4PIPA

Engineered egtd variant egtd-m252v,e282a in complex with tryptophan and sah
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
316
Chain Sequence
b'LSLANYLAAAAEALRRDVRAGLTATQKSLPPKWFYDAVGSDLFDQITRLPEYYPTRTEAQILRTRSAEIISAAGADTLVELGSGTSEKTRMLLDAMRDAELLRRFIPFDVDAGVLRSAGAAIGAEYPGIEIDAVCGDFEEHLGKIPHVGRRLVVFLGSTIGNLTPAPRAEFLSTLADTLQPGDSLLLGTDLVKDTGRLVRAYDDAAGVTAAFNRNVLAVVNRELSADFDLDAFEHVAKWNSDEERIEVWLRARTAQHVRVAALDLEVDFAAGEEMLTAVSCKFRPENVVAELAEAGLRQTHWWTDPAGDFGLSLAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine-specific methyltransferase EgtD
publication title Ergothioneine Biosynthetic Methyltransferase EgtD Reveals the Structural Basis of Aromatic Amino Acid Betaine Biosynthesis.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 115
structure length 316
sequence length 318
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.44: L-histidine N(alpha)-methyltransferase.
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10017 Methyltransf_33 Histidine-specific methyltransferase, SAM-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pipA01
2I7CA 3BKWA 2UZ4A 5GWXA 3R9XB 2ONZA 3JWHA 1RJFA 4QPNA 1D2GA 1HNNA 3NWBA 5DT2A 3TMAA 1XVAA 5BXYA 3THSA 1VE3A 3A7EA 5EOVA 3EVBA 3P2IA 2PT6A 2YUIA 3EVDA 5HIJA 1TPYA 2DULA 4AZVA 3VYWA 2CL5A 2ZULA 4KW7A 3FRIA 4KRGA 5EHIA 5HILA 4MHTA 2PXCA 1NE2A 1NV9A 2OY0A 1IM8A 2XYRA 3G8BA 3P2KA 3ELWA 3OZRA 5DX0A 4ZTBA 4DCMA 5HIKA 10MHA 4HG2A 4C08A 5EKXA 3E7PA 3LGAA 3NVMB 3R6TA 4IV8A 4EKGA 3LCCA 1P1CA 5DM2A 2FHPA 4E30A 2AZTA 3K0BA 3NDIA 2QE6A 4G56A 3GRRA 2PVCA 2AOTA 5T64A 1SVUA 2PY6A 3I53A 3PS9A 3FRHA 1ZHFA 3PB3A 4POOA 5BW4A 2P7IA 5K01A 1NW3A 2NXCA 2IPXA 4PCAA 3BXOA 2ESRA 4YUWA 1SKMA 3TRKA 3LBYA 5K0JA 2K4MA 5LSAA 3BWYA 4HSGA 1JQ3A 3FUUA 4YUZA 4DA4A 2PBFA 2QY6A 3HA5A 1N7JA 1RI4A 1KIAA 1HMYA 5CCXA 1KYZA 2JHAA 2O06A 2VZ9A 3A7DA 3FPHA 3D2LA 4RVHA 5CUQA 3SSOA 2FRXA 1YZ3A 5DWQA 2ZZKA 4K6MA 3NVKI 5DTRA 3BZBA 5F2NA 2AOUB 2R3SA 3FUXA 5FQOA 1X1AA 2CKDA 5BP7A 1XCLA 3EPPA 3CKKA 4U7TB 2VDWA 3G88A 3GDHA 5EIWA 4CXMA 2Y1WA 1BHJA 2ZZNA 3ELDA 4RV9A 3UJCA 4EK9A 4FT2A 2IH5A 2NP6A 2Z6AA 1EG2A 3MAGA 5CVJA 3FZGA 2PKWA 2VDVE 1VL5A 3HM2A 3PFHA 1I9GA 4MIKA 5DM4A 3GNLA 1ZKDA 1ZG3A 2NYUA 3BGDA 3GRVA 2I62A 3B89A 3JWGA 4MTLA 4C05A 4FT4A 4X63A 5EIFA 5K0FA 2BM9A 2HWKA 3PX3A 4FGZA 4CKCA 2NXJA 1JSXA 1YB2A 2OB1A 4CKEA 2AN3A 4BP1A 4EMSA 3LECA 4GC9A 3FYDA 3KR1A 5LQKA 2ZIFA 1ZQ9A 2GH1A 2IIPA 1D2HA 3EVEA 1NW5A 5HOQA 5E1OA 5E9JA 5LQNA 5DTMA 5CM2Z 1VPTA 4L7VA 5D1NA 4DCGA 4LWPA 3HCEA 2HNKA 3T7TA 2O0LA 5E9QA 1JQEA 1INLA 3GGDA 3BGIA 3FPEA 2ZIEA 2B78A 2OKCA 3ERCA 3LDGA 2Q41A 4X61A 1KPHA 3KQOA 1DCTA 2ZWAA 4RWZA 3UA4A 4YUVA 2PSSA 4Y30A 1PRYA 5GINE 3KQSA 3CGGA 1SUSA 1SQGA 2BH2A 4PYIA 3UJ8A 5FA8A 3BGVA 4H0NA 5DTQA 3KPWA 3MCZA 3LBFA 3BT7A 2BM8A 1QANA 4BLVA 1JG2A 4HC4A 3DXXA 3P9IA 1KR5A 4HH4A 1V39A 4HGZA 5G02A 3EVGA 5K0BA 4ER5A 3O4FA 5EEGA 3THRA 3GWZA 4EQZA 1WZNA 3BWMA 4QTTB 3SXJA 1EAMA 5EVJA 2PX4A 4RTKA 2P41A 1MHTA 1RJEA 3REOA 1R8YA 1UFKA 4EVIA 5KYGA 3DTNA 2OYRA 1O54A 2ZVJA 2PX5A 3FYCA 3LKDA 2PGXA 3DH0A 3GCZA 3NDJA 3KQMA 3KQYA 3P97A 3OZSA 4FSXA 4GBED 2EX4A 2VP3A 5HFJA 1T43A 4Z2YA 4PONA 2WA1A 4F84A 1B42A 2O57A 3LCUA 5E9WA 1QZZA 2XYVA 3FPJA 2G70A 4ER6A 2IP2A 2PWYA 4C03A 5IKMA 3G89A 3T7RA 5KVAA 4LWOA 3RIEA 3M6WA 2JHCA 4LECA 2IBSA 5K0CA 2EJUA 2ZFUA 2Z6UA 2O07A 1VP3A 3PFGA 2Y1XA 2JH8A 2IFTA 4GOOD 4QDJA 4Y2HA 5HIIA 4X1OA 1RI1A 4PYLA 5EZQA 3T7SA 3I5UA 5GP1A 4YV2A 4YV1A 5KQRA 3UBTA 5MHTA 2PJDA 1O9HA 3TM4A 2Z6QA 3PX2A 5T67A 7MHTA 5CIYA 2AOVA 4ATNA 4RTLA 5EKUA 2AOUA 5H02A 1FP1D 2GAFA 3G2OA 3OU7A 4OQEA 1QAOA 1WG8A 1Y8CA 3UZUA 2FK7A 2ZTHA 1WXWA 3EMDA 4PCLA 3I64A 4KDRA 5CVVA 5E2BA 2CWWA 2P8JA 3S68A 2IH2A 3DMGA 3G2QA 2G71A 2PXXA 2H11A 3KR0A 3UJDA 1P1BA 3LL7A 4PIMA 3CJQA 2BR3A 2FYTA 3C0KA 1XDUA 3KQTA 4JXJA 3UJ9A 3R0QA 5EEHA 5C0OE 3CJRA 1DUSA 3F4KA 2YQZA 3KPJA 4RTNA 3FTEA 3HA3A 4CTJA 4DQ0A 4GC5A 3M33A 2A14A 1YUBA 2IDJA 2QM3A 3JWJA 3E8SA 3I9FA 2XVMA 3M70A 1RJDA 3B3GA 2GLUA 4M37A 2ZCJA 4XCXA 4BY9E 2LD4A 1X19A 3C6KA 3ORHA 1JQDA 3R24A 2YVLA 1G6Q1 5GIOE 4MWZA 1L1EA 2ZBRA 1NV8A 5E8JA 3GU3A 5DXAA 1EIZA 2ADMA 3FUVA 3V97A 3UJBA 5BW5A 3EVFA 5K8VA 4E70A 3LCVB 4P7GA 1R18A 3EVAA 4PYOA 3UFBA 2PV0A 4XUEA 3NWEA 3UJAA 4PYJA 4RTOA 2AN4A 4M38A 4HRAA 3AJDA 5HEKA 9MHTA 3OFJA 3BUSA 5DM1A 5EMJA 2VDUE 1MJFA 5GM2A 2WK1A 2C7QA 2AOXA 4OA8A 4OQDA 2AN5A 5DRYA 4A6DA 5DSTA 4HTFB 5EQJB 3UA3A 4C04A 5GOZA 1VQ1A 3KQQA 3GRUA 3IEIA 1JR4A 3CBGA 4FR0A 2DPMA 4RVFA 4PIPA 4KDCA 3X0DA 3KPUA 3E05A 1JSZA 3BWCA 4GOND 1VIDA 3SVZA 1D2CA 3ELYA 3ELUA 3HCBA 1AQIA 3GO4A 4E33A 5LQJA 1G55A 1M6EX 2CMHA 1M0EA 3NMUF 3ANXA 2P40A 5DRTA 2B9EA 4P7FA 2F8LA 3TM5A 2YX1A 4DKJA 2G72A 3DULA 4CWAA 4RVDA 1L9KA 3OE5A 5E1DA 3ID6C 2BR4A 1YF3A 2NNWB 3NW9A 3TQSA 2NXNA 2NXEA 4FP9A 4M36A 2V7EA 3EEYA 5DXJA 5FHQA 5KQSA 1F3LA 5P8WA 2UYCA 1NBHA 3M6XA 2CMGA 2ZBPA 2B2CA 3U81A 2I9KA 2FCAA 4BLUA 4GEKA 5CVEA 2B25A 4UOEA 1G38A 2R6ZA 1UIRA 4P7KA 3C3PA 3P71T 2O05A 2UYQA 4ISCA 4OBWA 3KU1A 5DX8A 4FZVA 3I58A 3B3FA 4QQKA 3DLCA 3IHTA 2GPYA 5EGSA 1PJZA 3CJTA 2ZLBA 5GM1A 2YXEA 1R8XA 1YFJA 3CC8A 3C3YA 3MTIA 4PYQA 