA 4UTVA 2PE5A 3PHIA 3ZZTA 1WIWA 4J2HA 5F21A 3TRFA 1SCUB 2Y1KA 2GXQA 4ENRA 1CG6A 3J80A 1BXGA 3GFPA 4B6RA 7ADHA 1JA9A 1X94A 3X44A 4YUZA 4TYQA 3MAGA 5AOVA 4G84A 1PFGA 2IEAA 3B7GA 5CBKA 2ERXA 5FA8A 1D0SA 4RFSA 1NXTA 4C7JA 3HEAA 3DEZA 1I1OA 2Q8QA 3R5HA 4XOUA 3R0QA 4XQCA 1J7JA 1VGQA 2R6CA 2IL1A 3JQAA 3MYYA 3PQFA 4J0IA 1FLAA 2EDCA 2VJPA 2NM0A 3E0QA 3FGPA 3IJRA 4GI2A 4LXTA 3IEVA 3OKAA 4D4MA 2X3FA 3E81A 3EUFA 3H1EA 3IUBA 2A6PA 3WTCA 1GUYA 3QJ5A 4A03A 1OGIA 4BVAA 3W04A 4XTCS 2X7JA 3LBHA 1Q0UA 1LQUA 1WXQA 4ER3A 4CQLB 4GT1A 4MYDA 2CKDA 4OXKA 5EIAA 2P2YA 4OGGA 1YFZA 3IHLA 5BRNA 1A7JA 2QP4A 3INGA 3K09A 2H51A 4IEFB 4MB6A 5ALMA 1GTSA 3TECE 2XF2A 4HXYA 3UAXA 4UVGA 2ZIAA 4F4FA 5L3QB 3U6KA 3BE8A 3LPNA 4G56A 5LZ7A 4XJVA 5DNAA 1L5HA 6NULA 1OR8A 3FF4A 1V3TA 1EUDB 4I2VA 5BW5A 3RRBA 3EUEA 2WPNA 4JZKA 4X6YA 4QOIA 3CN7A 1ORRA 3EQ6A 3G5MA 4MS1B 4AN4A 4P6VF 6LDHA 2BFCA 3IAEA 3FOCA 2IITA 3BL5A 4JC5A 1PWEA 2H29A 2FJUA 3KKKA 3VR3D 1GAWA 1HPLA 4CFYA 4CUJA 1EIZA 2P9TA 1XMQB 1OA0A 2ODQA 2PQ2A 2QN6A 3CNLA 5IM4A 2ZFUA 1D7AA 3R5FA 1NPDA 2M6KA 8OHMA 1L7EA 1CRLA 3HU2A 5EUBA 5HOQA 3CUTA 3RREA 3RSSA 2J5QA 2WAXA 1LWOA 4Q9AA 5IKXA 3U09A 3HP7A 1UPXA 2F7SA 1NFFA 4E5NA 4NBLA 5CFLA 2B0CA 1RRGA 5JC1A 1K6JA 4UREA 2AC2A 3E1SA 3HKDB 1ZC4A 2E21A 1QHGA 2WYOA 1TEVA 3DJFA 3DCJA 1H23A 5FPQA 1WUIS 2INGX 2Q9AA 3BHJA 3MT8A 1TUBA 2AG8A 1N2CB 2PEYA 2X8JA 3PRJA 2I71A 5COBA 1W5FA 4AJOA 3S2IA 2VPTA 3CRRA 4UW9A 1E6KA 4YP0A 4IQ0A 2DLCX 2YZNA 2O5VA 4YJ3B 4QARA 2EARA 3O4HA 3T4XA 4J0EA 3N2KA 1XALA 2CJFA 5FHQA 3C4VA 4H35A 3WK4A 4RKQA 2CXTA 3U0VA 3R6GA 3DL4A 1EM8A 1GNQA 2WJ3A 1YB5A 1W4RA 5BSFA 2Y77A 5B36A 