4PIPA

Engineered egtd variant egtd-m252v,e282a in complex with tryptophan and sah
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
316
Chain Sequence
LSLANYLAAAAEALRRDVRAGLTATQKSLPPKWFYDAVGSDLFDQITRLPEYYPTRTEAQILRTRSAEIISAAGADTLVELGSGTSEKTRMLLDAMRDAELLRRFIPFDVDAGVLRSAGAAIGAEYPGIEIDAVCGDFEEHLGKIPHVGRRLVVFLGSTIGNLTPAPRAEFLSTLADTLQPGDSLLLGTDLVKDTGRLVRAYDDAAGVTAAFNRNVLAVVNRELSADFDLDAFEHVAKWNSDEERIEVWLRARTAQHVRVAALDLEVDFAAGEEMLTAVSCKFRPENVVAELAEAGLRQTHWWTDPAGDFGLSLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ergothioneine Biosynthetic Methyltransferase EgtD Reveals the Structural Basis of Aromatic Amino Acid Betaine Biosynthesis.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords Histidine-specific methyltransferase EgtD
total genus 115
structure length 316
sequence length 318
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.44: L-histidine N(alpha)-methyltransferase.
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10017 Methyltransf_33 Histidine-specific methyltransferase, SAM-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pipA01
3BKXA 2NXCA 3JWGA 5ICGA 4V0QA 5HFJA 5B1SA 3GXOA 5LQNA 4KIFA 4X41A 2AN3A 2PX8A 2OXTA 1XVAA 1KYZA 3DLIA 4OBXA 2UYQA 4QVGA 4BP3A 2ZWVA 1Z3CA 5LSAA 4FP9A 3PLAE 1FPQA 7MHTA 3AJDA 3D2LA 2P8JA 2EJUA 5GIPE 3B5IA 2BM9A 3G2QA 5GP1A 3BGDA 4DZRA 4E2WA 3HVIA 4R8SA 2I7CA 4PGGA 4P7GA 3T0IA 2PXAA 1ZG3A 3FUWA 2ZZKA 3OE5A 4GOND 5KVAA 2QY6A 2NP7A 3TRKA 1EJ6A 3C3PA 2P7HA 1KXZA 2PX5A 3I5UA 5GWXA 4AZVA 2OO3A 3REOA 1RI4A 2ZULA 4RVHA 5ICEA 1EQAA 3DP7A 4G56A 2JHPA 5DX8A 4UOEA 5FCDA 5EKXA 1U2ZA 2HNKA 4GBED 4XCXA 4DF3A 5CVJA 4DA4A 5E1OA 1RJFA 1R8YA 2EG5A 1EJ0A 2PXXA 3B7PA 1R6AA 4MWZA 3LCUA 3GJYA 2HTEA 5CCBA 4JXJA 1KHHA 5K03A 1OR8A 4PONA 3EGVA 5DRYA 1P39A 4PIMA 2G8NA 4KDCA 3UZUA 2JHCA 4PYIA 3HEMA 4X61A 4E33A 4BP1A 1BKYA 5FWDA 4HC4A 2K4MA 2PWPA 1AF7A 3FPFA 4QQKA 2QE6A 2B9EA 8MHTA 3HCDA 3M6XA 5GIOE 3ERCA 1JSXA 3KPYA 5EHGA 1JG1A 4YUXA 5HILA 2AOTB 3FUTA 3OZTA 3ME5A 3PS9A 2PXCA 1N7IA 3GO4A 5D1NA 4E70A 5KS2A 1G8SA 3P97A 2ZCJA 5DRTA 3PTAA 5EMJA 3HVKA 4FT4A 3A4TA 5DTQA 3G2PA 3FTCA 2NNWB 3KQOA 3NJRA 4E2ZA 3CGGA 3OFKA 4M36A 4NECA 1WG8A 2IDKA 4GF5A 4YV1A 4FSXA 4P7JA 3HA5A 5EQJB 3A26A 3KR9A 4C4AA 1PRYA 1AQJA 2FK8A 3VSEA 3DXYA 1L3CA 2I9KA 1ZGAA 5DSXA 4IWNA 3EVFA 3KU1A 4GOMD 5EOVA 3AY0A 3NTVA 2IP2A 5FA8A 3TOSA 5KQSA 3HNRA 4E2XA 1T43A 3M33A 1NV9A 3CKKA 2XVMA 2P3LA 3F4KA 4OA8A 2VDUE 4CKBA 2OBFA 4RTPA 3FPEA 3MTIA 5DXAA 4MIKA 4AUKA 4DKJA 5GM1A 4CTJA 2YUIA 1RJDA 2P3OA 4B17A 2IH5A 2BH2A 3P2IA 2AVDA 1UIRA 2O0LA 5MHTA 3A25A 3R24A 3AXSA 2O06A 4R8RA 4XUDA 5CUQA 5IH3A 1FP1D 4XUCA 4RSRA 4V0RA 2IDJA 3KQMA 3IEIA 2YR0A 2ORED 4IKPA 3TKYA 2B3TA 3OZSA 5KYGA 5LQCA 4QTUB 2OPBA 3MGGA 3UJ9A 3G2MA 3I64A 4PYQA 4RTJA 2OKCA 4RTRA 3T7TA 2BM8A 1JTFA 2Z6QA 3G5LA 1KPGA 2EJTA 1X1DA 3BZBA 3OU2A 4LWPA 4PWYA 2FYTA 3B3GA 3HVJA 2OB2A 3KR2A 3OFJA 4KVZA 5EMLA 4F86A 2HR1A 2XYRA 4E2YA 1YB2A 2GA9A 3HCEA 3KPUA 3X0DA 4C06A 5JUWA 3G8AA 3SSMA 2Q41A 4YUVA 1G6Q1 4GUAA 2PWYA 4OX9Y 1IM8A 5LQJA 1SKMA 3FZGA 4RTNA 5E9JA 1F3LA 1NT2A 4PYJA 3K6RA 3GU3A 3EVCA 2AS0A 3ELDA 3PX3A 3TM5A 3M6VA 3UJ8A 4ER7A 3LCVB 1IY9A 1QAMA 1SVUA 4IV8A 4PYMA 1KR5A 1VP9A 3EEYA 3TMAA 5CVUA 3GRZA 5DM2A 4ZTBA 2AOUA 2NP6A 1I1NA 2H11A 2QM3A 3P9KA 1F38A 4RYLA 3UWPA 1ZHFA 2YQZA 1SUSA 2QYOA 2YXDA 2ZBQA 1WXWA 3C0KA 3UJAA 3BWBA 1INLA 1NW8A 5BXYA 3QOWA 2ZLBA 4PYLA 3GRUA 2FRXA 3H2BA 3PFGA 4HSGA 1XDZA 2B78A 2GLUA 2P41A 1B42A 3CJTA 3NWBA 4LECA 5DTMA 3EVAA 3U81A 3SX0A 4C05A 3B89A 4PGHA 3AWIA 3NVMB 2ZBPA 2PJDA 2P40A 3P9IA 1VL5A 5EEHA 2NYUA 2P7IA 3T7RA 1XJ5A 3NDIA 3HCFA 5K05A 1KIAA 2G70A 5K8VA 5LR6A 5T67A 4ATNA 2BR4A 4U7TB 3CJRA 3OPNA 3R3HA 4FSDA 5H02A 3SMQA 1RI2A 4PYOA 4F84A 4QPPA 2C7RA 1RI1A 4A6EA 3QV2A 3KQVA 4HGYA 5ERGB 5F2KA 3HTXA 3TPZA 4C08A 1ZQ9A 1O54A 3DXXA 2OYRA 2ZIEA 4PYKA 5K0NA 4EQZA 5ICFA 1TPYA 2JG3A 4DM3A 5HIMA 2BR5A 4ER5A 3E05A 5JR3A 4DCGA 5M5BA 2C7OA 3FTEA 5C0OE 3RODA 3BKWA 3EVGA 5CVDA 4PCLA 5E1MA 3B3FA 3DH0A 3Q7EA 1N2XA 5DXJA 3ER9A 2P1DA 3LKZA 1VPTA 2O05A 3BGVA 4WVLA 3DUWA 1QZZA 5FADA 5BP7A 2F8LA 3LL7A 2XBMA 3DOUA 4YMGA 3A27A 1O9HA 1R74A 1L3BA 2PVCA 3GDHA 4O29A 5EZSA 4YV2A 3DLCA 5EEGA 4KRGA 2NXEA 3FRIA 2IH2A 2ONYA 3I9FA 3JWIA 3DULA 2AOUB 2DULA 3KPJA 3KKZA 2B2CA 3HM2A 2I62A 5E8RA 4GC9A 2IIPA 3LDFA 1P91A 3LDUA 1M6YA 4YMHA 1QAOA 2EX4A 3V8VA 5F2NA 4HH4A 1AV6A 1XCJA 3AXTA 3S68A 3SVZA 1EAMA 3ELYA 3P71T 3EMDA 1YUBA 3SR4A 5IKMA 3BT7A 1L1EA 1JG4A 2EFJA 2VS1A 10MHA 2N47A 5HEKA 3SM3A 2CMGA 3FYDA 5DTRA 4FR0A 4XUEA 3FPHA 3QOXA 5DPMA 9MHTA 4GOOD 2AN5A 1JTEA 2IPXA 5EMKA 5K0EA 1Q0TA 2UYHA 3MQ2A 2ZVJA 3ORHA 3KQYA 4M37A 1X1BA 1NKVA 4Z2YA 3A7DA 2GS9A 3UJ6A 4AZTA 1WXXA 3CJQA 2ZZNA 3TFWA 1X19A 2ZBRA 1NW5A 1QAQA 4RV9A 4HGZA 3THRA 4POOA 3HP7A 4KWCA 3CCFA 4QTTB 4A6DA 2WA2A 3KQQA 4HTFA 5CD1A 2ZZMA 2V7EA 5LQAA 5KQRA 3OU6A 4RVGA 3MHTA 1XDUA 4QDJA 5DX0A 2VDVE 3UJBA 5HZMA 2GAFA 2PSSA 1H1DA 2AOXA 2G1PA 3LDGA 5BW5A 4RTLA 1XXLA 3IHTA 1KYWA 3DMHA 2CWWA 3ELUA 4GQBA 1JSZA 1ZKDA 3EPPA 3UA4A 2PY6A 5E1BA 2PX4A 5DSTA 2AOVA 5DLYA 2Z6AA 4M7RA 2HMYB 4E30A 2P3QA 2AVNA 1YZ3A 3FTFA 2ZSUA 2ZTHA 1YZHA 