4PIPA

Engineered egtd variant egtd-m252v,e282a in complex with tryptophan and sah
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
316
Chain Sequence
LSLANYLAAAAEALRRDVRAGLTATQKSLPPKWFYDAVGSDLFDQITRLPEYYPTRTEAQILRTRSAEIISAAGADTLVELGSGTSEKTRMLLDAMRDAELLRRFIPFDVDAGVLRSAGAAIGAEYPGIEIDAVCGDFEEHLGKIPHVGRRLVVFLGSTIGNLTPAPRAEFLSTLADTLQPGDSLLLGTDLVKDTGRLVRAYDDAAGVTAAFNRNVLAVVNRELSADFDLDAFEHVAKWNSDEERIEVWLRARTAQHVRVAALDLEVDFAAGEEMLTAVSCKFRPENVVAELAEAGLRQTHWWTDPAGDFGLSLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ergothioneine Biosynthetic Methyltransferase EgtD Reveals the Structural Basis of Aromatic Amino Acid Betaine Biosynthesis.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords Histidine-specific methyltransferase EgtD
total genus 115
structure length 316
sequence length 318
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.44: L-histidine N(alpha)-methyltransferase.
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10017 Methyltransf_33 Histidine-specific methyltransferase, SAM-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pipA01
1NV9A 4AZTA 2JH9A 5KQSA 3LSTA 4QTUB 4RVGA 2IDKA 4X61A 2GPYA 4AUKA 3KPWA 1X1DA 2CMGA 3BXOA 1KPIA 2UYCA 3A7EA 3CVOA 5DXAA 3GWZA 2OB1A 3MTIA 1Z3CA 2ORED 3AJDA 5MHTA 2ZIFA 5T64A 3A25A 4X1OA 3T0IA 2C7PA 3U81A 3FTFA 5EKUA 2IPXA 2OO3A 3AWIA 3MTEA 4QQKA 1QAQA 4ER6A 1ORHA 5HIKA 4F84A 3BKXA 1DL5A 2G1PA 2O05A 3EVDA 3G5LA 3KPUA 2ZW9A 4QTTB 4IKPA 3UA3A 3C3PA 1YUBA 1O54A 3DMHA 1KIAA 2AOWA 2EG5A 2ADMA 3K6RA 5E9WA 2FK7A 2BM9A 5FHRA 4CKBA 2OKCA 3B5IA 3MERA 4FP9A 4X60A 5EPEA 3CGGA 4POOA 4CTKA 4GC5A 1XJ5A 3DLCA 5K03A 2BR3A 4ER7A 5E2AA 1G38A 3CCFA 3ER9A 5GM2A 3EVGA 2P3OA 1EAMA 4F85A 3I64A 3G8AA 5DM2A 2ZWAA 1NT2A 4AX8A 1XCLA 5DWQA 5ERGB 4E70A 1YZ3A 3CJRA 4U7TB 4G56A 3LDFA 4UOEA 1TPYA 3EVCA 1NW6A 3BGVA 4ER5A 4BLVA 4FGZA 5EMMA 5E9QA 4OBWA 1YFJA 4QVGA 3I9FA 3LCVB 2O06A 2XYVA 3ELUA 4PYJA 2R3SA 1R8YA 4C06A 1VIDA 5LR6A 4GOLD 5D1NA 3KR0A 3T7RA 4RTMA 2AOTB 10MHA 1N7IA 2GS9A 2PT6A 3HVKA 4EKIA 3DXZA 1UWVA 3NTVA 3TOSA 4HRAA 2EX4A 4HH4A 3BZBA 3FTDA 3LKZA 1WZNA 3EEOA 5E2BA 3KHKA 2PV0A 4P7KA 1B42A 5E8RA 2IIPA 3L8DA 4LG1A 3UWPA 5IKMA 5K0JA 1ZHFA 4LWOA 2OXTA 3BWMA 3EMBA 2IP2A 2ZIEA 3GXOA 2BR4A 5GP1A 5GWXA 4BLUA 3DXXA 1G55A 5FA8A 5EIWA 4C07A 4GUAA 2UYQA 3LHDA 2QY6A 5EGSA 2UYHA 3FPJA 2P3QA 3FRIA 1ZKDA 4OQEA 1QYRA 3DULA 2R6ZA 1RJFA 1INLA 4PYMA 1ZGJA 3DMGA 3AY0A 3MAGA 4HC4A 4A6DA 4AZSA 3DOUA 3SM3A 4YV0A 1SKMA 3P9CA 1YFLA 1RJEA 1UFKA 3FUUA 3GRYA 3LCCA 3NJRA 1HNNA 1O9GA 1R18A 1SQFA 3NDJA 5EZQA 5H02A 5BW4A 3ER8A 3TPZA 2UYOA 3GIWA 3PFHA 4PCAA 4MHTA 5EIFA 4FSXA 1TW3A 3FYCA 3C3YA 3NWEA 4RTOA 1FPQA 5T6BA 3UJ8A 2QYOA 2FCAA 9MHTA 5T67A 1KXZA 2NXCA 4QQNA 1L3BA 2G71A 4RX1A 4IV0A 4P7FA 5K0CA 5CIYA 3V8VA 1VP3A 3KQOA 1OR8A 4E2WA 2PXXA 3LL7A 3HCBA 4QDJA 5K0EA 3R0QA 2YUIA 3TLJA 1IM8A 1JG3A 2CKDA 3NVKI 2NNWB 4L7VA 5BW5A 3PX3A 1L3IA 4MTLA 3THSA 2F8LA 5EOVA 1R8XA 4PYNA 1I1NA 2YTZA 5KS2A 1EJ0A 2NXEA 4Y30A 1RI5A 3HVIA 5EEGA 1FP2A 1XXLA 1DUSA 4GQBA 1AF7A 4PGGA 2P7IA 3UJCA 4RTJA 4E30A 3CBGA 4JXJA 2I7CA 3GRZA 5CCXA 5HEKA 3LBYA 2Z6AA 2NP7A 4DA4A 2B3TA 4KIFA 8MHTA 2ZZMA 2P41A 2H1RA 4FT2A 1SQGA 4MQ4A 3CC8A 5DTRA 2C7OA 5LSAA 3NDIA 3ELWA 1U2ZA 2WA1A 2JHAA 4KDRA 5HFJA 4DM3A 1AQIA 4LECA 3TRKA 2YXDA 4RVDA 1YB2A 1VL5A 3KPJA 5EG5A 1G8AA 4IWNA 3TM4A 5ICGA 3PLAE 5DSTA 1XCJA 3IEIA 4U7PB 3KPVA 5DSXA 1G60A 2AVNA 2CWWA 5FADA 4A6EA 4E2ZA 4RTPA 1R6AA 5F2NA 5LQAA 2AOVA 3HCEA 2E5WA 5DLYA 2BM8A 2P8JA 3EVBA 3P9NA 5IH3A 3HCDA 3QOWA 2O0LA 4X63A 1M0EA 1MHTA 3M70A 1SUSA 1ZG3A 3HVHA 5BP7A 3KKZA 3I53A 3PB3A 5K0LA 5JR3A 2OYRA 2O07A 5FWAA 4DCGA 5P8WA 2GA9A 4XUDA 2ZZKA 3S68A 5ICEA 3GCZA 3P71T 5GIPE 2IGTA 1F3LA 3TMAA 2VP3A 3LKDA 4R6WA 3RODA 4YUYA 1BHJA 3SR4A 1IXKA 1H1DA 2ERCA 3BUSA 3HCCA 2AZTA 2ZBQA 4GOND 4ER3A 1Q0TA 5GOZA 2A14A 1JQEA 1V39A 3V97A 1P1BA 2HWKA 2P3LA 2ZFUA 3OZTA 5DPMA 5E8JA 3EPPA 4R05A 3CKKA 2JJQA 3B3GA 3HP7A 3OFJA 3P2KA 5E9JA 5DRTA 3OCJA 4P7JA 2H11A 2ZTHA 3E23A 2B25A 3MCTA 2YX1A 3PFGA 4FS8A 4PYQA 3LGAA 4P58A 1P39A 4GOOD 2EJUA 5DTQA 1WS6A 3BWBA 3DXYA 3E7PA 5FCDA 4OBXA 2FRXA 5EVJA 3FUVA 4HGYA 4E2XA 4YMHA 2IH4A 3EMDA 1JSZA 2PLWA 2FYTA 5GIOE 4EKGA 2IH5A 3IYLW 3P97A 2XBMA 5K09A 1JTEA 1L1EA 3LDGA 4KVZA 1EQAA 2QM3A 2Y1WA 1JQDA 2WA2A 4M37A 3KR2A 3HNRA 5DX8A 3FPEA 4QDKA 4YUWA 2ESRA 2AN4A 2YR0A 1L3CA 1T43A 3QOXA 4DCMA 3CJTA 3M4XA 2JHCA 5CVVA 1KPGA 4RTSA 4FZVA 3K0BA 3SSNA 3RW9A 4DF3A 2XVAA 2B9EA 4GBED 3P8ZA 4PCLA 5FWDA 2AN5A 2I9KA 2ZBRA 2ZBPA 1MJFA 2OB2A 4RWZA 2AOTA 5EHGA 5EEHA 3UBTA 3TKYA 3FZGA 2FHPA 4C03A 2NYUA 5U4XA 2PJDA 5C1IA 3RIEA 4EK9A 2Y1XA 4RYLA 4DZRA 4HTFA 3KQPA 4RTQA 4BP3A 4EQZA 5HZMA 4KWCA 2AOXA 5LQRA 4HTFB 2ZZNA 4PWYA 1FP1D 3SXJA 5M5BA 7MHTA 3MB5A 1WG8A 1TW2A 5ICFA 5LQNA 1RJDA 2PWYA 5LQKA 2GH1A 2OBFA 5LQCA 3O7WA 1XDSA 3HCAA 4BY9E 1F38A 5GINE 2FK8A 5K0FA 1NBIA 1WXWA 1VBFA 2EJTA 1KHHA 1XDZA 2Q41A 3G2OA 3P9KA 3PT9A 4PYLA 5DXJA 3AXTA 5EZSA 2PT9A 3VSEA 2P7HA 2BZGA 2WK1A 3FUTA 4V0RA 5F2KA 4CKEA 2N47A 2PX5A 4OQDA 2VS1A 4CWAA 4OX9Y 1D2CA 4R6XA 3REOA 1KPHA 4DMGA 1ORIA 5KYGA 4B17A 2OY0A 3G89A 3KPYA 5K0BA 5K05A 2IBSA 5CVEA 