5CCBA 2ZWVA 2GA9A 4DZRA 3Q87B 3G2MA 3OCJA 1R74A 5FADA 2BR5A 4O29A 3EVCA 2OB2A 3P9CA 3KHKA 3TKYA 3MGGA 2HV9A 1ZGAA 3KR9A 5E1MA 5CVUA 3TPZA 3DOUA 2P7HA 2PLWA 3IYLW 4PGHA 5D1HA 4EKIA 3LKZA 4GOMD 5LQUA 4IWNA 3TOSA 4AZWA 3LX6A 4GOLD 3B5IA 2ORED 5FTWA 3B7PA 3FPFA 4P58A 1ZGJA 3EMBA 1IXKA 3DUWA 4FSDA 4OBXA 5E1BA 5EHGA 5FA5A 2JG3A 1X1DA 2QYOA 1X1CA 3FTDA 3IV6A 2VS1A 2ZW9A 2YXDA 3M6VA 3MB5A 4GQBA 3VC1A 2IGTA 1FJXA 1X1BA 2AVDA 4ER0A 5DPMA 5FWAA 3P8ZA 2YR0A 2IBTA 1U2ZA 3OE4A 3PLAE 1I1NA 2AS0A 1WXXA 5FUBA 1KP9A 1G8AA 3GRYA 1F38A 3TR6A 4U7PB 1RI3A 3G5TA 3DR5A 1WS6A 4AX8A 1SQFA 4HGYA 4R6XA 4QQNA 3P9NA 3M4XA 3SSNA 2JJQA 4KVZA 1BOOA 1NW6A 5K0EA 1FPQA 3A25A 5F2KA 3FTFA 3DXYA 3L8DA 1YFLA 4OX9Y 5CD1A 1FP2A 3TLJA 4E32A 3CCFA 3O7WA 5LQAA 1YZHA 3HCFA 2P3LA 3BKXA 3MQ2A 4E2YA 2ONYA 2EG5A 3C6MA 3KQWA 3K6RA 3O31A 2C7PA 1BKYA 5C1IA 2ZBQA 3M6UA 4WXHA 3UJ7A 2QRVB 4V0RA 5JUWA 1G8SA 2GB4A 1QYRA 2E5WA 4X41A 2IDKA 5CVDA 5ICEA 3SGLA 1P91A 3EGVA 1JG1A 4PYKA 2HTEA 4YUXA 3UWPA 4GF5A 4R8RA 5EMLA 3LDUA 2YXLA 2OBFA 1EQAA 3HVKA 4B17A 3VSEA 4CTKA 4HTFA 2AVNA 2YTZA 5DLYA 3EVZA 3RW9A 3HCAA 5ICFA 2G1PA 5JR3A 3E23A 5E8RA 2XBMA 2G8NA 2P3OA 3PVCA 3MERA 3B3JA 3DMHA 2AOWA 3ER8A 2OO3A 4PGGA 5EMKA 1VP9A 3HVJA 4PNEA 3PTAA 1ORHA 1NW7A 3G7UA 3ME5A 5LQRA 3OU2A 1XDSA 5FQNA 2XYQA 1EJ0A 3SR4A 1AQJA 1QAQA 1JG3A 5HIMA 3G2PA 4E2WA 2JH9A 3Q7EA 3AWIA 3BWBA 3G8AA 1AV6A 1NW8A 5FHRA 2JHPA 2P3QA 4KIFA 2H1RA 2B3TA 3AY0A 3KKZA 2HMYB 1JTEA 4GUAA 3LPMA 3HP7A 3HEMA 1R00A 1TW3A 5EPEA 3HTXA 4RYLA 4P7JA 4PYMA 1DL5A 3FTCA 3LSTA 3FUTA 2UYOA 3LHDA 5M5BA 4E31A 2ERCA 3NJRA 3V8VA 5ICCA 2AOTB 3QOXA 4M7RA 4YMHA 3VC2A 1L3IA 3MTEA 1QAMA 4PWYA 4C06A 3DP7A 5EZSA 2EJTA 1OR8A 2N47A 2NP7A 1NKVA 1NT2A 1O9GA 4MQ4A 1XXLA 4NECA 3KPYA 4QTUB 4R6WA 3LDFA 3P9KA 2XVAA 1IY9A 1RI2A 4FS8A 1P39A 3A27A 5LQCA 5GIPE 4RTQA 5HZMA 4C07A 4PYNA 4C4AA 4E2ZA 3WSTA 4YMGA 4XUCA 5FULA 1H1DA 1KYWA 3GIWA 5DX1A 1VBFA 4KWCA 4RX1A 5T6BA 1XDZA 1JTFA 3OFKA 4F86A 2C7RA 3OZTA 3OU6A 3RODA 1L3BA 3EEOA 5B1SA 2PWPA 2OZVA 1KPIA 1ORIA 3HA7A 3KQVA 3R3HA 1NBIA 5IH3A 4BLWA 3MHTA 4V0QA 3EGEA 4F85A 1VLMA 3HVHA 3JWIA 3ER9A 1BC5A 4QPPA 3GXOA 5EG5A 2PXAA 5K03A 3FPGA 3HCCA 3HCDA 4IV0A 3UJ6A 5FWDA 5K0NA 2H00A 2V74B 4QDKA 4KIGA 2AR0A 2ZZMA 5LR6A 3NTVA 3H2BA 5F2OA 1N7IA 5DM0A 5EMMA 2P35A 2ZIGA 4RTPA 1SG9A 4DF3A 2OXTA 4WVLA 4AUKA 4RTSA 3A4TA 1L3CA 5K0LA 3SX0A 4YUYA 2PT9A 5FCDA 5DSXA 2BZGA 3KQPA 2HR1A 3AXTA 2I6GA 3QV2A 4ER3A 4CKBA 2GS9A 4R8SA 4QVGA 4DM3A 4IKPA 4DMGA 3MCTA 4LG1A 5K09A 1KHHA 4A6EA 3DLIA 3TFWA 3PT9A 2OPBA 4E2XA 5K0GA 3TKAA 4RTMA 2QRVA 2WA2A 3GJYA 3SSMA 4RTJA 1WY7A 1SUIA 4ER7A 5E2AA 3HVIA 5KS2A 2EFJA 2KW5A 3HNRA 1RJGA 4R05A 1FBNA 3OPNA 4PINA 3SM3A 3SMQA 3T0IA 1N2XA 1UWVA 3DXZA 1XCJA 8MHTA 3FUWA 1TW2A 5U4XA 5C9ZA 3G5LA 2FPOA 1M6YA 2PX8A 3EGIA 1KXZA 3GRZA 1AF7A 1I4WA 3KR2A 1EJ6A 1KPGA 1JG4A 1Z3CA 1Q0SA 3KPVA 5ICGA 2ZSUA 2C7OA 5EC8A 4OA5A 2PX2A 4YV0A 3QOWA 4RSRA 3AXSA 4RTRA 1XTPA 4BP3A 4XUDA 3A26A 3P2EA 2P1DA 3DMFA 1R6AA 4QVKA 5K05A 4AZTA 4AZSA 2UYHA 4RVGA 4X60A 3CVOA 5ERGB 2IH4A 2FK8A 1RI5A 1Q0TA 1XJ5A 1G60A
chains in the Genus database with same CATH superfamily
2EWWA 4G5XA 4D1YA 3KYDA 3QBTA 2WG1A 1RJFA 1TJYA 4JUDX 1HNNA 5DT2A 2NUAB 1BHO1 1UDCA 5FRDA 3RWOA 2OG1A 2P9CA 2ZYUX 4R8LA 2B4AA 1DKOA 3WKCA 2PT6A 4JY7A 5KWSA 3UB3A 3OX4A 4FXPA 3WB2A 4F9FA 3BXXA 4ZU1X 1XE3A 4ZVKA 3B6KA 1XZJA 3P45A 2HMAA 1PSDA 2XYRA 3P1JA 4H7KA 1JHYA 3ELWA 1NDUA 3OFNA 3OTHA 4MRNA 4PLYA 4Z1MA 3WDLA 4CDMA 3E9EA 5G3ZA 1G8KA 1N0WA 1MW9X 4IJKA 4TT3A 2JHFA 2BN4A 1FRZA 1I0IA 2H51A 1M8KA 2JVJA 2BHTA 1O8BA 1SVUA 3K70B 1P44A 2OCLA 2HWXA 1ZHFA 4U7JA 3UT0A 1TT7A 3AY6A 1H3EA 1EUDA 5JC1A 2XGMA 1Z7WA 1A1VA 1GNLA 3LUKA 3WXBA 3GYBA 1OZ0A 5AVUA 5BYAA 1LRLA 5J4YA 1Z2EA 4D0LB 1D1PA 2G1UA 2PBFA 3BCRA 1N7JA 2ZRKA 1KIAA 1T8RA 2B1RA 2QG6A 5CUQA 3FPHA 5AW4A 2ZRHA 3UUEA 1BDMA 3I0MA 1NF2A 4QJ3A 5JSHA 3QVUA 5H16A 5JZOA 3OQMA 4Q9LA 2VF8A 1QFZA 2DETA 3HRIA 2YICA 1ONPA 1T15A 3QBEA 2F62A 4JC0A 4JLKA 1OX4B 4BXOB 2H0RA 4KWHA 1Z75A 1U98A 4MVJM 3MGBA 3EODA 3RH0A 1O5TA 4LYEA 3JD1A 3TEFA 5HF9A 1XPOA 2VXCA 1Q77A 3E3NA 2Q5EA 2RIRA 3K0AB 5CB4F 2XNJA 3CHYA 4I8DA 5TQ2B 4XWOA 4YRGA 3CTMA 3ND9A 1K97A 5EZYF 3WE7A 2BRUA 4TZ0A 4YH1A 4C88A 2G4CA 3UV3A 1FSPA 2PZ8A 3C7KA 1I8TA 2GTIA 4N8DA 1SHLA 2R6DA 4KAXA 1W9MA 4QUEA 3TE6A 2QEQA 4FEEA 4GSKA 3S5JA 2VAXA 5JRZA 2BEWA 2ZCVA 4I81A 1PUIA 4HAVA 2C54A 1VPTA 1W29A 4C7VA 1IMOA 1ZISA 2EAUA 4YEDA 3C5HA 5AI5A 3QFHA 2HK9A 3R76A 2O8FB 3UQZA 2QTVA 3KOUA 3L7DA 3OIFA 4V2UA 3AUYA 4MX8A 4O8CA 4R98A 1EXNA 4NY1A 2WWFA 3FZYA 2XCRB 2H4YA 3L4SO 3ERCA 1DUVG 3IAS6 5DCLA 4ZPXA 1NRIA 2NVWA 3EZXA 2ZWAA 3K0FA 4X5OA 4YUVA 3LXRA 1D8TA 3RDPA 2RCYA 1Y6ZA 2YWFA 1JFSA 1HK7A 4FWBA 1QDUA 1G42A 3TLAA 2VQ6A 3U3JA 3UPDA 1CY6A 3UCXA 3JRXA 3WJ7A 4WZBE 1ISHA 1M7HA 2A9FA 4YUAA 3LF2A 3EZFA 2BE7A 3AHGA 2BFFB 2NUTB 1QANA 4RMNA 3PT5A 3VSCA 1M1NB 4WFKA 4QT4A 4L02A 5JJCA 5KNCA 3QPUA 1SURA 2YINC 3DXFA 2H18A 3HJUA 3JARB 3WP0A 3WMFA 1ZINA 3OPXA 4F2PA 2GBCA 2H85A 4JXXA 1RQ2A 4MVJP 3VC7A 2QAGB 2IHJA 3TR5A 3EHEA 3IXMA 4N12A 4DM4A 4P9NA 1JKJA 1IWPB 1V6CA 2VCYA 2PX4A 4HNAA 5A7GA 2PZGA 1KI2A 2H48A 5CLQA 3R3VA 2N0SA 