2H1RA 3BWYA 3FPGA 4ER3A 3R9XB 2LD4A 3LGAA 3NWEA 3VC2A 2IBTA 1XCLA 4RVDA 5E9WA 4EKIA 5DM0A 4CXMA 2AZTA 2YX1A 4AX8A 5FA5A 3IV6A 1G55A 3CVOA 2FPOA 3KPWA 4RWZA 1QYRA 3HA7A 3OZRA 3OCJA 2PKWA 1WZNA 3OE4A 3KR1A 3PFHA 4CKEA 4YV0A 1FJXA 4CKCA 2IBSA 3EVZA 3C6MA 3P2KA 2B25A 4FS8A 5EG5A 4U7PB 1G60A 3BUSA 1BHJA 2NXNA 3NVKI 2H00A 3GGDA 1V39A 3NW9A 1P1BA 5K0JA 2Y1XA 5DM4A 3LPMA 2PT9A 4PIPA 1MJFA 3FUVA 4PINA 5EPEA 5LQRA 1NE2A 1RI3A 3M70A 1D2CA 1M6EX 4QDKA 3A7EA 2DPMA 1R8XA 1YFJA 2V74B 1HNNA 3MCTA 1VBFA 5CIYA 2IFTA 2ADMA 1EIZA 1G38A 2QRVA 3P8ZA 1MHTA 2AR0A 5CCXA 2VZ9A 3LHDA 3R6TA 3G8BA 4OA5A 2ZWAA 5LQKA 5K09A 5E1DA 3TKAA 3P9CA 5HIJA 4Y30A 3EMBA 1JR4A 2VDWA 2BR3A 1JQDA 3KQWA 4L7VA 5EIFA 3TM4A 5LQUA 3EEOA 3CBGA 5CM2Z 2GB4A 4LWOA 3KQPA 5DM1A 1Y8CA 5ICCA 2CKDA 3JWHA 5G02A 3E8SA 2G72A 3HA3A 3FYCA 3GWZA 5E8JA 2Y1WA 3FUXA 5K0GA 5HIKA 2O07A 4YUYA 1WY7A 4KDRA 3K0BA 3SSOA 1RJEA 4RTKA 2ERCA 5EHIA 4MTLA 1I9GA 1NBHA 1KPHA 1JQEA 5GINE 3I53A 5CVEA 3DMFA 4GC5A 4ISCA 5DWQA 2UYOA 5EMMA 2PGXA 2PLWA 5T64A 3BWMA 1XTPA 2FHPA 1FBNA 1N7JA 3M6UA 3M6WA 5K0BA 2JHAA 3MCZA 4EVIA 4RTQA 3O4FA 3G89A 3GIWA 5EZQA 3JWJA 5FQNA 4R6XA 3KR0A 2ZW9A 4OQEA 1SUIA 1VQ1A 1NW3A 3C3YA 4RVFA 4KIGA 1M0EA 5FWAA 2YTZA 3O31A 1P1CA 1HMYA 4HTFB 3EVEA 5K0CA 4R6WA 3FRHA 4Y2HA 2G71A 3LBYA 3LECA 1RI5A 2R6ZA 4LG1A 1VLMA 3PX2A 2JH8A 3KHKA 5U4XA 1BC5A 2OY0A 1BOOA 3EVBA 1L9KA 4HRAA 2YXEA 1SQFA 3GRRA 1X1AA 3IYLW 1KP9A 3ID6C 5P8WA 3UJDA 1L3IA 1DUSA 2JH9A 3DXZA 4HG2A 4C03A 2XVAA 4AZSA 2FCAA 2PV0A 5C1IA 5DT2A 4RTOA 3C6KA 5FUBA 2IH4A 3UJCA 3MERA 3DTNA 1SG9A 3HCCA 1IXKA 3BGIA 2P35A 5EGSA 4DQ0A 4OBWA 1YFLA 3NMUF 1ORHA 2VP3A 3LSTA 4YUWA 1NW7A 4RX1A 2FK7A 3SSNA 4CWAA 1VIDA 2JJQA 3P2EA 2ONZA 3LKDA 5T6BA 1X1CA 2NXJA 1I4WA 1AQIA 2PT6A 4MQ4A 3UA3A 1VP3A 4GOLD 2PBFA 2R3SA 3RW9A 3UFBA 1RJGA 4AZWA 2Z6UA 2KW5A 5CVVA 3GNLA 4FT2A 5FHQA 3SGLA 5BW4A 5K0FA 2ZFUA 3CC8A 2I6GA 4CTKA 3MB5A 4E32A 1ZGJA 3FUUA 3EGEA 1D2HA 4K6MA 3LX6A 3RIEA 3THSA 2XYQA 2UYCA 3LBFA 1DCTA 2ESRA 2O57A 3LCCA 4OQDA 5D1HA 1KPIA 4RTMA 4E31A 1Q0SA 3DR5A 3UJ7A 4F85A 1R00A 4BY9E 1ORIA 4YUZA 1QANA 3KQTA 3EGIA 4QQNA 4QPNA 5DX1A 4QVKA 2AOWA 5FQOA 4ER0A 4PNEA 2AOTA 1XDSA 2QRVB 1UFKA 4KW7A 4WXHA 2UZ4A 5FHRA 4IV0A 3ER8A 2WK1A 1JG3A 4EMSA 1NBIA 3PT9A 1G8AA 3P9NA 3VYWA 2BZGA 2GPYA 3MTEA 4EKGA 4DMGA 5HOQA 3NDJA 4H0NA 2ZIGA 3G5TA 4PYNA 3E7PA 4R05A 4C07A 1NV8A 1TW2A 1YF3A 3G2OA 1DL5A 3KQSA 3TR6A 3G88A 3HCBA 5EVJA 2CL5A 2PX2A 3L8DA 3SXJA 3I58A 3M4XA 3EVDA 4BLUA 4ER6A 1PJZA 2WA1A 3ELWA 3MAGA 1TW3A 3BXOA 1WS6A 1EG2A 3GRYA 5EC8A 4P58A 5FTWA 3TQSA 3PB3A 5K0LA 3FTDA 3WSTA 2OB1A 3FPJA 5E2BA 3HVHA 3GCZA 1NW6A 3B3JA 4P7KA 4EK9A 4FZVA 5K01A 3O7WA 3PVCA 4GEKA 3GRVA 5GOZA 3T7SA 1R18A 5C9ZA 3UBTA 4X63A 3HCAA 4M38A 3OU7A 4X1OA 5E9QA 3VC1A 2GH1A 4MHTA 3TLJA 2HWKA 1JG2A 5EKUA 4X60A 1D2GA 1O9GA 3ANXA 4RTSA 4BLVA 3KPVA 3R0QA 2XYVA 4P7FA 5GM2A 5FULA 5E2AA 4BLWA 2ZIFA 3V97A 3E23A 4DCMA 2C7QA 2OZVA 1SQGA 2A14A 2IGTA 3DMGA 3Q87B 4FGZA 5HIIA 2YVLA 1JQ3A 3G7UA 5EIWA 2CMHA 2YXLA 4C04A 5F2OA 1UWVA 1VE3A 2C7PA 3BWCA 2HV9A 4PCAA 2E5WA 2AN4A 1FP2A
chains in the Genus database with same CATH superfamily
3WHKA 1QQBA 3F97A 5IULC 4JXZA 4JB3A 3K1ZA 3VHXB 1UUFA 3OJXA 2Z8YM 2AN3A 2BGMA 2G36A 3FUCA 3K94A 2B0CA 5E4TA 5J2UB 3RROA 4AULA 3TL2A 2PL3A 3UBMA 2VT3A 4AO8A 3LXMA 3W3AA 1DBPA 4ZU1X 1ORDA 2PEZA 3CVWA 1OLUB 2A9JA 1Q7GA 3SK0A 3Q5DA 4R4JA 3G2QA 2EWMA 1W8IA 2QE7D 2WVJA 2YVKA 3EMVA 4XLTA 2ZYSA 3ROFA 2W22A 1YULA 5JY6A 3T0IA 2IYQA 1G2IA 3L9XA 5BPHA 5KVAA 3FUWA 2VOEA 1EJ6A 1KZ1A 3G17A 1I7NA 2Y77A 1TQ2A 2ZRQA 1Y81A 3VSBA 1KAGA 3DE4X 3EOAI 5JANA 1N5JA 2WJ3A 2I6FA 1QC5A 1ECGA 5TPZA 3STWA 5AM3A 1F1JA 1HFJA 5K5EA 1EKXA 4NONA 2JAXA 2ZIVB 1LK7A 3FJOA 3WB9A 3DE6X 1WF3A 2J6BA 5FPTA 5H68A 3LCUA 3NYQA 2ZYUX 4WEQA 2VJKA 3WGTA 4BV8A 1E5LA 1JHUA 4OJQA 3ENZA 3ESZA 2FFHA 4PONA 4YAJA 5DMXA 1MDBA 2OCXA 2D13A 4RIGA 1VI2A 4Z0HO 1ANKA 3A9SA 3UZUA 1TYCA 4Y1FA 2YV1A 1KBQA 3MWKA 1VB5A 3T5AA 1E2PA 1AGRA 3H3JA 1FE8A 3L0DA 4BLTA 5HP4A 1F8XA 2MCFA 1GZUA 2X4GA 1J21A 1LBQA 2A78A 4NE2A 4RV4A 4JYPA 5IVPA 5LMCA 1KEEA 2Q2WA 1NLZA 5D84A 1T8YA 2DHCA 3KPYA 3H2SA 3OHMA 2BFDA 1W75A 2I66A 3G85A 4ZVVA 4M8NE 3SX2A 5I7HA 4F9EA 3U4QA 5JS2A 3PFIA 4AMBA 1IM5A 2IZ1A 1QX4A 2REBA 5EMJA 3TFQA 1B8VA 4HLQB 3O47A 2R66A 3G2PA 1MNAA 1V2HE 2NNWB 4CG3A 4FMCB 2JCSA 9ATCA 4FQ5A 4UQPA 2ZRCA 4ZEXA 3WG9A 1SHJA 4N5LA 1DEAA 3VPGA 2I4TA 3WJ2A 1AQJA 3DXYA 2P9HA 2PQMA 1G20A 3V1YA 3ZZNA 2V1UA 2VOJA 3NTVA 1KDOA 3HU2A 3Q9UA 2BEVA 4LMAA 4OA8A 2XVMA 3ER9A 1GUZA 4J03A 4BN4A 4EJSB 4EO4A 2GK6A 3ABQB 7REQA 2E5LB 2X0KA 4MIKA 1NZJA 4PO8A 3DZBA 1BEUB 2JIBA 3IPLA 1Z4PX 2Y1GA 4MRMB 3JTMA 4ZO7A 2PQ6A 1YCFA 2ZS7A 2ZS9A 4H6WA 5HTOA 4V0LA 4JCCA 2J6CA 2IDZA 3H4TA 2OESA 2RHRA 3WTCA 4YRJA 3M5DA 3ZCTA 1C3LA 3GA0A 2OPHA 3TBKA 4DLUA 5KYGA 1HE3A 1JU9A 2H2FA 2VNJA 3IXLA 4IEIA 4US2R 2COKA 2WT4A 3EW7A 4ID9A 4PR0A 1GGKA 5F12A 5JISA 3NHUA 4KQ2A 1LLDA 4GL4A 4K9MA 1JTFA 4MGEA 3GJ5A 4YJ3F 5FI1B 1BCRA 1P8AA 1QH1A 2I4IA 3HGQA 2PZMA 1Z4JA 5EMLA 1ND6A 3HDQA 2D59A 3LQ1A 3B6MA 4HSEA 4U7FA 4UE2A 4LX0A 5ENDA 3LX8A 1V35A 4HO1X 1YB2A 2GA9A 3HCEA 4C3ZA 1CF4A 3B6JA 4C3OB 3MWYW 5DYNA 