3IQFA 2Q5OA 3FUCA 3QBTA 2CVOA 2OV3A 2W6JD 2R47A 1F0KA 3A9TA 2YV1A 1D2RA 1LVHA 3CX8A 4L4XA 2H63A 4EENA 3CJRA 1RHRA 3U4MA 2JJYA 1IN1A 3UPDA 1AVTA 1GR0A 4TMYA 1XZAA 2A0WA 3DMDA 1YDFA 4LXGA 4V38A 1ZWKA 1JEQA 5C34B 4JIMA 1OZHA 2FZLA 1Z5ZA 4WLOA 4PTYA 3S3TA 1AUXA 3PT9A 3MAJA 4QATA 3F4BA 2AKYA 2QN9A 3M6FA 4Y9TA 3V80A 1NYLA 1QYWA 4YXFA 4AY6A 3UBTA 3SEQA 3D5TA 2ZJZA 4L3OA 1TMKA 2CVHA 4QEKA 4B43A 2WIKA 3E5NA 4CLEA 1IY8A 2YXBA 3KKZA 4MQ5A 4TOIA 4HQ6A 3ZWBA 4EI9A 2VF4X 3CHYA 3MCAA 5D1NA 3NBXX 1SCNE 2XQFA 1ID1A 1IL0A 2NLOA 3SJBA 3VU9B 3TOZA 4YXWD 5AM2A 4P8RA 5K6AA 2E4ZA 4LOJA 1D03A 1ZD1A 4KG7A 2JFBA 5A6VA 3PIDA 1JZTA 5JAPA 3ZBTA 1BC5A 2GLUA 1P9OA 2IIQA 5HUQA 3FZQA 4F97A 4FXOA 5G2OA 3GJSA 5HIJA 1T36B 3RRJA 3GYBA 4C7BA 1FMTA 4FHFA 3KTDA 2XY4A 4NL4H 3GLGB 1JR4A 2PKYX 1QGOA 2IHZA 2XMBA 1D1SA 3GN1A 3MC1A 3SLRA 2IH4A 4UVEA 5KYYA 4MV4A 1SUDA 4U2BA 4FB4A 2IYNA 4ZCIA 3W79A 5D51S 5AOBA 3M6AA 4E94A 3GVPA 4HG2A 1JBEA 1QV7A 4G5OA 3AP1A 4J75A 4V1CB 1JAHA 3BWEA 4GL4A 3VNVA 3PDWA 2BTOA 4C0XA 4WOBA 5DPMA 4EFNA 4B4OA 1OKKD 3CWCA 2EBWA 1SD1A 2YWJA 2P9GA 3FPHA 4LVCA 2FLWA 5HQ3A 3AX6A 2FSIA 2FHSA 5FWYA 1C29B 3IAHA 2NPFA 4B33A 3AZQA 1OWLA 4GLLA 3RSGA 1JDZA 4RA9B 3I01M 4FFLA 2BRUA 1LGYA 2QXYA 1PO7A 2JD0A 1EPUA 1G98A 4YFVA 5CYGA 1NXSA 3EXG2 1NZJA 4D9IA 3UGQA 3DYIA 2JIMA 4LI3X 2QRGA 3AHCA 2EBFX 1KBZA 3GFFA 5EA2A 5FH9A 2E49A 1RBYA 4U2GA 5TVGA 2R6FA 1SHLA 2FK7A 2F8TA 1OAOC 2Q1SA 3EG9A 3JARB 2IUSA 2ZQ5A 1UC9A 5T4HA 1JJ7A 3ILYA 5HZGA 2G0TA 3AF2A 3RBVA 3TIFA 2CZCA 5E4JA 1T4GA 1UKZA 2HFKA 2HQ1A 3AHIA 4PO1A 2BLLA 5G40A 4DYDA 1Q6YA 1J06A 2OHFA 3G2MA 4JL8A 4L9WA 3IE0A 5K3AA 1X42A 