5FPTA 1V8OA 4M1ZA 1JQ5A 4BQPA 5ECWA 4TKUA 1BQ3A 4TRRA 2MSKA 1XBTA 3COJA 1XL0A 2FP4A 5JAMA 1L4EA 2A88A 1NRXA 4QM6A 2WD8A 1LI7A 5ALWA 3ILYA 4EGFA 2YQ5A 1GUYA 4MQEA 4TSRA 3F73A 1B42A 1RHQA 5I3ZA 3T15A 4CM9D 1QZZA 2C77A 2NTEA 2CUTA 1H94A 3CUTA 3MTJA 2W90A 5F33A 4CUZA 3DL7A 4N7MA 4HNVA 1CXZA 1OJLA 3JATB 3Q7TA 3VU0A 3HU3A 5BURA 2RB5A 4DIKA 3EDMA 2Y92A 3A2NA 4KBFA 5HPYB 1QPZA 1E3WA 1CDDA 2B1GA 1Y8QA 3G9XA 3GCDA 3IBGA 1XJ0A 4PSVA 4KXNA 2BFDB 4HGRA 3PQDA 4P92A 1G5TA 2CV2A 4AECA 4M1TA 1MAHA 1UZLA 4LZLA 4LHXA 3A2KA 3HCWA 4WLNA 4FTWA 2H7YA 3A9TA 2QM8A 3E58A 4PG8A 1GZ6A 5LYJF 2PUJA 1L4BA 4F3CA 2QG9A 3CYFA 3LZ6A 3TOZA 3NNSA 4OL0A 3ST7A 3ZOZA 4HYTA 1KI7A 2H11A 3EXIA 5CVCA 1QRDA 3L0BA 1EVJA 2BR3A 4N18A 3CB2A 2I6TA 3LK7A 1O94A 3D31A 1OLSA 3HKEA 4UAGA 2HBRA 2W2KA 5CEJA 1V16A 3HA3A 3IJRA 3NALA 4MQFB 3E27A 4G84A 1M2GA 4ZRNA 4E4YA 4ZYXA 1LTKA 1TX4B 2JIZD 1JEAA 3FTPA 4DC0A 1TCBA 3V9AA 3OSZA 1I30A 1RE1A 1U3TA 1VCOA 1ZDMA 2H92A 4NH0A 2I6SA 3D1VA 3L1VA 1T0HB 3NDBB 1SD1A 3PJGA 1VRWA 2HF9A 4BNYA 3O47A 2J4DA 1GPYA 5BR4A 4WOKA 2ZBRA 2I03A 1M5UA 1P31A 2NO6A 5SYMA 1EIZA 4KAJA 1GLVA 2QB5A 2ZRNA 2X0EA 1F2TB 1M1YE 3UFBA 2FHSA 2YXBA 4WNAB 2PV0A 4Z4IA 3NWEA 1NI5A 1N3IA 5ALVA 5KPJA 4G0OA 1GR0A 3ZWPA 2AN4A 3QQPA 3PDIA 3QVGA 1MX5A 1L5YA 2ANBA 3X2EA 3KB1A 4NIMA 3KDAA 2CLFB 4W9NA 4M54A 4N65A 4NZMA 4TWAA 4OA8A 5IDYA 1XZNA 3SFVA 3ZQKA 1G7RA 4I4TF 5FFFA 4B79A 1N6KA 4IS2A 4IGAA 5AK5A 1Z8NA 4MLCA 4FDMA 3KQQA 5C80A 1Y1RA 4Y18A 1PGPA 3HSKA 1FK8A 4FI3C 4WXEA 3SS7X 1YVPA 2RGNA 3E4CA 3UXHA 3DVAA 2GUWA 4GKBA 2BMFA 2C9CA 3U4GA 4LEIA 1ULZA 2JNWA 1P8JA 1EX6A 1X2BA 2JRLA 1EQ2A 1V1RA 3ELUA 3HCBA 3GY0A 4IIJA 5DLPA 5F7ZA 4D98A 1O6BA 4J7AA 1LDBA 1Z82A 2JGDA 1LBIA 1M0EA 1K2VN 1OILA 2I8LA 1AUXA 3K8OE 3K6SB 3JYOA 5KOJB 4D25A 3BD9A 2R00A 2ACEA 5HTOA 2CLMB 2ZYIA 1HKHA 3ILHA 4OGWA 4D5GA 1NKSA 2BKXA 4EI2A 5AW8A 2CXUA 2BLLA 2HCTA 1S7GA 5ALOA 1VMIA 2EBWA 4A36A 2B37A 5K3AA 1UZAA 2OCGA 2V7EA 4X3PA 5IMBA 4AFNA 3KVYA 4R9SA 3K8ZA 1XSEA 1GTZA 2I9KA 4X1IA 3PX7A 1XMVA 1U9IA 3PEUA 4IDAA 3KALA 3TQQA 4WXYB 2LBPA 1OYOA 1GNPA 1K8XB 2Q3BA 2ZRMA 1L8AA 4X1KB 2ZJOA 4DLAA 4TTRA 5TC4A 5ALPA 2L69A 5IDXA 1R4MB 1W30A 1W88A 1U7TA 1L5NA 1HDZA 3JZAA 4GX2A 3T1YB 3CWQA 5EGSA 4U39A 2ZM6B 3AONB 4BX9A 5LMNB 4DEXA 5BR8B 3O8RA 3EN0A 1NXQA 5IT0A 2PTHA 1C3EA 1LPMA 1OV4A 1ZVKA 2E7ZA 2OZLA 3Q87B 2EOAA 2QMEA 4JZKA 4MDYA 5DEIA 1Q0UA 3FNFA 3IEXA 4DPMA 3ZGXA 5BPHA 1CUYA 2R2GA 3K4PA 1APBA 4II7A 2XBLA 3PRJA 3TPZA 4MKHA 2JEYA 2X8AA 4FXOA 1PUXA 2REQA 4XQ0A 5HR5A 5JZBA 3HBMA 1XQVA 2I67A 1A76A 2V6FA 3TQIA 1QJCA 3DCYA 5FUYA 3CZAA 1CRWG 2VEOA 1ZJ4A 3FIJA 4EYEA 3THYA 1T36B 1KH3A 1W87A 2K2QB 3KDSE 4YRTA 5AVJA 4C4ZA 1PEYA 3ZJTA 1K6EA 3JD2A 4FKBA 2DSNA 5D7BA 3VZPA 2RKBA 3SWWA 1PLKA 3VO8A 4JLUA 4E3ZA 2AS0A 2UV8A 1RYDA 1Y1LA 4Y6RA 1X92A 4B09A 4CPDA 2F17A 5IARA 1QZTA 1PUJA 2OV1A 2XMGA 3G5TA 3DR5A 2BGKA 4JQZA 4YREA 4MEAA 1LZKA 3OM0A 2OT3B 4ZALA 1I6MA 1CDEA 1YS2X 2AZ4A 1I9CA 2D1YA 2V7VA 2WIBA 3FYHA 3O38A 3O75A 3MWEA 4PZZA 4DABA 3OIWA 5KJEA 1JAZA 5JJ5A 3MHPA 5IT5A 4C7XA 1ZICA 1QOQB 4Q1VA 5KYXA 2WTUA 2J0SA 1GCGA 1L5OA 2AH5A 1XZGA 2JKVA 1EHIA 4PBSA 3AJ8A 1G8FA 3E2IA 3QKSA 4YQEA 3M81A 3ZQ4A 3PYMA 4V0RA 3U56A 1C8BA 2FPIA 1K08A 1NXTA 1QCCA 1BMDA 1FFSA 1AF4A 5L3RA 2JIPA 2P2ZA 3BRWA 4IUDS 4KLAA 221PA 4GF5A 4MUFA 3QJYA 4IUBS 1J25A 3BD6A 5D01A 4YQZA 4AW9A 1K0FA 1T0JB 4NCJA 2H7CA 5JBNA 5BQPA 2E18A 4X8HA 2AVNA 2MSCB 2HQSA 1SY7A 2J3IA 4KN6A 3ZY4A 2XBMA 1WB5A 3A6GA 1FMFA 2YDYA 4G65A 4RQTA 5B57C 3BA6A 2KPOA 2WWYA 2OBYA 5G0SA 1SJ9A 1L7QA 1ZNZA 1A5ZA 3RABA 1LPSA 1UM9A 3UB4A 9ATCA 1K66A 2C4VA 1QE0A 4Z0HO 1T2NA 3IMEA 4P36A 4AZ3A 2GSDA 1WQ1R 2HWUA 5FQNA 3CONA 3OEYA 2D7DA 3KD3A 2QUJA 4QUIA 1B6SA 3EOZA 4MO9A 3DMRA 3SC3A 4BIIA 3PUYA 5A62A 3WWEA 2HNAA 5AYVA 1S89A 1CZHA 4Y0AA 4P6VF 3ZE6A 1MTOA 1BQEA 3KZVA 3OPYB 1UK7A 3LPMA 3UHAA 3RHZA 3STTA 3HEMA 1R00A 4GP9A 4OP2A 2O7QA 4DW8A 1SK8A 2G7ZA 4RYLA 5KU7A 4RULA 1NDHA 1KA9H 1P1JA 4X90A 2AZXA 2A3NA 3V8NA 1SBQA 1K6IA 2YWHA 4TLEA 2DJ5A 4PGMA 4JL6A 4YRZA 1M67A 4INAA 2ODPA 1ZRHA 3U61B 3CSUA 2AOTB 4CM8A 3DEIA 2Q4BA 2GNPA 3URMA 3EXFB 3I52A 2BDTA 4N5NA 3HJFA 1E2IA 5ERXA 3DDUA 4ZWNA 3BTSA 5FOVA 4KPEC 1T6XA 3K71B 4P93A 4FLMA 2OV2A 4Q4JB 4S2EA 5LLSA 4HFJA 3CIFA 1ISPA 5K8UA 1V35A 1VJ1A 3FNIA 5JSFA 2ZT5A 3U7QB 2I2DA 3I83A 2PEYA 2PMCA 4LKRA 2CFTA 2H16A 1RE0A 3KYJB 3W5IA 1LK5A 1O95D 3BD8A 3L41A 1J99A 5JMWA 5EJEA 3ZHBA 2AXQA 2J9FB 3TCXB 4Y1RB 2RCNA 2C42A 2ZI9A 3DAPA 4BEJA 3RODA 3GFTA 1LU9A 2JAHA 3OTIA 4Z0TA 4RDCA 1CS0A 4EGSA 3X2SA 1F3OA 3W3AA 2ICAA 1PR4A 1U8XX 1Q74A 3MM4A 1UKEA 2YCBA 4UFPA 1NP3A 1TTQB 1U9CA 1X80B 4DLRA 1QONA 4QLAA 4QNMA 2SBTA 4ZT4A 3ROXA 2RARA 4Z7NB 3BIJA 2V74B 4DS3A 3FYUA 2GJSA 3WVNA 5K8TA 1CK4A 4HDMA 1T3GA 2D3TA 1E2QA 4NCIA 4TYMA 5BNTA 1LJUA 3RS3A 4AUKA 3HO1A 1N2CE 3WADA 4O2AB 1JI0A 1TL7C 2QJFA 4RUKA 2IDZA 3ZC3A 4TKVB 2D0OB 5TF0A 1R5OA 3PPXA 2XOXA 2FW6A 2ZU0C 3OJEA 2GS9A 3E9MA 1NRWA 1P0FA 1ZO8A 2Q8QA 3QLVC 4PTYA 5TIIA 1J20A 1QH8B 4FVTA 3I3OA 4G6ZA 3V8QA 1D9XA 3OCVA 1YZQA 3ZYZA 1W4RA 4TOIA 2ZSHA 4Z9AA 4A6PA 1R3UA 2VSXA 4M9UA 3RUAA 4E2XA 5A0VA 2ACWA 4G1VA 2ILVA 1IHXA 3B6IA 1WXGA 1Z28A 2HDNB 