5DRYA 3VYWA 2PX8A 5FQOA 2LD4A 3SX0A 3NMUF 1BOOA 2P40A 2AOUB 2QRVA 2ZWVA 5C0OE 2IFTA 3BT7A 1HMYA 1RI1A 2PVCA 3EVZA 1G8SA 4PIPA 3SMQA 3G88A 4E2YA 4E31A 1YF3A 2PGXA 3LX6A 5CVJA 1R74A 2VDVE 2I62A 3FYDA 1RJGA 4GOMD 1RI3A 4PYIA 3TFWA 4F86A 1RI4A 3WSTA 3T7SA 4OA8A 4XUEA 3LECA 3EGVA 3SSOA 4EMSA 5CD1A 4ER0A 3P2IA 3M6UA 3KU1A 3X0DA 1N2XA 5FUBA 3A26A 2H00A 5CCBA 5K01A 4MWZA 3SSMA 5ICCA 3B89A 2ZVJA 2NXJA 5JUWA 4WXHA 1L9KA 1VQ1A 2G70A 3I5UA 4GEKA 3G5TA 1EJ6A 2FPOA 3GO4A 3QV2A 3TM5A 4RTLA 2IH2A 3M33A 2NXNA 3UJDA 3HA7A 4AZWA 5BXYA 3PVCA 4ISCA 4WVLA 4M36A 3UJ7A 4KRGA 3CJQA 4RTRA 3B7PA 1PRYA 1YZHA 4XCXA 3DMFA 2HMYB 2PX4A 3UJBA 2ZCJA 1QAOA 4YV2A 5DT2A 5E1BA 2YXEA 2ZLBA 3DLIA 1JTFA 3P9IA 1QAMA 3F4KA 1X19A 4KDCA 3PX2A 4BLWA 3LDUA 3M6WA 3EVEA 4NECA 5DX1A 3ELDA 1D2HA 4FSDA 2JHPA 1R00A 3MCZA 3R3HA 3R24A 1FBNA 4P7GA 2B78A 2BR5A 5EHIA 5LQJA 1Y8CA 3R6TA 1VE3A 2PSSA 1VP9A 3GRUA 3FTEA 4EVIA 3A27A 3C6KA 3UFBA 4M38A 3I58A 2KW5A 3EGEA 3GGDA 5HOQA 3GRRA 2JG3A 3EVFA 1G6Q1 5CVUA 5F2OA 1BKYA 3FRHA 3OU7A 4HGZA 4QPPA 3FPGA 5FQNA 4GF5A 3FUXA 3SGLA 3GDHA 1SUIA 1I9GA 2VDUE 5CUQA 5CVDA 5K0GA 1EIZA 3EVAA 3TR6A 4QVKA 3Q7EA 2PWPA 5E1OA 2CL5A 2G72A 5DM0A 3JWJA 3THRA 3BGIA 1ZQ9A 2CMHA 3M6VA 3ELYA 4DQ0A 5C9ZA 4RTKA 4DKJA 4PINA 3GRVA 3E8SA 1KYWA 3FPFA 3SVZA 3ME5A 4RSRA 2PY6A 1VLMA 2AVDA 4YUVA 3UJAA 4CTJA 3R9XB 3EGIA 5EMJA 4AZVA 3KQVA 5FTWA 3KQYA 2Z6QA 2ONYA 3DTNA 1P1CA 5DM4A 1SVUA 2HNKA 3GU3A 3HCFA 3TKAA 3BKWA 5CM2Z 1X1BA 1FJXA 2QRVB 2QE6A 1VPTA 3AXSA 5FA5A 3DP7A 3G2MA 3KQSA 3M6XA 5HIIA 4PIMA 3G7UA 5D1HA 4C08A 2C7RA 3ORHA 5EC8A 4YV1A 1IY9A 3KQMA 3OFKA 3ID6C 4KW7A 1N7JA 1NV8A 3LCUA 5E1DA 3H2BA 1UIRA 2AR0A 2ZSUA 5DTMA 2DPMA 2GLUA 1NBHA 2P1DA 3O31A 2P35A 3B3JA 3NW9A 1AQJA 3OZSA 3KR9A 3TQSA 3IV6A 1NE2A 4IV8A 3BGDA 4RV9A 4YMGA 3HVJA 1NW7A 3BWCA 3EEYA 2YXLA 1X1CA 2XVMA 3GJYA 4XUCA 5KVAA 2AN3A 4Z2YA 4E32A 3HEMA 1SG9A 4HSGA 2OPBA 5EMLA 2ONZA 5FHQA 3JWIA 5GM1A 2YVLA 4H0NA 3IHTA 2UZ4A 3HTXA 4RTNA 1JQ3A 1RI2A 4K6MA 4RVHA 2ZULA 2PXCA 2V74B 1XTPA 4ATNA 1M6EX 1QZZA 4FR0A 3A7DA 2O57A 4C04A 3LBFA 3NVMB 4C05A 1Q0SA 1I4WA 3C0KA 4MIKA 4YUZA 3HA5A 4ZTBA 4PONA 3MHTA 4KIGA 1JSXA 1JG1A 3G8BA 3JWGA 4O29A 3UJ6A 2DULA 2AS0A 3C6MA 4R8SA 5FULA 3KQTA 3UA4A 2PXAA 5DX0A 1D2GA 3DH0A 3FPHA 3HM2A 4PYOA 3O4FA 5EQJB 4QPNA 5HIMA 5KQRA 1XDUA 1KYZA 3DUWA 4C4AA 3E05A 1KP9A 2K4MA 1EG2A 1PJZA 2HTEA 3MGGA 3G2PA 4OA5A 1XVAA 3BWYA 5DM1A 1WXXA 2I6GA 3ERCA 2Z6UA 3MQ2A 2VDWA 3OZRA 5EMKA 2EFJA 3UJ9A 4LWPA 3LPMA 5EKXA 2AOUA 3OU2A 2VZ9A 2PKWA 2B2CA 3B3FA 2PX2A 3DR5A 2G8NA 3KR1A 3NWBA 1JR4A 2IBTA 3OPNA 2HV9A 3KQWA 4HG2A 4M7RA 4FT4A 5E1MA 2OZVA 3ANXA 3VC2A 2HR1A 3PS9A 5HIJA 2JH8A 3PTAA 1AV6A 5G02A 2C7QA 1BC5A 1NW3A 4BP1A 1QANA 3OE5A 4E33A 4CXMA 1DCTA 1JG4A 4Y2HA 1NKVA 2BH2A 3FUWA 3JWHA 1NW5A 1P91A 5HILA 3A4TA 1ZGAA 1M6YA 4GC9A 3KQQA 1WY7A 2XYRA 4PGHA 4CKCA 1X1AA 2V7EA 3P2EA 1O9HA 3FTCA 4PYKA 4RVFA 4X41A 5K0NA 4V0QA 3HA3A 5LQUA 2IDJA 2GAFA 5K8VA 2XYQA 2YQZA 5B1SA 3UZUA 2NP6A 2PBFA 3OE4A 3T7TA 1NW8A 3OU6A 3G2QA 3Q87B 4R8RA 4YUXA 2ZIGA 3GNLA 1JG2A 3D2LA 2GB4A 4PNEA 3VC1A 1KR5A
chains in the Genus database with same CATH superfamily
5LDGA 1F7VA 4YAOA 2KI5A 3D6FA 2EBHX 1GSIA 2CMGA 1KI7A 3VV3A 3R5XA 1Y8RB 3PF8A 1FTWA 1N5MA 4YJ3F 4PAMA 3TH5A 3V00A 5HX7A 3DMRA 3B60A 3PUKA 4IVPA 1IATA 2ZBGA 3ZE9A 1L1QA 3NT2A 1EU1A 2WDPA 4EI8A 3CNLA 3CG0A 4NS1A 1SUFA 4BO0A 4IJ6A 5HKLA 1D0VA 3OT1A 1ORHA 1ZA2A 1ZMRA 2XA9A 1DL5A 3K8QA 4UTXA 4BKMA 4IDQA 2VI5A 3G5LA 4Z3KA 4DPLA 3RIYA 2BSQA 1IZ0A 4YA6A 3C3PA 4PLGA 2DBYA 1MVNA 3MTDA 5G0UA 2EG5A 3DQPA 1KR2A 4ZP1A 3TPFA 2O7VA 3FF1A 3QKIA 4GSYA 4J91A 4MR9B 5AHKA 2Y66A 4YJ2A 3AG6A 1W87A 2KHZA 4KO3S 3V1YA 2CB9A 2ODEA 1RM3A 3BH6A 1GYQA 3IAFA 4P38A 1UBRS 2CNBA 3INRA 1XDDA 3PXBA 4I4NA 2X0NA 4OU4A 5CRIA 4DN6A 1Z39A 1YR3A 2CVFA 4F85A 1NTRA 2Z5VA 2OCYC 4FI3C 4FYIA 1GUZA 1OTXA 3KKEA 3LE8A 4D9BA 1C41A 5SZJA 4JLKA 3Q3HA 4EGSA 4UOEA 2ZRDA 1PR2A 5C8VA 2PD4A 3F0TA 1F4VA 1U9ZA 3BGVA 3RSQA 3KQKA 1E3EA 1KZ1A 3TLXA 4F06A 4F97A 1I6WA 1QX3A 1UXIA 2H4HA 4RIGA 2BFWA 1NVGA 3FJOA 4E4YA 3GUYA 5ITZA 1X7WB 4FCVA 3FMGA 4TXHA 4XB6B 4B85A 2FV8A 3GH3A 4MW7A 5DIFA 2Q6TA 1JV2B 1YIDA 1DIHA 4GRAA 4DMMA 4D97A 1O77A 2JLRA 2MSDB 1QOZA 3L06A 1EWKA 3G8CA 3EZFA 3LUHA 3VVCA 2A4KA 2GD1O 3C8HA 3E0XA 5D3MB 4HEQA 5C8YA 1KZYC 1EXDA 2QEQA 3MMPA 1TMOA 4TMTA 2PO7A 5HUQA 1B6SA 4PZAA 5E2BA 5FBWB 2F90A 3NM4A 1Z9BA 4G0VA 2NX2A 4ADSG 5AJXA 1K6XA 2A1UA 2HX1A 3VI4B 1Z6GA 3HY4A 1JVSA 5JNUA 4XPZA 4MWSA 1DO8A 4K1XA 2ZRNA 5LZ5A 4LOAA 3RVBA 3T4XA 3LOQA 3VZSA 4EG7A 5TGZA 3DXXA 2SKCA 4MMZB 4EB6B 3WLAA 2PLFA 1KDZA 2XCTB 1HT2E 3VO2A 4GUAA 3VC7A 3FPJA 3FE2A 3FRIA 2WT8A 4GMFA 3EBPA 2XOEA 3A4LA 5LBIA 3CLHA 2CV2A 1WD7A 1VM6A 1EUDB 4GPEA 4EL5A 3O75A 4HWOA 4WLFA 1QTIA 3GBSA 2Q3FA 3CUSA 3OJLA 4IFTA 4KXUA 4YQZA 4QRDA 2P6NA 4KGDA 5A0VA 1CQPA 1JS1X 2JIRA 4P32A 1R18A 3AHGA 3H5AA 5EZQA 3SZMA 3TX2A 1T4MA 2BFFB 5JFTA 2EJWA 4PCAA 4H7PA 5JE8A 1F3OA 3GJ7A 4PX5A 3EISA 1UKCA 1V1RB 3WJ1A 1CP3A 2E85A 2IDZA 3WGYA 1JX6A 3WZMA 5EQTA 3SJAA 3FIUA 5CIYA 3LT4A 2DH6A 2NGRA 2JFXA 4B6PA 3SEQA 1U11A 1XJCA 1I2AA 1KOJA 3KQHA 2J3EA 1GR1A 5L9AA 4UTNA 2CKDA 3BCRA 4L7VA 2YMPA 