1X9IA 4AMVA 1VA5A 4OX9Y 4RHXA 3C5EA 3H05A 4N40A 4YMUA 2ZXUA 1PFQA 1Y89A 1VJCA 3G6WA 2ASEA 1BOFA 1P5FA 1THGA 5C4GB 1QF7A 1GQQA 1P0CA 3ONVA 4MQ6A 3ZU5A 1CRQA 4RY2A 1IPEA 2AN1A 4JX8A 4OXQA 4B5LA 1XLVA 3TMAA 4RA6B 2I4MA 4HDOB 1ISSA 2JFOA 3HHPA 4Q34A 4U2DA 5F73A 4MUKA 4ZVLA 1F38A 1KC1A 4ND7A 4MI1A 3QKRB 3UUFA 4CODB 3CEMA 1WPRA 4Q82A 1V8BA 4Q9AA 4UFOA 4C88A 1C3XA 2IBMA 2WU0A 3ZVNA 2Y66A 4Q1VA 4OK3A 4S35A 1WM1A 5AVYA 2QZSA 3BC1A 1C3VA 5A6SB 4BV9A 1IHXA 2NAFA 1N8SA 1OFUA 2CLOB 3B9BA 3N7TA 4NJOA 4B6RA 4EYKA 2I2DA 4W5OA 2PJDA 3D43A 3KZXA 1GNVA 1OFVA 4HWRA 4IXTA 3GLFA 1AUXA 2X22A 1V8DA 1X77A 3NHLA 3QVGB 2OCIA 1DSSG 5BRJA 3CSSA 4EB0A 4X90A 3DFFA 2REXB 1K3FA 5ALMA 3G49A 5DOVA 4FSDA 1O94D 3KDSE 2FA9A 2E5FA 4PYOA 2C2KA 5DYYA 5IDQA 1NG1A 1DQRA 1PW7A 3M2TA 5EZYF 3ZKWA 5ERGB 4HD8A 2QK4A 1N2OA 5BQ3A 1FFXB 2N75A 5K0NA 5REQB 2JFXA 1GYQA 2E3JA 3SZRA 3AHFA 2R4UA 4HVLA 1E4OA 4RW0A 1TKBA 5JCZA 4J1TA 1THTA 5IXSA 1HT3A 4X8HA 4KTVE 1W4CA 1QGED 1UDRA 2H16A 4URYR 4CCSA 1Z4MA 3YASA 2PIDA 2VHZA 5DXJA 4UJ3A 3U4IA 2RHGB 1SUWA 1ZSNA 2IXFA 4GVXA 4JJGA 4TSFD 2YJZA 1JEYB 1QIJA 3IALA 4K7JA 1JPNA 3A1WA 4L5IA 4U9UA 2XLCA 3QTBA 1FNSA 3JRXA 3WWYA 3K8QA 4JXKA 3IT1A 1ZWKA 2R11A 2DY0A 2QOEA 3KS9A 4NNOA 1U98A 4F5ZA 2IH2A 4LMRA 4WDRA 3JWIA 3B5JA 3JQGA 4HQLA 1VIMA 5CT8A 5H3CA 4PG8A 2TSYB 3SVTA 1J5EB 1O9BA 4BVJA 1LNQA 2B2CA 1U9CA 1YQDA 4GC9A 3ZIAA 4JENA 4F6CA 1SXGA 4OH1A 1QAOA 1JYEA 2UVPA 3QFFA 3AXTA 3CW2A 3M9WA 1K4YA 1XOIA 2GSWA 2WU3A 3PDHA 4GGPA 2YJNA 1K6MA 3L1KA 2RB5A 4G1MB 2JI9A 2OP0A 4WZBE 4EB6A 2DFNA 1L1RA 1XLUA 3AM4A 1XRMA 2DBZA 3BMOA 1JXMA 4ND5A 3DWFA 2NU6A 4IINA 4MCIA 3HMQA 1FNCA 2Z3VA 3EG9B 2AJLI 1NBOA 3CCCA 5DW0A 3T41A 1RLTA 2VYND 3VR6A 1CUUA 4CQMA 1DIOB 4TQUS 1GVHA 3ISJA 1QAQA 4ILKA 1N6OA 3H9CA 3WWOA 1U2GA 3W9UA 1R64A 3D3WB 3WLAA 1E2UA 1DUVG 3RT1A 2ZZMA 1M8FA 3GQBA 5M29A 1NNEA 4KU4A 1F1BA 1LDMA 2X6QA 2DWOA 2YNMC 3ETDA 1X7WA 2PTHA 2O4CA 3GV0A 3AINA 2AH5A 1ZL2A 2NZUG 2AOXA 3DAYA 3PDUA 1H65A 3QNMA 4N3BA 4OXKA 3LW8A 4HL6A 1WMFA 2B4KA 5BW6B 3WLNA 3DVLA 1VTKA 3P4XA 5K3BA 2TMKA 3ZHZA 5ECWA 4GVPA 3NBAA 4HQ0A 3PKIA 3KOZA 1PFGA 2E85A 3EAQA 4KN9S 5KNCD 5CFQA 3KWLA 3UA4A 3GAMA 5J40A 3TZCA 1XEFA 3HL4A 2CNLA 2R7KA 4E30A 5B5SA 4B7CA 1D7AA 1SQ5A 1J6UA 4WXMA 3Q9NA 3C7AA 4N7MA 3QIAA 4Z49A 4U4AA 2P2LA 2ZYWX 3EPJA 5KAPA 5DM0A 3EXFA 2QMYA 1JMKC 4FGSA 7MDHA 3V7UA 5J47A 1CUWA 1WCIB 2G9ZA 3EZLA 3O4GA 2ROQA 1X80A 3CXRA 4TKLA 2Q9AA 3GZJA 4WKNA 2EFEB 4ZD6A 1DTWA 1OD6A 1LQ2A 3QV1A 2OV2A 1EXNA 3HUEA 5HFAA 3K8ZA 1VCHA 3VAYA 3MCAA 3GFPA 4J0DA 4KXXA 4LA4A 4NENA 2CBZA 4X1KA 4YK7A 2X19A 4I4NA 2VUTA 5MGNA 3NVKI 1L5YA 1Z35A 1E0SA 4GUDA 1KK2A 5AK0A 2R6R1 4M9QA 1OASA 1W5AA 1BD4A 3N2LA 5K3EA 2I5PO 3THWA 4MR8A 1LVUA 1Q2XA 1M6EX 4QDKA 4DM4A 1QO7A 2OCLA 3E3AA 3K31A 3PNPA 2G40A 1G3UA 2I8CA 1W9HA 4JYCA 1O1YA 3SYTA 4DA6A 3FWNA 4LYJA 4OPMA 4B6SA 4LVNA 1GGEA 1JHOA 4RAOA 3V48A 2C3UA 1JKXA 1B1CA 3EVNA 4OHWA 4LVUA 3QELA 3HSYA 4JI4B 3GQBB 4PLGA 1QF6A 1N6NA 2BZ0A 3ZH9B 4JLUA 2V9PA 3WGUA 1RLUA 2WU8A 4TTRA 3LC2O 5AESA 1ZMRA 2R6DA 1FFDA 3ZH2A 3DHYA 4H7DA 1VHQA 3RBAA 2ZKLA 5C8YB 2D5LA 2EFYA 3G9QA 2OR3A 2VK1A 1PBNA 2VXYA 1CX9B 4WZBA 3WS7A 5BV8A 1EQUA 4P4TA 3FYUB 3E8SA 4WASA 4W1RA 4A36A 2O5CA 3AOEC 4P4UA 3ZE9A 3TXAA 2AZ4A 3PDWA 3M5CA 3GWZA 1VSUA 5MN4A 1NFRA 1TZCA 1I3KA 4WFJA 3QVKA 4I1RA 3ZHYA 1WY7A 2O8VA 2YFHA 3INGA 3TL3A 4HNVA 3V1TC 4RTKA 2LIPA 1MV8A 3I8SA 4BV3A 1DVRA 4UEQA 1OAOC 1TCUA 3SOPA 3ZW9A 4YRGA 1JQEA 2C99A 5I8PA 4GD3Q 3TJRA 2CY0A 3UCFA 2WQ7A 3DMFA 3FMFA 3QEMA 2D1QA 3DGFC 3KJEA 2DKOA 2PLWA 5AM4A 3QPDA 2QDXA 2FMTA 5A4MS 4YQEA 3L6BA 2OORA 5KSZA 4K9QA 2CLLB 2ZJ6A 2H1WA 3CZ4A 3DAPA 2DR0A 2RHJA 1YJXA 5B55A 5AW1A 1YUMA 4YCAA 1Z4KA 1XTRA 1GN9A 2N0SA 3HQ4O 2XBUA 4KGDA 4DSTA 5FTKA 4NCJA 2FR8A 1K88A 1MPXA 3RIXA 5CDSA 4Y9TA 1ZK4A 2OGSA 3NDPA 4FOLA 4HVAA 2XIQA 3HR4A 5AW5A 5DEIA 2WIGA 3HE3A 1EHYA 2JH8A 4KAJA 1EFVB 2GHQA 3K8OE 1PFUA 2MINB 1L9KA 1XXHA 3JAMA 4OSPA 2R1UA 3DEHA 1SZPA 5E6SA 1E3QA 5CB6A 1BE6A 2V03A 1G6KA 1QP8A 1Y34E 2IJGX 1TQHA 2P79A 3UH1A 3MA0A 5L6LB 1I2AA 1OGIA 1RHRA 5T5QA 2VDOB 4YRCA 5ALEA 4JT9A 5LP6B 4BNKA 1P3DA 3RFVA 5L53A 2OQRA 3OPMA 1VIVA 4O33A 1RYZA 1VBMA 3E2PA 4Y9SA 3FVVA 3QGMA 2WZBA 1Y5LA 4HDNB 1NUAA 3ZE0B 4YB8A 4B3SB 2X6TA 3ECAA 3PGJA 5PNTA 2VP3A 2QLMA 5HQTA 4PGMA 1SCDA 4M2LA 3D4LA 1YJBA 5A4IS 3TLMA 1JFVA 1TZ2A 3JD1A 3RYCB 4I5DA 3OETA 2Q3HA 4KRXA 2YMLA 3SMVA 4N54A 2WINI 1EDZA 1LDBA 4P0TA 1RYMA 2RCYA 4X7PA 2HSZA 4LFCB 1TU0A 3RI3A 3HFJA 3ZLTA 1W36D 1WBDA 5ADWA 3SGLA 1V1JA 1R9MA 1V4NA 1Z2NX 2YZ7A 3I42A 3HJRA 4KLCA 4NU0A 2V7PA 3RRXA 5BW4A 3UGJA 1IBRA 4KSBA 2BHTA 1KA9H 1U2GC 5LVAA 4FHGA 2RI6A 1D2HA 1T6NA 3GLQA 4R2WA 5KTKA 2W6ID 4A73A 4DDTA 2JLVA 2VNSA 3B52X 3LBFA 3OHPA 2WT8A 2IY9A 2HEIA 1V16A 4MARA 1KOLA 1Z83A 4Z54A 4UMDA 5D1HA 2Q9CA 2JFFA 3ILSA 2YCBA 1XJCA 2N46A 3UJ7A 5LMUB 4PPNA 1IK4A 1GZSA 3KQTA 2HPVA 3EGIA 4J16A 4ZYXA 2UU9B 1OC4A 1E7SA 2QRVB 3SLKA 3BJMA 2IOFK 4IDAA 4Y6OA 1KO7A 1TTQB 4MZDA 1G8AA 4GE0A 4O1IA 5TB5A 1N2SA 4DSOA 4EF5A 4LY0A 4MB0A 2ZIGA 3IIKA 4J2HA 2HRDA 1C5KA 1NV8A 2N9UA 5EJAA 4KI0A 3H1TA 1YF3A 1AKEA 1EE9A 4AKEA 3HCBA 3JASB 1C7ZA 3VSAA 4BLUA 2Q4EA 4C4ZA 4JMPA 