4PIPA

Engineered egtd variant egtd-m252v,e282a in complex with tryptophan and sah
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
316
Chain Sequence
LSLANYLAAAAEALRRDVRAGLTATQKSLPPKWFYDAVGSDLFDQITRLPEYYPTRTEAQILRTRSAEIISAAGADTLVELGSGTSEKTRMLLDAMRDAELLRRFIPFDVDAGVLRSAGAAIGAEYPGIEIDAVCGDFEEHLGKIPHVGRRLVVFLGSTIGNLTPAPRAEFLSTLADTLQPGDSLLLGTDLVKDTGRLVRAYDDAAGVTAAFNRNVLAVVNRELSADFDLDAFEHVAKWNSDEERIEVWLRARTAQHVRVAALDLEVDFAAGEEMLTAVSCKFRPENVVAELAEAGLRQTHWWTDPAGDFGLSLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine-specific methyltransferase EgtD
publication title Ergothioneine Biosynthetic Methyltransferase EgtD Reveals the Structural Basis of Aromatic Amino Acid Betaine Biosynthesis.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 115
structure length 316
sequence length 318
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.44: L-histidine N(alpha)-methyltransferase.
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10017 Methyltransf_33 Histidine-specific methyltransferase, SAM-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pipA01
3DP7A 5FTWA 1XDUA 2P40A 3U81A 2C7QA 3EVDA 3TKYA 3JWIA 3MTIA 3E23A 5K0GA 4HTFA 4E33A 3ANXA 2PBFA 1G8AA 2AOUB 5LQRA 5D1HA 2ZFUA 5DTRA 3UFBA 3LBFA 3OU7A 2BM9A 3FUWA 4R8RA 2HNKA 1R8YA 1X1BA 1Y8CA 1YB2A 2QE6A 4PNEA 2WA1A 2FYTA 2JH8A 2QYOA 3THRA 3KQPA 5EEGA 3T7TA 3NDJA 3ELYA 3GJYA 4QVKA 4G56A 4YUVA 1P39A 4M7RA 4OQDA 5GP1A 3LSTA 4C04A 1SQFA 3K0BA 4KVZA 4C4AA 2BZGA 4X41A 3V97A 2ZBRA 3UBTA 3C6MA 1PJZA 5EGSA 4WXHA 3C6KA 3P9KA 3HVIA 4GBED 5E2BA 3REOA 2BM8A 2Q41A 5DXJA 1P91A 3BGIA 3OCJA 3IHTA 1RI2A 3B3JA 3HCEA 4ER0A 4HC4A 5DM0A 3KKZA 1U2ZA 3TM5A 2G1PA 3UJBA 2ZWAA 2ESRA 