2KW5A 3KXLA 2AWNA 1YDGA 5IWCA 3H9EO 1QO0A 1XCJA 2J6BA 3OAAD 2LDXA 1SD2A 3GI1A 4ZVQA 3ZWCA 5KMGB 2GN1A 4L9SA 4YDQA 1K75A 3CRMA 1WXDA 1YD7A 3LOQA 3PPIA 4YMGA 2PL1A 1ZOIA 5C9ZA 4RLSA 5L95A 3GLIE 3R9WA 1JG4A 4G1UC 2ZRPA 3KPVA 3N5KA 5IEBA 4QUDA 3RTGA 1GG8A 1JEQB 2VDRB 2G40A 3AF1A 4KUGA 4ESEA 1XFAA 2C7VA 3Q6IA 3RQIA 5JZSA 2NNLD 2VC2B 4LCBA 4GSYA 2CW5A 1DJLA 3FBWA 4G5RA 3LM8A 5K05A 4ZV7A 4Q05A 4AZTA 2LCIA 4H60A 4W99A 3ZWNA 5ERGB 3TG8A 1VCHA 1J6UA 1KAQA 2VTBA 3U44A 1RYYA 2X4LA 4KMMA 4UNSA 1VGQA 3AERA 1XROA 3K1JA 1N6RA 3NWBA 5JVDB 2FWPA 5KYTA 4FJ1A 4RDHA 1YULA 1GXSA 2IW3A 2YUIA 4EJSB 4FHDA 4LJRA 5DBEX 3HXPA 1IVYA 3OLVA 4G24A 5CLLA 4Z51A 3KZCA 3BIWA 2VJQA 2HT6A 2ZR9A 721PA 5IZ4A 1EFPB 2QRKA 2V7QD 3KXPA 4WBSA 4B4WA 4XEUA 1VLJA 3P9XA 4B2LA 5I8ZA 3O94A 2DPXA 4B6RA 4R0MA 1JPNA 1UT6A 2HGSA 4JBIA 3R6TA 4LC1A 4CQMD 2WWIA 4DYVA 5LN1A 1TF5A 2I22A 3DG9A 4RPKA 1K88A 4KO1S 3KP1A 2G0AA 3QYAA 1T5LA 3NDIA 4B3IA 2ZXUA 2F8SA 2DKFA 2J59A 4A8JA 2O2XA 4MKXA 2VHTA 3BJZA 2ORWA 4PPNA 4COOA 1NE7A 3I6ZA 4JLSA 3QEAZ 2Y71A 4ZYUA 4FQ7A 2ZS7A 1COWA 3EG9B 1AHHA 2I8CA 2ZS8A 3JQAD 4MWGA 2ZQYA 3LP5A 4WVFA 2KHZA 1J8MF 1E61A 2AC4A 2A1TS 2YXPX 3PUZA 5TGZA 5K0JA 1R88A 2NZVG 1FVOA 4ZEVA 4YJHA 1J00A 3N3BC 1M2EA 1HMYA 1PNQA 3CUEF 4JJ8A 3OF2A 4GGMX 1LTHR 4PHGA 1NY6A 4UDOA 3B8EA 4EELA 3EJWA 4WZ6A 3EXEA 2GVNA 3ZCUA 2R3SA 4J76A 2O54A 3O2JA 5BP7A 4A0HA 1M1UA 1AMOA 4WI1A 3F8TA 4CTNA 1CDOA 1AMUA 4UMVA 1M73E 1XK6A 2WFLA 1VMAA 3QVVA 4QGFA 1KI8A 1PZHA 4FN4A 2A0WA 4S24A 2WR8A 3DT9A 3COPA 3V42A 1J0EA 3IOMA 4F5YA 2IH5A 5DTEA 4EAQA 4H31A 1IN5A 4ENPA 2EFGA 1MC1A 3E22B 4MGYR 1SIBE 4URHA 1YQEA 2I62A 2ZSDA 1P5ZB 1KC1A 1N3BA 1QGDA 3GPCA 1XZMA 2X7XA 1QYXA 4UTZA 1KR2A 2GJ8A 2ZAMA 4XIIA 5K3EA 1MMFB 2WV9A 3A9VA 1E6CA 2M1XA 5D3QA 4CKEA 4NMHA 5IU6A 5A06A 4EB6A 3AYXB 4NOJA 1CWUA 4INPA 1HDIA 2GH1A 2VJPA 2W2NA 4L1KA 4TUYB 4EZIA 2RB4A 3F5QA 1LRJA 1ISSA 2HSWA 5FWYB 5L51A 2FZVA 3CLRD 3ER6A 4OJTA 4EVSA 4DCGA 5JFGA 4QZVA 1Y9DA 5JMTA 1E6MA 4RA9B 4UUOA 5T4BA 1GRRA 1NQUA 2D5AA 4D3DA 5TLSA 4QUHA 4YRDA 1DQZA 3QBDA 2I8AA 2Q3DA 4ZYLA 2QPOA 4JLJA 4WUTA 5BSGA 3A37A 1QH0A 1PZXA 2RH9B 3CBQA 3PBKA 2Q9CA 4BNVA 2IW1A 2B1QA 2M1ZA 2VCHA 1GAWA 2CLKB 4PQYA 4PXAA 1XQXA 1ZD9A 2P77A 1ISFA 1JHUA 3EFOA 3REGA 1WCWA 1TI7A 2UVPA 1XZCA 2FXVA 3H6HA 1U7ZA 4DHWA 2W42A 2OGZA 3IP9A 5IUKC 3KQSA 2CVOA 2OHJA 3JU3A 1JU3A 3BWXA 3P9PA 1SUSA 1TM5E 2Q8PA 3F49S 2QW1A 3HLTA 4QTZA 3VGJA 1W0KD 2R86A 4DA7A 1MIOA 4RSGA 1NQVA 4OHBA 1AUPA 2W37A 5EUCA 1XDDA 3O92A 3RC8A 4MYRA 4I0WB 4EJMA 3C7DB 1NI4A 1SCNE 4IILA 1OAOA 1QFXA 3LMKA 1F8XA 2FV8A 4DCTA 4EHDA 4AG6A 4QSMA 1T26A 1ZGZA 3PC8C 3QU9A 5BWLA 1K63A 1DKUA 5HKKA 2GF9A 2PVPA 1KMNA 3GWZA 2GEVA 1AKYA 1E1CB 3R9KA 2ZYTX 1K6XA 4JT4A 2YXNA 4EHNA 4IDEA 4DMMA 5BUZA 3N1UA 1PR6A 3JYNA 4HRYA 4OXKA 4OYLA 2X77A 4R9NA 1X9GA 1NU8A 2A7QA 2F43B 1OASA 2B5VA 4GBJA 4XGNA 5KYGA 4PCUA 5TNXA 4TVSA 3K94A 3REQA 2O9JA 4P7BA 4CRWB 2VPPA 4U2GA 1G9SA 4FOTA 3UK0A 1W46A 1V8BA 3DH0A 4YRLA 2QTWB 2H4WA 2O3RA 3IO5A 1R10A 2E4VA 3DV9A 5HFJA 1I5OA 2QLJA 2YYAA 2QRUA 1D0IA 2IEZA 1YCDA 1JDBC 1Q1GA 1RLTA 2XYVA 3OTQA 1TF2A 3CWZA 3E2PA 2JLQA 1L5QA 4M9ZA 4UM5A 3DONA 4RIEA 1H65A 5I9LA 5H4GA 3JZFA 1UR5A 4PZEA 4Y2HA 4UBIA 4DY4A 3LV8A 5T7BA 3EDYA 4G4IA 3I2GA 3Q2OA 1DT5A 1QQ7A 4HJRA 3WICA 4D99A 2NUPB 3F7NA 5CA1A 2JDIA 4NJMA 2AOVA 4EI8A 2EERA 2JGJA 1CT9A 1C2YA 1UJ5A 1Z8DA 3ICCA 1QAOA 4J9VA 1THGA 4WCDA 1PQYA 3Q3CA 3FZQA 3KTAB 3V00A 1ATZA 1VE5A 2WP8J 5CVVA 2RHMA 1ZXXA 3L8MA 5AVOA 3H3JA 1DC6A 1F2UB 1YZGA 2GX6A 2XODA 4PY2A 1YB1A 2PGLA 1JAIA 5HK9A 1W36B 5JT1A 5A2GA 2KYRA 2PD6A 5BT8A 4I9UA 1N1MA 1VG1A 2Y1FA 5U1PA 3UJ9A 5CB6A 3AUAA 1E9DA 4Q4HA 2GEBA 3OWOA 3DZKA 5F51A 1AQYA 3SXUB 4DQVA 3ZLTA 3A32A 3KKPA 4H15A 4OU5A 3V1MA 2VZEA 1BEUB 4E6EA 2PUEA 1P17A 2X7HA 3OG9A 4ZGGA 4YRMA 2AQIA 4DSUA 3RJTA 5AXBA 3CISA 1MKYA 1Y42X 3ORHA 3PZBA 4UHBA 1VYUA 1E20A 3H99A 3HL4A 2O8EB 1Y3FE 3BQ9A 3ORYA 2QYSA 4R51A 1ONBA 4PM4A 5DXAA 4A2PA 5BWBA 3E61A 3RIMA 1VRVA 3K7EA 4ENQA 3CE6A 3VR6H 4F6RA 2Y66A 3KSMA 1SXJC 2WDZA 4RAQA 2XNDA 4UXJA 2WKPA 4ERNA 1OXMA 1XZIA 5IAKA 3WGUA 3A8TA 4DMHA 4FD2A 1SU8A 1WDTA 2W0MA 1ANKA 2WT8A 2FUNB 1UANA 3OFJA 4TGLA 2WWVD 4AJOA 4UM9D 2NYRA 1UXJA 3BFPA 2XMCA 4CBVA 3WGQA 2JCBA 1EGVB 3WGVA 1OU4A 5A5DA 2EG9A 3RFTA 3Q0IA 4TMFA 2QLMA 2YWGA 4ZOEA 3D6HA 2ZYRA 3Q9LA 4OKSA 2P9BA 2BT4A 3AHJA 1QFJA 4FKZA 3PNVA 2ODTX 3N7UA 1NI3A 1O95C 3ESRA 4HN4B 4PLCA 3X0DA 4G8JA 3QG5A 4X3OA 3O93A 4MR7A 1ODTC 4ARCA 1OH7A 3ZXSA 1XPUA 4QARA 4E08A 1YS1X 1KI3A 3P4UA 1M6EX 2I5PO 2P6NA 2DKOA 1AZSC 2NZWA 4LY9A 2CJYA 1GJRA 4GEGA 4PYRA 4YRNA 4ZVTA 2VYFA 3EBOA 4HUJA 1N4AA 4HDQB 3BILA 4DUGD 1BX0A 4CQLB 1HYGA 1KVUA 3QTTA 3SG0A 4YRBA 5DWDA 4OQYA 1XVLA 4KFCA 4KLZA 3A1DA 5AKJA 4EFMA 1DC4A 1TCVA 4D8TA 3O4IA 3EPKA 2NXNA 2CDCA 3JR3A 5PGMA 5HZGA 5ABPA 3M0EA 5FHQA 2LW7A 4J49A 1XZQA 4WZAE 1R6VA 4QFCA 2D1RA 3QJGA 2FCAA 4B6OA 4GEKA 5CHYA 2A2ZA 4GI2A 1NXWA 2VQFB 2BMDA 4R31A 1QB8A 2HXGA 3HSYA 4G67A 4ID9A 1EX9A 2XDWA 3D4LA 3IP7A 3M4ZA 3P71T 3W1EA 3DHEA 4UE3S 4DTIA 5JBQA 4GZLA 2IHNA 2PYIA 1EK0A 2FX5A 1LPBB 5GJCA 4B2PA 4HQ0A 4M21A 4MP6A 1N3YA 2Y9PB 1QQ6A 3CO0S 1XZEA 2QZPA 2YXEA 1E1NA 4IR7A 