4DY6A 4QD3A 4EHIA 4F6CA 4H0CA 3PXBA 4CQMB 2WWRA 5CM9C 3P9RA 2X5JO 4MP6A 5THXA 2R751 3KWLA 2ZRAA 3S1AA 3EXFB 3OLXA 3R0XA 3LX4A 4FFMA 3R7LA 1CDZA 4BMDA 3PL5A 2X0RA 1MXFA 2Z95A 2GOYA 2V97A 1E3EA 3VKWA 4PZZA 2BBWA 4DJAA 4MTCA 3A3KA 2HA6A 4EGJA 2J9FA 2YIJA 2IBSA 3BWXA 1AB6A 2I3ZA 4MVJI 3HJUA 2PM8A 2W22A 2Q45A 4B34A 1M8JA 2ZGVA 3X1YA 1VOTA 5DXAA 3QF4A 4CKBB 2LIPA 3FPKA 1ZOSA 3E48A 3Q6NA 2FRDC 2ZBUA 3OJCA 4LJ9A 4NS4A 1YS9A 3RVMA 5JLAA 3O31A 2IPXA 5LYJA 2GX6A 3UB4A 4XWTA 4RD2A 1SCDA 2QR2A 2HA0A 5AJVB 3VX3A 1S8FA 2WMYA 4JWTA 3SR4A 4RJKA 3KHTA 3RB8A 4M53A 1X0XA 2CT8A 1S02A 4RY9A 3Q3HA 1NHWA 3PZRA 4R51A 1SCKA 2REOA 4V3CA 1D2MA 4BZWA 1EWQA 2QF7A 3RHTA 4GBJA 3PTLA 3WLKX 3DEJA 3MOSA 4U2KA 4UNSA 1CKEA 2P2DA 3KEOA 2W0MA 2C98A 1JF8A 3TDMA 2FOLA 4OHFA 3ZCTA 1XKQA 3HCBA 1QJ4A 3DMFA 2O23A 3NHRA 1EXNA 1FMCA 1QIGA 4MINA 3AHHA 3QELA 3KJGA 4HUQA 4OVKA 1TT5B 4K9KA 4EEXA 3ONVA 3AESA 5BW8A 1JHUA 1HURA 2EJVA 2RGBA 1WW8A 3AUUA 5BYKA 5K0JA 2O8CB 4R8SA 2IEYA 1DP4A 1L7QA 1VC2A 1EAMA 4J29A 5IP5A 5I51A 2FN7A 4URXR 1MVNA 4K6CA 2CL0X 3RJ5A 4KQKA 4S1VA 5AVXA 4G0VA 5JJKA 1L3CA 3QOFA 1HRKA 1JSLA 3DH0A 3JRNA 1M0EA 5IT0A 3TDNA 3BQ9A 4IOJA 4R8RA 1FCJA 1GG2A 1YE3A 2XWJI 3TXYA 3W5HA 1UMDA 2AFIB 2UYGA 3DAFA 3KSZO 2OCGA 5LQAA 2YS6A 1IG0A 3WV5A 2NXJA 5EQJB 1GYRA 1NY5A 5DOVA 3ZCQA 3O26A 2O8FA 4CF5A 5IDXA 1HY3A 1UM8A 1Z0KA 1IB6A 4DCJA 3HR7A 1GG8A 2HGSA 3FYSA 3NQ41 2OQ2A 2QGFA 2WP8J 3FPCA 3OIDA 3V1UA 4CNBA 5BPFA 2Y0DA 5HBRA 3Q6IA 4KH1A 3OTOB 3V7NA 4PLHA 2HRRA 3VKHA 2A5FA 4BO0A 1GGFA 4O4IF 2DQSA 1AA6A 5EN4A 1ZXBA 3DBHA 2NO6A 3WZMA 3NHKA 2LWIA 4L5IA 2JF0A 1EBUA 4BNWA 3ZK9A 1X86B 2GBPA 1PQWA 