4MGIR 5FTLA 3IXMA 4JLKA 3U9LA 1E7WA 1NVTA 3EDOA 2A0UA 3HCWA 3ZDBA 5UKDA 3U19A 4MW5A 3RC7A 2Y1OA 4ZU3A 4ENUA 4WBNB 2HHJA 2IYEA 1JQAA 2V98A 4ZPXA 5KMGB 1Q15A 2CV0A 2C2HA 1T9DA 2IU6A 4EZBA 5LOVA 3SG0A 2BFBB 5JOQA 5KWVA 3PVCA 3K70B 1EYZA 3GJSA 3WLFA 5DNEA 4MHTA 1A5SB 2QW8A 3M4NA 5FR2A 4RU1A 4ZYLA 2F55A 2UDPA 1P7ZA 3S4YA 1GPWB 2JLBA 2BHLA 4MVJH 4RV5A 1QIGA 2VJDA 2MSEB 4A7PA 4GZMA 3K9CA 1P17A 4PG7A 5ITVA 3ADCA 1Y7HA 4I1SA 1Q14A 3Q87B 2A14A 4L50A 4P80A 3WOVA 3FPAA 3TW4A 1Y8AA 5J4LA 4UDNA 2CMHA 2QRMA 2OBLA 5DKFA 2FZEA 3UB3A 1JBKA 2H2HA 2VJQA 4AYTA 3KYIB 3K5PA 3E18A 3EUWA 3ZUPA 5TNXA 4G65A 5YASA 1XDGA 2C2YA 4I2VA 4LXYA 1IUNA 5IJ0A 3OSZA 1RKBA 3JY6A 4PCUA 4LJAA 4TS3A 2O0MA 3EY4A 1E5QA 4HN2A 1YQXA 2A35A 4IPTA 4FP9A 3ZJUA 3FNRA 5I7UA 1C9YA 3DUFB 4HUTA 4Z6KA 1Y8QA 2XKBA 5HTKA 4Q19A 3WDKA 3C4VA 2OILA 4H3KB 1J0BA 4DR2B 4PGGA 2LV8A 4ASUD 1GZVA 4YALA 2OZLA 1I10A 3H1AA 1JT2A 1ZH2A 4UM9D 3I5UA 3V4VB 4AW9A 1KEVA 3I4FA 4QBTA 3DP7A 2JHPA 3RK4A 4MJ7A 2J33A 1X7WB 5CVJA 1Q16A 5E1OA 4GWGA 3DAOA 4BNWA 2C9ZA 4BBZA 4QGHA 2PXXA 1QC5B 1WR8A 4MLZA 3QFHA 2HTEA 3DDOA 4Z7OB 3L06A 5I48A 1C0LA 4D82A 2RG7A 1OR8A 4YLYA 4DV2B 1W6RA 2H57A 2PRKA 2QQGA 3OZFA 2XUGA 3BMQB 3D1JA 3LY8A 1T5LA 2Q07A 1AQLA 1H4TA 1RR6A 2XQVA 4IRMA 4QOGA 3U44B 1IXZA 2KE5A 3OMXA 3DOIA 3LXRA 1NBWB 1PHPA 1PZNA 4LC1A 3QVVA 4MV4A 2XD9A 4RFSB 2PR2A 3KLBA 4HB3A 3OP1A 4OAPA 2QVLA 4H6VA 4HDKB 1TKAA 1BO6A 1CEXA 2PKEA 3L40A 1DIGA 3N2KA 4FYWA 5JQWA 3P97A 3B1VA 2YWHA 2OCDA 3H9JA 1IG3A 4JUBA 2X42A 3HVKA 4AZ3A 5JD3A 3RRFA 2VK2A 5BT8A 3OQMA 5GONB 4R84A 4Q4DA 1A96A 1IN8A 2Y1KA 3JZMA 2O8FB 3V2GA 1IZ0A 4L8FA 2CDCA 1HZJA 2HYDA 1LK5A 1TZBA 4QNRA 2B20A 1U0GA 3WHIA 4YV1A 1V7ZA 1TKCA 1R27A 2FX2A 1SIWA 2R96A 4Q7EA 5IKXA 1JUDA 2JZNA 1JVBA 1P3Y1 1J2YA 1REQB 1UMBA 3OICA 5AHRA 1Y42X 2IUSA 2EJWA 5EOVA 3PQ2A 3VR2A 5B7QA 2XBMA 4AQYB 1VE7A 3GBSA 3HDHA 3M33A 4ARUA 4BE7B 1FJGB 2VDUE 3F6BX 3U4AA 1BDHA 3X44A 1NNLA 1GSOA 1VKZA 3U7GA 4DKJA 5JZBA 3HDGA 5IZCC 1GZ3A 4JSRA 2EFCB 2B92A 2E87A 4EA8A 5IDXA 5AWFC 3ZE6A 1IJKA 1J33A 1EI9A 1E1MA 3LQ2A 2ZTMA 3ENVA 1KOJA 4GPEA 2NZJA 3MEQA 4R9UC 2DUNA 1MOSA 4BKPA 4GOKA 5BURA 1XD8A 2W6ZA 1UIMA 3LTEA 4MRAA 5IHPA 2OPBA 1GKYA 4CLOB 2B4YA 3G2MA 1SBHA 4DM7A 3PYXA 5JHHB 5FUVA 4TKMA 3MYYA 1P44A 3STHA 5AOBA 2WC1A 5AUQA 3WGHA 1Z88A 5I6DA 1R9GA 2AZDA 2HDNB 1SOVA 3EC1A 3FXAA 4P82A 4B83A 1A9XA 2XGJA 3ZGZA 1OSNA 2GYVA 4HX5A 3STXA 2ATEA 4D9IA 1E9FA 1DAGA 1QV6A 2FZCA 2NWQA 4UASA 4X1IA 5HKBA 2ZTSA 5CLIA 5CBPA 2CLIB 2Q41A 3KXKA 4KYIB 5H81A 1E60A 4A0GA 1KWGA 3VO1A 3B38A 1SKMA 3NYIA 2Q1UA 3A4LA 4K0KB 3VU1A 5P21A 1F3LA 2IYRA 1QHHA 4EENA 3IBCA 5FYDA 5BV0A 2DQ4A 4C0QC 1F6BA 4ZODA 1W5SA 1YONA 4QZVA 3VMFA 4IV8A 4QULA 2Y99A 1T2VA 3EIUA 3I3SR 2YWRA 4XB2A 4ZTBA 1G9TA 3HR7A 5FNZA 4G0PA 3TGPA 1NFFA 1P31A 2W6JD 1ZHFA 2VJAA 2YXDA 3GJTA 3U61B 1FXUA 4R68A 3W4IA 1W1IA 3BWBA 4KNWA 5BXYA 1H3EA 1ATIA 3LC1O 4PHCA 3KXIA 4R1MA 5F4ZA 3Q0TA 5G0SA 1NQXA 1SXIA 1FDIA 2B78A 4KK3A 2NTEA 2H5EA 3P45A 4M9UA 3QF4A 4ZDWA 5TQJA 2RE8A 4MVJD 5EAIA 2Q5LA 3DOFA 3DZKA 2R7NA 1T4CB 3FYUC 2ECPA 3T1VA 1A9PA 1ACMA 1FRVA 5DBFA 4EHKA 4EGCB 4EHFA 2NTYC 4KYUA 4FMCF 3Q3CA 5IXJA 1XEWX 4PPGA 3MQ4A 3UK6A 4KQFA 5CT4A 1N0VC 4G0OA 3FNEA 1Z8FA 4DIOA 4CIBA 1ADFA 1PUXA 3H2HA 1RKQA 3UMCA 1HLGA 1ONNA 1TVEA 1V2GA 3C48A 3OY2A 4UVDA 4R0NA 1RI1A 3RVJA 5F2KA 2HBQA 2ZTUA 3NHWA 2Q5JA 3T9EA 2YIDA 1E5TA 1M2NA 1N2GA 2DGDA 2H1SA 1ZAKA 2PEYA 4ZQEA 3EQ6A 4K9RA 4UNPA 4TRRA 1E1KA 1WLSA 2VAXA 5JSZB 5JJ5A 3H75A 1LU9A 3OTHA 4BMYA 3AEKB 4X7BA 2QX9A 5F35A 4MQMA 2EEZA 1X0XA 2AX3A 1P60A 1W2GA 2LW7A 2WWRA 4MV0A 2DQYA 1L5KA 3BKWA 4YAIA 4ARIA 4PO1A 4PCLA 1W36C 1RAIA 2XUHA 5CCDA 4DRYA 3GZTB 1JEYA 2A1TS 2LCIA 2CSXA 2LE0A 1F8GA 1K7YA 1RWWA 4P3XA 4BXOA 3RBXA 2WF9A 3U17A 1XPOA 3GPCA 3KJZA 4DANA 4DXHA 5L3VA 1SVKA 1G8GA 3GDHA 4O29A 5L45A 1FUYB 1UEJA 1TD1A 1H4VB 3DT8A 1SZCA 3GFBA 3IP5A 4LAFA 2Q8QA 1QG0A 4LJSA 5HQ3A 3I9FA 1Z28A 2ADFA 1TK2A 3PXCX 2NSLA 4L75A 1ABFA 4OQLA 5ADHA 3T1QA 1X7HA 4ETWA 3FHTA 1CHDA 4PC7A 2I62A 1IHYA 1P91A 3X1JA 2DHRA 3V8VA 5A4FS 3JQEA 4MW2A 4GZ3A 1X3SA 2XHZA 2YWDA 3LA6A 4NLLA 5ALJA 3QNWA 2ZB8A 3DDSA 3HI6A 2XT0A 3MS2A 4YRAA 5LLDA 4OMCA 3CNQS 4M0MA 1HDOA 4PFSA 2FMKA 2CMGA 1TM3E 4JLNA 5DTRA 1PT9A 1QQTA 4Q6WA 4W5JA 5TQ2B 5KQPA 1MENA 4UATA 2DVMA 5K3CA 3NHRA 1Q0TA 4IIVA 2XVXA 1LJ8A 2UYHA 4MYDA 2FWMX 1TU3A 3KV3O 1QPGA 3A7DA 2D1RA 2YVAA 4YJGB 5DHFA 1S89A 2AMLA 3CH4B 1P4AA 4B3FX 3RASA 4CUKA 3MF4A 4YJKA 3SBDA 4EBBA 4R5MA 2J3DA 2AD1A 4C6SA 1HL3A 1UK7A 3PBKA 2GYUA 2OP1A 4J6FA 4J94A 3BQNB 3INRA 3O1HB 4M0EA 5BNIA 2GHRA 2C42A 1SCNE 2ERYA 3DL2A 1SU4A 3ESBA 4F3RA 3K8YA 3OF2A 4HB4A 4O3FA 2BGRA 3V55A 4HNTA 5AKZA 3UTDA 2YICA 4OH7A 4RDHA 3BULA 1KYWA 2DY1A 1UXHA 3BHIA 3PENA 3LUJA 3EIQA 4RLHA 2OFPA 4H7FA 4OQPA 1QE5A 4UNQA 3EPPA 3N39C 4FE3A 3ORSA 2VDJA 2X8JA 4LW8A 3B7WA 5A4KA 1ZM7A 1D8TA 3PFBA 4YH1A 5JWRA 2QEQA 4Y9RA 2XB6A 4PNHA 3HGTA 3WY9A 1UL1X 1RQNA 3BH6A 4LXGA 4UNIA 2PD6A 5CEJA 3TK1A 3WDSA 3K92A 4Q15A 1C4XA 3KQUA 5BOVA 1M7BA 4CMKA 4ROTA 1Z6GA 1P75A 3A6DA 1DX4A 4U39A 3PKZA 4TKVA 4DQLA 4O0LA 5E7IA 1VOTA 3KIPA 3TQHA 1N6PA 1WU7A 3PWTA 4NZNA 2R5NA 1JHAA 3MC1A 5EWLA 4D43A 1R5NA 