5DSXA 5HIJA 1QANA 3LGAA 1M6EX 4P58A 3FYDA 2E5WA 4FR0A 4GF5A 2UZ4A 2JG3A 1XCJA 1JG1A 4CKCA 5K05A 5FCDA 3KPJA 3TOSA 2EG5A 3DMFA 5DT2A 5EIFA 4C06A 3E05A 2B2CA 2ONZA 3MQ2A 4GOMD 1XDSA 2V74B 4CKBA 2OYRA 3OZSA 1PRYA 4RTPA 5FA8A 1XVAA 4YUZA 3R6TA 2AN3A 5EZSA 3VYWA 3HNRA 4C05A 3LCUA 2ZCJA 5K03A 5KS2A 2FK8A 1WY7A 2H00A 3GRUA 5D1NA 2I62A 5E1OA 4YV1A 5IKMA 1RI5A 3KQSA 5GIOE 3GRRA 4E2ZA 4CWAA 3MCZA 4XUEA 2OKCA 5BXYA 5LQJA 2Z6AA 3C3PA 1FP1D 1NKVA 4M38A 3FTCA 4YMGA 2HV9A 1XJ5A 2ZLBA 2PVCA 4GOOD 1R00A 4QPPA 1JTEA 3G2OA 4RV9A 3FZGA 2AOTA 5C9ZA 5GIPE 2P3LA 2YUIA 2GPYA 5F2KA 3LDGA 3MTEA 4LG1A 4PYLA 5FUBA 3PTAA 4IV8A 4C08A 3FPGA 1MJFA 1VPTA 3QV2A 5P8WA 3EVGA 2IH5A 5FWAA 2HMYB 3GO4A 3IYLW 3CKKA 1L3IA 4QQNA 1O9HA 1P1CA 4EKGA 2N47A 1WXXA 2AVDA 2IDJA 1R8XA 2UYOA 3BKXA 2GB4A 1D2CA 2GS9A 4RTQA 3G2PA 2P41A 3NW9A 5U4XA 2IFTA 3PS9A 3UWPA 3DR5A 4DM3A 3KR2A 4MIKA 2XBMA 3HCAA 3H2BA 4H0NA 3L8DA 3THSA 5FADA 4A6EA 4RTNA 3KQOA 3SSOA 3EGIA 4PYJA 4RTSA 3ELUA 1NBIA 3NDIA 5DWQA 3ER8A 3KQTA 3AY0A 2PT9A 1UFKA 2VZ9A 3OZRA 2B25A 2PX8A 2AN5A 1ZGAA 1B42A 2ZBQA 3JWHA 4GEKA 3HA3A 5CIYA 2PSSA 1VBFA 4DCMA 3TLJA 1NW7A 4RVFA 1MHTA 5CVJA 2IPXA 3IV6A 4RVHA 3HA7A 5E2AA 5JUWA 4ER3A 1ZGJA 3FTDA 3KPUA 3M6UA 2O05A 4FSDA 5DX8A 5FWDA 5ICCA 3A27A 3HCBA 2EJUA 4FZVA 5DRYA 3P8ZA 3UZUA 3LPMA 4XUDA 2F8LA 3FUXA 2G70A 5KQSA 3DULA 10MHA 5LQNA 2WK1A 2G8NA 3TKAA 4RTJA 3MGGA 2P3OA 3CBGA 3T7RA 3Q87B 1KP9A 1KXZA 3MERA 3NJRA 5DTMA 4ATNA 5K01A 4HGZA 2O0LA 5DSTA 5K0CA 5BW4A 3BWYA 3A4TA 3HEMA 2PGXA 2PKWA 2AVNA 2R3SA 3G88A 3HP7A 1JG2A 1JR4A 1L3CA 2ADMA 3T0IA 2O57A 4HRAA 3EVZA 4V0QA 4P7JA 5CVVA 3FPJA 4DQ0A 2FK7A 2AR0A 3B7PA 1RJDA 2AOUA 2KW5A 2PX5A 2Y1XA 3BUSA 3GDHA 3P71T 3DXXA 5G02A 3P9IA 5GM2A 