4UU8A 4YK7A 1Z0AA 4DLPA 1HSZA 4L4ZA 4JKIA 2Z6VA 1JPVA 3OJWA 4TRRA 2ZUWA 4ZJPA 3IEVA 4I3FA 1PJBA 2YWEA 2X9QA 3CINA 3QVUA 4OI4A 1KL7A 1NXTA 2VBFA 2EGHA 4O2BF 3F46A 2LVBA 4MIYA 2BEUB 3JYNA 4HGQA 3AF0A 2QL9A 1QU2A 1MOSA 1WMSA 1XZBA 4IKEA 4NXMB 1J0BA 1XO1A 3GMIA 3RS2A 4S05A 3DGFC 3V8MA 1U0FA 3HABA 3IP7A 1XEXB 4M2LA 2X19A 5DBEX 2HREA 3MIZA 1V7PC 4B3JA 5IVKA 4W63A 2WWTA 3CC8A 1QQBA 2VEOA 2XHZA 2EJVA 1GAEO 3G02A 1FXSA 2QVZX 2VOJA 3EGDB 4FDAA 3ZVRA 3SS8A 4KDRA 3RYHA 3WTCA 1X7XA 2BGLA 2WRZA 1T29A 4LECA 1Z0KA 1U6JA 1UXJA 4AN1A 3WP1B 1BS1A 1R6TA 3T3DA 2RHTA 4E22A 3IEIA 1UP6A 4Y9SA 3T9FA 4ZZ3A 1SHTX 2G5PA 3VZBA 1TEVA 3AOEA 2Z95A 3ORFA 4PC7A 1G8HA 1AKQA 1O8CA 3HCEA 1FRQA 3L7OA 2J85A 3T3EA 3ZU4A 1AF4A 2NU7B 2YIDA 3OKCA 4JMLA 5IH3A 3V1NA 3GZTB 4A0QA 1OI2A 1NBAA 1Y5IA 4JI4B 1DU4A 3ZE1B 1SRRA 2I4NA 4FX2A 5JR3A 2R6DA 4D02A 1HFKA 4KPUA 1M5UA 3JAWA 2HLPA 4CJXA 4JENA 2CHVA 4OJMX 3TQHA 3PPVA 2V7WA 4R6WA 3OA2A 3NM5A 4JT9A 4ZCSA 4QODA 3L93A 2D2XA 1U1DA 4IZHA 3W4KA 1BVUA 2J9YB 2VHVA 4HX5A 5AKXA 1IHUA 4JYPA 4GOND 1FE8A 2Z58A 1TTPB 4I99A 2WZQA 1BNCA 4KAXA 3ITDA 3LQFA 4PZ9A 3CONA 3OCYA 3FGZA 4P8RA 1K92A 4QEDA 3BK1A 1LTHR 4R05A 4MQFA 1O8BA 1EFAA 2QSYA 4D6XA 3O8QB 2VJCA 1F2UA 1LPAB 2O14A 3AM3A 2QX8A 3K0HA 2A1TR 1BEEA 1US8B 2C4TA 2EAUA 2RG1A 3BWBA 2NVWA 3GHHA 4S3MA 5D5QA 1NXPA 4I4TF 4JT4A 4RWEA 4MQMA 3NONA 3URKA 4AMZA 4CM3A 5J1SB 4DR7B 4HNAA 4IDNA 5D7NA 3TQQA 4IP0A 3GCWA 4JYMA 2DCUA 2O2ZA 2XGSA 4PM4A 1J2RA 2ODBA 4L07A 3WYAA 3K1YA 3EX7C 2BFDA 1B43A 4LHXA 1ZH2A 4P4SA 1LBQA 1SQ5A 1JIIA 2AK2A 1S9DA 1SKUA 2CK3A 3JQDA 4CT0A 4MITA 5ICSA 1N6IA 1U2GC 1Z4NA 2D74A 1XMJA 1QGOA 1W9MA 4BVBA 4KE8A 4L3VA 3RO7A 3LNCA 3TIIA 4QG3A 2H92A 4ZVKA 3VJLA 1LK7A 1V45E 2AUNA 2JZNA 2LW7A 2E48A 2WVHA 3KSMA 4I9NA 4CFZA 1U4OA 4IX9A 4D9MA 3A2NA 2NT4A 1QO0D 2R7NA 2C4KA 3IBYA 4NLLA 4W1QA 4J49A 3TUIC 4D5EA 3FBWA 1JG6A 2QRNA 1B8VA 3QYPA 1P1RA 2E87A 1J2YA 2WYWA 3NETA 4DR4B 3GLRA 3PXDA 5KYXB 4A15A 4LWZA 5EZYA 5LQNA 1TA4A 3QPWA 5LQCA 1J9GA 1A4IA 2H29A 4RQTA 3RBZA 4EENA 1J5XA 3H4TA 5K0FA 4RA9A 3OMXA 3SS9X 4F45A 3FETA 3SDSA 3DWFA 5FLEX 4C6SA 5J3JA 1B23P 3H5RA 2GFHA 3S40A 1GZHB 2YWJA 3H9EO 4L8LA 4CMCA 1GKKA 1WLSA 2W8BA 4V2IA 3FCOA 2BELA 4BE4A 1SOVA 4UASA 3AIIA 4GD3Q 5KJ1A 4EEXA 4W5NA 2VATA 1JRLA 3OP1A 4BEBA 1LPNA 1PT8A 4KR3A 2C4VA 2D6FA 4LCBA 1H4QA 3VYWA 1OASA 3BIOA 1XPJA 2P9HA 3M9WA 3SQLA 1XD2A 2BC9A 2O54A 4HDCA 1Q15A 4AKGA 4DCUA 1K7SN 2CSUA 1LS6A 5C0OE 1HMYA 2D59A 5ADHA 5DW0A 2O8DA 4IJVA 1G8SA 1F2TA 1MZVA 2EP5A 3FCSB 2ST1A 3OQBA 2TRSB 4KSBA 4BMCA 3W7VA 1S0UA 3PZRA 2BDUA 3QJGA 4BX8A 4E94A 2BMDA 3EIOA 1DKMA 3NCTA 4Q1BA 1RAGA 4U3JA 2RE8A 2NXWA 1AB5A 2Q6VA 2XZOA 4B4KA 2FR8C 1CDEA 3QRWA 5BSMA 1YQUA 1GARA 3D6AA 3VPHA 1NPTO 3ZW8A 3CSSA 2RI6A 1N2XA 3O84A 4N4AA 5CCBA 1Q12A 5LN1A 2DKFA 3GJQA 1VZ3A 1T5DX 3OF3A 2PUVA 1W76A 4RGVA 3VXKA 1IONA 5F23A 3LKBA 4FGLA 4XYMA 3RHFA 4CIVA 1W0JA 4IIVA 1I4TD 3LFTA 2ZAIA 4BMNA 4DAEA 1KO1A 2FPOA 2QN9A 3GO4A 2WQ7A 3DPIA 3C1AA 4L6IA 2DBZA 1R8SA 1PJAA 2I71A 5EE3A 2ZJ6A 4D3YA 4DY6A 4GOXA 1JMYA 2EHDA 3G2NA 5A5GA 2VZ0A 4EJ0A 1U8AA 4HEJA 4QUJA 4FDLA 3HR8A 3PPYA 4NDAA 4CKZA 2HMYB 7ABPA 4G37A 4JQCA 3ZTWA 5HCIA 3L8MA 2P1RA 1XNQB 4Z7QB 3N76A 5BQXA 2P9FA 4B6JA 4X3CA 1P3Y1 2HNBA 2O1SA 3KALA 1L5LA 3VPBA 4B8WA 1E2GA 4EB3A 4HNVA 1J07A 1WCIA 3N2GA 4MTCA 2DTEA 2O2SA 2ZUBA 4GP6A 3TBHA 4ND2A 4FGUA 3E7XA 4YMVA 2PT7A 6ABPA 3PGMA 3NDPA 3RWOA 4ZGGA 1TIKA 4K3VA 4QGBA 3LO5A 2J9ZB 1VDZA 1CEEA 1Y9EA 3W34A 1A8IA 5KVCA 4KL8S 4H6VA 3OY7A 4NCHA 4BNMA 2JAUA 2Y6VA 3S70A 3WRXA 1ZMOA 2H5JA 3GGDA 3QKSB 4PZPA 3H7AA 1H2RS 4B79A 2XZPA 2D5IA 5AJHA 4QT4A 2H2IA 4QPPA 2AXNA 3FPGA 4LJRA 3HKDB 4MS3A 3ODPA 4Z7OB 5JRZA 1AIPA 1P2DA 2O9JA 5D3ZA 2OBXA 1EIZA 1TB4A 2TMDA 1SUAA 4IF4A 2F1OA 4J0KA 1VOTA 4OGKA 4NCJA 3W2HA 3W90A 3G1UA 3QNUA 3V8NA 3R9XA 4RHUA 1XQWA 2PGAA 5FUMA 1ZAYA 2DLDA 4ALJA 3NWPA 4Q3AA 4X3PA 4CDMA 3OEWA 3AR8A 2K6GA 1IRIA 1Q3KA 3FLEA 4HB4A 1Q17A 4H08A 5E4YA 1F5NA 3CYFA 3WHLA 4M6WA 2CN1A 1VZ2A 4J7CA 4A3SA 2W0SA 1PWZA 2GVDC 3VVMA 4ZO6A 1AA6A 1T3TA 1ZJ6A 3HJBA 3QX3A 2GBLC 4HO1X 1G3MA 1JUDA 4Y9TA 3OZBA 1JBKA 3OZXA 5G1NA 3UQYS 1XLUA 5EJIA 4HGRA 1O96A 2JK0A 1O0SA 2VJQA 4WPGA 3U6KA 4WD3A 3FB1A 1JDSA 2IYAA 3ABSB 5IM5A 5LP6B 4Z9YA 3B1XA 3FJYA 2WWHA 3G9QA 4A0GA 3S99A 3ZE6A 4F9EA 4IUBS 2WB2A 2II6A 1XHFA 2D5AA 4FDMA 1YJCA 4JT8A 4PSVA 4S35A 5ARCA 1NNLA 3PEUA 2W6ID 2NACA 2Y4NA 2W71A 1PS9A 3CU5A 5ERYA 1JEOA 3TQSA 5K8UA 3EG9A 1YQTA 3RSFA 4B6FA 5LYJF 5DYYA 3KT6A 4FWTA 4RK7A 1G6HA 1M54A 1UBTS 1PS0A 1YDWA 2R60A 4GVXA 4QBKA 5KO2A 3WMGA 3O1IC 4HX9A 4C4SA 5I7RA 2YVLA 1CJUC 4TUYF 5IXSA 2X1VA 5LC1A 1C8LA 3WKBA 4PICA 5DCLA 1O95D 1CS0B 2ZULA 3BMCA 5AR1A 3U3DA 1A3CA 5BORA 5EWJB 1Q83A 3N2EA 4F1KA 2Q7DA 1QKKA 1ISHA 3STYA 5E3IA 2IYWA 1HYQA 2YZKA 3TTWA 1JFVA 4DDKA 2VDQB 3LY7A 3UWMA 4YLEA 5J4YA 5HZKA 2AS0A 5BYJA 1Z7EA 1OB2A 1XEWX 1FPMA 1FW6A 1VG9B 2HB6A 4C2BA 4MW5A 1KETA 2Y99A 1SUCA 4HRVA 5DCYA 2QWXA 1FTSA 3QY9A 4TYNA 1GL6A 2VTVA 3EYWA 5LWHA 4LYDA 3RRMA 5KWJA 1AHPA 4KFRA 4CUZA 4OI2A 3OPMA 4PAGA 5K20A 2EKBA 5L7WA 1O0BA 3MQ2A 4BRZA 2HCRA 1Y1LA 4WNIA 1P8AA 3P9ZA 1YXMA 3VPDA 1GADO 1Z08A 2E21A 2OV6A 1BJTA 3UH1A 1IB6A 