2UU9B 1U63A 1YK1A 3ECAA 3GJQA 3PL1A 1OXMA 1Z4MA 2VHQA 5ALGA 2ETXA 2EKLA 4QG7A 2AFHB 4JMPA 1CSEE 3A6KA 4CWAA 4EG4A 5DSXA 4LDJA 2V7XA 2X9VA 5BN5B 2LDBA 2LRHA 5IG2A 3NC0C 2V0GA 2V5VA 1HDCA 5EXSA 4BE4A 2ZS9A 4QFMA 2O57A 1T9HA 3IOEA 2XW6A 2H5JA 4ZYYA 2HBRA 2J3LA 1HSOA 3ZKWB 5LZ9A 1QRRA 2QP3A 1G3QA 4R8KA 3I5MA 5ELLA 2L82A 1GKLA 4CKYA 1SC3A 3R0JA 5DM70 1RD4A 4R2IA 2UYQA 4UTXA 3ESRA 1RTTA 2XOKA 3EZ7A 2FETA 3FSGD 3MT9A 4GPIB 4N5HX 3U3XA 1C3OA 2SHKA 4J7UA 4ARBA 4DM4A 1DRKA 3JQBC 1RQLA 4AKSA 3H2KA 3LRXA 2MTBA 3KJZA 2LZ0A 1FJ2A 5AYVA 1IG3A 4BNDB 2YZ2A 4RLQA 3CLHA 3G1TA 3GJZA 3ET5A 4GI1A 4BLRA 2AWOA 3WGVA 4DQLA 2V98A 2ZRGA 3PNSA 4FN5A 1TJ3A 5E6RA 3RSHA 1GPDG 2ECPA 2UUOA 2BHSA 5EPUA 5F73A 4BWGA 3A2LA 2EKQA 4HFRA 4I3HA 5FI3A 3HJBA 1V5FA 1DO2A 2Q49A 4ZOBA 1XL0A 3SXJA 3FX2A 1WMBA 4C4XA 4B79A 4GLJA 2QM3A 3WADA 3K05A 3OKPA 1AKRA 2HJ9A 1I94B 3TE6A 3OOWA 5B57C 1RYDA 1MQSA 4LBVA 1DS6A 1KFBB 4Q66C 1A3CA 3WGTA 3HMQA 4XM0A 5IMBA 1W85A 1PJ3A 1ZMBA 1IXZA 2E5FA 2JAQA 3H5LA 2POQX 4Q0MA 4ZJPA 3HG7A 2HBQA 2EW2A 2HA2A 1JS1X 4N4AA 3GPCA 3IKJA 2AWNA 3GX1A 3T7EA 1S7GA 5J1TB 4FM9A 4DR6B 1CUFA 2Q6VA 3CKMA 1U5CA 4OAPA 4WNAB 5JVDA 2GRAA 3DEYX 1VL1A 3HWRA 3D8BA 4JBXA 4LZNA 2SBTA 2VLBA 4FINA 4Z86A 3SX2A 4BNVA 3W9YA 1SRRA 3PKJA 1D0IA 4QUDA 5DT2A 3RRFA 1M2NA 3IQGX 4R1LA 5BOVA 3TBKA 1E3WB 1QIKA 3UK0A 5JQGF 1G3UA 2ZSUA 1NOJA 3RR2A 4FYXA 2PPVA 3K30A 2Q3EA 1KZ6A 2JLQA 4NAHA 4Q48A 4TWAA 2FQ1A 4QJBA 4B7UA 1HUQA 1KMQA 2BUCA 2AX4A 3OI7A 1R0XA 4G23A 2WLSA 3T5DA 2F4VB 4CHTA 3V9PA 2FR0A 3DHWC 2ECFA 2CVQA 3PXCX 2J85A 3E70C 2M6LA 2VUTA 1TO2E 2FFBA 5A4FS 5JI3E 1YQUA 1ZUD1 3B1VA 3N2YA 1EFKA 