3ABIA 1DAEA 2QN3A 3RSGA 1BCRA 4A27A 3PGXA 4BJ6A 5IP5A 1NMSA 2X9NA 3L8CA 3KKLA 1R74A 2F2TA 1YBFA 2GDZA 3N2LA 1TTTA 2C4KA 4P2BA 4FOOA 4KGZA 3PXCX 5DHRA 4UOQA 1EIWA 2P7HA 4NBWA 3AR7A 1YIDA 1KO1A 2ATCA 2Q5CA 3WL5A 3HVUA 2H4ZA 3R7BA 1K8RA 3UTCA 5JD3A 2PT5A 4B2IA 1KC3A 2PAAA 3ANLA 5CDSA 4C21A 1ISRA 4NU6A 2C92A 1IB6A 4IVNA 4DMUB 4JX8A 5DE3A 1OF1A 1XKXA 2NTNA 2BAGA 1L8LA 3F9RA 3VC1A 2WSIA 3DDNA 3ONWA 1TZCA 4ND6A 4QVIA 1GZ3A 2GPBA 2F1IA 2GAJA 2IWRA 2WJPA 1PKEA 5FWAA 3CVXA 2AN1A 2ZITA 3AESA 3OE4A 3SK0A 4IPTA 4BMVA 1Q0ZA 4MEJA 3M8KA 1MNAA 3Q88A 1W0JD 4KR0A 2WI8A 1CW2B 2WIDA 2P27A 2GPTA 2ZR8A 5I51A 4K86A 1P2UA 2ECKA 2Z30A 4UE2A 1SOUA 1BWSA 2ZSEA 3ESBA 4IGFA 4LVUA 3TQHA 3ZW7A 3C6XA 4W5TA 1BOOA 3JTEA 2QORA 1U8YA 4E32A 2C9MA 2HJRA 2ZBUA 3LL4A 1YA8A 3EYAA 2G9ZA 3Q8WA 5AI0A 2C96A 3LLVA 4M83A 2P2CA 4AJ4A 2P6RA 2CB0A 5K0TA 5J2TA 2HPAA 2Q1XA 3QMWA 5LA6B 1LLUA 1KVSA 1FJHA 3D1JA 2M6LA 3WLTA 2JLUA 1EESA 3TLGB 5CXUA 5ITZA 1KY3A 2GHTA 3HVKA 1GPAA 4B17A 1E1RA 3T3EA 4IGEA 5EHNA 5IFKA 2G1PA 3HCAA 5A03A 5MN4A 1DOAA 4FN5A 4K03A 3JZMA 2G8NA 4DNQA 2B5OA 1XRRA 1H0RA 3BX1A 3K4HA 1U6JA 2GK6A 3WZ2A 4F4FA 3ER8A 2XMSA 1UOPA 2IZ0A 3L18A 1ORHA 1W4LA 4MDFA 4JJAA 3WC4A 2BONA 3PPYA 1SHJA 2NUBA 1XA4A 2FPGA 1JXMA 3JPYA 1AQJA 5EQFA 1I5RA 1OH6A 1MFZA 2GPWA 1WMFA 4FDLA 1X70A 4RU1A 4L2IB 3CX6A 4BE4A 4F4CA 2ZUEA 5K3BA 1M6HA 4AYWA 3ON5A 3O3OB 3S44A 1YJCA 1X15A 2W2LD 2D1SA 4ZJZA 2DPHA 1QZXA 3JWPA 2V03A 2J0EA 3UMGA 3E3AA 4GLBA 4DLWA 2IUTA 3GQBA 2H6EA 5KNBH 5AW1A 4N7BA 1DL5A 3AHIA 1F5NA 1RPAA 3M82A 4EG7A 2V3WA 3K1AA 1GZHB 3C1UA 4NQZA 3UB2A 2Y76A 2OCKA 1DEOA 3MIZA 4IIEA 4OKNA 1UDRA 2HU2A 4P86A 2WJJA 1D1SA 1VMDA 2HN9A 1P0IA 2VA8A 3GMTA 4MNTA 4ZK2A 5JD5A 5FLXA 4AMUA 6REQB 2WVGA 4CDNA 1G291 5BN5B 1O9GA 3BZUA 1KAHA 1XXLA 2XTAA 3L4EA 3JQDA 5CBPA 1F1BA 3GD5A 5ESRA 4CFSA 1JX6A 4F7WA 1VIVA 2CHQA 4J3FA 3EC2A 1M2FA 1X39A 4M8IA 4XDZA 5K6RA 3PJFA 4MITA 4E2ZA 4HHEA 1L7DA 2XA1A 1T1EA 3D1LA 3THWA 3TTVA 1ZUNB 3LWDA 3EFHA 1X6VA 4YRJA 5KYVA 4IDGA 3K32A 1HT0A 1I7NA 2CFRA 2IYOA 2W6MA 4RM2A 4UQOA 2XUOA 3PG5A 3T9BA 1SCJA 1VLMA 3NBYC 3EW9A 3P4XA 4DRXA 1CULC 5J4KA 4OQXA 1IY8A 3GXOA 3SDSA 1PK9A 2PXAA 1XCMA 5FF9A 5K03A 3SR3A 3GOHA 5IM4A 3IR5A 4IV0A 5K6TA 5JATA 4IZ6A 4OSEA 5KTSA 5IDWA 3U6BA 2HO5A 5IJ9A 1MXHA 4WLEA 3AJAA 5L53A 2REBA 2QN2A 1DJNA 1CYDA 4DPLA 1L5KA 4JFRA 2GEUA 4LJKA 5DM60 5IF9A 2P0YA 1M0SA 1Y1TA 4K6KA 3OD5A 1REQB 4KOAA 2HQ1A 1PQWA 3SX0A 2A0YA 2B8TA 3AEYA 3LFTA 1SHZA 3NHSA 4JVLA 5B4TA 1CUIA 3CINA 4KODA 5EKDA 3AXTA 2ZUVA 3MBIA 1UAYA 3T3HA 2J09A 3C14C 1OT5A 2ZSIA 5LP6A 2BTQB 3CEAA 4ZU6X 1PJ4A 1XQ1A 3TW6A 1OW3B 3PPVA 2E37A 3LU1A 4KV7A 2QL9A 4KB5A 4YBZA 3DGEC 1U3WA 2PUWA 1P7YA 4IQ0A 2J7KA 1TO2E 1DPGA 4HEQA 4R05A 3SM3A 5ALSA 4AVYA 3OFND 4Z1MD 1WHSA 3EDQA 1CP2A 2XWSA 4TVBA 2VSQA 1TW2A 3F98A 1M2OA 1J0BA 1BGVA 1EFVB 1K98A 1M6YA 1Q0LA 1T2AA 3BIFA 1I4WA 5BOVA 2ODAA 3DL0A 2C7OA 5HCNA 1NN5A 1QKJA 2EYUA 2N75A 2G36A 1Z5GA 3F71A 2FN3A 2R7LA 3DFZA 3UHPA 1SIWA 1E7WA 2BFOA 1Z7BA 2V9PA 3FMOB 4OH1A 5KYKA 5KYWB 2ZYHA 3DMFA 3MF4A 3SX4A 4BN5A 1E6KA 2R1VB 2I2CA 3LVFO 1N8NA 3KFVA 3VM6A 4U02A 2D5IA 2Q4EA 4ZGWA 3NEJA 2XX3A 4EH1A 1PR5A 4OQLA 3IP6A 3KVVA 2QN7A 5EIEA 4LWQA 4UXIA 1DEHA 5GWXA 1BXGA 4IFIA 1IEQA 4IFEA 4QPNA 4UHJA 1I0ZA 3ZDQA 4ZHSA 5EOVA 1E62A 4IVPA 4UTVA 2J32A 3C48A 3DDZX 5DF1A 4IIUA 3ZIDA 2IYEA 5IKOA 4UULA 1WV0A 2HYIC 2POQX 3FKQA 4EO9A 5IDQA 1IM8A 4C3VA 2W6JA 3TBKA 3HU5A 4AL4A 4BFXA 1Y9ZA 4MICA 3W2GA 5FOUA 3LBAA 3SKXA 1VJTA 4ZCMA 3QG1A 1TT5A 2DXIA 1UK6A 1ZOLA 3FZNA 4QHTA 5LCXA 1DLJA 2EX0A 3MWJA 2VHQA 4RD2A 3L0DA 4MS3A 2UZIR 2O1XA 1ZZGA 5D2CA 5BW4A 3FCYA 3R0IA 1SUDA 4G4JA 5J59A 1SKMA 5CB0A 1E3MA 2VPWA 3ASYA 4CL8A 4WKOA 1AM4D 1CF4A 3X1YA 4Q1FA 1YRBA 3FGZA 4JI5B 2Q3EA 3LQRA 2G9QA 3NAMA 2GAIA 4PLFA 1KSHA 1KYZA 1SGWA 3CB4A 4DIEA 1CHDA 1HDYA 3EEBA 4C20A 3UCFA 3ED5A 3MJEA 3C85A 1IBLB 1E89A 1R2QA 3DZDA 3D6UA 4M98A 1SBHA 3DZBA 1LSJA 4EYQA 4EKYA 3CKKA 1QFMA 5BVGA 1UKZA 3G88A 3F2IA 3R7DA 3VVCA 3C1AA 4V39A 4L08A 4RIIA 1KJIA 3R7WA 2R11A 4PC7A 1Z8FA 3AK4A 4AP5A 2VTDA 1HKUA 3HM2A 3WV4A 3HABA 1YCGA 3GRVA 4XAQA 1CY2A 5GVRA 1L7PA 4G26A 4L95C 1J06A 4ME6A 4D6YA 3NC1C 4HGPA 3KUDA 1A2KC 1EDEA 1M5RA 4NENA 1R4NA 2X5JO 3SQMA 4YGXB 3EXG1 3JYPA 1E0KA 4AJLA 3MPUA 4CHTA 3CR8A 4OHRA 2OHGA 3FOCA 1GPMA 3NYQA 5LQKA 1ZQ9A 3ESCA 4FBGA 4PHFA 5KNCD 5E1OA 1R8SA 2Z98A 3B1VA 3EZ6A 2BFCB 3AF0A 4TS9A 5CM2Z 1YHYA 3L6OO 1PF7E 2EFDB 2P6PA 13PKA 2DCMA 2XF2A 3QZUA 1ZX1A 4P35A 4EA6A 4LWPA 2O48X 4ND4A 1M76A 4Y6OA 4JUFA 3IRUA 4M9SA 2RH8A 4B0OA 1WP4A 1NMYA 3CZ4A 3AI7A 3SJ7A 1YOVA 1GCUA 3AOEC 3TZCA 4C22A 3DPUA 3LS2A 1X7YB 4BO4A 2Q4RA 3DYIA 2EKQA 4DDWA 2OKCA 4D8WA 1YKSA 3Q6NA 1K5PA 5BN3B 2AK2A 3COYA 2PSSA 1DIGA 4UKDA 2C4HA 3IAS1 2F67A 2E1PA 1DBQA 3H9BA 3LFUA 4BDSA 4L85A 4AJ2A 2PH3A 9LDBA 2FEOA 2LKCA 2BPOA 2PH1A 1S2IA 1ZH0A 1Z6YA 4MVJD 4NJEA 5JEEA 4M8NE 1YFZA 4HDRB 4RKEA 3DAGA 3RBXA 4NNJA 1PX0A 2CGEA 1IHPA 3HNOA 4Z4HA 5BQOA 2NUAA 4U2DA 3VV2A 1VG9B 1J0CA 2PZAA 2W4MA 2OBMA 2TYSB 1DQPA 3O8BA 3RO7A 3REOA 5C5EA 4W82A 3J7AC 4I4LA 2X14A 3MTAA 2Y2UA 4P84A 5I47A 1O54A 2JBWA 2IC5A 4N5HX 3RUIA 4EGCB 1AKVA 2QAJA 3FYCA 2PGXA 3N07A 4Q3LA 2J6HA 