4OX9Y 3PX2A 5K0EA 3NVKI 1RJGA 4KRGA 1JG4A 1JSXA 4PYOA 2K4MA 2I7CA 4MTLA 2FPOA 2QM3A 5C1IA 1ORHA 2B78A 3FPEA 3UJ6A 3MHTA 3DH0A 5EC8A 2ERCA 4MQ4A 3AWIA 2ORED 4QPNA 2YQZA 3NWBA 5EOVA 5K0BA 3KQVA 4QQKA 4RX1A 2VDUE 1KPGA 1AQJA 5EZQA 5FHRA 3BGVA 3G2MA 2EJTA 5CVEA 1SVUA 1RI1A 3GRYA 5HIMA 3ER9A 3CJQA 2ZIGA 3KR1A 1FJXA 4MWZA 4EKIA 1RI3A 3ME5A 3HCDA 2P8JA 3GWZA 5DPMA 3EVEA 3M6WA 5DTQA 1M0EA 5LQCA 1AV6A 3HA5A 2H1RA 4OA8A 1EJ6A 4X60A 2CMHA 3DMHA 5FULA 2AOXA 3CC8A 3KPWA 2IIPA 4YUYA 2ZVJA 3BT7A 3GRVA 3LX6A 1BHJA 1NT2A 3FRIA 3P9CA 2YTZA 4FT4A 2JHAA 4AZTA 2I9KA 1NW6A 3LDUA 3E7PA 3M70A 1HNNA 3A7EA 3LKDA 3MB5A 5K0JA 1VLMA 1NBHA 3PFGA 3UJDA 3DXYA 3FUVA 1O54A 4HSGA 4R8SA 3B89A 4ISCA 5EMMA 3AXTA 5DRTA 5CVDA 2A14A 2BR3A 1KYWA 2PJDA 2PXAA 3LECA 3BZBA 4KIGA 2CL5A 3G2QA 5E1DA 1VP9A 1KIAA 3OFJA 5C0OE 3DUWA 3PVCA 1G38A 1WG8A 2FHPA 2ZSUA 3BGDA 4DF3A 5DM1A 3HVHA 3UA4A 3TFWA 2G71A 1D2HA 3BKWA 5DX1A 3SR4A 4E30A 3VC1A 3G8AA 4JXJA 2YR0A 1G60A 3EEOA 3HVJA 3O31A 5CM2Z 4ZTBA 2ZZKA 1VP3A 2EFJA 3OPNA 4HH4A 4PCAA 3BWBA 3D2LA 4RVGA 5E1BA 4DA4A 1JQ3A 4DKJA 2P1DA 2JHCA 3NVMB 3CVOA 2ZZNA 4YV2A 2PX2A 3KQWA 3ID6C 1KR5A 3PX3A 4O29A 3GCZA 3TPZA 2BR4A 3EMDA 3QOXA 3ELWA 4R6XA 4LWPA 3LHDA 5K0LA 3EEYA 4PWYA 3FUUA 4CTJA 3KR9A 3WSTA 3BWCA 1T43A 1ORIA 1Q0TA 2CWWA 2PX4A 3CJTA 5HOQA 1HMYA 4QDJA 2I6GA 5E9QA 5FHQA 4DZRA 5HIKA 2NYUA 3FTEA 4KW7A 5EKUA 3P97A 4ER7A 1NV9A 1SKMA 4YV0A 5E9JA 4DMGA 2JHPA 5IH3A 5ICGA 1IXKA 2O07A 3GNLA 4RSRA 3I64A 2GH1A 2XYVA 5GOZA 1L9KA 1F38A 5MHTA 1TW3A 4HG2A 1FPQA 2DULA 3TQSA 2QRVB 2PXCA 3AJDA 4RTOA 3HCCA 3KQMA 5KQRA 5LQAA 3FRHA 1P1BA 5EMJA 1VL5A 3HCFA 1VIDA 4A6DA 1O9GA 5ICEA 4ER6A 2BR5A 3KR0A 1WS6A 1UWVA 2ZIEA 2PT6A 1QAOA 3EVBA 3GRZA 4E31A 