3HDVA 1QIEA 4EJSC 4OGLA 3RM3A 3TW0A 3FWKA 1T1IA 2YWBA 4ZQGA 1JZQA 4J90A 4K6GA 3QKSB 2M9MA 2VP2A 1IN5A 3C3BA 4B44A 5KSPA 3ZCUA 3FPJA 1LNQA 5DF1A 3T3EA 3WLIA 1HNWB 2ATIA 1REQA 2REQA 3X0DA 1M2KA 1VIAA 2C4VA 4EUEA 3LT1A 1L5HB 1T5SA 1OZFA 3TMYA 3IP8A 4RGYA 1P1HA 4DA4A 2WTXA 3GO4A 1DEOA 1XLWA 4MWTA 5M7EA 2WV7A 5IDWA 1MR3F 3QLVC 5A0FA 3EXG1 5KDLA 3TD6A 2GEKA 3S5JA 4Q7QA 2Q2NA 4BEJA 3O3MB 2BM0A 4QXMA 4ROTA 2G9QA 3AL0C 3LFHA 4M7OA 3PXDA 2HMTA 2P9FA 3GZNB 1EFVA 3LJKA 3NGMA 1FRFS 2PZ8A 3P2IA 4PZYA 2K7FA 1T5BA 1RQRA 3V1MA 4U7FA 1NZFA 5FXMA 3MMPA 1L4GA 3L7AA 4F96A 5LMCA 2B78A 4QA9A 3ZCVA 3HP1A 1AQYA 1T2FA 1DNPA 5AVKA 1E1MA 5FBZA 3MEQA 3RIEA 2D7DA 3INRA 2PX5A 2PKCA 4TMKA 4XYGA 5BQ3A 1H66A 3RT1A 3KZKA 3UF0A 5C51B 1GNVA 3GPLA 2Q50A 3MGKA 3WMRA 2NUAA 5FWXB 3VR6A 2CFCA 2VRNA 1V7QA 4RTSA 5IYZF 3DDCA 4RACA 2ONCA 4HXGA 1VCOA 4KIJA 3R9IA 4LHWA 1E9RA 4XGQA 1G20E 1L5RA 3N2KB 1LS6A 1CEEA 5KPJA 5C4IA 3AB3A 4R3UC 2VXYA 1Z6QA 3OM8A 4H9GA 3PI7A 2MYNA 4G24A 2V6GA 5ALTA 4QZVA 4P4GA 2CVZA 4O33A 1NNSA 2VHXA 4TWIA 4UCXA 1M10A 1RLUA 5CH5A 4FS3A 1AIPA 1SA0B 2EF0A 3L02A 1K3TA 1H2BA 1O89A 4BN4A 2FPRA 4G1UC 4EZIA 3E1KA 2H1CA 2DB3A 1F2VA 2O8BA 1LS1A 4FDAA 2NV6A 2ZBFA 1F9EA 4ZRDA 4EVIA 2WFLA 3G88A 4NEQA 2X0JA 4YJHB 4PNEA 1XFAA 1Y3DE 1JHMA 4HOYA 5JHHB 1J9GA 1OSNA 4D3ZA 3TO5A 4A2CA 1H9AA 3DCYA 5LZ2A 3F3YA 2IV2X 4UM9B 4LC9A 2AR9A 4WK6A 4D41A 3OIGA 4LCBA 1RI2A 3ELBA 1FSFA 2QAIA 5TXGA 3HDTA 1YK0A 4PSKA 1VIVA 5EMNA 4QASA 3RF7A 1U5AA 3V4LA 4DARA 1EXMA 3HUTA 4A8JC 3E82A 4XM2A 3I2FA 1BE0A 1DOZA 3AVQA 3E5HA 5JO9A 3E84A 2AEMA 4L0DA 5EPOA 2ZJ0A 5ILOA 1Q0LA 3D0KA 1PQUA 2UUAB 3FI0A 2B5WA 