2CLCX 3FNIA 2BW0A 2WFZA 4QSMA 4Z8YA 1H2YA 2ARKA 2E4VA 3OF3A 4M8KA 3O8RA 2ZWMA 4J7AA 2DFDA 3MUOA 1GVNB 1UPCA 3H8VA 2J5BA 3OLVA 1MEOA 1NN0A 4OXYA 2J0UB 2QW0X 1X7XB 3M70A 3N75A 4DCVA 1W52X 5AVOA 4CL2A 3QX8A 2M32A 4IM7A 2IOQA 3SCZA 4B80A 3QW2A 3T7CA 4K40A 3DFIA 2FPUA 3E8XA 3L1UA 1NN1A 3H87A 1XTQA 3L6UA 3Q40A 4N7BA 3IQHX 4O4IA 3AEKA 3DWIA 5FPPA 3R6WA 3ZV4A 2C9YA 1V1RA 3IHLA 3JWPA 3M4JA 2OYCA 1AKWA 2C04A 2GZ2A 3KKNA 3OURA 2WJ4A 3LHDA 1JXOA 3HCPA 4G8CA 1SKYB 2AI1A 3KSZO 4MMZB 1CJSA 1V9CA 2AT1A 5JYDA 3SJZA 1ADYA 4XX0B 2ZRNA 3V1NA 5KYXB 1CJUC 2BR3A 2OG2A 4NBNA 1G63A 1FC0A 1QH8B 5CM2Z 2XCUA 1HTBA 3L1JA 3BMXA 4QEDA 2DPGA 1A5BB 3B1ZA 1BJRE 1AY0A 5DM1A 3R7WB 4AP5A 4BQPA 2A5JA 1F12A 2ZJ7A 3EGCA 4NOKA 4BECA 4MWTA 4ZIRA 1IEQA 1H0HA 1ODTC 3N0RA 4YJFA 5KTRA 3OQNA 4QT0A 3D6UA 4OSOA 2EKQA 1C3OB 1G19A 2OT3B 4C4XA 3PU6A 2YHIB 1ITZA 3QEOA 2W2PA 3PC8C 2WNSA 2HF2A 2BVNA 4H17A 3OBIA 3A6FA 1U0NA 6ADHA 4FFBA 5B1EA 4YY3B 1LRJA 5GINE 5HKAA 4HPJB 2QLFA 3TUJC 4B79A 4B3HA 3JTEA 5JSUA 4HB0A 2PGXA 4FDVA 4YROA 4ABYA 2FHPA 3SM3A 1KU0A 3IOEA 4FVTA 4F8EA 1F5SA 2RSLA 1KS2A 5C7LO 1L8LA 1T9GR 5EPUA 4R6XA 2ZW9A 2I99A 1UJ6A 1U2PA 1VQ1A 4RVFA 1IG0A 3DPIA 1WUHS 5ALFA 4IIXA 3KC2A 2VRCA 3E0XA 4V2IA 2XKAA 1YB6A 3NKLA 1C7RA 3TSAA 5I7VA 5A9RA 1KTIA 1BDMA 2XOKD 3FWYA 4FBGA 1E9CA 2V6JA 2VNAA 1XXHE 2IZOA 4Z7NB 4LG1A 2Q2VA 3CM0A 1TJYA 1SRRA 1Z7EA 4L8YA 1ZBDA 3FDZB 2A9KA 1KVUA 3SI7A 1HC7A 4V1CA 1VE5A 2H4YA 13PKA 1DDOA 4LTNA 2JB9A 1HLDA 5FT9A 4GM0A 1I24A 1CIVA 4OGFA 4JYBA 4AB1A 5FEUA 3I6QA 4HG2A 4MJ3A 5IDYA 2JDIA 4IOLA 1AN9A 5CLJA 4RTOA 3JAWA 1TI7A 1MRSA 5JPIA 1BQ4A 4RJ2A 4UAVA 5ARCA 2GPTA 2XVZA 3NHKA 2W2LD 5BNWA 3ZWCA 2HOQA 3RK0A 5TS2A 4DV3B 3S1AB 3M82A 3P2OA 3GOQA 1F2VA 4WESA 1R6VA 3DBIA 3H5OA 4KR0A 1VIDA 1TA0A 1SD1A 1W59A 2CJWA 3EPLA 1C8BA 2FB9A 3PXGA 2WAAA 2XF8A 5ALOA 1Q6YA 2DKNA 2PBFA 4RK6A 4UUBA 3AGPA 1NMQA 4BFXA 3AL0C 2J45A 3GC6A 5J2TF 4BQIA 2ZPAA 3RUPA 3S2YA 4I4TA 2WYUA 1Q83A 3QTLA 4JLMA 5DNWA 4JASB 4F9GA 3IA7A 3AHGA 1FYEA 1N36B 5J5CA 2ZE5A 3LX6A 1G0NA 4NIMA 3DKKA 3S1AA 1DJMA 3H9EO 4N3NA 4GBGA 1OZGA 2I4OA 4H7KA 4IGFA 2J3KA 4KLAA 4EZIA 2YY5A 2VQEB 1ZN8A 3HCNA 1UMDB 5GAJA 1OXSC 3BGSA 4QQNA 1J2TA 3OAAA 4L02A 4C4PA 4P86A 4Q12A 4DQUA 3E9ZA 3MILA 4ZT3A 3FFTA 5FHRA 3BRWA 3WV5A 3Q7SA 3MELA 3R3ZA 1XX6A 1XZBA 1Q19A 2MMGA 4ZVPA 4GYYA 3L43A 4NDAA 2VA9A 4GP6A 2BAGA 1T1RA 4WEOA 3NALA 4V1CB 2IXGA 4UUPA 1B74A 1VE6A 1Z4LA 4XR9A 1E1LA 1HEUA 2J3JA 1K75A 2VQ6A 3C7TA 4I8IA 5KNLA 1JHZA 3BXOA 4N9WA 4YDQA 3MW8A 2F9MA 3VHQA 1HTTA 1BMFA 2Q3BA 2PRSA 4J4HA 4OJKA 2V7TA 3FRJA 3R5KA 5BWCA 1ZITA 3CG0A 4ENQA 1PG5A 5CXUA 3EPRA 2JW5A 3CE6A 4TSFA 3OCZA 1EB9A 5ALPA 2WAOA 3P0FA 4IDDA 4N7JA 4G24A 4ZCLA 3OU7A 2EYUA 3S81A 3I6YA 1O57A 1TTTA 1PSDA 4LFAB 2ZJ8A 4BCDA 3PEFA 1PBTA 3ANXA 4BLVA 2NZ2A 3R0QA 1D5WA 4P32A 5EQTA 4GDFA 5FULA 4WKPA 1NJ6A 3LVRE 2BGLA 3BOSA 2R8PA 3G7SA 3AEQB 3INYA 2JJ8A 4II7A 4R2MA 1SXJC 3VPAA 4AY2A 1CJMA 4ZCSA 3UAYA 3LGXA 3K3PA 2CNOA 4OHXA 3IS3A 5EIWA 1GQOA 5CFPA 1KI6B 2ZYHA 7AT1A 3D8BA 1E1DA 2A58A 2YQ5A 2E1RA 3D0OA 3LLSA 4LJ4A 4ZZIA 1YS2X 4NL4H 3C6YA 4RJIA 1GKKA 1EGQA 1YIOA 1U0FA 2WDPA 3O4IA 3B3AA 2QUKA 2W2KB 4G4SP 2HDWA 1G8PA 4AFNA 1BH6A 5EA2A 4EKDA 3C6BA 3CW9A 5JFTA 4LJ6A 1TAHA 2QV0A 3TIFA 5AM2A 4OBXA 2REQB 1EDBA 1CNMA 3HDJA 1XZFA 2P2CA 2ZSDA 5K7SA 2C2GA 4QVGA 2ZWVA 2HRBA 3F6CA 1SNYA 3PPVA 3BRSA 1PD1A 5EZ5A 4M8IA 3JSAA 1MC4A 2BM9A 4XJTA 3B1XA 3BGDA 3ROZA 3VX3A 4AZ0B 5C3MA 3A2MA 4R8SA 5DU2A 1T1JA 3C8UA 3QE4A 3A9RA 4P7GA 4TRJA 3HGMA 1ZG3A 3TI9A 2ZZKA 4IGKA 5B2FA 1II0A 4ZO9A 1P2DA 2VYFA 2HX1A 3TIVA 1BWSA 3R5HA 1JZTA 5GWXA 4UZSA 5ICEA 1CUDA 4REOA 1QQ7A 5K8TA 4WX2B 4PNZA 3ZWYA 3KL4A 5EKXA 1U3TA 3GELA 2WE7A 3TSZA 4Q9IA 5CFLA 1P0PA 1R8YA 2ECKA 4H7JA 2L82A 4TS1A 5EPOA 4E15A 2WHPA 2Z43A 4MV3A 3QVSA 421PA 1M1YB 3IH5A 4AP9A 4MP8A 2XSZD 1DKUA 3FD8A 4O4JB 3WLHA 5FIUA 1JLKA 2WMNB 2XUDA 4E22A 1CUJA 1YDWA 4MKRA 1VG8A 3U3OA 1I6MA 3U37A 4CMGA 1AS2A 1TM7E 4D9EA 1J8FA 4FOTA 2ZRBA 3V1KA 1N3BA 2E4WA 3KQNA 3AR9A 1P1FA 4DBLC 2INGX 3T3PB 2H8GA 3V7FA 1KORA 3UYKA 2PZLA 3JV7A 4E6EA 4KGZA 3ZY4A 3NFYA 3QYAA 4MROA 3OZTA 1UKAA 1IOVA 1GNPA 2QXUA 4OV6B 3HG7A 5BQFA 2CFSA 1FU4A 2AI3A 3UMBA 2QAIA 5LB4A 2VEOA 1QKIA 3E9YA 5TEVA 4YT2A 1IXRC 4OHPA 4QXQA 3IAM1 1JLLB 1BCRB 1B8PA 4O1HA 4D9BA 3VVMA 3QE9Y 2ICAA 4NECA 1C2TA 1U2SA 2FMFA 4JKIA 4AY3A 1Z5WA 3AZOA 3C74A 3GGPA 4OJMX 2QORA 3SP1A 1JDTA 2YV4A 4C2TA 5LU8A 3GZ4A 3NC4A 3SZLA 3GRFA 2QL5A 1RWNA 2XV1A 3NKFA 1LQUA 3QWFA 2BISA 4A5OA 1P2SA 4MR9A 4UXJA 1QFYA 1MW9X 2LP4Y 2VSOA 3DZFA 3IVMA 1Z26A 3LP8A 4BO1A 3AV0B 3C8MA 4FGLA 1EUZA 4NJMA 1V6AA 3PXAA 4BNFA 5IT9A 2XITA 1KMHB 2IVFA 4QKQA 3QLUA 3SQOA 3ZE8A 2AVDA 1ZD4A 2WFMA 1A27A 1XD2A 5C18A 2QJRA 1A98A 4GI7A 4BQEA 3NT4A 4HYYA 3UGKA 4JI2B 1M2KA 1QP0A 4E5UA 2QI9C 1DC4A 3IEIA 3ENKA 4RMHA 5I9TA 2B3TA 3AJRA 4CGYA 3MFYA 5FWYB 3SHTA 2P67A 3FCAA 4CBVA 4Y2QA 3M5PA 2Q4DA 3MVEA 4Z3OA 4RTRA 5A3JA 4AUNA 1FP4B 1EVJA 2POCA 3WLOA 4PWYA 1X1DA 2C3OA 2MT9A 3ZDZB 4EJSA 1E96A 1SA0B 4O2BB 4C6RA 3VR1A 2D2VA 3HNPA 4INZA 4LN1A 2OHVA 5CJJA 2PMDA 4YS6A 1L7VC 2C2MA 3DHWC 1G9SA 2WJIA 1YAHA 1R1DA 1U6IA 3WO0A 4NBKA 1ZISA 1RM3A 4D1YA 4YRIA 3AUYA 