2V7EA 3EVFA 3I5UA 4YUWA 3TR6A 2C7PA 4YUXA 5K09A 1FP2A 3UJ7A 4QTTB 1VE3A 3A7DA 1L3BA 5GWXA 1X1AA 3CGGA 3KPYA 4MHTA 2ZTHA 3ORHA 2GA9A 1NW8A 3T7SA 1AF7A 5E8RA 4AZWA 1ZHFA 4R05A 4EVIA 5EMLA 4OA5A 5DLYA 2C7OA 5HIIA 2XVAA 2P7HA 3EPPA 4U7TB 3UJAA 3GXOA 3HM2A 3UJCA 1SUSA 5B1SA 1TPYA 4BLWA 3EMBA 3M6XA 3BXOA 1IM8A 3OE5A 2NXNA 4DCGA 3R9XB 3B3FA 3ERCA 3OE4A 3O4FA 2YXEA 3LL7A 2OB1A 4WVLA 5T64A 1SQGA 3SGLA 2B9EA 2P3QA 4C03A 3M4XA 3PB3A 3VSEA 4GUAA 1RJFA 4F86A 3OFKA 5LQUA 4PIMA 5EMKA 1IY9A 4RWZA 3TRKA 3EVAA 1YZ3A 2UYCA 7MHTA 9MHTA 3GU3A 2FCAA 1RJEA 4PONA 1JQDA 3LCCA 4IKPA 2QY6A 1YUBA 4PYNA 4BLUA 4EMSA 5KVAA 1YFJA 3NMUF 5HEKA 3UJ9A 1G55A 4XCXA 5ERGB 2AOVA 3P2KA 5EIWA 4XUCA 1KYZA 1ZKDA 4GC9A 5FQOA 4QDKA 4E2WA 4X1OA 5LQKA 2NP6A 2FRXA 1BOOA 4OBXA 3LCVB 1TW2A 1JQEA 2OBFA 2UYHA 1KHHA 3SSNA 3OU2A 4GOND 3BWMA 1G8SA 2C7RA 2Z6UA 1SUIA 4PGGA 1JSZA 3ELDA 3I58A 3R24A 5EHIA 5EQJB 5E9WA 2XVMA 1YFLA 2GLUA 1QZZA 1NE2A 1XXLA 3M33A 4KWCA 2ZBPA 4PYMA 4X63A 3V8VA 3UA3A 5HZMA 5GINE 2OY0A 3QOWA 3M6VA 2NNWB 4E2XA 5K0FA 3R0QA 2OXTA 3DLCA 3SSMA 4NECA 4HTFB 2UYQA 2VS1A 3EGEA 3G5LA 4FGZA 3F4KA 3RODA 4QTUB 2AZTA 3KQQA 1RI4A 2Z6QA 2VDVE 2IH2A 3FTFA 1XCLA 1I1NA 3LDFA 5GM1A 1N7JA 2ONYA 2G72A 2WA2A 4F85A 2PXXA 3SM3A 1EAMA 3TM4A 4AUKA 1I4WA 3CJRA 1YF3A 4PGHA 2ZIFA 3LBYA 2GAFA 1X1DA 2XYQA 2YXLA 3C3YA 3A25A 3I9FA 5F2NA 4F84A 2VDWA 4PINA 2OZVA 1QAMA 2AN4A 4M37A 3EVCA 4BLVA 4POOA 5E8JA 3SVZA 3K6RA 2OO3A 5HFJA 3G7UA 5FQNA 2IBTA 3KQYA 4K6MA 3PLAE 4BP3A 3FPHA 4B17A 1QYRA 1ZG3A 4V0RA 1YZHA 3VC2A 4AX8A 5EHGA 2VP3A 5BW5A 3DLIA 3CCFA 4KIFA 3S68A 3SXJA 8MHTA 5EG5A 2OB2A 4PCLA 3FYCA 3R3HA 3KHKA 5CCXA 1R18A 1L1EA 2NXJA 4RTLA 4RTMA 3P2IA 4ER5A 4CTKA 1F3LA 2NXEA 5DM4A 2JJQA 