1NRIA 1U8TA 5EFOA 5KYVA 2GUGA 1MNAA 4YT4A 1D7OA 1NW4A 1F48A 1HG1A 2AJBA 4FE3A 1NQVA 4JS0A 3FBTA 2W2KA 1V1MB 1K2VN 3HCPA 1TQ2A 2J8ZA 1RLJA 4K46A 4N5NA 2WG0A 4TWRA 2WYUA 1CNMA 3C2QA 3GGOA 3KUXA 4DLYA 4EGFA 4LBZA 3TQIA 3F7OA 1S02A 3N2YA 3LAWA 5HKBA 5CR9A 1GRRA 1RR6A 3FMOB 3R6GA 2HSJA 3OEED 2F3SA 1GRNA 1TCVA 4CW7A 1MU0A 3UAGA 2PH5A 1P91A 2C7VA 3UMVA 4C5CA 2Q6LA 2VJOA 2ZT7A 1DWQA 3PLNA 1N75A 5FWYB 4B1FA 1O9HA 4X65B 4HZUB 4IPTA 3L18A 2ANCA 5AW6A 4Z2AA 2RAPA 4ZXPA 4UDNA 3V2HA 3OM1A 3I6MA 4MGHA 3VSDA 4O4HA 1ABFA 2WHPB 3FGPA 5CK4A 1LQ2A 4CT4B 4D8WA 4PHHA 2O6HA 2YINC 4YJ3A 3E2MA 4ZVNA 4PNEA 1OBFO 1H6BA 2IF2A 4AMYA 2WWXA 4X61A 2GFQA 4DRXA 4DHWA 4AUKA 2NSDA 1Y5RA 2VLBA 3DFZA 5TEWA 4DHEA 3P32A 4PWZA 4NMWA 3MTIA 4L4YA 4HJXA 4B45A 3P2YA 3PICA 2ORED 1PV1A 2VTEA 5MHTA 5CD9A 1UUFA 1L7EA 2JLQA 5A2GA 2QDKA 1IJKA 5BVHA 1ZXBA 4JEIA 3ILSA 5CJ2A 4RJJA 3Q8LA 1JALA 3MJHA 3QKWA 4R2WA 4LJAA 3GEHA 1XTRA 5ALIA 1SU8A 2ZT5A 4Z3OA 3G0HA 2I1QA 3E4DA 3OCZA 1D2NA 2RGEA 1OYOA 1SRQA 3BIFA 2EKDA 2FK7A 2EATA 3HI4A 4NOJA 3G5AA 4ASUD 4BO6A 1X9HA 1XZJA 1CUGA 1P77A 2FVXA 2GSWA 1Z38A 3PXCX 4ONEA 2W93A 1C1XB 4YBRA 4H0FA 4WZBA 3AL2A 4B35A 1N25A 1YWGO 3VZRA 3PC7A 4LXHA 3TUZC 2GJAA 5FRDA 5ALOA 5EJ8A 4R9RA 3L6OO 3TO5A 2V7BA 2IYSA 2J9GA 4G97A 3WGGA 2B8TA 3I42A 2PRKA 1EUCA 2VNJA 3HCWA 2EVWX 1JHPA 1Y5MA 2QMQA 1M5RA 2QUAA 2GM4A 3GLGE 4BLQA 4Z4GA 2AG6A 2H4XA 2P9ZA 3QVVA 1CCWA 1N4DA 2V58A 4Q4JB 4DB4A 4D8TA 4F71A 5BWCA 3ND7A 3WJ7A 3I9NA 4J16A 5F4BA 3KAQA 2C2GA 3D02A 4D9FA 4Q1VA 1DQRA 1NSYA 2M2IA 4MWOA 2DHRA 1E2LA 5ESXA 4U2CA 1TZMA 4J3JA 4YCLA 1KVQA 1VSVA 4WESB 2PTHA 5G1PA 2WY2D 3JWPA 3VUFA 4DJ5X 3MLBA 4BX3A 1KAMA 6Q21A 2CBZA 1KDVA 2MCFA 5E3HA 2PV7A 4PSUA 4TM7A 5DB4A 1YZKA 2ZIXB 5AXCA 1J0XO 2NU6B 3HP1A 2CNKA 2ZCUA 3U4QB 2PMDA 1VIVA 3MMXA 4L7QA 3U1BA 3KJXA 1A5AB 1X87A 5TQ2A 3KG2A 2O48X 1WMBA 2P75A 5SYAA 2C2MA 1YNOA 3GVPA 3WHKA 1IBLB 4LEIA 2JLZA 1W85A 4GI3A 3K0FA 3KQNA 1TOAA 1E1KA 4B4DA 1T6NA 3LUGA 4A6DA 2RHWA 4O4IB 4AZSA 3TOZA 3CEHA 3LWDA 4IEFB 1P2SA 1U0SY 3NHBA 5KNCD 1RAFA 3AEYA 1HNNA 1XHEA 1XQ6A 1DFGA 2GM9A 5H02A 1YQEA 3TTUA 5AKIA 1NMSA 1LWOA 3KOUA 3REGA 1C3OA 3DHEA 3GX1A 1UBJS 3AF4A 1TCUA 1CQZA 3BB1A 1G20E 4MHOA 5D7BA 3UVEA 4GKKB 4CN9A 2JGNA 3UJ8A 2QYOA 2IRWA 3UXMA 4RPJA 4GZ3A 4DAOA 4OB7A 4E4TA 3MCUA 4P7FA 3A14A 1UBUS 4I5DA 2Q5EA 3TQTA 1EM8B 2BGJA 3KQOA 4E5NA 3I62A 1IPHA 2X4LA 1UPUA 4IHKA 1GT91 5D8DA 3CZ4A 5HFNA 3ZIAD 1OYWA 3TI9A 5LMCA 3FROA 4ZHQF 3IKVA 1BJKA 1LX6A 3KJEA 1E5TA 2ZQYA 4V0MA 2XUFA 2GZAA 3Q7RA 5G0TA 5TMBA 3HJTA 3HRIA 3ITEA 3HVIA 2YXBA 1BSVA 3LVFO 4BRUA 1AF7A 4WFJA 2O2DA 4JI2B 1G18A 3K70C 5HEKA 5AI5A 3ZDEA 3ZI7A 1I4OA 2J09A 3AB8A 4HWKA 4MMYB 5EJFA 2QXYA 2XCLA 2Z4RA 4RPHA 3C3KA 3VR3A 2NV2B 2VSNA 1XZHA 1HUQA 1Z8HA 1V9CA 2EZTA 2QW1A 1PEAA 4JD5A 1RRCA 4BO7A 4HRYA 4A8PA 3TRJA 1O87A 1RMYA 2Q9CA 4PTYA 1I3KA 2HYDA 3UG7A 3JASA 1VC2A 4CDNA 2RKBA 4TUYB 3CNNA 7AT1A 4R7TA 2P3SA 4TQUS 4F92B 5J43A 2QMZA 2RHGB 1CP2A 2RGXA 2VF4X 2I6UA 3QU2A 4A91A 4DLWA 4O02B 3WDSA 5AVVA 1DAOA 1G60A 1DPGA 5P21A 2OBLA 5F2NA 4YACA 4Q7EA 4YLYA 1DJMA 3SYMA 5BSTA 1QYCA 2BM8A 3EXHB 3U7FB 2XIQA 3WVNA 1KVSA 2A67A 2HI0A 2JK1A 3EY4A 1V2HE 1LKZA 3AG5A 3FSGD 3Q7SA 3QOWA 5IVDA 3RF7A 4UNRA 1M0EA 3BQ9A 3LPDA 1JHDA 2OBBA 2Q9UA 3PJGA 3RVNA 3VM6A 5KBYA 3NUGA 4FE4A 2A6PA 1EFPA 1QV7A 3WQRA 2NPIA 1IK6A 2ZZKA 3B8EA 1T2DA 3PFBA 1SPBS 4L22A 2B94A 3ZJUA 4HGOA 3UCXA 4CF3A 3UOGA 3HZRA 3SHOA 1OFUX 3F2VA 4JFAA 4RD1A 2HUPA 3P19A 5T5QA 3HR4A 4AAYA 3Q8KA 3ASZA 4N1AA 4CM5A 1E9BA 4ALNA 1RAHA 1P1BA 1P9RA 2GCOB 3A32A 4HBZA 4WMLA 5KTMA 3DLTA 4O2BA 5DNCA 2I9KA 2ZB2A 5F12A 3ZYZA 3QKSA 5KPJA 3HKCA 4ZV4A 3OZGA 3X1DA 4KGVA 3MCTA 3B6ZA 1XFAA 4PO9A 3O2NA 2IYUA 4IXDA 4JC5A 4KJXA 4MRRA 4KN5A 4RACA 121PA 2YXNA 1BJRE 1OIWA 1AUPA 1PF7E 3MS7A 2ZEJA 4UNNA 4S2UA 1F2TB 5ITSA 3NT4A 1CNFA 3J81k 4MW6A 5ECDA 3SR3A 2RGYA 1NMZA 2ANBA 4OH7A 3JCZA 1A4RA 3W8NA 2XA1A 1X94A 4I36A 2JI7A 2PSJA 1DC8A 3T8YA 3L01A 4U00A 3RVLA 3FPEA 3IQXA 3QX8A 3R40A 2X2EA 4IF6A 2RCYA 2XUZA 3K70D 4MYUA 3SQMA 5CVTA 1J7JA 1VBNA 4QZVA 4EG0A 1QR2A 4PR0A 4D44A 3BSFA 1TTHA 3MRTA 4YP9A 5ENVA 3S2SA 3VPCA 4KRXA 2PHZA 2DR0A 2YL2A 3U44A 4DWJA 1SNYA 1QKJA 2Z8YA 1XL1A 2Q7XA 3BM5A 1GPBA 2IPAB 2VCEA 3ZCRA 1USIA 1QDUA 2HRRA 1T6BY 3G5MA 5HDQA 3ETJA 3QSGA 4C03A 1E2QA 4GM1A 3RIEA 1P1JA 1GOTA 1TJPB 1ODSA 3KLOA 4TX1A 4RYLA 4ZK2A 3EPHA 5A7HA 1R6BX 5KCZA 5SYMA 4DA0A 4CUKA 1KO4A 3DFKA 1E5LA 3WICA 4XVHA 3MFQA 4D0GA 2Y77A 1N1MA 2I55A 3A1WA 1XRQA 2EL9A 3BULA 1QTQA 1KQ3A 4N0MA 5JO9A 3NBKA 2ZBFA 1HO3A 1AA9A 1NA5A 2DQSA 5CITA 1I5RA 3ZHXA 1GNLA 2NTVA 1K97A 4MGZR 4NZMA 4BZZA 2GJ8A 2QU8A 2PIAA 2HBYA 3KYDB 2PX5A 4W7SA 3QEAZ 3U19A 1IHDA 2P2SA 3U4QA 2OY0A 3CUUA 1I2BA 1H3FA 2YJGA 2XWSA 3K0AB 1VA4A 3O3CA 1IDN1 1ZNZA 5CVEA 1GL7A 4R41A 3EAFA 1K4KA 1T4BA 4F21A 4PW0A 1URPA 4WKNA 1QE3A 1NXQA 2JCSA 1BG6A 1NMYA 2HAEA 3FDFA 2ZJ1A 3KAPA 3EVZA 4GBGA 1BE6A 4M88A 3RFTA 1S3GA 3RSOA 1BGWA 2WZCA 1KOLA 3PQ5A 2G1UA 4I1UA 2P77A 5CVJA 1GM5A 3DZ8A 2PS1A 4WXMA 4E13A 2HXGA 5IDWA 3C14C 4PG5A 1SCIA 1Z34A 1VKOA 2WSSD 3AJ8A 3RUAA 3VNRA 3WWOA 3M4JA 5F3RA 2IOFK 1Z5VA 1MABA 3VFDA 3IB3A 1W29A 4MQFB 4D25A 2XXJA 2QM7A 3DFIA 