2REQA 5E9JA 3IXQA 5A5VA 3K6RA 5AK3A 1NM5A 2ISSD 3ICWA 5H9WA 2QD4A 4FONA 1NF8A 4UVGA 3S44A 4HZUB 3NG1A 1FSSA 1WMEA 1I1NA 2ZIZA 3OKCA 1HDXA 4XD7D 5C46F 2P6PA 2V8BA 4UTNA 3U49A 3C0KA 5JS6A 2ZBQA 4BXOB 1S1CA 3H19A 3U13A 4CKWA 2V7XA 4D7AA 2R84A 1QTQA 1TB4A 3GRUA 3F49S 4P38A 1FTWA 1VBNA 2IHZA 1JDSA 4BATA 3LZDA 2RCNA 2WF8A 1TVKB 2O2ZA 4KI7A 1OREA 3FPKA 5F7XA 3V9PA 3NVMB 4UNNA 5F51A 3DPSA 4BFUA 1AU9A 4ZVMA 3PHLA 2I33A 1CB7A 3TTVA 1XJ5A 3LYAA 2XLBA 4QJ4A 5HS4A 3BIFA 3DBHB 4RADA 4ZJYA 4HFRA 2BR4A 4U7TB 1Z18A 4CFYA 3R3HA 2OBYA 2AEFA 3SMQA 5BVHA 3DLBA 4QNMA 1JDJA 4M4SA 4LDRA 3R5XA 3G0OA 4UDOA 1MQAA 4NULA 2HHLA 5HCNA 1P4RA 4EB3A 7GPBA 2OZKA 4L4XA 5ICFA 2GHTA 1JKIA 1TPYA 3UHAA 5HIMA 4DM3A 3U2QA 5KHOC 4WK2B 5IKOA 4S04A 2C8VA 3V7NA 3L05A 4C4SA 3EG9A 1MVNA 4GSKA 5C0OE 1M6HA 4JYMA 4FNOA 1NF3A 5TQ0A 3OUZA 4BNGA 1JNYA 4YXFA 1QTIA 4DV7B 1KJ9A 2Q1XA 3FAKA 2I3ZA 4IR7A 5KDOA 2C61A 4QDOA 1KP2A 2P1DA 3G0DA 3QKIA 4WJKB 3P9ZA 2ID7A 2F8LA 5FTNA 1K5HA 3TPCA 2O1SA 5HIAA 2ZXEA 2YL2A 4I99A 4N03A 3NHYA 4PW0A 1O9HA 4AG5A 4F6RA 2JIOA 3IAS6 2ZTVA 3CX8A 2W93A 4ZICA 2CNNA 2ZIUB 3ZXYA 1TTHA 1LLCA 1WHSA 3KVYA 4IVPA 5JSYA 3TJMA 1P0FA 2V65A 1A2KC 4Q7LA 5DGHA 2XJ4A 2CDRA 3DULA 5FNVA 1NUPA 3SHOA 3QYJA 1WSDA 3O4RA 3PDCA 5CNKA 1PO7A 4AIRA 2P9CA 4BNIA 1YR6A 3HXOA 4M0FA 1XTTA 3MOIA 4BJ3A 1N2ZA 1QX3A 4RPGA 5DCYA 1XCJA 3NOQA 3KJHA 2OCPA 5BN4A 1I6KA 2ERXA 4GP9A 1DADA 1VGRA 3T95A 3RWMB 3NNNA 3FYDA 5AW4A 3WL8A 4CV2A 3SE0A 4HMOA 4D46A 4FEAA 1IULA 5JO0A 5K0EA 1RPNA 4D8UA 4D5EA 4ON9A 3D4NA 4TMFA 2QTBA 1L7QA 1OI4A 1U5BA 3E0QA 2ZIXA 1R5BA 3CH7A 4RV9A 4OK6A 2JLYA 4EJFA 3EIXA 3E1KA 4R1UA 2B8JA 1N2IA 4K9OA 4LHEA 4YFYA 5AVJA 4P0PB 2GDJA 3E9NA 1F9AA 4XFDA 1P62B 3RYFB 4OKSA 3LQQA 4RF3A 4FCTA 1MNQA 3HWSA 3JQFA 1SEVA 1JIJA 4JA0A 2I71A 2PSSA 2NVUB 5JSHA 1K63A 3N2YA 4GMKA 5ECDA 2W6MA 1XVVA 4DBVO 5KJ6A 4LF9B 2X1HA 2JC3A 1VIYA 2D2XA 3MNFA 4QLBA 3NR2A 1RP7A 4YASA 4QEZA 4QLAA 5FP0A 2O52A 1XLWA 1ISFA 1R8QA 4UE3S 2NZ8A 3VAAA 2PX0A 1DE0A 3IT3A 1A50B 3IQEA 5EMHA 2F1OA 1GRRA 4UEKA 2AVNA 1V7QA 2ZSUA 3D2BA 1OAOA 2OAGA 3BWYA 2ZREA 1CEYA 1EESA 3LGAA 3Q3HA 1D09A 3AF6A 2JHFA 3CR7A 4M7OA 4B35A 2G4VA 2TECE 3L8EA 1E8MA 1GTRA 1XD2B 4OAQA 1A9YA 2NO0A 1XVIA 4JLVA 5ELMA 2XGSA 4DLTA 2Q1SA 5INTA 1SBIA 4IIJA 2Q62A 2IYTA 3RSZA 1WZNA 4O6VA 3EQ7A 4CKCA 1W1WA 4TM7A 2EFHB 1H5NA 2QA5A 2CZQA 5EG5A 2P6RA 1DV2A 4YR7A 2FP4A 2JEYA 2C4HA 3Q7RA 4I6GA 4EYEA 4AKSA 4YCNA 3KSRA 3EUAA 2A94A 2OBXA 2WIBA 1EWVA 1L7RA 1P1BA 3REFA 3EWNA 1MORA 2SNIE 3W9BA 2OHFA 4R16A 1J9ZA 3RQSA 4V24A 1UFVA 1VC2A 2FPKA 4YJFB 4C7VA 1L5QA 1XIVA 1M83A 3F0TA 3M3PA 1DXHA 3JPWA 4J1TC 4NMMA 5D3ZA 2IUUA 6GPBA 3EJ6A 3ZLUA 4RVNA 2F9FA 2Q4BA 1A9SA 1EIZA 2XXJA 1ZD5A 1D2AA 2IU3A 2VCYA 1DX9A 2ZCUA 4G63A 2OSVA 4B47A 2VZ9A 4O08A 4BMSA 5FAKA 3EEIA 3QU9A 4V0MA 4RD1A 4EHNA 2FV8A 3WWDA 5HIJA 3FGNA 1O87A 2RGWA 2X8LA 4IJWA 2C7RA 1KZHA 3K9GA 1W2WB 4DDWA 3A37A 2YC2C 2F1RA 4DEVA 1PT6A 2CKDA 5C8YF 5KSWB 3A1EA 2NYVA 5K51A 4JEMA 1Y8QB 4RUKA 2JLAA 3R9WA 4GI5A 1NYRA 2GM4A 1OLXA 3CUYA 1ULAA 2A7QA 4MWGA 3H42B 4YUYA 1WZIA 4RKRA 2AWNA 3GZNA 2QTLA 4DR1B 2H65A 3N6RA 4I3FA 3ELBA 4PX2A 3BHJA 4A1FA 2BHSA 4S3MA 4D8TA 1KPHA 3W2HA 4W9NA 1OBFO 1ZMTA 3FTPA 5CURA 4Q24A 3RS3A 4KMSA 3TLBA 3GD5A 4CV0A 4QX6A 1MT3A 1KI8A 4M87A 1P1KA 3BWMA 5LXTF 3I8XA 1XF1A 1N7JA 2QWXA 3GLHB 4G5YA 4KQ9A 4MINA 5AYVA 4DLKA 1JKJB 4OLAA 2VZEA 3P5SA 3VR3A 5EZQA 5HNKA 4WK6A 1R9NA 4Y2RA 5EIBD 4P84A 5ER9A 3IKTA 2D00A 4XGNA 3H13A 3L77A 3LRPA 1NVEA 2IYXA 3ETEA 4G01B 3PP8A 4DLLA 3LUGA 3O03A 1YHZA 2IODA 4FLMA 2VYVD 1XQ6A 2BCJQ 4KQWA 4XE5A 4PE5B 1M0EA 1LW6E 2PU7A 3LRXA 3O31A 4LEIA 1APBA 2VK8A 4HTFB 2BBOA 1ZSYA 3FRHA 4LFBB 1Z68A 4C2AA 4BNDA 2VPIA 2BMJA 2XNJA 1LH0A 3LBAA 2QLJA 5J59A 4TZ0A 2C20A 1PQWA 5CT6A 3EIHA 2WD9A 3LYUA 4FINA 5T4EA 2RBKA 1VJRA 3C7CB 1BRTA 5H3LA 4F2HA 3LF2A 2WYWA 2F1HA 3BRWD 5KPJA 1VSTA 1RBQA 2CUNA 1B0UA 3ES9A 1DJLA 3UJDA 4UMFA 5CA1F 3R7FA 2I1WA 3AI3A 3FWZA 2HYIC 3A3OA 1GNSA 3IUEA 3FHJA 1C3JA 1FF9A 2LXNA 3R7DA 1DOAA 5I9IA 3FOZA 2IH4A 1L4UA 4NE9A 3HCCA 1IBMB 2XE7A 3TQRA 2CD7A 1CUGA 2YJ4A 1P1JA 4DQ0A 1IEXA 1GUBA 4KQCA 4OBWA 5E6RB 4E5YA 2ISQA 2KWIA 1AHHA 1OLSB 1OMOA 1WXQA 2PRZA 2X2PA 3C4QA 3P9YA 4HI0E 1PLKA 2R6JA 1GZHB 3IP8A 1NGSA 4UUQA 3CB2A 2DPHA 1N0HA 3X1ZA 2ODEA 4G41A 2GBFA 1G16A 1SKBA 2C88A 4X94A 5DEOA 4YJ3B 3UWKA 4FOOA 1M75A 3UMRA 1X15A 3UFBA 2V0GA 2VJOA 3ZWKA 4CM9A 2MIIA 3KHTA 3Q3EA 1BX1A 1L7BA 3OP4A 4I66A 1R4NB 4R2KA 2YJTD 5DHSA 5HF9A 4QPDA 4ALNA 4BWGA 5JYCA 2ODAA 4R01A 4CR8A 3D3JA 5K0FA 4CTKA 1R7RA 2VNKA 3OIYA 3W3AH 4BPBA 2VHQA 3A1DA 2LCFA 1ZNYA 3K35A 3WRYA 1Z2CA 5K6AA 3WGKA 4CNQA 1OBVA 4OQDA 4MQEB 4NX2A 3TW8B 1G2OA 4R98A 3ZDFA 3GG9A 4NZMA 3OJEA 1XRQA 4YUAA 1FFBA 4RFLA 1G21B 2BFPA 1THZA 1VHJA 4IIJF 3GN2A 1RS0A 4DR5B 2A9VA 4ER0A 5JFGA 4JL8A 2BFDB 2HDOA 4PNPA 1A0OA 1O77A 4FFMA 1E64A 1HDZA 1PF7E 1XPJA 2R5FA 2WK1A 4FJ0A 4Q1DA 1VCMA 3G2NA 2V5AA 2CXNA 5HJ7A 1E79D 4N82A 5BN4B 4ZPJA 2QLTA 3E7PA 4Q1EA 5EJIA 4YYZA 3UPTA 4HWSA 2Y0CA 5LQSA 1WXHA 1XQ1A 1Z13A 1H23A 3PUWA 3FFXA 4I1UA 3ZXXA 5C53B 3L8DA 1IB6A 4LXQA 2OMKA 4L5BA 1AK2A 3NXSA 1PJZA 4KVFA 1V11A 5IH7A 5FNVB 4GAEA 5JDIA 5DVZA 1W76A 