2C99A 1FVFA 1O94D 2ZTUA 3QXXA 4G0QA 4TRJA 1TQ4A 2R8EA 2R87A 1QHIA 4REMA 4EAAA 2E5FA 2X58A 4ER6A 1DIHA 4EUNA 2QBYA 2YHAA 1UZUA 4C03A 2JCGA 4PHTA 2WUFA 3K9GA 3ESQA 1PS9A 2DR0A 2IHBA 2NO0A 3EZ2A 3H87A 4LWOA 1K4KA 2JBAB 2Z6UA 3IAEA 1M8FA 2Z2XA 3AP2A 1K7EB 2EJCA 3D7MA 1YQUA 4REQB 3LC7O 2FN4A 4KGVA 3G6KA 1GLNA 4A4DA 4DEYA 4TYYA 5JNUA 1K27A 1H22A 2EP7A 3AR5A 3E2MA 4XASA 3TM4A 1UMCA 3VNAA 4F6LA 3A3YA 3D2CA 4WY5A 5ERYA 5H02A 4CKBB 2HXYA 2WKQA 4KR3A 4Q93A 3LYLA 5G3YA 3I64A 2NU9B 1P2BA 1P4HA 2CWWA 3TI7A 4UEWA 1OX4A 4CM5A 4NULA 2CV1A 3VNUA 1PWZA 3UJDA 1TKAA 1SZCA 4H6XA 4OHZA 3RUHA 3W9BA 5L7TA 1EB8A 3K53A 1JXAA 4R2WA 3KQTA 1W9HA 2JFWA 1D04A 1E2KA 4C4TA 3DHVA 3UXEA 3EZGA 1N0IA 5GZ6A 2IYNA 4CR8A 1OCEA 1UFVA 3ZXUB 4I1PA 3M33A 1NONA 2XMZA 2UZ1B 4K3UA 4MB0A 1RJDA 3EUFA 2B6NA 3QX9A 4BV3A 3UUGA 4Q7QA 4R40A 2ZAIA 5HE8A 3IQFA 4E5UA 5FV7A 1LSSA 2ZVQX 2XBUA 3R5HA 1I3CA 5JCJA 4C7KA 1DE0A 3L6UA 3IAM6 2B4YA 3GLUA 3OA2A 2X1HA 4MJ3A 1H1TA 3GA0A 4CL2A 3GU3A 3HBFA 4GXNA 1RHRA 3TL6A 1TB4A 1BXKA 2O8FA 1WM1A 2FFRA 3EQ6A 2QNRA 1CQJA 3MPOA 5COBA 3NHBA 5KTPA 4QDXA 1ISGA 1FXWF 4KN8A 3V46A 4JWKA 3WWPA 1V0JA 2PGJA 3JVEA 1ZM9A 1MLDA 4A82A 2FZLA 1GZDA 2VDMB 5EKSA 1BEEA 1ZSVA 4BU1A 5JNLA 2CNLA 4Q4AA 5D5PA 2C7GA 3CNHA 4WK4B 3UWOA 4B6GA 3MBKA 2QI9F 3KUUA 4ZZ0A 3H1FA 1SVIA 1E2BA 4ND1A 1YNSA 1IQUA 4IMRA 4LN1A 1AA6A 4HDNB 4QUBA 2KI5A 1C9JA 5CYPA 3IPXA 1H2RS 2VPTA 3EFBA 4NDNE 4Q21A 4ZOLA 5L40A 2R44A 3GBVA 4BNJA 1WTCA 1RMQA 1YJBA 2PR2A 2NUTA 1MA0A 1OA1A 1QIKA 4XI9A 1X1SA 1KSJA 1DBPA 3ZI0A 4D9NA 1QP0A 3H3XA 1YQGA 4CF5A 3IEKA 1JG6A 4H35A 2Z8ZA 3M5DA 2IJGX 3JZIA 4FZ5A 3MGCA 2IYYA 1Z5NA 4UZSA 4AP9A 5AJXA 1LNZA 3IMGA 2OM6A 2EL7A 4E5VA 4DFDA 1ZC4A 1HE5A 3D5QA 1ZWKA 4KLCA 1UFOA 2EJWA 4HQ6A 3D02A 1E5TA 4M1YA 5KVQA 5JY6A 3U5ZB 5B5SA 5AI6A 4TL8A 2VRBA 4IRXA 2D59A 4U1RA 2NU8B 4C3ZA 5KOYA 5A2QA 5HGJA 3BDVA 1E7MA 2C8KA 2GPAA 5KO2A 3QYFA 1WKVA 4BMCA 2V4ZA 3U13A 2PLRA 3WL3A 3DBLB 1A4UA 1DBVO 2H2FA 2J8ZA 4YPOA 1VHJA 4HFNA 3T7JA 5HF5A 3B3FA 5IJZA 4U6NA 1W93A 2FMHA 4Q16A 4MS4B 2WJ6A 1LBHA 3JATA 2Y1GA 1P7CA 3ZDDA 4TN5A 3PNSA 1TIPA 2P5SA 2X86A 3CC8A 3ENVA 1V9LA 1QIJA 3L8EA 1NBOA 1G21E 3U4IA 4M3NA 4PC1A 5KPDA 3D2AA 3G2MA 4C1BA 2R7AA 3PUJA 3VQTA 4DR4B 1SUFA 1PQPA 3KHKA 2IWHA 1JQKA 4BFUA 2Q3FA 3U3ZA 3GLKA 1IM2A 4PGHA 2OSBA 2FX3A 1PZMA 2FEAA 5ALZA 2QA5A 4IWNA 1L5VA 4RVUA 3AZOA 3ROGA 1TD1A 4B3MB 3C3EA 3OIGA 5BMVB 1GU0A 2NSHA 1PG2A 4PR0A 4L3VA 4LDNA 2BELA 1UBUS 1PWYE 1N57A 3B2QA 5L6LB 4L78A 3EMBA 2EFHB 4O4IB 4GH5A 1CJUC 1IY2A 1CZLA 2JL1A 4PNPA 2QYOA 4OH7A 3IV6A 1NXSA 3KZNA 3DE2X 4QGAA 3SYMA 2CEKA 2HMWA 2ZREA 1WDMA 4MXDA 4V24A 4HS9A 1V1MB 5EJ4A 4MQFA 2JGLA 2EEPA 2AFRA 2GXQA 1OLXB 4HAIA 4HXFB 2JJ2D 3PQ6A 3AEKB 3OOHA 1UWCA 4QHYA 4YMWA 1JIQA 1HM5A 1KYTA 3C97A 4CCSA 5B1EA 4WN9B 3SQWA 3LZCA 3QWFA 3UYLA 1A9PA 4BX0A 3IKLA 2XCOA 1T4CB 2OILA 3A25A 4I5EA 3H6KA 5K3CA 3WTBA 4V0SA 3T5TA 4AKEA 5JD4A 1AKTA 2PHZA 1V48A 3C6ZA 4FYYA 1V71A 4HUTA 5JS7A 5AXCA 1Y6RA 3FDJA 4GNRA 2VYNA 4CV0A 3FLBA 4XRRA 3JSAA 5IM5A 5ILOA 5K51A 5TARA 5TS2A 4J75A 1YCHA 5FEMA 3D81A 1I1HA 2O0HA 4ZD6A 3WL8A 3H8SA 1QVZA 4CIVA 1Q21A 1T5HX 1ECGA 4YAOA 1M2VA 3RU9A 3RWBA 5TEWA 3C6YA 2FUCA 1P4JA 2R25B 1IJBA 1LBTA 5ER6A 3I30X 1D07A 4XA8A 5IVDA 2G09A 2YTZA 4REOA 2QX9A 1KI9A 2E1RA 4CUKA 4ZHQA 2I4OA 3M6LA 2TMYA 1DRUA 3I72A 1TQ2A 4TV8A 5DOVA 1HNZB 2O8DA 2QJRA 1HOTA 2Q2OA 3N8DA 4OFWA 4P38A 1ZOOA 1N2CA 4W5QA 3HVJA 3AJ9A 1EFKA 1SOVA 2QS9A 1E2HA 2P11A 1J2TA 2V7PA 4GVPA 1H8HA 1RBQA 2VDNB 3SR4A 3DKRA 2ZJ3A 2IIQA 3OE1A 1K4MA 4ARZB 3PNMA 4S04A 2DU8A 2ZDHA 4JVSB 3K6SA 1AV6A 3CFYA 3CEHA 5KOJA 2QJTA 1U0RA 3AR6A 3COVA 2B92A 3HYRA 3IKVA 5ALTA 3FSGA 4LK2A 3ZDEA 2A0KA 5CK4A 2OWDA 4WEQA 1MF7A 1XA3A 3TCNA 4V0MA 4LXUA 1A71A 1OC4A 1OI2A 3HP7A 4KR9A 3EMVA 4ZCRA 5IBRA 3W3AD 5JAIA 5K6AA 1BMFD 5KYUB 3KEOA 5I9NA 4P7JA 2O8VA 2XTJA 2J3EA 3R2JA 4CG3A 5JNVA 1R4ZA 1WXQA 3WJ1A 3BVPA 4PSDA 3CF6R 2VQDA 4LRTB 4PRZA 4XH9B 5HUHA 4N6OA 2FZ4A 2HDHA 3GLIA 1AVTA 5JFTA 4HB4A 1R0RE 2J0VA 4YNBA 5D51S 5T3YA 5C8XA 1R4MA 2VXYA 5KCMA 3OQNA 3ROZA 4ITVA 4JVMA 1AG9A 4N6NA 1PD0A 1NNEA 5AK6A 3RVNA 1XC7A 4LWZA 4L5CA 4Q4LA 4WN3A 3TX6A 3RVQA 1J7JA 3EF3A 4FS8A 2C2OA 5JROA 3SIXA 3UGJA 4GE3A 1QE5A 2A9RA 2WKRA 3A1SA 4U8GA 4W7SA 3RRFA 4KPFC 1RFLA 1RTTA 2DHEA 2ECOA 2HRBA 4JJIA 4XDGA 2C7RA 1ESEA 2QU7A 3TUJC 2W6CX 5LIRA 2CCGA 3HA7A 3DNMA 4N4AA 3U60B 2C78A 4UFOA 4YJGB 3MHTA 3FPKA 2PS9A 1ZN7A 2RHBA 4K05A 2OGUA 4V0NA 5IXYA 4IHAA 3MWDB 2WG2A 2P1ZA 1RWWA 3QU2A 5B6PA 3OURA 3UAXA 1LWOA 4ZPJA 5I6DA 4JJGA 5TMBA 5JISA 2Q3JA 3J7TA 4KRYA 3W7AA 4P3OA 4LHYA 3CF4A 4PZYA 3W04A 4D4MA 1TAUA 1AX9A 1CDZA 5DM0A 3RT1A 3N7AA 2ZIGA 2GBPA 4JOBA 1E60A 3M4NA 4M1SA 4X94A 5CT4A 1GRNA 2TS1A 4LJSA 3LP6A 3HDTA 2PT9A 4I55A 1UKVY 1O4VA 2H3EA 3K9WA 2B20A 1TPZA 1JKMA 4RABA 2EDAA 3NUGA 3S5UA 5A1TA 1JSCA 2RDMA 3C7TA 3ONDA 4RMIA 2CXPA 3D43A 2FE1A 3H5RA 3UXMA 5AIBA 2GYUA 1R9MA 1C0IA 5K09A 3SX2A 1KHHA 3I6BA 5A4KA 1JIKA 3K09C 3AQIA 4G1EB 1ZR2A 1JIIA 3L7MA 3ACCA 4TPKA 4IDBA 1Z6XA 2CHGA 1XJQA 1O94C 4QAQA 4WOBA 4WRRA 2GJKA 3ED1A 5LA6F 1U81A 4BTVA 1JH8A 4P31A 2VUTA 3HNPA 5E38A 1QRUA 1MEJA 1NOIA 3G2KA 3OPNA 3Q12A 1M7GA 1S02A 