3USES 1E6MA 1I14A 3ZD9A 3SSOA 4MUKA 1LRJA 3L1JA 1BFKA 2PLNA 1S89A 1T9GS 2DQ4A 2IY8A 4R1OA 4BLOA 2FH5B 2V3WA 5KSYA 2QOEA 4ZO9A 1R5BA 2DUNA 1C9DB 4P4NA 3IE1A 1I32A 1T9AA 3QWBA 4QOEA 5AKKA 3NTRA 4L0QA 2TMKA 3TLEA 2W2NA 2BMEA 2Z08A 2GTHA 1JAIA 1SXPA 3DXFA 1GY8A 4Q39A 3UJDA 3HA7A 5HDBB 1EWRA 1KEUA 1J21A 2I65A 4LIPD 4IEIA 4LZOA 4O4LB 5DHQA 1E0JA 5GMOA 4X93A 2P2GA 4EO7A 1FBTA 3L0DA 4DDTA 1YBAA 3TAXA 4K0KB 3W78A 2WSYB 1T0PA 4O4JA 2ASEA 1ZVMA 3D5TA 4H0CA 2V6MA 3LVBA 4M1KA 4DQUA 3DBLA 1GTL1 1O9BA 3MWGA 4QFDA 3I2KA 1M2HA 2YN2A 4G0ZA 4M1YA 5DBGA 3OBIA 3LW7A 3PPXA 1AS2A 1RYBA 1BVHA 1NOJA 3S7TA 3IAS6 5DBOA 1NJ5A 1XX6A 3HV0A 1QHIA 3OIUA 2PSSA 2FOXA 3DD1A 4ZYWA 1YNSA 2V5VA 3EGDA 5BYAA 4CM1A 2GM3A 2W6IA 2P4UA 3M49A 5BURA 1J8VA 1XYVA 2GEJA 1HLGA 1NP6A 2ECFA 2P6OA 3FOWA 3OECA 4HX2A 4UCXA 1BDJA 3WGMA 4QDUA 3SBXA 3RKSA 2AF4C 3HYTA 3QVWA 3R7SA 4EJ6A 2QYHA 3CR3C 4RA6A 2Q3HA 4GIBA 5I4BA 1TYZA 4MPJA 3O2JA 3OTIA 4CHTA 3L8GA 2OPHA 3AUTA 5AHWA 1MAWA 2WZBA 4M1OA 3TR6A 2CSXA 4DIUA 2BEUA 2UVDA 4N5HX 2C78A 2CZGA 1BW9B 1Y1PA 3KU4A 4AJ4A 4Q00A 3T3IA 4DKJA 1HT0A 3ZIDA 5I4KA 3GLIB 4LYAA 5EY5B 3VZCA 4F6RB 4KPEC 1OX6A 1E9SA 1T24A 3EGIA 5ELXA 1VMDA 2BMAA 4G63A 4C05A 3O8RA 2EBWA 1FNSA 4Q18A 3V1LA 4ZEWA 2PMWB 4J76A 1SY7A 3AUUA 1E64A 1ZMTA 2D4AA 3QA3E 4LGCA 1TZJA 2JZOA 4KTVE 5KYNA 2QE6A 1X1EA 4LYFA 3G2MA 4N12A 3NUQA 4C08A 3FAKA 3G7UA 3FSJX 1QH1A 2CT8A 3OE7D 1CRPA 2Q0SA 1JDUA 4QBIA 2BEWA 2AEFA 1R6UA 1L8QA 3HGQA 4F3KA 3UK6A 2AE1A 4P4UA 4IH9A 4DMKA 3ECSA 2QLTA 4YRQA 3SJBA 4KR0A 2B4KA 4ZOCA 2VQEB 4N18A 1CY8A 4YRZA 4RF5A 3HBMA 1L4HA 4RV9A 3G79A 5LIRA 3EPRA 1LWNA 3PHJA 4P80A 4TTIA 3GJYA 4DFDA 3C3DA 1JHQA 3K6SB 3ZY4A 2A3RA 4D4LA 1QF6A 1ZRSA 1IEXA 1DRUA 4HL6A 4G4IA 1CUZA 2QK4A 5JAIA 1G9XA 5B7QA 2UZ4A 1CYEA 3TLBA 4QM7A 4OSOA 1Z45A 4TMKA 2ZQZA 1ZIXA 1ZK4A 4TKMA 4JOBA 3Q7TA 1X9IA 4IVNA 3GEPA 1COWD 1Z8FA 3NP7A 4YJKA 3JQ9A 2NQ8A 2A4MA 3U5TA 4WEQA 1M8PA 1Q0SA 1NI4B 1KJYA 2GWHA 4PLVA 5DW3A 2W6JD 1YS9A 4EGQA 4R81A 2X22A 3ELBA 1W46A 1U7ZA 4WLOA 1WBJB 2FNAA 3MRVA 3PENA 3QVTA 4E33A 1VJGA 1LEHA 2VIIA 4MV8A 2TYSB 1I7LA 4K2AA 4ZT7A 3KZVA 4O5AA 3R75A 2VT2A 4NJMA 1UQUA 5F1YA 4A8TA 5T3UA 3ZZMA 4BX2A 5CA1A 5DHPA 5KC9A 1ZD8A 1KDRA 4PLYA 3MGGA 5EUMA 2IP1A 4B3TB 2MJLA 1UT5A 4D9EA 3HJAA 2ZTMA 1BQ3A 5I9IA 2F59A 2Z8YM 4TN1A 1NQOA 2I1LA 4TKUA 1TEXA 1W88B 1M1YE 3K70B 2JFNA 1W52X 2P91A 2FG5A 1VCIA 2A94A 1HY3A 2C94A 3JXEA 3UW3A 3CLRD 4PTLA 1E4YA 1OGJA 1EM6A 1U0OC 3BXEA 4O0MA 2VTBB 3CTPA 3SZRA 3KZMA 4WZBE 4DUGD 4CL3A 1JBEA 1YA8A 4NBTA 2C7QA 4NESA 4G25A 4HUJA 4NH4A 2OCDA 5K4AA 3W05A 1U0RA 1YS4A 1K63A 4MCAA 3ZQ6A 3I9LA 3N6XA 3BJMA 1F0PA 2OOKA 4R84A 3QEMB 2IHKA 1DUVG 5J47A 4L9WA 1OJ7A 4LSGA 3FW1A 5EJMA 3LHSA 4PYKA 3DEJA 3HDJA 4KMOA 3TQFA 5DM60 5JAHA 3I72A 3GCXA 3DUFB 1WVMA 1TJ4A 2C5FA 2GAFA 3R1IA 1I3LA 2F8SA 3G85A 3IP1A 4PE5B 3G2QA 3ICOA 3WIDA 1J33A 2ZWIA 1T2FA 1DJPA 3E48A 1HQYE 2IV2X 2EKLA 2NO5A 4LV6A 3BJIC 1ZZGA 2ZTSA 3LPLA 2JKVA 2XITA 3C5CA 3NHLA 4GI7A 3FPBA 4LRWA 4QTUB 1BU8A 2IDKA 4LNUA 1HDRA 4PO3X 3TCNA 8ATCA 2I76A 4TKVB 5KX5B 1FMFA 3TB6A 4OK5A 3KOYA 3EIFA 1KEZA 1XWIA 1UEXC 2XTJA 3CH7A 4AFNA 3F6BX 4EYGA 4BGUA 5L6LB 4OQLA 3WK7A 1XYYA 2IXDA 4BZXA 4X1OA 5B64A 2V5AA 2GYUA 3GRCA 4OHBA 4ALIA 1JJAA 5EERA 4ER6A 1XEFA 2JFFA 1WHTB 5DASA 1Q1BA 1BD3A 1WD5A 1PI3A 3DTVA 5J63A 3RC7A 1Z2EA 3ZWYA 5BMVF 4PQYA 1E6LA 3LUBA 1W0CA 5ADUS 3CZMA 4WGGA 2OG2A 4RENA 2QAJA 1ODIA 3STVA 2RD2A 1UZUA 1YKFA 2C04A 5IW8A 1LW7A 1CUBA 1FJHA 1VLZA 1W44A 2LE0A 3SYNA 4B84A 2XBLA 3ONDA 1H0RA 3OQJA 4HYQA 1A9YA 1AD2A 5DHUA 3P0JA 4E70A 3I1YA 3HYSA 1ORDA 2AGVA 3MBIA 2XT0A 3MGAA 4N0EA 2Q1WA 4RUKA 5IS2A 4CIXA 1YRBA 4P9NA 1AKWA 1EUZA 2MMCA 1PGOA 2NUAA 3KEMA 1Q0UA 4MKZA 4KN8A 2DFNA 3IMFA 1FOEB 4LOKA 3ZDYB 4ZCRA 2QR3A 2XOXA 3SLRA 1PR0A 2FUKA 5K3BA 3Q6IA 3DBVO 4J6FA 4C87A 4HNSA 3LLSA 3QEMA 2H2HA 3GCGA 3T4EA 5B36A 2AN9A 2NZWA 1E3WB 1T2EA 1R4MB 1TJNA 2QNIA 3LOUA 1HDOA 4H1HA 2R84A 3PRJA 3DS8A 4JBGA 2DT8A 2EX4A 2GZMA 2JIPA 2QTHA 3DAPA 3GK3A 4MQBA 2IEGA 3ZTYA 4INOA 1JVBA 2B2NA 3FVTA 3OLXA 4OI1A 4IQ0A 4ZQIA 1CS0A 2VJDA 1YTUA 3SAJA 1E4VA 3L8DA 2FWPA 1QGYA 4WASA 1XDWA 3AEZA 1DTWA 4MQEA 2G1JA 3VYUB 3AF2A 2IHYA 1RZ3A 4NP6A 2ZVDA 4XB1A 1W0KA 5F7XA 5K7SA 1M2OB 3NR2A 4P3PA 1SZCA 1ZU5A 1A9ZA 2A5YB 4CG0A 3WGKA 3O1JC 1RQXA 2PRIA 4LC0A 4RSGA 5HF6A 1DIGA 1C1HA 1SXJB 3DV0B 3IDZA 1Z63A 1H5QA 3ZX5A 1C3JA 2VA8A 3QOFA 2H1IA 4L2IA 5IVHA 4F7WA 2W2TA 5TF0A 1DP4A 3A9UA 5INTA 1QK4A 1IPFA 2D1FA 2V7XA 2PVSA 3B9PA 5A3VA 4CCAA 2AHRA 2YFKA 3E70C 5CM8B 1NX9A 3R7BA 5A2QA 5KDDA 3G82C 1U7TA 5T41A 1TW3A 2XUAA 2D62A 2QTBA 2CD9A 3WGJA 2R8BA 3L02A 4QDXA 1QHYA 2COEA 3ANYB 3UHFA 3WK5A 3ZGVA 1H5NA 1PG2A 3FYSA 3L9XA 4KV7A 1RP7A 3D7KA 1RQNA 5L3VA 2QVGA 5C18A 1CXZA 1PR5A 4RDHA 1HH4A 1W9HA 5HQ3B 2LKDA 1JPUA 3LF1A 4E5YA 2Y0BA 3MYRA 1UXHA 1BE8A 2XD9A 3GT0A 3Q5EA 1JG3A 2IK8A 2C00A 4QJ5A 4MJXA 3TLJA 5JAOA 1P7VA 2GXUA 3CTMA 1P2GA 1HE8B 4OTZA 4QNMA 4WOCA 3A6FA 2JIZA 2CCJA 1OZ0A 4IO1A 4PYNA 1ULAA 4EABA 4ZHSA 2ZJ7A 4HS9A 4R5HA 4GU5A 4Y30A 3JYPA 1ODKA 3V3TA 1C4WA 4M1TA 1O6ZA 5JH7A 3B1WA 1L7XA 2EKQA 4L3WA 2B1IA 3LG2A 4XJTA 4CF4A 2FWRA 3Q5DA 2BHTA 5CEJA 1NX6A 1QLWA 2VRCD 4EHJA 