3JWJA 4CXMA 3GIWA 1KPHA 2P7IA 4OQEA 4CKEA 3B5IA 3KU1A 5DX0A 4BP1A 4EK9A 2EX4A 1INLA 2YX1A 4HGYA 4X61A 4YMHA 2QRVA 2O06A 3E8SA 1I9GA 2ZW9A 4M36A 3RIEA 4E2YA 3DXZA 1UIRA 2IGTA 2PWPA 3X0DA 4PYIA 4LWOA 3LKZA 5M5BA 1BKYA 4RVDA 3JWGA 3KPVA 1R74A 1N2XA 5BP7A 2XYRA 2ZULA 3FPFA 3DOUA 3RW9A 1FBNA 2CMGA 3G5TA 2AOTB 5K8VA 2DPMA 5F2OA 4RYLA 5HILA 5K0NA 4GOLD 3PT9A 2R6ZA 3O7WA 5EPEA 4RTRA 3DTNA 3P2EA 1DUSA 4FSXA 4FP9A 3GGDA 4PYKA 1EG2A 5E1MA 4PIPA 2P35A 2HR1A 1X1CA 5CUQA 4R6WA 1JTFA 4FT2A 2YVLA 4LECA 1NW5A 3AXSA 5EVJA 1Z3CA 5EKXA 5LSAA 2BH2A 2H11A 3G89A 1XTPA 2ZZMA 5EEHA 5ICFA 4E32A 1KPIA 4UOEA 2LD4A 2NXCA 1D2GA 4L7VA 1V39A 1H1DA 5JR3A 1X19A 2ZWVA 2B3TA 3PFHA 3MAGA 4IWNA 1JG3A 3SMQA 1EQAA 3I53A 3B3GA 1EIZA 1VQ1A 2Y1WA 3P9NA 3NWEA 5DM2A 1M6YA 4BY9E 4Z2YA 4E70A 3HTXA 3NTVA 3SX0A 1BC5A 1EJ0A 3C0KA 2IBSA 1QAQA 1R6AA 5T6BA 4P7GA 4C07A 4RTKA 2IH4A 4FS8A 3HVKA 2OPBA 1G6Q1 2PLWA 5LR6A 1SG9A 4IV0A 4KDCA 2IDKA 2IP2A 3MCTA 4P7KA 1DL5A 2PV0A 1WZNA 2AOWA 1NW3A 5CCBA 4U7PB 5DXAA 5FA5A 1Q0SA 2HWKA 2AS0A 3OZTA 4OBWA 4PYQA 2PWYA 1ZQ9A 4EQZA 5KYGA 3G8BA 1DCTA 3FUTA 1AQIA 4KDRA 4Y30A 3IEIA 3Q7EA 4GC5A 4GQBA 3EGVA 3OU6A 3TMAA 3A26A 1N7IA 2JH9A 5T67A 4AZSA 2PY6A 2HTEA 5H02A 1NV8A 4P7FA 4Y2HA 1OR8A 3DMGA 3UJ8A 2NP7A 5CD1A 2CKDA 1WXWA 5CVUA 2YXDA 4QVGA 4AZVA 1XDZA
chains in the Genus database with same CATH superfamily
4N82A 1OIVA 1SXJD 3ZGLA 4J2TA 4CG0A 2CKMA 4BV9A 2C8JA 2AC4A 1FNDA 3CX7A 5BOSB 2VJOA 4IH1A 3B78A 3MTIA 4CCYB 1DOHA 2NU9A 5DXFA 5EJ6A 1UM9B 3JPYA 4O2AF 2IYUA 1DUVG 3BMOA 4UD6A 1HFWA 1T2FA 2ZSKA 5D1HA 3E5RA 5LBIA 2DH6A 3I5MA 3UFBA 1QJ4A 1Z6TA 4R1QA 1WMAA 4RIGA 3ZHQA 5BSWA 2PZFA 2RG7A 3PR1A 2OCDA 1RWPA 3CNNA 2QPAA 4J0IA 1AHHA 3UK1A 1NJ6A 