3UJHA 2Q2WA 4FR2A 1GPH1 4R1UA 1MHPA 2Z4TA 1FUEA 2AXNA 4HNUA 4PTLA 1QTQA 3VH1A 1Z7YA 2OL4A 2I7XA 2IP2A 1QRDA 4I55B 4IYRA 1PSWA 3MB5A 2EXXA 4S2EA 2D2IA 4X65B 3WGUA 5GWXA 1FRZA 3ICQB 4JIGA 4PS0A 5EIXA 1X2BA 1ZDMA 1Z4NA 3ZGOA 2W11A 5GONF 3A25A 5C7LO 4RELA 1WMDA 4HS9A 4FYYA 2PUEA 4D7AA 1IQRA 1I6WA 5CFRA 3QMVA 2BIFA 3B8HA 3R74A 1F0PA 3WWYA 1R4AA 5HBGA 3BUSA 3NWBA 4M1KA 4QU0A 5I01A 3A4VA 2W5UA 3HR8A 4N7MA 3TOVA 5BSMA 4BX3A 5FOUA 2J45A 4FCTA 5ANRB 4F6RA 1E1RA 4NPHA 5FBRB 5CA0F 4F3RA 3ZIUA 1D2AA 1RMYA 2J67A 5JI2E 2AZ4A 2BGJA 3BERA 3OETA 2I65A 2A58A 2CMKA 4CBVA 4DEXA 1G7CA 4UOEA 1AV6A 4BNUA 2YHIA 1TEZA 1JUDA 4YRTA 2BY4A 1VE9A 5CLIA 1KJZA 2OFFA 4UEJA 2QP9X 4WZBB 2HF2A 3NHWA 4CFZA 3S7ZA 1I7PA 1JKIA 3FVTA 2C0PA 2RK6A 4ZI7B 3SI7A 2ZIVB 1N2XA 1XU7A 1MF7A 4BGIA 1Y5NA 1DKUA 5BQOA 5AW0A 4C29A 4QLBA 4UE6A 3EDYA 3CMMA 3OEWA 1J42A 1RMQA 3RG8A 3RS9A 1T9AA 2WMNB 4P93A 2YWCA 1N0HA 4DV0B 1OAAA 3BXOA 3SK0A 2FP4A 4BO8A 2Z9CA 2FUNB 1SHZA 4TYYA 1K6IA 1SOWA 1K9VF 3OIWA 4FLMA 4LMPA 3KFVA 3PPIA 3LSYA 3NIWA 4DJEC 1EJ0A 2WKWA 5I8PA 2QBYA 3FCSB 1F1BA 4Q7LA 2F48A 1YS7A 3DO5A 4S1NA 4BAUA 3WI7A 4Q9LA 1TM7E 1WRBA 5LQRA 1LH0A 2GYWA 1CIVA 2I2CA 2I22A 1E5QA 2PGLA 2H85A 4IOKA 1RBQA 3K1AA 3L1VA 4QPJC 4XQ0A 1XZGA 5K3OA 1KEUA 2KHZA 1M2GA 1L6IA 2K5UA 1NULA 2ACEA 3F3MA 3TKAA 5LBTA 3TQRA 2RJNA 1ORWA 1OBVA 4AMGA 2Y0CA 3L07A 2HN9A 2CMFA 4WPGA 5C8YF 4KQ1A 3MUEA 1G3RA 2GI4A 2A9VA 3DMPA 3N53A 1CT9A 3G8AA 1A9XB 4YWHA 2I0FA 4KWHA 1XTSA 4P7JA 2BZGA 4DQXA 5CH3A 4GEKA 1OH6A 3O90A 2X5NA 4B4DA 4BWYA 3F6RA 1PJRA 1N5DA 2A5JA 2VI5A 3H1FA 1AGPA 2PUVA 3REFA 1KTVA 4QJ4A 5TF0A 1GYPA 4OSOA 4AJKA 2FPGB 4A2PA 