3KOZA 1D2AA 2P30A 1AS3A 1V5IA 3CX3A 3PQ4A 4HDKB 1O89A 4I2NA 4QHTA 1BXKA 1CZNA 1GGHA 3QPBA 5D01A 3E9MA 4AKIA 4YRCA 4WT7A 4R31A 5K3SA 1T3SA 4DA8A 4CF6A 2ODTX 3TEMA 3QVLA 5HFJA 5IN4A 4DCJA 2EV9A 3CX6A 3WP0A 2XYPA 2YN4A 3K0CC 2C9MA 3MJVA 1ABBA 3TRFA 5I3ZA 3O92A 2PYIA 4L5JA 3ZD6A 4ND7A 3DB2A 2WF6A 3PGJA 3RAFC 2XGJA 4E2ZA 4PLTA 1CR0A 4ARVA 5FOTA 3H0EA 3K0CA 3P0EA 4AP6A 4EJSB 2H7VA 1RTTA 1YONA 2PWBA 5EMHA 1MEEA 1S8NA 1M0SA 1ZONA 1GCAA 2OM6A 3AQ4A 3C45A 5EWLB 3RJ9A 5HKKA 2HF9A 1MHTA 4XB2A 5AOCA 4UNSA 1RC0A 1GNVA 2QP9X 1HTWA 4P83A 1VFPA 1D4ZA 2WKSA 1R0RE 4RS4A 1IYZA 2B0CA 4F9GA 4MCHA 4MUGA 2PU7A 5GIPE 3S68A 4TS4A 2BMVA 1JIXA 2WHEA 3OKPA 4RA6B 5HTOA 3HNOA 4DCPA 3HBLA 1KGDA 1UBSB 2Q4BA 4RL4A 1RM5A 4N82A 3T61A 3ZXUB 5JD6A 4A0HA 3H5WA 4FMPA 4ER3A 3WL3A 5IMBA 2DWCA 3L6UA 3LPCA 4GLBA 4MQLA 5A4JA 4JKYA 2JGRA 4RMIA 5F64A 4NABA 3WAGA 2HJHA 2P3LA 4UU1A 3KZNA 3ZBUA 4YVFA 1H94A 3ULKA 1CUCA 1YACA 3NAQA 4OGFA 3THXB 4UNQA 4Y6OA 2VUHB 1TA0A 2C3MA 4YCJA 3NJ4A 1IEWA 2GQ0A 3ZCXA 1VG8A 1WS6A 1U0TA 2FCRA 3QP9A 2YKGA 5COAA 4BFXA 2H18A 3EMDA 2PLWA 2BUCA 3B53X 3KJHA 4LRUA 2AB0A 1XTKA 1KA9H 1J1ZA 3D8BA 3IYLW 4JQOA 4LOJA 4MEJA 4HDSB 5HQJA 3JVEA 1PJCA 4MR8B 1D0IA 4ZOAA 3RAGA 1D1PA 1W19A 5LA6B 1V4VA 1IQRA 3A1SA 1ZM2A 1JKJA 3DBOB 3SC4A 2IPNA 2GN9A 5JEEA 1C9KA 2IC5A 2QZ9A 2VA9A 3COPA 4OHCA 1KJWA 1ISPA 2IYYA 4TV8F 4BQQA 3TMYA 3GNQA 1PL8A 2XOKD 5I7AA 5BV8A 1F12A 1NPDA 2B9EA 2MHCA 5C1BA 5KOYA 1TLFA 2V3CC 1C30B 3KDPA 5J2TF 4MDFA 2WQZA 3H18A 4D0LB 5C35A 3P2MA 4HY3A 5LQDA 2O5EA 3AOGA 1I7PA 4I6JA 5EHGA 5L40A 2MWMA 4RPGA 3FF4A 2WW8A 4W9RA 5U4XA 3UMYA 1THGA 3LXMA 2P79A 2FPKA 1BX1A 1A8QA 1D6SA 2W2VA 4UM8B 4OHZA 3UT5A 4BO9A 4Z5XA 2BI4A 2AI1A 4YAWA 2GZDA 1Z0ZA 4X5OA 4F5WA 3B2NA 3DMPA 4F6CA 4BNTA 1UBFA 2J5QA 2WJVA 3BD6A 1RJDA 3NX4A 2OBFA 4KLZA 2YIJA 2EW8A 2IYZA 2PMFA 1KBZA 1T8YA 2EDCA 4AJNA 2DJIA 1CZKA 5BOVA 2QRMA 1ARZA 2VRWA 4KO8A 4LYGA 3C5EA 2C3UA 3RS3A 2W6PA 2IHJA 4D4KA 1KHHA 2G63A 1UINA 1BIFA 3TD6A 3VISA 8ADHA 1Z5ZA 5F2KA 4BOYA 2D7CA 4JZKA 2XWQA 3W06A 1V71A 2ZXUA 2MYPA 2YASA 1O03A 4R6XA 1NMQA 2QJFA 4IIXA 5K0BA 3BMCB 4LDZA 4AJ9A 5I48A 3N5KA 5AKZA 4NJEA 3KXKA 3SOZA 2EJCA 1TT5A 2MR5A 3GFOA 4EFNA 1MPTA 2H51A 4CFSA 3FWHA 5FQOA 3PYXA 5C34B 1TZ2A 1IPEA 4YXWD 2FQ1A 3V42A 3KIPA 3M6AA 3FM9A 3NMUF 1N0IA 4XWYA 4FNAA 3GFTA 2O6LA 3T1OA 3E3MA 4AWBA 3K96A 1Y3CE 1BHQ1 3WNQA 1C0IA 4TLMB 3MGBA 1UKVY 1FQKA 2I62A 2XB6A 3JW8A 4DNXA 1MQAA 4G9GA 1QX4A 4TTAA 2AG8A 4INPA 5HJ5A 2VZLA 2X5OA 4DJJA 1D3AA 4Y2XA 1XQXA 4GXRA 2M6KA 3DLAA 3W5UA 1DOZA 4JL6A 4FW8A 3KU1A 1BA2A 1O4VA 1V16A 4UJ5A 5JYBA 3HUEA 2AZXA 4Q7KA 4YONB 2A7QA 2ODAA 5ICCA 2JCXA 4EG8A 2P0EA 4IQGA 4RDCA 1JVNA 3ITKA 4NV1A 3SX2A 1PYOA 2DSNA 1TKAA 4Y1GA 3S28A 4D46A 1XZGA 1VKHA 1IE3A 3MCAA 3LRXA 3GLQA 3O3MB 2IL1A 1XROA 3E5RA 3I52A 2ZRQA 2B61A 3QVKA 4G5FA 3FNQA 4M36A 3U80A 3IOBA 4XW2A 4RY2A 4P22A 1E1RA 1M3SA 4J9UE 1WMEA 4OXNA 3JATA 4PRLA 2P9YA 4M7WA 5JS2A 5IAOA 2QLJA 5ALZA 4I1RA 1N8TA 1CRLA 2IVZA 2Z83A 2WEKA 3ISVA 3I01A 3T52A 2OP0A 2E4XA 3K09C 2VDNB 1PL0A 3BMOB 1R00A 2G07A 3NFRA 4OXIA 3VR6H 4AJHA 1V25A 2W58A 3E58A 4WBNA 3DFUA 2QBYB 3JWEA 5GJBA 4FR2A 5K3EA 3L8EA 1L5OA 3F78A 3A9SA 3QE0A 1OKKA 3I5AA 1HOXA 1O58A 1Q21A 1JQLB 1P4AA 4M38A 4GI5A 2OOSA 3EGEA 3IIMA 4C4XA 4DSNA 2JEOA 4M9SA 5AK4A 5G1OA 2ACKA 3UENA 1XMIA 4HADA 4NE9A 4CF5A 4F5ZA 4QQ8A 2YJ5A 3R4VA 2VDUE 1AKEA 1GEGA 1XBTA 3AINA 3PYMA 3QF4B 1V5FA 4IGKA 3OOJA 4DNQA 5BN1A 1VMIA 2JLAA 3X2FA 4E5KA 4RE6A 3M3HA 4JEHA 2DUJA 3RS8A 3CRMA 1FYXA 3KAKA 4O63O 3F7NA 5A3RA 1C80A 3GJ0A 1GV0A 2X15A 3UH0A 4E08A 1ZOOA 4II3A 1QPGA 2QMYA 3TIFA 1SXHA 2PD3A 1XPUA 1IJBA 2B0JA 1R6XA 2BE9A 2GX6A 2R97A 3AZOA 1Y6FA 1E1YA 3IBTA 3W6OA 3BKWA 5JW6A 4G5GA 4U0KA 3WNDA 1CIPA 1IN5A 1CHNA 3AF1A 4FKBA 3E2PA 2VQFB 3VJRA 4TUYA 4KLNA 3TZBA 4JLSA 1Z36A 2FFBA 3TJZA 1MAVA 4OBEA 9ATCA 2WI8A 4MVYA 1RHUA 4INJA 3OLQA 1MO4A 1VPLA 1UZLA 5AVZA 4AMUA 5ITWA 5K6AC 5JAPA 4KWTA 4Z7JA 4GYKA 1EVQA 4BP9A 5F4ZA 1EUDA 3BICA 1PZMA 2A7XA 2P35A 5KOJA 2DH5A 2WSMA 3MLAA 3WB1A 3D64A 3HXPA 2BJHA 3FNEA 1TQ4A 2F67A 3KR9A 3L4EA 1GG5A 5C8YF 2P5TB 4KR9A 4AS3A 2GM5A 2C3OA 2DSTA 3KYIB 3WAJA 2Q8QA 2VRCA 2Q49A 3I39X 3ZE8A 3O9VA 1OV4A 2I3DA 4E6PA 1G3IA 5EP4A 3T1VA 3UK1A 4EB6A 2PUEA 3BXXA 3MB8A 1C3VA 3EUEA 3HJNA 1W25A 1G98A 2VH2A 1B3BA 3ZK8A 3PJEA 3P45A 1M2WA 1U0JA 1NVWQ 2UAGA 3UOAB 3BMQB 3UMJA 5EJGA 4RJLA 1MOPA 3GHYA 4J0HA 3GGSA 4WCFC 3C0KA 4QUDA 3PK0A 4XDZA 1DC4A 1POXA 4L4XA 5DHRA 4AVYA 1L8AA 3GT3A 1Z5PA 4NAUA 5E6RA 2X3UA 4WK0B 2DULA 3C6MA 4JHLA 3VGPA 3IULA 1MO6A 4DMRA 2OMKA 5ALYA 2BP7A 5CW2A 3FPHA 4AUNA 5EMNA 2JIZD 1U7UA 1L4YA 3LGXA 3QUAA 4HLUC 3TK1A 5JJCA 3IHWA 4C4AA 3HLYA 1LPPA 4BLTA 4TV9A 4YRNA 3BA1A 1D2EA 2HSGA 2WHQA 1ZVVA 4MKFA 2ETVA 3FVVA 3O03A 4FEAA 5AK6A 3ERCA 5A05A 1Z15A 1L5HB 2ZJ2A 1E99A 4H1VA 5EIBD 4LWPA 2BJWA 2REQA 3FLAA 1M1ZA 3OU2A 1DSSG 4ESEA 5EJEA 4HDOB 3OE7A 3E27A 3F5QA 4LWQA 4YRGA 1B15A 3D3KA 3O82A 3PEYA 3OPNA 2TMYA 2VK2A 3CISA 4B40A 1QK3A 3ANXA 2HR1A 1LA2A 1P1FA 2FW1A 3OCXA 4IOMA 1SD1A 2QTMA 4TM8A 5JDCC 4CMEA 5CLIA 4B8ZA 2C0PA 3A9TA 3AVOA 4HQFA 5G02A 1VKNA 4CCWA 3RHSA 1J5EB 7REQA 1G8FA 3M1IA 2IW3A 3JQ9C 1NR7A 1DKLA 