1GA6A 1DBPA 4KHPB 2J45A 4UATA 3ZQ6A 3P7MA 4G5RA 2FUG1 4PFQA 3EZ2A 3NCHA 3ZCTA 4O1HA 2CVQA 2ZJ7A 4MR8A 1ZKMA 3FMVA 3NEPX 3OHSX 3KSBC 1O5IA 3C3KA 1EFUA 4Q4AA 3K0SA 2HBQA 1N2CE 4FUTA 1UZLA 1I4TD 1P81A 3O8BA 1GDHA 1QFYA 3PTZA 3F9RA 2Y1LA 4PG7A 5JISA 3W05A 1ZDMA 4CFZA 1FP7A 3AVXA 3WI7A 4C0QC 3COSA 5DSXA 1G2IA 3PENA 4LRSB 3H2HA 3SE7A 5J2TB 4H4DA 4BQOA 4DLTA 4B1FA 1XCJA 4IFIA 1JG1A 5KU7A 1ENPA 2VTBB 4TXNA 3T3NA 4CM1A 2BFWA 2OR3A 1L4UA 1V9LA 2EHJA 2E7ZA 2WYVA 4PQEA 4HQNA 1Y0BA 4P4LA 4N03A 1ZR2A 4PX2A 4UHEA 4M0KA 1FSGA 2WYUA 5FPSA 1VDZA 3CH5A 4H59A 4KGDA 2QXYA 3WP1B 2YWRA 4KEAA 2DY0A 4PHGA 1S01A 2VEDA 3L46A 4Q9AA 4YV1A 4LEIA 6LDHA 4X44A 1C1DA 1QYXA 4J7CA 4YJFB 5EWJB 2XB9A 2H5JA 5JO9A 4KQ6A 3ZWYA 4UW9A 4CI9A 2P9ZA 3B9BA 3DKVA 4C3VA 2G9NA 4YMGA 1ZCBA 2ZLBA 2XADA 1E3DA 1NUAA 3QXSA 1U0EA 4JEIA 1RWXA 2ZUSA 4LDAA 3NYRA 4J4BA 3VKHA 3KUCA 3Q9NA 2BFBA 2W8ZA 4WJLA 3TIIA 1L8LA 4PZCA 4U8GA 4OGGA 5FOVA 1RHUA 4PGFA 2E2WA 3ON5A 4B6OA 3SMVA 4F46A 2H7CA 5JVDF 4YALA 2H3HA 1XEWY 1CJTC 2AHRA 2O1WA 2BGLA 1OWNA 2Q3LA 4HDSB 3PX7A 4Z4GA 2HSZA 1OGYA 2IDJA 3ESBA 3IAS6 5CFZA 3SHWA 2ASVA 5FLEX 4L4ZA 3NW9A 3NQ41 5U4XA 4LJAA 1CUBA 1GU0A 1MNQA 1KZ1A 2VXOA 3RASA 1GZVA 4H35A 2C0CA 1H69A 3GJRA 1CHNA 4FX2A 3TLGB 1X80B 2XTJA 3O8OB 3MA0A 3KUUA 4L5JA 1IN5A 3WL5A 5LU8A 1A95A 5F78A 1C7RA 4HDAA 4HMQA 4D44A 2FW9A 1KI1A 3ILHA 3QBVA 3DFIA 5EIEA 1I94B 1NLMA 2J0SA 3HJRA 1DSSG 5HJ7A 2BSQA 2Z5GA 3OZRA 2Z3VA 3D0RA 3P2OA 5CTJA 2IHUA 2V7QA 3EUEA 4J3FA 4M0CA 5BQOA 5KTRA 4KRFA 2JGLA 5KSPA 3HU5A 2AC2A 3UFXB 3DOEA 2EZ9A 4BFTA 5CVJA 2JAPA 2IPXA 2Q1WA 1QH8B 2ZI4A 3HA7A 1LTHR 4W5NA 2YOHA 4JX8A 1E6EA 1GZ5A 1CUHA 4JHLA 1UWKA 1WW8A 4X94A 5DH9A 3TTVA 4EB8A 4E15A 4EPYA 4ROSA 3FYUC 