4PINA 3DXZA 4S12A 3HI6A 2W11A 2GGSA 1Y3IA 3L9XA 1Y7TA 3FUWA 3VTFA 4QYXA 4B76A 2RGEA 3AEQB 3RAEC 4F3KA 5AVKA 4JB2A 5KOIA 5M04A 5TDHA 3RVLA 2Y93A 5KKNB 3BC1A 3D0RA 4UATA 4RSRA 3AFMA 3KD2A 4RTRA 1MJ5A 1ZHHA 4KQGA 5HKKD 3OICA 4A8TA 2P9FA 3ODGA 1COWD 2GWHA 3IUQA 3WYGA 1VTKA 4H6VA 4FINA 3GF4A 4LDZA 1F20A 4YYEA 1MG0A 4NBSA 5FO1A 1WPRA 3Q2IA 4EG8A 4ZI7F 5AK0A 1Y6FA 5JXGA 1JLMA 3T1HB 1QHGA 4Y9RA 4KNYA 1XNJA 4YALA 4BFWA 2AFVA 1QPBA 3O4JA 1YO6A 4ZT5A 4W9NC 3OPYA 1VJ5A 1LQUA 2FTKE 1OVMA 4HAXA 1K7SN 4MHTA 1SPXA 5BXQC 1HURA 4YCCA 3G2NA 1ZI6A 3ZYCA 4HG2A 2O2EA 4LSWA 2XQGA 1KBOA 4MI9A 2KMLA 2RGNC 1M54A 2YY7A 3SAJA 5KC8A 1J4AA 3I45A 1JZTA 5HJ5A 2FOXA 3TOXA 2AOTA 1QE3A 1YVRA 3FVWA 5F35A 4GMKA 1XA0A 3EXFA 3I53A 4P4NA 5A04A 4OIMA 2BF7A 2V9CA 3UFXB 5IJWA 1DZ3A 1YMQA 1NKTA 3CRVA 4D9BA 1NXOA 2R00C 1SA0B 3LBYA 1JVSA 2W9XA 2BCJQ 3NBXX 1JAHA 4JYBA 5J43A 5HJ7A 3U7QA 3U7HB 1OBVA 3E9YA 1TKCA 1CY4A 1C7FA 2PT7A 2EKBA 3OQBA 4JYPA 5CCXA 2VWPA 4RZHA 3VPHA 4RVHA 3D2LA 1TZJA 1DAIA 2J9FA 1YJXA 2YWDA 3GEGA 2UXDB 3KJXA 5EYPB 2AOUB 1LK0A 2Q50A 4WNIA 4DMRA 2ZB3A 3CSSA 1ADYA 2IU3A 3GZ4A 4Z4CA 3GMSA 1U9IC 4YTEA 1CR1A 3IQDB 3R3WA 1QK3A 1CY8A 2FPUA 2QVGA 5AKIA 3ZBPA 4ES6A 1IVSA 1EUYA 2VJMB 1H6BA 1HWYA 4K9PA 3V7WA 2WKSA 1P7VA 1T9GR 5F1PA 1X80A 1Q16A 1KWKA 1TKBA 1LBEA 4DPKA 2J07A 3MAGA 2PV7A 5J2UB 1U0GA 2PGNA 3DMNA 3BSWA 3W5HA 3HZOA 1QNFA 2MSLA 3NV9A 2I34A 1R7RA 3QU5A 4HQRA 1RXEA 4HY3A 4JOCA 2BTOA 1P77A 4ZARA 3B1KA 3T5MA 4AF8A 4AS3A 1I2DA 1YB2A 2I3DA 2OB1A 3EGOA 3H4MA 2IIBA 4L3WA 3E81A 3FKJA 3NBQA 2EL9A 2WT4A 4CQMA 3BULA 3DCNA 1TUBB 4JLAA 5CCEA 2JZNA 2QX8A 2LZ0A 3LTNC 1RZ3A 2HRQA 3F6SA 1YR8A 5T3UA 3DHYA 2E9SA 5EJ9A 1JDPA 1G64A 1JKXA 1P0CA 1I1OA 1X74A 2L17A 4FX2A 4N49A 4MI3A 1QGUA 4WBXC 3JQCA 4M7PA 5CNJA 1JDBB 1KGDA 3VUFA 4EYGA 3E4DA 3PNKA 2C3MA 2MSWA 4IIGA 1YT5A 3PQFA 4QEDA 4GPAA 2X5KO 4OHMA 4A73A 3OM8A 5FTLA 4IOJA 3BGIA 3BCSA 3F90A 1GHTA 3EC7A 4Z0PA 3GGCA 1K89A 1PGNA 4DV5B 1ZSYA 4FR2A 2UAGA 4WERA 2GAOA 3D4IA 1YQXA 2GD6A 4G1CA 4BKOA 2J4FA 4IIDA 5BSWA 5KMGA 3C8DA 1RPZA 2ZI4A 3L79A 3D6MA 3OUTA 3NT2A 4M1EA 5DGXA 3DDSA 3GJ8A 2QXUA 1JEQA 2GZRA 3ENZA 4H6WA 5JCOA 2IZ6A 5CNIA 3E0QA 4JI7B 4PFKA 5GQSA 3DPSA 5A3VA 2X2FA 3I39X 3MCZA 4NZZA 3AEXA 4ZK6A 2GVZC 5KEIA 3CN9A 1N5OX 4ACBA 1Z4QA 3DDOA 3FETA 5BWOA 3TLBA 3PYLA 1Y7LA 3CURA 5L3QB 5H8WA 2GYYA 5KOHA 1Y63A 3INGA 4DARA 5JVDA 4EY7A 1TUEA 1WZNA 1Z0JA 2JDID 3O84A 3BCHA 4IEEA 4D43A 4K40A 1VC2A 3ZLBA 4EJSA 3LPNA 3SE0A 4HPWA 4K6CA 2YJ6A 4NQRA 3TIIA 5I9BA 1M33A 4M22A 4LJ8A 1GL3A 4G8BA 3FMFA 4YB8A 3QXHA 4ALIA 5LZ7A 1D8AA 2C5FA 3C3CA 5FUQA 1S3GA 4DWWA 1V5EA 3P0JA 1RQNA 1XP5A 1D4ZA 3VH2A 3VA7A 2Z8YM 3KQMA 2PPVA 3L01A 1M2KA 4NZ9A 1Z2AA 2XAAA 5AOCA 3U4AA 5F3DA 4Z2YA 1KAEA 2RGYA 2WA1A 3GA5A 4GICA 4MWTA 5E7MA 2FP3A 2YWRA 5CVTA 5HCUA 4UVDA 3WXMA 3SY8A 2JFBA 1JN0A 3FSJX 1RACA 4U2KA 1ZIDA 3EQ7A 3JQEA 1HA3A 2IU4A 3IIKA 2GBLA 1KMQA 2VBFA 1RP1A 2OXIA 3I5UA 5MHTA 3LSYA 5A6SB 4F93B 5ADVA 5K4HA 3WQQA 4C6TB 1J9EA 4H7HA 1FIUA 2DPLA 1IHYA 1FP1D 2WW8A 4CEHB 4KN5A 5L9AA 1SOWA 5DHTA 2G67A 4ZREA 2Q8NA 3OWXA 4X3CA 1PD1A 2XNDD 2YYSA 2X6QA 3OHPA 3WGLA 1U8AA 3T12A 2JI7A 4AG3A 4AO6A 1C1XB 1DXYA 3GUYA 3RFFA 1NGSA 1IUKA 1HMPA 3LL7A 4Q0MA 2XECA 5I4CA 2IE8A 1D2AA 1GILA 1K7YA 3QUBA 1H42A 2F8MA 1JA0A 1Z4JA 3ASVA 3C0KA 3DVQX 1NUUA 3QVKA 1PJ3A 1X8XA 3R0QA 3U3RA 1YJQA 3ZJUA 2ZYWX 1E2DA 3E22A 3E82A 3RV3A 3L82B 4BB9A 1Y8AA 1N7GA 4RF3A 1W52X 4R7ZA 2XVMA 2JLZA 1DBIA 1IDN1 4RY8A 3KAJA 4UUMA 5GVSA 5EIAA 3LC2O 1EJBA 1TU4A 3QRWA 4H9GA 1P5JA 1RP7A 2J9ZB 3EZYA 3GPIA 5TT1A 4YJ2B 3U31A 3WG9A 4K8RB 2MYNA 4AWAA 4ZYTA 1C7QA 5BVHA 3WRVA 5JWRA 4WESB 4MKGA 4MWZA 1F51E 1L1EA 1HFJA 5B7PA 3KTFA 1C9NA 1V7CA 3RSCA 3LUAA 4S1NA 2ZJBA 2VR1A 4KE9A 3KV1A 1R50A 3L6EA 1R18A 1GPH1 2FLVA 2IU0A 1ZVQA 2GEKA 2JLCA 3AUTA 3HB0A 3PL1A 4J43A 5DI9A 2COKA 3FYUC 1EM8B 2OCYC 3QEOA 3ZW9A 2G83A 5I7WA 2VF7A 1U5CA 1E6WA 3AJDA 1A82A 4RVNA 3Q6MA 2VHXA 2YYYA 2GPSA 4PSCA 1CJTC 1VCNA 3LYHA 5EMJA 4OXRA 1PIWA 3CRNA 5ALGA 4JB0A 3ISTA 4NMWA 5JO9A 1YQ9A 4KVGA 4MULA 1DS6A 5CDFE 3U7IA 2XLBA 4EY4A 1Z16A 2F3QA 2GM3A 1ZIXA 2I54A 2Q6TA 1L5HA 4JEUA 1UDAA 1LBSA 4XB1A 3KPUA 4GOND 4I6GA 4ZCPA 3T94A 3GPDG 1Q0RA 5K3SA 3T5CA 3TKLA 4V1CI 1W5AA 1FB5A 4BO7A 5FPYA 2VL7A 4G23A 5EP1A 2VK8A 5DYNA 4JUCA 5KSZA 1E6LA 3ANXA 4TLLB 1P8AA 3FNBA 5DRTA 3KT8A 4JBWA 2OO7A 2YZ7A 4CGYA 4EPYA 4JMLA 1QOZA 1JYFA 2EZ4A 4M86A 3DTTA 4P98A 4WH0A 2GA8A 1ZR4A 3HJRA 1DJMA 2WY2D 3LW7A 3W7VA 3DYBA 1ZLYA 3C3DA 3L92A 3WI7A 5SZKB 2YOHA 5AM2A 2JIQA 4JI6B 2BZ0A 6AT1A 2ZPAA 4LTMA 1JILA 1G2PA 3D3JA 4PG4A 3SHQA 3BXHA 3A4VA 2HLDA 2RC6A 1NBHA 2BMWA 1QP8A 2CMGA 4DCJA 5CFRA 4HQFA 4QOHA 1UMKA 1GTMA 1CQWA 4KRXA 5CEEA 1TAGA 3RPEA 4H0FA 1G38A 1E3SA 1N6HA 2O2DA 2Q4TA 1MD9A 3LWZA 3MS2A 2DHQA 3ENQA 4BKUA 4RH0A 3U26A 4GMDA 3EJ6A 5HQ3B 1H4QA 1HE4A 4Y0NA 3CJTA 4MW2A 3ROMA 5JIBA 3MTIA 3NTQA 3NHAA 1E9FA 3Q7SA 5KVCA 1PSZA 4UTRA 1RKQA 1QO9A 4X92A 1WU7A 2FZWA 4O29A 4C30A 1IOLA 1E4OA 3KAPA 2GERA 3T7EA 5LSAA 1A88A 3Q2KA 2Q4DA 2NAFA 4J3JA 1F7VA 1LDMA 2X4IA 4FI3F 4Z3DA 1KE2A 2O2SA 5THKA 3C41J 1IQRA 4GOMD 4F3RA 1DMSA 2Y4OA 2VAVA 4FUQA 5AHOA 4LQ4A 2DECA 2O5VA 2KBFA 2P4UA 3D0OA 