4TKUB 3A0UA 4JT2A 4LDRA 3NHSA 3OCWA 5KQGA 1RBYA 5KNLA 1N9GB 1JFFA 2EQBA 4PGHA 2WJAA 3L8HA 2E4WA 4MV3A 2J3IA 5EXPA 4ZEXA 1EE9A 1XMOB 4AX4A 2D8MA 2W6NA 3MMNA 4BQRA 4D9GA 5C46F 2BSXA 4YT8A 1I7SB 4KX5A 5DDIP 3T7TA 2PIDA 3KX2A 1E20A 1RXUA 4KRFA 5JTTA 3IDAA 4RHXA 4WLEA 4KZKA 3W8FA 2IXBA 3ZUGA 2OHVA 1E1NA 2IS1A 2XCQA 3L49A 4JJFA 3RFUA 1OBCA 5CIQA 3W0LB 4CM4A 5FFMA 2QY9A 4GLLA 3VZPA 3BDIA 2UYCA 2HA5A 2K87A 1YVEI 3NRCA 5E9AA 2YOHA 5DK6A 1Z07A 2ONJA 3TINA 1EFPB 1NQWA 2LUOA 2ONCA 3H86A 3HNPA 2BGRA 4II7A 3COVA 4JJ7A 2IHZA 3MCWA 4K81B 4WI1A 3BJRA 1E2NA 2O3JA 3CRW1 4DBLC 4B6SA 5JY6A 1J8DA 3A25A 1DQZA 4WLUA 4WL0A 1ELOA 1FLNA 4EZBA 3P4YA 1JEDA 1MW9X 3JD2A 5CVCA 3TIGA 3G3EA 5T6MA 2ZU0C 4F84A 4FOPA 2FXIA 4EATA 1DNPA 1U1CA 2YV2A 2BOVA 3IIKA 4ENPA 5JSZA 3DE2X 1KYIA 3UA3A 4TTJA 3R9IA 3I2YX 4JVMA 3T6KA 1GZ7A 4MGKR 2XB9A 2GAJA 1F9AA 2BM9A 4DJEC 1JHUA 2YRWA 4UM7A 4CTKA 2X76A 2C2KA 1XAHA 3DMTC 3LLCA 4GC5A 4EHAA 1XJ5A 5CA0F 3A1DA 2HZ7A 2VJPA 4PZ0A 1J90A 2AFHB 1NMXA 1EAMA 3CB2A 3RT9A 3TZHA 2XCUA 2ZWAA 1UBMS 1QH1B 3ABZA 4ZXFA 3OOHA 3DYBA 3SKXA 3SS7X 4AJIA 5FPYA 3ZQJA 3CRQA 5DVZA 2AEEA 1S2DA 3RABA 3N2KA 2J67A 4LAFA 4XRRA 4XD2A 3TW8A 2XT6A 1T4GA 1Z8DA 3OUZA 3KE9A 3CA8A 2WYOA 4KYTA 4OBWA 1NFQA 1VCOA 1Y3AA 3I34X 3JY6A 3QH4A 4FMDF 3T5CA 1FTNA 3ONWA 2R3SA 4HAWA 4GWKA 4UUMA 4Y0NA 5IYZF 1BW9A 3F1LA 4ESHA 1QHHB 2HGSA 1E6UA 3Q7PA 4E0BA 2PPVA 2OE2A 4HQOA 1FXWF 1CY1A 2PKQP 3HSYA 4LJYA 3EK2A 4OQFA 4HRAA 4YRTA 5D84A 1T6ZA 2VXOA 1SBNE 3ZE0B 1C4OA 5CDHA 2LCQA 1G2IA 4IEEA 5AOVA 5IBPA 3LFHA 3S44A 3JYQA 5BMVB 1R15A 4C76A 2XWJI 5JV5A 3WIUA 3UM9A 2D2IA 4P5EA 1A76A 1OILA 3R5SA 1GFZA 2FHSA 2Z6UA 2PX0A 4CNQA 2IV7A 1M8GA 2DY0A 1DKQA 2ZS9A 2ZYRA 4OHFA 5AVOA 5D5PA 3DHYA 4MV4A 3U44B 2LRHA 1N7GA 1T4CA 3EC1A 4Q15A 1NWHA 4YGYA 3STHA 4BJ5A 3KSAC 1MW8X 4NPAA 1KEPA 2X9LA 1GV1A 2JI6A 1QYRA 2R6ZA 1U3GA 1QCCA 3F47A 4H17A 4OK3A 3ZZTA 5CBPB 4B0OA 5CB8A 1CUVA 3M4NA 3PP8A 4I9HA 4RS3A 4BB6A 4K9RA 1XVUA 2GILA 1XV5A 4QGFA 3N8DA 3PFHA 4R7ZA 4AK9A 1ZJZA 3E9CA 4O1IA 4C0HA 2CMKA 5DBIA 5H16A 3A8TA 1SHUX 4NDZA 3KZ1E 1CRZA 3JQGA 4IGIA 2FRDA 4JJZA 2QNBA 4WCFA 2QQGA 3FMVA 1VYUA 1CULC 5ALKA 3I2JA 4KSYA 2FMFA 1YR7A 1IBSA 2QSJA 1FXUA 3MUNA 3OI7A 4LJ6A 4F2PA 6REQA 3OVMA 4M0CA 1YMVA 3CZQA 2GCOA 2XNDA 2Q99A 3LOPA 2D0IA 3MWLA 4NJOA 1YJXA 4PFJA 4U2EA 1XTVA 5BN3B 5JUWA 1XXHA 2V54A 4JI6B 3THSA 4DTCA 1OAOA 3ZCPA 4LC9A 5TQJA 4TL8A 1QU3A 1CE8B 3ADBA 4UTZA 5EEGA 4PPFA 3QENA 3B1KA 3EG9B 3WFJA 4JI7B 5EJ7A 2BBOA 1OFGA 3I2IA 5I7EA 3WG9A 4YRKA 2I7CA 1OVGA 3RLFA 4XIJA 5AVTA 4MGIR 3G1WA 3WFIA 4ZRMA 3CE9A 2IQIA 5DWDA 3NHPA 2ZE8A 2VP9A 2R2GA 1Q3TA 2CJWA 1NJ2A 3IKJA 3GQBA 4I2VA 4XWTA 2X9VA 3ANNA 2QRKA 2NO0A 3U7GA 4J9VA 3CG4A 4U2DA 4XYBA 4JLAA 4F4UA 1OHHD 4QUEA 2Q0HA 2QRJA 1P0IA 4YFVA 2VJAA 4B9AA 5LZ4A 1QKIA 2FVYA 1GUYA 1HXHA 2QV0A 3W2TA 4I6GA 4QPCA 4A2WA 4EVQA 1TJ5A 5LKRA 4C1BA 3QYAA 3PE4A 2FUCA 3WY9A 3WWYA 1P81A 2OGTA 4H7DA 1DZIA 3DL7A 1J5PA 4KJZA 1ZN7A 4KQHA 4Z3DA 1XYGA 3U3RA 3ZLTA 4E5UA 5EXXA 4DBZA 3V2UA 5KWSA 1YHNA 2QGZA 2Y71A 3HVHA 1CY7A 1LU9A 4RSMA 3Q0TA 1Y8AA 2H4YA 1IXSB 2PFSA 4MEBA 1R9JA 4Y6PA 4YXWA 5JMOA 2VQ3A 2A78A 1UEIA 3DR3A 1MF7A 1F3LA 3TNYA 3K31A 4IFIA 1EXVA 1VMEA 1LJUA 4M8IA 2G0TA 2Y05A 4CLXA 5EWLA 1I0LA 1V39A 1I2ZA 1T8UA 1FYEA 4J4TA 1QRAA 4KUGA 3FOBA 4MPPA 2QZSA 3BAZA 2R751 1USVA 1K7YA 2ZXEA 3U09A 4JQSA 4UE2A 3U4GA 1CDOA 4I0WB 5GPBA 3VSCA 4F7DA 5JTUA 5MFZA 5GV8A 4UAGA 1UWCA 1IY0A 3V7NA 2CHGA 2PX3A 1SCBA 2DR2A 4M8KA 3GLHA 3W5HA 3Q9LA 2ZYDA 3AZQA 1L5YA 1W6RA 3ZWMA 4C7BA 1E7RA 1GKYA 2C5HA 3P97A 4WKPA 5DN6A 4AQDA 2KE5A 5JASA 2JH3A 1J9EA 1T4DA 2YY5A 1J24A 3RQIA 5BN4B 1LV8A 3FDJA 1SH7A 5GOTA 3K1AA 3T5GA 1GAXA 5KTTA 3ECCA 3HFJA 2F4VB 1GUBA 4C0QC 5CDTA 4V1CA 2GN2A 4R8VA 1FUUA 1QMPA 3AR3A 4JB0A 5IAKA 3SSNA 5LFAA 4URWR 4JJKA 4BMSA 2VTKA 3ZC3A 1PUXA 2FWMX 2GAOA 1WCYA 4QARA 2MSCB 4NFLA 3NHFA 3CVUA 2XMBA 2WD8A 3EFHA 3NJ8A 3WWEA 4B4OA 3T1YB 2VJLA 4PVCA 1DFIA 3KS9A 1JI3A 2BM1A 1E3IA 2R8EA 2ILTA 4LJ4A 2I80A 3NORA 4UVEA 1F2VA 3T3PB 4ENUA 1N2HA 2HA7A 4IXMA 4XVCA 3SDZA 2FPGA 2QTCA 4E46A 3G0OA 1ZL2A 3IAEA 1W4LA 2OFXA 3C7CB 2I7VA 4HTFB 4OX9B 4PWYA 5BXQC 1DRWA 1NJ6A 3ESBA 3KWMA 4XM1A 2CF5A 2YC2C 4J2OA 4GRIA 4C0XA 5B1EA 2A35A 2GH1A 1YI8A 5CK5A 1JSCA 2XTAA 1TUIA 2WSSA 1VHLA 1G5PA 2Q3MA 5GV7A 2I4TA 2PMEA 4DWVA 1DXHA 5K0CA 1DAKA 3N59A 4R0VA 1H8EA 2GJ9A 4WKCA 4ABYA 3EPJA 1C3EA 1NVMB 2FZVA 2HZBA 3H83A 4PS0A 5D6OA 4AT1A 4DREA 4EYQA 1N34B 5BR8B 1X92A 5JNWA 2HMAA 2QLFA 3L7JA 3WNBA 1R4NA 1ORIA 1TM5E 4QAJA 3CH4B 2OHFA 1X2EA 2IXEA 2QZPA 3EIQA 3ABQB 2W6JA 2YYYA 1RCTE 1Z6ZA 2OZLB 1M83A 3INYA 4DIMA 5I01A 2XUJA 2PX8A 1G21E 4US1R 1RVV1 4MRPA 4URXR 3SX0A 3DL2A 1GA6A 3SQDA 3TBKA 2QRLA 4V02A 2UVQA 1YE8A 5CAEB 2ISSD 4CLDA 3PQ2A 2F1KA 1CUWA 2RARA 1I2DA 4LXTA 2JAOA 1QG2A 4GP9A 5BO5A 3UNXA 2PGXA 1IBRA 4PRYA 4E31A 1DEHA 3DEZA 1R74A 1WQ1R 1AVTA 2Q07A 4G23A 5K3CA 1ZPDA 2CXTA 3W7AA 1MIHA 2PANA 4F86A 4KACA 2IE0A 3QUCA 4D8XA 3MSXA 1NLYA 2HA6A 4L50A 4QPZA 4MNTA 2DFTA 1YB1A 4TLLB 1IQPA 3V8BA 1P31A 1KEVA 2PZFA 1P73A 4E51A 2QJRA 3VYRB 1KKMA 4HEHA 2MSNA 2I2XB 4JITA 1PFWA 4YROA 5BSKA 5KEIA 3CVWA 5IH7A 4EO4A 1TC2A 2ZI7A 2VYND 2WC1A 3OO1A 