2VJKA 1USIA 4TX1A 5LUAA 1YVRA 2IK8A 2VYQA 4L9AA 3LQFA 1QQ7A 1DELA 2Q6LA 5KMGA 4PXAA 5KX5B 4GWKA 1WMDA 2X0FA 3IALA 3NJRA 1GPAA 1UMDA 3ZUGA 2Q5OA 4DHEA 4QUKA 2IUSA 2H16A 3A6ZA 1E9AA 2J6HA 3TSYA 1LK0A 3C3CA 3HEMA 1LDYA 2AVNA 3CF6R 3ISTA 2OM2A 2JGKA 3EW7A 1LPMA 2RGBA 3P96A 1SURA 4K9OA 4L2IA 4KPGA 2QLLA 2NVUA 2X7JA 3HCOA 2O57A 1J23A 3Q2OA 4BFZA 3ICQB 3CVXA 4JXKA 1AUVA 1P7PA 4QYIA 3ZDAA 4DVGA 5BSUA 5LFAA 5IYZB 3GBPA 4B79A 2JA1A 1OX5A 3NAQA 3RYIA 5HHTA 2ZM5A 3ESXA 5BWOA 2H29A 4ZVOA 2H5IA 3OUUA 2WUFA 5K0EA 4QPDA 1TJPB 2JLVA 1W93A 1V6SA 4QTZA 1V11A 4EB6A 2J6CA 3GK3A 2HDHA 3Q1LA 4BQIA 5HMLA 2AMYA 1EFVA 4YT4A 3OCWA 3EAGA 1AUXA 1SKUA 2IELA 3Q7IA 1ZA1A 3F7OA 3GEMA 3E82A 5ESRA 4GECA 1QLWA 1XZPA 1Y7HA 3F6RA 1KQPA 5COQA 2P9CA 4KV9A 5AVYA 1G3RA 3DTVA 3AHJA 1W4BA 3MRXA 1GL7A 2NUAB 5HX7A 5CVEA 4FMDF 2NACA 4D8UA 3IKTA 3VNAA 3SF8A 4ADSG 4MWZA 2ZRPA 3HXKA 4XE5A 1JN0A 1MXFA 2WU1A 4NAVA 4FEAA 3I2IA 2H57A 2DCMA 1U0NA 3ETEA 4GI2A 2CMHA 1Q22A 3DMHA 2XR1A 2YXPX 3PR3A 3TDNA 4Z5XA 4GICA 3UB3A 1UFQA 2OTCA 4E22A 5BRAA 3WTCA 2WMNB 1QF6A 2YTZA 1W87A 2GBLA 4WY2A 3DXFA 4ZO9A 3W4IA 1VJ0A 1TYBE 1ZK2A 3UWOA 4FFNA 1GXSB 2O4UX 1HNNA 3ZU5A 2H85A 4F5EA 4Y8VA 5IXJA 2REBA 3UJDA 1VHJA 2Q4DA 2BWJA 3ST7A 2FFQA 3LVRE 1BDHA 4X0EA 2G77B 1C9EA 3U17A 1LC3A 3EEBA 1RC8A 2EDCA 4GNRA 4J7XA 3H2IA 3WK6A 1GFZA 4HS4A 1A2BA 1EQ2A 5SY4A 4DCTA 4E5NA 4KX5A 1GG2A 3WNVA 3TPCA 1E92A 4DJEC 1JLLA 1W8IA 3EAFA 3GOHA 5DBHX 5T57A 4CIXA 1EU1A 1PX0A 1V7CA 3U4IA 1VGRA 2GDJA 1Q20A 2NYRA 3OECA 5DM1A 4PLYA 1JSLA 1BFDA 1P4AA 2IHJA 2FQWA 3I04M 4HEHA 2VZ0A 2Y9PB 3EEOA 4XDZA 3AR5A 2EFJA 3OPNA 4GGOA 4NESA 3IJEB 4HWRA 2A0XA 1T2EA 4WNCA 5DGIA 5FB3A 4X62B 2P1DA 2C0QA 5JJCA 2GFQA 4ITUA 4OHUA 5DDIP 3TR5A 