3DC7A 3KHUA 3KTAA 4R7TA 5KTMA 1NG9A 4XGIA 4PSKA 3GRCA 5FA5A 1L5WA 4JUAA 3EXG2 1NVDA 3H6GA 3LPCA 4QSHA 2VS1A 3AKCA 2YXDA 3DBOB 2YNMA 4RE5A 4CF3A 1G7SA 5HUJA 3HGQA 1KEEA 1E1RD 1RAEA 3OFSA 4C5AA 2YR0A 2E4WA 1E5LA 3CX4A 3FJOA 1EG7A 4HH1A 4KPUB 5J4LA 2W43A 4U63A 2ZOSA 1XCGB 1IBMB 3S2GA 1L7BA 3KB8A 2XOEA 4YRRA 1D7AA 4RQAA 1ABEA 2R8BA 3WLPA 3ZU5A 3LQ4A 3LRXA 2V5AA 2H5EA 2FR0A 1XEXB 1O08A 1QWSA 4L4ZA 4WKNA 3PHHA 1G8GA 3FHOA 5JJIA 1B93A 5CD1A 3TLJA 1VPWA 3OT4A 2VUUA 2BFAA 3CV3A 3T4XA 4F4HA 3AIIA 4TTQA 3VZRA 2HY7A 1UC9A 3MTBA 1I36A 3C8HA 4HQNA 4KXXA 4NZYA 5FKJA 3SQNA 3WHKA 4UU8A 1KU6A 3CNEA 1T9HA 4IL5A 5GTDA 5K8LA 4DKXA 4F4DA 2PX6A 2GN0A 2IPLA 4R8VA 1S8FA 2R6GA 3I9KA 1KFBB 4HNQA 4S2UA 2OFFA 2B5WA 2BI8A 4MW0A 4M9XA 4QDUA 5G0VA 3R3ZA 1VIYA 1BDIA 1RWVA 4O5AA 4RESA 3G7SA 5AW5A 3VTZA 2QTLA 1WV1A 4L5IA 3H2GA 4EYOA 2BHSA 1LBQA 2P3OA 2W2XA 4ZJUA 4MKFA 3I9JA 1P2TA 3VYSB 1QH9A 2IT1A 5C8YF 1UKYA 1RHKA 3SFZA 2UVDA 1N1DA 4D9KA 1G7TA 3BCUA 3NOXA 3UV7A 2SKCA 2ENWA 3GT7A 1NLFA 2ET6A 1XDSA 2ATIA 1VPVA 2Y2VA 2CSUA 4II2A 1R9GA 4PICA 5ALQA 2B61A 3DVLA 4RFVA 4D9JA 5ADWA 2IS2A 2B30A 3AWIA 3BWBA 4XWTA 1QHXA 1CEXA 4ZC8A 1MX9A 1I3MA 2IZZA 2H1RA 3O03A 4UU1A 5EJFA 3S8EA 1VRCA 4LYAA 2FUG6 4DXAA 1J42A 3HFGA 5HE9A 2QY9A 1U2TA 3VHQA 3DD5A 4PNHA 1WZEA 5EZYA 1Y5LA 3IMCA 1SKYE 1Q5PA 4BO3A 1K6MA 2VP2A 2QUHA 1KBZA 2KJQA 2PVSA 3AIMA 3M1YA 1R5BA 3G1UA 5DGDA 3WB0A 4G1BA 1IHOA 5CU7A 5H5JA 2AR9A 1WD7A 4NFLA 3ZE0B 3L8ZA 2WAYA 2H1VA 1Q1ZA 4YMHA 1BWPA 1F4PA 1FC0A 1YRHA 1OAOC 4PWYA 5FJJA 4UJ3A 4HB2A 5EZSA 1MC5A 2HKIA 2PBZA 4JLVA 1PG0A 4N5IX 4TTPA 2EIXA 4NECA 4WA8A 5CFLA 3IPLA 1NVVR 2ZIVB 4FQ8A 1UJ6A 3OPQA 4CCYA 4JVNA 3WOVA 4C07A 1W4AA 4L72A 3WSTA 2HIGA 2FGKA 3BJEA 3N2GB 2D2IA 2BFPA 1VA5A 3WHLA 5MN6A 2CVPA 3D6AA 3IUBA 1O8CA 3UEOA 3C7CB 3UJ3X 4H7JA 2QRMA 1HLDA 2HWWA 4BLWA 4F97A 4V0QA 4LV5B 4LYDA 1BC5A 4DREA 3SIPA 4ZAYA 3UWMA 2V8OA 4MA0A 3B5JA 3KWMA 2O4UX 5P21A 1C3VA 5FI1B 2JFXA 2YHUA 5BRNA 5LZ2A 1R3DA 3IT0A 3WYAA 4QDKA 4BJ3A 4WBNB 1RJ9B 2QR3A 4YAIA 1I24A 2AD5A 3AZQA 2J5RA 3CGWA 1XVTA 4UPEA 4CMAA 5F2OA 1N7IA 4KXLA 1R37A 2YC2C 5L7WA 3STYA 4OOFA 1ILEA 3VDXA 1XZFA 2GCIA 1QHHB 4YAFA 1DZIA 3WBBA 2YV1A 3PWKA 2MIIA 3MT9A 4B0PA 2PN1A 4DDHA 3LO8A 4HNTA 2FOIA 4WCFB 3T3DA 3CWCA 2X40A 3QHAA 3NWPA 3K15A 1PSWA 4XIGS 3ZGZA 2PWZA 1W59A 3KQPA 1EVEA 4DQUA 4E88A 2E3JA 3TXYA 3LVRE 4D0GA 2OBXA 4DM3A 4LG1A 3ADOA 4MQUA 1Y8ZA 2OPBA 1L4MA 3PA6A 3RSOA 2M9MA 1DMRA 4RTMA 3T3GA 1Y34E 1W0CA 1SUIA 3SZ3A 3HVIA 1GGNA 1TOAA 2EFJA 3PK0A 4R2JA 4LJ6A 4BEVA 3SMQA 4PW0A 4LJLA 5DASA 4HCJA 3DNPA 4YIKA 2F4VB 8MHTA 3TLGA 3GDOA 2VT2A 2OV3A 4IJWA 1A8SA 1KXZA 4EKNB 1RC0A 1BU5A 4J94A 5C4MA 4UM9B 2AJDA 3QPVA 4L0MA 4OHYA 1QIHA 4PZ9A 4B34A 3NCHA 3BD7A 1XTPA 2A84A 3GARA 4TQ9A 1Z4OA 2E0IA 1OY1A 3BPSA 3P2EA 4LCJA 3ZJVA 2XSZA 1R6AA 4QOIA 4GRIA 4MWOA 4ZYZA 4ZCQA 1IJKA 2O4CA 1W5BA 4M2LA 3A6KA 3BWVA 3K0KA 1N8TA 4L4YA 1E1QA 1HQDA 2J30A 3M6IA 2BMAA 1GEEA 5EJIA 1ZMTA 5B2ZA 8OHMA 4ZTZB 2W6ZA 5AKZA 3AFGA 4HZUB 4L2IA 3I2KA 1P9WA 2AFIE 1IH8A 2Y0PA 1CUXA 3I3SR 3Q5DA 1C8VB 4LXHA 1ADCA 5JE8A 4HK4A 2DULA 1Z73A 3P27A 4NEHB 3T9FA 2PH5A 2QE7A 1V25A 2XADA 4JYAB 2Q9UA 2W70A 2AJLI 3RYIB 3F4BA 2PXCA 3FOAA 1NV9A 4ZRMA 2ES4A 2GPNA 2IXGA 10MHA 1OAKA 1KDRA 2NVOA 4LSGA 4C08A 4IKOA 2CD7A 1I7LA 4UXHA 3ET5A 5FA6A 4YRIA 3VJMA 1MU0A 4UUAA 2A1IA 2QE6A 3EH2A 3OLWA 1M1XB 5DI3A 2XUDA 3IDFA 5REQA 4AJJA 4B44A 1HRKA 3NLLA 1JQLB 5I5GA 2XRMA 1CX9B 1GPLA 1L6IA 4L5YA 1VKHA 2Z5LA 4H3VA 3IUYA 4Q3EA 2PU7A 2IPXA 4RH3A 5DCUA 3SNKA 4MP8A 4ZVVA 3THOA 1GFSA 4ZZ2A 4BZPA 1TC1A 4EA7A 3VZQA 3EF1A 1VLHA 3G2IA 1SOAA 4EEKA 2X2OA 3BGOS 2CUZA 2XIJA 3F6EX 5ALMA 1RI4A 1A2BA 1NMQA 5ENZA 4YP9A 3TLCA 1AMNA 4U5QA 1C30A 2GKSA 3IXLA 4ANFA 4FB4A 3Q8LA 5A9SA 4MRPA 3A2LA 4LUCA 4C6SA 3UK1A 3QV1A 4FDTA 4AMVA 4MPJA 2PS3A 1PR0A 1GWNA 1X1AA 4CKWA 2WJWA 3CVYA 1GTG1 1ZH6A 3C8MA 4IZHA 1SVOA 1ZEMA 3CX7A 3F8SA 1WULS 2VDWA 4QPDA 4CXMA 3PUKA 4K9MA 2PLNA 2IP1A 4ADSG 2IUYA 1YL7A 2W58A 3EOBI 3H9GA 3QPDA 5EWJB 3S40A 5FV4A 2H4XA 2Q6KA 3ETNA 4INOA 4MRRA 2WUWE 4F2DA 4EQ6B 1USKA 5JV5A 2Q7OE 1PK8A 1KJNA 2J48A 1QRAA 1MJGA 1W1IA 4J6FA 5TMPA 1WETA 2BBOA 2NYUA 4R1PA 2YZ2A 3GJ7A 4FU0A 1ESMA 1XRSB 3CR3C 3I6QA 2OZPA 4FGZA 1JB9A 3L7JA 3OI7A 2AFHB 4J4BA 2QT1A 1AHNA 4I7EA 1CTQA 1GIAA 1WUTA 1U1EA 4RL4A 2EX1A 2IY7A 2VA9A 1P1KA 3DZFA 4GPD1 1NIJA 2ZIFA 3PVZA 1NW5A 1U8CB 3DM9B 4CIDA 5LQNA 1UP6A 2WE8A 3RARA 4G8DA 1CUWA 2JLXA 2H4HA 1FP4B 1PDOA 3E9ZA 4LZNA 1Z6QA 2B9VA 3K9HA 2BTQA 1B16A 1KI4A 3GFRA 2HNKA 2CHEA 5E9QA 4U00A 2J3MA 1B1AA 1DCKA 1H1LA 3QE2A 2C4WA 1JHDA 2VEDA 4UU7A 4Z8XA 3ZH2A 1IHDA 4HPJB 1Y1PA 4IJVA 3CVVA 2J3KA 1O87A 5AHRA 3N8GA 1GAXA 3LDGA 4EHJA 1LSUA 2P90A 2RFLA 4G2NA 2FEWB 1JWLA 2IUFA 1UP4A 5D3KA 3KUKA 1Z0FA 1PYOA 2J3QA 3IBYA 4ZAXA 5GV8A 1EFVA 2FWRA 3A1VA 4R9VA 3X1KA 1CHNA 3VI4B 4C2BA 1VCIA 2ON6A 5CFPA 4LFBB 4U6QA 5EHZA 4H0NA 5JG7A 4O08A 3FFWA 4Q47A 1A04A 3ACDA 3QSGA 4QDTA 3SU8A 4A8HA 5KYWA 4RCZA 4YJ3F 2A78A 1B74A 3ZHUA 4HKTA 3OZDA 1S8OA 5HKBA 2IHKA 4GOKA 3VAYA 1MH9A 1YE5A 1E9CA 1SMKA 4BPBA 3CZCA 5AJTA 3QH4A 3WLHA 3QPCA 4JI2B 1IK6A 1QTQA 1GARA 1S2OA 4Q9NA 4DILA 3NYRA 1SPBS 2XB4A 3AIKA 1DRVA 1W581