1TZBA 2VXCA 2G70A 3L04A 4OYLA 3KELA 3V4SA 3U0VA 2WIBA 5H59A 3BL8A 1ORVA 5IPFA 4RTLA 2ZJAA 3GFFA 1A7AA 1GQOA 1WHSB 3EIUA 1DO0A 4YAEA 4AXBA 5BXYA 5JADA 1G9SA 4RF4A 5KQPA 3ZW7A 4LTMA 4OKNA 4N6GA 2ZBUA 4O4HB 2CDRA 1IOWA 1A5SB 1DJOA 1YZHA 1YDMA 2KX7A 5L7TA 3H84A 4ZOLB 1W8DA 4QDTA 4FZ3A 1RACA 2J0EA 2QQ5A 2AF3C 3A70A 3M5CA 1SXJC 1Y82A 5EJAA 3AVVA 3K09A 3GLKA 1NURA 3LDUA 5LZ9A 4W6ZA 4BN5A 4UFPA 1RQRA 2FRVA 1SK9A 2I54A 5AO9A 2P6UA 4WSOA 1XB2A 3PI6A 2KJQA 3DE0X 2AMVA 2X7JA 4DNPA 1LLFA 5EIHA 5LQJA 1QV6A 1YC5A 5DIZA 1R4AA 2R00A 4CMHA 1GITA 2YJTD 3DDSA 2Q1XA 5AOBA 5CFQA 4LC1A 1HQKA 3KK0A 2OV8A 4KMRA 3JARB 1A5ZA 5HZHA 4RADA 3TQOA 2K2QB 4FOOA 1U8CB 1K0FA 1MX5A 3FZQA 4NH0A 1GKIA 1E9VA 1QS0A 3MXTA 4PHGA 3OZAA 3GEIA 2ENWA 4TKLA 5IJAA 5PGMA 2OXIA 1NVXQ 1M7BA 4Z0NA 3QLVC 2DF8A 3ICPA 4BQFA 1BKDR 1MTZA 4UEJA 2YVAA 4PINA 4Q9IA 3TL2A 2P8SA 1HL7A 3KCQA 2XQIA 3GA0A 1VLMA 4H7KA 1HDYA 5FTWA 4GPBA 3JAMA 2EZUA 1WDKA 1HFWA 4MOWA 4QUHA 3WTBA 4D9JA 3WZ2A 2G9ZA 4EI9A 2OQRA 4A2QA 4CU5A 1BXGA 2OC9A 5AM4A 1QG0A 1VPTA 1G5RA 3KJQA 1QDEA 1NF3A 3C87A 1OLSB 3KQSA 3CT4A 4PIMA 3W9YA 2BLNA 3F74A 4TV8A 5ALJA 5L3QA 2PBLA 3CLRC 3AT1A 3DDWA 1LBEA 3SM9A 1P0QA 1UZMA 3H4VA 4DLUA 4JX9A 1K3UB 3ZNNA 3MTAA 2ZSUA 4JU8A 4UU0A 4GPZA 1UJ5A 3O74A 3WL6A 4AJJA 1QGUB 1NVAA 4I6EA 3OF5A 5TX7A 4UNPA 1FTGA 2FI1A 1XJWA 1MRNA 2O1XA 1UH5A 5IU6A 1XI2A 1Q7RA 1W5FA 2J3MA 1T3GA 3VYVA 1ONPA 5HK8A 1SC4A 1SUEA 2Q6IA 3ADPA 3BWCA 3D2CA 1VHDA 2H5IA 2I78A 3I30X 1M2FA 3WIOA 421PA 4KR6A 4H6WA 4C0BA 1YASA 4BO1A 1Y3IA 1S2MA 3WLHA 3BG5A 2EBUA 2VJNA 1Q1EA 3JWIA 3OP4A 5JEDA 2IQ5A 5CT8A 5EXEA 4UTPA 5HKOA 2QG6A 3HTXA 4DMUB 1JQ3A 1PEKE 1FRVA 2HC9A 2VLIA 2ZSIA 4ID3A 1QV9A 1XKQA 2JCBA 4XJXA 4MO2A 4RD4A 5KSWB 1O4WA 3IOMA 1M0WA 4LA4A 3B20A 3HUDA 4DCCA 1PTKA 4BNGA 2VXBA 2C99A 2JAWA 3ZWBA 3TTVA 4Q0MA 1A9XA 1L7VC 1JSXA 3F3MA 1NG9A 1F2DA 4RABA 4EW6A 1BE1A 2GEBA 2ZRMA 3K1TA 3KQTA 4TRJA 5CT5A 2X23A 3RUEA 3RK0A 3WRYC 1QS0B 2GN1A 1R66A 1RT9A 4HKTA 4RLFA 3PJRA 3D4NA 1JFRA 3P9PA 4JVNA 1L7AA 3BGOS 3W5BA 4HQ6A 2X2FA 3OCVA 2O4CA 1RBZA 3IV7A 3NNNA 4ALMA 2Q2QA 3NYRA 2PE5A 5MN5A 3I61A 2BEVA 3LYLA 2QP4A 3E81A 5IDYA 1GL3A 2P65A 1FNBA 4RQUA 1U1IA 1OYVA 2GCEA 2V45A 1GNPA 3EUAA 721PA 3H99A 3R3JA 5JS7A 3ACDA 5KOJB 3UT0A 3WGTA 2H2AA 4LKRA 5HF5A 1SBQA 4EA6A 1XRSB 2C2OA 1KK3A 2E0IA 3FOAA 3ADKA 3KQWA 3C85A 1NTOA 2OZVA 2EJBA 2WWRA 2JD2A 3RFVA 4V0ME 2P9GA 4NE7A 2CJYA 5SZIA 4LK2A 4UUAA 1WXIA 2FFAA 5SY6A 3S0JA 1HZJA 3CPHA 3MWDB 1VJ5A 2BDTA 2IUEA 2WF7A 2GYVA 4BC0A 2ZB3A 1HBJA 5IC6A 5B6JA 3JWHA 4OXKA 1NW5A 3KWJA 2V9PA 1P60A 3KXLA 5IJ0B 3Q98A 4BXOA 4X41A 1E2MA 3UAZA 2GVNA 1Z5NA 2ZYAA 4K03A 1JIQA 3NHKA 4MLDA 3NALA 3D0QA 4DQKA 3PGA1 1USUA 1NN1A 1XN4A 5ARDA 5FEUA 5LLTA 3I45A 4BCCA 5C1PA 4KO2S 1QMGA 2P4EA 3WRXC 4BN4A 3CLTD 3NBAA 1NJFA 3KVRA 3N07A 4MVJD 2BZ0A 4WKBA 5LNK1 3LA6A 4KVGA 4FGZA 2WIDA 3C7DB 3OETA 5FO1A 3AVPA 2ECPA 3BE4A 5EWJA 2JHFA 4XM2A 4ZYVA 4FW9A 4ZAWA 1CIJA 2XMQA 5EIOA 3GWZA 4JU9A 3G9UA 3OZVA 5I8PA 1WV1A 4ZARA 4KQKA 2CVQA 2C7PA 1RXSA 5BW8A 2V97A 2I7XA 2R5NA 1VJDA 5DISB 5ALGA 4CG2A 4ZDKA 4QVIA 2PZJA 1VB3A 2O05A 3BFPA 3L6DA 1OX4A 1WUTA 1X80A 2X7XA 2QTWB 3G2HA 3MIIA 3NC1C 1DBIA 2AYXA 4FN5A 1DBWA 1NNUA 1DAGA 2PUGA 3S1AA 2FEWB 3D4OA 4EYKA 4BZPA 3AL0C 5FP0A 2P0YA 3B5IA 1YE5A 1EEHA 5EPEA 5HQTA 3Q8WA 4CMKA 3H2JA 1DJNA 1L7MA 1QC5A 1V47A 3FVRA 3GEGA 4RDIA 4HDMB 4COOA 2XCSB 4JYCA 3DL4A 4L0DA 1Q6ZA 2Q0QA 3EVGA 4HFJA 4AC9A 3EZLA 3OOWA 3CSDA 4B6RA 5ERGB 3QPVA 1L4UA 2MSKA 4BVKA 5JWRA 1T5SA 3HFRA 4HT3B 3LDFA 3OFSA 4ZDWA 2VK8A 1W73A 1SB9A 2ZP1A 5ENZA 9ABPA 5KU7A 3SSAA 2F9MA 4JLMA 1QH0A 4WNYA 1TLTA 4B4VA 4QVGA 1ZXXA 1M72A 3NAGA 4JSTA 1VGRA 1HLPA 2ADOA 3E8MA 4IINA 4L85A 4OFXA 4UD2A 2QE7D 3GPLA 1TYAE 2A9FA 2WYHA 3H8VA 4K5QA 3HVRA 4YP6A 3PC6A 4UM5A 3LC1O 5A6SB 3IUEA 3ZWQA 4JVSB 4DC9A 4ZT6A 4DLRA 2OHXA 2QM8A 5EZYF 4DLKA 4PBTA 1PFQA 2XGGA 2A1IA 3I23A 2OGUA 4MI6A 5FL7A 3ZDAA 2EYUA 3RFCA 3KQLA 3E7DA 3IT0A 4DLLA 5D86A 1TAHA 1BRMA 4RK1A 3KHKA 4M87A 1T36B 1RQPA 3GROA 1LF5A 3OFVA 5E8RA 1LC3A 1BFUA 1OH5A 2ZB4A 5CG1A 4ZHQB 3BWMA 1JHAA 1R5JA 3GUUA 4L72A 5AVJA 5FX2A 5HBGA 5CFLA 2ZBDA 3A2KA 5IASA 4BV2A 2PFKA 3RKUA 1GLVA 4W5TA 1R37A 3PIDA 4GPIB 2FW9A 2GETA 3FTQA 1QIEA 3D59A 4LHZA 1D0SA 4MVCA 3F9CA 4FFOA 1DEAA 3DULA 1RJFA 4ARIA 1P2TA 2EW2A 4NZOA 1U2QA 2VDMB 5IHXA 1FLDA 3BEDA 2JGEA 3CMMA 2PNFA 3QEJA 4LXYA 5B7GA 3SVLA 4OXXA 3Q3EA 4TLAA 1UBNA 1UFKA 3GRYA 3BQNB 4DXDA 3LW8A 5BW4A 5DCWA 2OVFA 2RK3A 2H4JA 2XEDA 2SBTA 4ND4A 3FWKA 3NASA 2RHHA 3EDYA 4FSXA 4PIVA 3C3YA 4AJLA 2R0QC 3GRPA 4LYJA 3TMKA 4UE3S 2F64A 3TLMA 1BCRA 1FUIA 4I14A 1CVIA 5B4TA 1P44A 2HU7A 4QQNA 1UPAA 1RRKA 3NS7A 2E4YA 4Z9AA 1FTQA 5TLSA 3IVAA 1UOPA 4J0JA 1IBCA 2V7VA 4MWTA 3VR4H 4EY3A 3E3LA 4D6PA 1P33A 2BGNA 2NNWB 1BVYF 2ZSJA 3PZBA 2XBUA 1E62A 4FYWA 4CM9D 4YHHB 1FNCA 1W2GA 2C8LA 2J4DA 2WTAA 4IUCS 1DBVO 3AI3A 2POQX 2FPSA 3ESDA 2JRLA 4DDWA 4DQVA 4UEOA 1B0UA 3THWA 2WVJA 4NKRA 1NKSA 2J3QA 1XQ1A 1Y63A 2AG5A 2WIGA 1H8HD 2RONA 2VDKB 2QS9A 4JB3A 3BMNB 2NP7A 4HOYA 4DA4A 3VDNB 4X1YA 1DG1G 3C3BA 4BKOA 2QN7A 2WVAA 2XRYA 3CEAA 3SXUB 1LNQA 1NXXA 2PDAA 4REOA 4BV9A 2X1MA 4F5EA 4DBLE 4CLHA 3RK4A 1MEOA 4FT2A