3JD2A 4IJWA 1JU4A 3HA7A 4KXYA 3NATA 4UD6A 3BGVA 4J2TA 4R3WA 1FYEA 3Q0TA 1NOIA 2BGNA 3KOYA 3UW1A 3UWDA 4PAOA 5ICEA 5F77A 2DKOA 2FR8A 3C3EA 3F7TA 2WWGA 4MGZR 1X1CA 3ZDAA 4B3MB 2CD7A 2QL6A 3W6PA 2CNBA 4YI5A 1KMHB 1E3LA 4MVJD 5F7OA 1NUTA 1KOJA 1OJLA 3DP7A 4KL8S 4PQFA 3I1JA 4OP3A 3DZKA 1GLVA 4HN2A 1TJPB 3O7MA 2EC5A 4KHZA 1QANA 5E4TA 4BLWA 1N6RA 2BGLA 2RC5A 1A4RA 4OJKA 4PRZA 3GJTA 1GPUA 2JJ1A 1LFDB 2BSQA 2A86A 3FDJA 4CMIA 2ZG6A 5G0VA 1US8A 2H2DA 3K1ZA 2OCBA 2GF2A 4HTAA 3EXIA 4AS1A 1FDIA 1PR9A 1VP9A 3LCMA 4Q4AA 4IF6A 1V8DA 2I1QA 2DHDA 2PUWA 2W6OA 4U63A 2HU2A 4R81A 5DHTA 4CLDA 2XQKA 2GN9A 1IK4A 2G80A 3FNRA 1M2OB 1MOSA 2DX7A 1UKAA 4KBFA 3UA4A 1W4BA 4CQJA 1LJUA 1XL1A 2HI0A 4GGPA 4HDRA 3R7WB 1P0MA 4UAGA 1RM5A 2XBMA 2IHJA 2Q9CA 1DPGA 1N3BA 1G20B 3QVVA 3IE1A 2JGKA 1I2ZA 2H52A 2HKIA 2QN2A 3ZGZA 2XT6A 4Q3DA 3NJ8A 5EFOA 4X7MA 3TXAA 3WLNA 2P9QA 3SU8A 3VR0A 4IGKA 3BMQB 3P2OA 1NN0A 3WGQA 3LY8A 2R6GA 1IN6A 1ZMTA 4LW8A 3QWIA 3NVDA 4G0ZA 3L3BA 3ZYZA 5CBPB 2XV1A 3ISVA 5ENZA 3ZIDA 2VYQA 5CTJA 1S1CA 3ON5A 2B4QA 1FYDA 3COJA 3MS2A 3VO9A 1VI5A 3IMGA 2O1WA 5BO5A 4Y2YA 3PUHA 2R87A 1ZRHA 4MVJG 4Z1MA 2AV6A 4RY2A 4C20A 5HRAA 1ZEMA 3HUDA 2ZYUX 1M9NA 3CLTD 1BE6A 4BGDA 2I91A 3K4HA 3JASA 1WW3A 3MMXA 4JP3A 4BMCA 2ACWA 2HD4A 1FC0A 1N6HA 3A1WA 5EUQB 4P0PB 3HUFA 5EJAA 1IXYA 1N7GA 1NXWA 5LB4A 3GMSA 4MRMA 5DBFA 1OAKA 1PJAA 3NWJA 1LA2A 1BMQA 4O4LA 2OD2A 2JJ8A 1T4MA 2C9ZA 1FZQA 5HIKA 1MO2A 2QQGA 2LXNA 2PVPA 1KQNA 4G9GA 2IY9A 3RYHA 2AXEA 2ZTMA 4PXSA 3HP4A 4MMXB 5G1OA 4IJUA 2WSMA 5EMKA 2XR1A 1J0EA 4L9SA 4YS6A 4K9QA 5CFZA 1G3MA 5IT9A 2NUTB 3ZHXA 3KU1A 1JDBC 4RV5A 3RARA 4BEWA 5B2EA