3N8GA 2W43A 3R0JA 4O8CA 1U2RA 3ZDYB 4K6OA 2YBDA 2ETVA 1D5CA 2BFFA 1RHKA 1K7FB 2C3YA 4EY7A 1CRZA 3ZBQA 4I9UA 1IHDA 5A9SB 2RMKA 3VJKA 2Z2YA 2C83A 2OCYC 5KX5A 4JYAB 3LBIA 2GH1A 2BP7B 2XMQA 5K8CA 1NZFA 1XL1A 1U8YA 5EKSA 3TDMA 3J7AC 5A0FA 3KPVA 4XB1A 1T4CA 3Q0IA 3LF1A 2X0RA 2WTXA 3FMVA 2MSKA 4DCMA 3E23A 3ONWA 1G4AE 3WICA 1HDIA 1SQGA 2C2WA 2GASA 2IGTA 4BFZA 4WZAE 3W3ZB 5DP1A 2IPNA 4R1TA 2NUAB 4QPCA 4ZEMA 1Y6FA 4NFYA 2C9MA 3L0BA 2V6GA 3OC0A 4IKOA 2HRRA 4IO0A 3HK2A 4OO3A 3U5ZB 1FTQA 1JQLB 1ZM4A 5D7NA 4Y1RA 1C1XA 2I3DA 4CKEB 2G1KA 3LP5A 3PJDA 1VCIA 3I5AA 1N8TA 4G0XA 5AVTA 1HE2A 1PSZA 4KNVA 4WOBA 5MN6A 3GA7A 1MT0A 1T0JB 4IXMA 3AFNA 1PG2A 4D9JA 4PLVA 4URVR 4KIFA 1CQIA 1OXXK 5CLLA 3DLIA 3CUWA 3H9QA 4I4IA 1MOZA 4M1YA 5EIOA 3VYUB 4MCJA 5I7FA 2UXDB 4G5QA 1FB5A 3K1JA 2JF0A 1HY3A 5HQJA 2PZAA 4K9DA 2V0NA 1CJVC 1IH8A 2QN7A 1FY2A 1ZICA 2VHCA 2KB0A 2OCKA 2XWPA 3IERA 2EDAA 1NUQA 3BMQA 2AR7A 4BKUA 5KI6A 1V1MB 3GGOA 4RH0A 4ZVUA 5KPDA 2GKGA 4IP0A 4QYSA 1O3YA 2G7ZA 2NUPB 2O50A 4AZVA 2VXBA 1IOLA 4RZIA 4CV3A 4P1ZA 3S29A 3BDIA 4C0AC 2CNWD 1FRFS 2TRSB 3AM1A 4DJTA 4XCXA 4MV7A 4EQ6A 2VJLA 4M9ZA 3EFOB 4O63O 4KGVA 3WKEA 3CLUC 4CU2A 4ZHQA 1J06A 2G9UA 4LOAA 1GAWA 3M0EA 4PIMA 1OX5A 1DT3A 3NGMA 5ALQA 3PFKA 3D6TB 3AW9A 5AHKA 4E4YA 5JXIA 3ZNNA 1OYYA 2XYPA 2QXTA 2O5EA 1DRJA 4N12A 5TR9A 2R87A 4R71A 2XWBF 5EUBA 3CKLA 5IBRA 2ODPA 4C6HA 1R4MB 2CCGA 2ISCA 2Q1YA 4IDQA 1QIKA 5A3SA 5JROA 2C5AA 2V7QD 3MAAC 5DGXA 4EUKA 5K6RA 1DC3A 1KS9A 3UH0A 1UXKA 4UFNA 3O9ZA 1KYIA 1HDEA 1O4VA 2WJHA 4OFXA 4RPHA 4BAGA 4KFTA 2AJCA 3HL0A 3ZV5A 2QMQA 3N28A 1UBTS 2FKAA 2PA0A 4DIEA 1U28A 4GMFA 1L5SA 3FPBA 3K0EA 1O08A 1M34B 2WIFA 3K0FB 1Z29A 1JEAA 3KQOA 3MINA 4KXLA 2WYVA 1GRNA 2CK3A 3TNLA 4GF5A 3VZBA 4YRBA 4WN9B 4MKZA 2C7GA 1KY2A 2XUIA 4QBKA 1I36A 1L3CA 3HA2A 3IMEA 4LPSA 2RAPA 3IDOA 1NYQA 2Z9CA 4GOMD 3U3DA 5MF6A 3HNRA 1SB8A 3I39X 4JJIA 3VDRA 4AJOA 2PLRA 4RTPA 3CLTC 2H1IA 3EJWA 2O0HA 2ZBGA 1PLLA 1ZJYA 4F0JA 3GLGA 1IHOA 2YFKA 4UCWA 1MFPA 3UQZA 2HA4A 3TLGB 5L9AA 4LZWA 2BJVA 3ZBTA 4EECA 2RJ3A 3QEKA 1PGNA 2O0LA 5MHTA 4J4BA 5SV2A 1U1FA 4L16A 3SKXA 2O06A 2XZTA 4ICIA 5B7PA 2AC7A 2HHCA 3UMSA 1H8ED 1QE0A 1O95D 3JQRA 2Q29A 4MEAA 1JF8A 1HUQA 1K68A 1QPBA 3W4JA 4EF6A 1P73A 4PZDA 5FBKA 2JAOA 4P54A 3W1WA 4ZO6A 4EB8A 3TPZA 2BHRA 1JLHA 3ANNA 1E1QD 1AV7A 1U7XA 3JRNA 1W5EA 3QKUA 1LFDB 3NWJA 5FRDA 4RHEA 2EFDB 3OU2A 1QMPA 3ADPA 4KCGA 3HFGA 3LO8A 2OV4A 4ND2A 2PKYX 3FDIA 4OUDA 4RDCA 4YA6A 5K2OA 3D3KA 4PZZA 1G9XA 4U8GA 4E2YA 3WKCA 4RPJA 1N5KA 4LNAA 5A71A 5KJFA 3VKGA 1OHHD 2JBHA 3PQ5A 3INNA 3PCRB 4U7WA 4EG0A 1FSFA 4GUAA 4N5MA 1V9SA 1IM8A 2CMFA 1DAFA 2R1VA 4ZYVA 4IDHA 2Z5GA 4O2AA 5LQJA 3FZGA 3A4IA 3DEZA 1LI7A 3KUXA 4KXMA 4WOJA 3RIHA 1P5JA 1ZD3A 2XEXA 3WLKX 2C77A 2XGGA 2JA2A 3EVCA 5B4VA 2X5OA 3M6VA 2C8JA 1OW3B 3O8OA 4BRSA 4NXMB 2XI4A 5IBQA 1MABB 4A91A 4YCJA 3IRVA 2B8TA 1XD9A 2QM3A 4UVHA 5JATA 3RYHA 3VKWA 5EJ8A 3R0ZA 1ECPA 3MMNA 2IZ7A 4LC9A 4WACA 1IQPA 1VZ2A 4Y6PA 3QLTA 2O48X 3E5NA 4QL3A 3SLGA 3KJIA 3Q98A 3WDMA 2A3NA 2GLUA 1OFTA 1B42A 2K87A 2ZOSA 3MT0A 3NX4A 5BSRA 1DG3A 3SIRA 1MZVA 3B89A 4L27A 4FZ5A 3CPHA 2XDYA 3VJLA 3P9IA 1XJWA 2BF7A 4QREA 4QYTA 3X1WA 4LISA 6AT1A 2R62A 4F3YA 1FP4A 2BKUA 1YDGA 3H86A 4WN3A 3TWOA 3QRWA 5HQ3B 2J6IA 1FNDA 5JYBA 4DLNA 5M04A 4UU7A 1GM5A 2ZJ2A 1E66A 1X1EA 1I2ZA 3HU1A 5F1KA 4BUZA 1LK0A 1EUQA 1TGVA 4MICA 3ZJ5A 1EBBA 4LUCA 4RE5A 2B1RA 3CPSA 4GYJA 1SVWA 3KQVA 4GGOA 3K6SA 3JYHA 3I2KA 3I04M 1W0KA 1QE3A 2HU5A 3MJEA 3OESA 4DT1A 5KTTA 1BXGB 4TKUB 5EE1A 3TTXA 5AUPB 1EXVA 1NXQA 4EYSA 3I6MA 1E20A 1UXOA 4Q6BA 1ADJA 3NU1A 1Z2AA 3L5OA 1YXMA 1K4MA 1VCOA 1YQWA 1Z0JA 3A9WA 2JFZA 5E1MA 3SFZA 4YCSA 3DH0A 2WTNA 3ADKA 4YP1A 2D1FA 1RYHA 2O05A 2WFAA 3BGVA 4HB2A 4WVLA 2WIKA 1WHTB 4ESEA 1E3IA 3HXKA 3PEUA 2DR2A 1L8AA 3CCBA 2Z3WA 2B98A 3E3NA 3JQPA 2BY4A 2POQX 4YV2A 1WE2A 3KWJA 4TN5A 3SYLA 4K8OA 3HKDA 4YRTA 3ZVLA 2HEGA 4TMKA 5TRTA 4BRZA 3BIXA 3AR3A 2NZWA 3WNDA 1XZLA 4GLLA 1UT6A 1WUKS 1TCCA 1VLLA 4WUTA 1EA5A 4JK3A 3W5VA 1LB1B 4QHTA 1N6LA 5J4KA 2CKMA 4D41A 2IA5A 5IKMA 4N6NA 4WRRA 2YV5A 5C2JB 1Z12A 3HBJA 4NICA 1DKOA 3PXEA 3W9YA 2FW8A 1WMSA 1LUAA 3WIEA 1R15A 3R5SA 3GBVA 1MC1A 1WUTA 3O0DA 3UT5A 2RBEA 4F8JA 1EWYA 1UOEA 4MAFA 2F3UA 1NUSA 5TJ9A 2QMUA 4FGWA 3MJVA 3WAKA 3QFTA 3W7BA 1CUFA 3HN6A 3IE0A 1WXXA 4C9BA 4COOA 4P5PA 2BM0A 2FWJA 4POOA 2L42A 4XASA 3STTA 4CF6A 5IAOA 1X1TA 4OSEA 2CVOA 4LCJA 5CTJA 1H85A 2LTAA 3OTQA 1CZNA 1SUDA 2X5XA 1BSVA 2FUG1 1FYFA 3ILXA 1E6CA 1RHQA 4G5RA 5K20A 3WMFA 3I62A 1JKFA 2ZRGA 2V9ZA 1B14A 1OJ7A 2W58A 4KO3S 3GVIA 1XAHA 2H1HA 3FNGA 2N1MA 4GECA 4ZCQA 2IV2X 5BW5A 1QP7A 3K32A 1OWMA 1NR5A 2ODWA 4XOUA 5K6TA 1QFXA 4GZ6A 2FPLA 2FQQA 2PT5A 4L6CA 2EZTA 5LBIA 4UNSA 3BL5A 3IBYA 3GDOA 5JPDA 2X2EA 2FR0A 3TVYA 3C1TA 2VDQB 1S2LA 1UP7A 3IEKA 4YIKA 2O2SA 3H5IA 2R8EA 2QF7A 4URUR 1KKLA 3VC2A 4Z1MD 3L7IA 3AETA 3KOYA 1YQUA 3EFOA 4RVDA 3NLLA 1HG0A 3VQTA 4EKIA 1S1MA 4QDUA 1ZS9A 1KAHA 2YX1A 3UAZA 4X5OA 3A6GA 4N76A 3K09A 3TTSA 3IV6A 3RUCA 4NP6A 4CEIA 4ZP1A 3H6GA 1ULUA 1V47A 2XCIA 4TV8F 4U3JA 2Q3FA 3OCJA 4L95C 4XPIB 4RK7A 1KI6A 1Y3DE 4MXDA 5ALRA 4AZ3B 3DC7A 3DSRA 4X00A 4RL6A 3T52A 3WJ1A 5JNVA 1AKUA 4U7PB 2HLDD 3PNVA 2PUFA 5K0JA 3I9KA 1VKNA 2J59A 2WTAA 2CJFA 2OUKA 3B1FA 3IEXA 3N07A 4PIPA 1UEIA 2FW6A 4TL7A 4IRXA 4DSUA 1O6FA 5EP3A 3FVRA 4IIBA 4WAUA 1BTOA 3VR4A 1VBFA 1Z07A 1GRVA 3RRZA 4WNIA 2VAWA 1IRXA 3L8HA 3HCRA 3PI6A 3P8ZA 2PGJA 1HE8B 3PG5A 3JYLA 1RRKA 2PQ2A 4F2PA 2YOFA 2B30A 1CP3A 1NQWA 2X76A 4MMXB 1F0YA 4WY2A 4EHJA 4ENWA 5LQKA 1MQ9A 2NUPA 1Q74A 2K7FA 1R4AA 5KCZA 2HA0A 3KTAB 3KCNA 1JQDA 1QK4A 2REOA 3CBGA 4ND1A 1QSGA 1Y98A 3JWHA 4OFWA 3MMPA 5G02A 2G72A 4MS4B 2IZ6A 3NXKA 3PQ7A 4UHFA 1XLTA 3UF0A 3FBWA 4CDMA 2HI0A 1BHQ1 3FMPB 5JCOA 2E6KA 4C2UA 2O8BB 3GJQA 5K0GA 2JRCA 1XZGA 1H5UA 3COVA 3OTIA 4JQYA 4LHZA 2BGTA 1FLVA 3JYPA 4PS0A 4XIFA 4H6XA 3MYRA 3SYMA 1YO6A 1EA7A 1VE9A 1YMUA 3UMMA 1F0PA 4U9IS 2PLAA 3ECCA 4PZEA 1PZHA 3HKBA 3DOHA 2P8SA 2VPTA 4C43A 3L4JA 5EMMA 1YVEI 1K7XB 3BFPA 4Q3AA 1XTPA 3BJZA 4BZXA 1HFKA 3IOYA 3N2ZB 1SURA 4AJLA 2Q99A 1N0UA 4DRXB 1ZRNA 3LIIA 4ZANA 3RVNA 3WRYC 4EARA 2H63A 4OQZA 4B8ZA 3C3EA 1A71A 3L2OB 1JFTA 4AL4A 4LDJA 2IUYA 3LLUA 2WSBA 4R9VA 3CLRC 3CRVA 1QORA 1A69A 3HUTA 3PFNA 4IDFA 4M0CA 4RS3A 3UM9A 4BU1A 2H9YA 2BP7A 3JW8A 2GARA 1LWNA 1RI5A 3GT7A 1VLMA 2FPIA 1JFLA 1M5TA 4MP3A 1TMYA 4JP8A 1DIRA 2E4ZA 1E1QA 2J7PD 5HM6A 1R0RE 5BXQC 1GOTA 5IJ9B 3W8RA 4ARVA 1KP9A 5TMEA 2A30A 1N2CA 1BKSB 2J3MA 3MTAA 3WGLA 1T4MA 5GZ3A 3ND5A 1H8EA 3GT0A 4PZUA 5FORA 3W2FA 4WBSA 5KX5F 1L5WA 5JAIA 3OLZA 3ZJYA 1UAAA 3KB8A 4J9UE 3LT4A 2NTVA 5BYAA 3HBFA 821PA 3PRJA 3QX9A 3CF4A 1OROA 1DXYA 3E7FA 3DL7A 4H1VA 3VH4A 4FHDA 3U7JA 2AJDA 4JV5B 2R8OA 3MG9A 3LSTA 1P7CA 3JVUA 4C21A 4Z4IA 3VR5A 2ONZA 1K27A 1T8PA 4HDQB 2VUHB 3FCUB 4KH1A 3UA3A 4XGKA 3ROPA 4GOLD 1P72A 2A3RA 4JWTA 2NPFA 3WZ2A 5CVTA 2XE8A 5IXYA 5CIWA 5KMGA 3JQAA 2QVGA 4FT2A 4GYWA 4R7ZA 2ZUUA 2R8XA 3E9RA 4FBMA 4TMYA 3RVKA 5AJUA 3H9UA 3FUUA 4XKJA 1EQ2A 4X71A 1HKHA 5A7HA 4DFDA 5CH5A 3CR8A 3PNYA 1FTSA 5SYNA 3E9QA 4FN5A 1QKJA 1TCAA 4EG4A 1Q2UA 1ZK2A 2HB6A 4QU9A 1Q0SA 4EDHA 1HOTA 2QZ9A 1SXJD 1HEIA 3TTTA 5A04A 1POWA 4OQXA 4NF2A 3C1UA 3C85A 3DDNA 4UBNA 4LF4B 3ROMA 2MYPA 3BK2A 4EW1A 3ZE7A 2P75A 3V4SA 2GPYA 4I1IA 3WLLA 2YWBA 4FMDB 1DKLA 2IXBA 1XRNA 2DHEA 1ECFA 3QBVA 1AX9A 1PNQA 3HWWA 2UYGA 1E5DA 2VTBB 1G3RA 1L7NA 4X85A 1YDMA 4UC0A 5FBVB 2J9GA 3BF7A 4BN0A 3VU9B 3DGEC 3OEYA 1SKAA 1OPRA 1P9OA 3DD5A 5KNDA 1ONOA 3CLTD 1Z6AA 3PB3A 5AVVA 2OB1A 1GU0A 3VGPA 3PEYA 1LKZA 3C6XA 3B3JA 4G5OA 4N39A 2ZUCA 3ZR4B 3FNFA 4MWBA 3GLGE 3O7WA 1FDUA 1PWHA 1VJGA 2O8NA 3L4SO 4MRMA 3TQTA 4B7AA 5H4GA 3T7SA 1PL7A 3WOHA 3D7MA 3T5TA 1NKTA 3UBTA 2GZAA 4HLDA 1PAUA 3RFTA 2J8ZA 2XXAB 2YRXA 1Y63A 1X13A 4ZCMA 4X3CA 2XR1A 1BXGA 4TKUA 3W8NA 4RTSA 3CNHA 5DBHX 1EFVA 1FFAA 1RKVA 3V97A 4BB0A 3I0NA 2J5RA 3H84A 3IOCA 5AO9A 3R6LA 5FI0B 3HPRA 4NABA 4PF1A 5JCXA 2FWPA 4OHVA 4RCVA 2IDMA 2X7XA 1UWVA 3AWDA 1UOPA 1LF5A 1CUIA 4XSGA 3E7WA 3JD2A 1U0EA 2AN4A 2W2VA 1XNHA 2ZJ3A 2SKEA 4XARA 4MMYB 2O2DA 4CQNA 2O54A 1JXQA 3CS3A 3AILA 3GPIA 1CJKC 1XQXA 3F6PA 4X41A 4HLCA 5KNBD 3AUJB 4ZRNA 2YFYA 5AD1A 1XFAA 5ARDA 2RJOA 3EWAA 1KDZA 5BN1A 1NL3A 2PJUA 4I9GA 4RPKA 5ALGA 3PC4A 2HRQA 4AX4A 7MHTA 1WX1A 2C9DA 1QB7A 3DCJA 1JU4A 4EGSA 4X93A 5KNDH 4N48A 1KDPA 1MABA 4LOLA 3R75A 5C5EA 3QLEA 4ZI7B 1RZVA 4I1YA 4G2NA 5CMLA 5A9TA 2AB0A 4NBSA 2AFIE 3HADA 2P7HA 2OCBA 1NQAO 2WUVA 3AFHA 4GPAA 1PS0A 4DUYB 3JVEA 5FCDA 2DQSA 5C8YA 4F6LA 1KAEA 2IOHA 2XQKA 2YZKA 1E5VA 3O75A 4IO1A 3A0UA 3TYXA 1C4KA 2JGKA 5GVSA 4PC1A 5JXJA 2P5SA 4MWZA 2GAIA 3QPUA 1DFIA 2EJBA 1ESMA 4NYJQ 3WL7A 1IXYA 4LSWA 1KSHA 3KDAA 4M83A 4I55A 4KQXA 1OH5A 2I55A 1R0WA 4TT3D 4C7OA 5TQVA 2H51A 1K8QA 3C87A 3IJRA 1Z75A 2K4MA 3KJGA 4LZAA 5FWDA 3CG4A 3EZNA 3JCZA 2FE4A 1UMCB 4Y0VA 4F93B 4MUNA 1W88A 1MAVA 3OKAA 3A9TA 3PFFA 4GLOA 2QNIA 3EIFA 1BGVA 1WB5A 5KNCA 1FMFA 2G6BA 3ER6A 5L3SA 1T0PA 1SPBS 1XVLA 3MJCA 3HXMA 1U7OA 1X42A 1ZXXA 2GD1O 2ZRAA 3U4CA 1N7IA 2WD7B 1ZESA 2QSJA 2O2YA 1DP4A 3QE2A 4D3YA 5FEMA 1OI2A 3RU3A 3ODGA 1A8PA 1EK1A 4P3KA 4FNMA 2Y05A 4R3UC 1MAUA 2ZYGA 1DJNA 1H2XA 2IIVA 1E94E 2O7SA 2IP1A 2PH7A 1JL3A 2XQIA 4TYYA 4QA9A 1H2EA 4WMLA 1M8KA 1VSBA 4TS9A 4OY3A 3MWEA 3QI7A 5ELXA 2QM8A 1RRCA 1SUFA 4AY5A 2W2NA 2E1PA 3M1YA 5CYOA 4EH1A 1PZFA 1Y7LA 3VSEA 3P0HA 1YR1A 4W7HA 1QYWA 3K9QO 3G0CA 3H5VA 3H8SA 4ZCIA 4TMXA 4MWCA 1MW8X 4Y0AA 1U8UA 2LIVA 1XNQB 4RPIA 5AW7A 2P3LA 2QUAA 3RLFA 1ZJ6A 1NFQA 1DHRA 4TXJA 1E6WA 1JEQB 3T99A 1E7YA 2ZITA 5BSVA 2AYZA 1U2QA 3BMNA 4Z8XA 3CWQA 4KPUA 5EP1A 4X7MA 1IONA 4BVEA 1N3YA 4MUXA 2X4IA 3GPBA 2WE8A 3UTCA 1FP1D 3U9SA 1I9CA 1CVLA 3H65A 1ABEA 4L5YA 4BMNA 3PLRA 4NCKA 3KT8A 3GLIE 1WP4A 3QP9A 2GJ9A 5IJ9A 4DV6B 2XMDA 1OGJA 1P1HA 4QTUB 4CM3A 3TZHA 4YAGA 3ZWBA 4MUBA 2V5VA 3LMKA 5EJMA 5D85A 1M1UA 3LT1A 1GPLA 3VVBA 2YS7A 2QTTA 2ZJFA 5GJBA 1P6QA 1GZ6A 2AFRA 1SKUA 2JH3A 4NARA 1EP2B 4UTRA 2QP4A 4GHWA 1PV2A 5HR5A 1KZGB 1JDVA 3KPUA 2P30A 1PN3A 2QTCA 4MQUA 5AI8A 3EMKA 1GN8A 3ZCPA 3AUXA 2Z2XA 3TZ6A 1JHMA 3PEWA 3PXBA 5JWHA 1ZXLA 2W4MA 4MPPA 4YHHB 4CJXA 2QMEA 4HXFB 2JLUA 4CF4A 5HGJA 1GFIA 4FK8A 4R0VA 2QX6A 1W7AA 2VQDA 1QAMA 2O7QA 2YV3A 4U2EA 3TUIC 2LDBA 1NHWA 2BE7A 4XIJA 4BP9A 2ZJOA 4P33A 3KSAC 5HWSA 1HT1E 1EX9A 3IDQA 3MJFA 4REQB 4L4UA 1PYOA 2JATA 1JKMA 1U7WA 2YQZA 1FMJA 2PZKA 3BDAA 3KFLA 3OT5A 3PC2A