4DQUA 4PO3X 3KSZO 2C9MA 4G07A 4FN5A 4N6OA 4YB8A 3H2YA 4YCJA 3P9YA 4EEKA 3G79A 5I9TA 1ULHA 3O92A 3BCHA 2XITA 2V4ZA 3OLWA 2ZUTA 2E82A 1DC8A 4UQOA 3AESB 1PJ2A 3KK0A 1BX1A 3THWB 3K70B 4C3OB 1XMJA 1IHDA 2BGTA 2I1WA 4UMVA 1A5TA 5TX7A 1YZKA 3FOEC 5AVRA 1E2KA 4JCOA 2ZR7A 4P3PA 1SB8A 4MRMA 4Y9UA 2VK8A 3GAAA 1SKMA 3W5CA 2ZUUA 4HYTA 1P5HA 4FHFA 4ZQFA 4NMLA 4CT5A 5ELXA 1LS1A 2XOKD 1QCYA 2XZPA 3K9GA 1IBMB 1ENOA 3LZDA 5EIBD 4XVCA 1E6KA 5GOZA 3VZPA 5LQSA 1TW3A 3BF8A 1MR3F 4PVDA 2O8EA 4B3TB 3SS8A 1JLKA 4EGAA 4DQVA 2HPVA 1TUIA 2KBEA 3A36A 3HCFA 4MW4A 4P8RA 1Y6QA 4IZOA 2ONKA 5DKFA 1K97A 3O38A 4H6VA 1X7ZB 2QAGA 1DKPA 2K7FA 3COJA 1R5NA 1XHEA 3ZTTA 1NQUA 2VKQA 4RLQA 5C52B 2XDAA 4YUWA 1YU6A 2WVJA 1OT3A 1FNBA 2XGMA 4WNAA 4XSGA 4EG1A 1EBUA 1ODSA 1RPTA 1CE8B 1I36A 3CNOA 2VDNB 3LZCA 4H0CA 3EUFA 3FKSA 1S6YA 2I4LA 2GM9A 5FPHA 3WGKA 3KPYA 4YUAA 1ZJ5A 1OTYA 2W00A 3AY7A 4MW2A 3UTDA 1K8ZB 2FSVC 2EFCB 4G5FA 3VHXA 1X2BA 4R05A 5FXMA 1JQLB 3LE8A 3CW2A 1OZ0A 3DZDA 3QLEA 1BE0A 1TUBB 3AM5A 3IRVA 4HWKA 3BYZA 2QYSA 2Z30A 1AA6A 1LPBB 1T5OA 3NO4A 2XUDA 5F73A 1AU9A 3PV0A 4EVRA 2C1XA 3W4JA 2CXNA 3CTPA 1PJ4A 3FFBA 3I37X 1ESDA 3EGDA 3FPCA 4JLPA 3W8EA 1NN0A 4BLPA 3L05A 4TTJA 4RHUA 3HSKA 5FO0A 2R96A 3GEDA 3GLFB 2QV7A 3RAEC 4OB7A 2B9EA 4IDPA 5FTLA 3ZKAA 1M72A 2OAQ1 3AC0A 3W9SA 1SXJB 1K3TA 3ECSA 1NRWA 3TMKA 2PS9A 2BEVB 1CUZA 3I05A 1G8YA 1TM4E 4KQHA 5A3SA 4A03A 5CXUA 5IM4A 1EB9A 3ZZNA 4J2OA 1KTVA 3SOZA 1LRKA 1S1CA 1EXVA 2JFOA 1Y80A 1HRKA 2GCNA 4JQYA 1KO8A 1KOFA 4WOBA 4AY3A 4C76A 2BE9A 4E2WA 4OIMA 1D5WA 4JDUA 4XGNA 1JR3E 5IRCD 10MHA 5K4GA 1FLDA 4BL5A 4LRTB 2NPOA 4F7DA 4M1YA 5TGZA 1P2UA 1JQEA 1GCOA 2EV9A 2VBGA 3JCZA 3O8DA 4NYJQ 4CIAA 4NFLA 2J0EA 3DAHA 4I55F 4WTOA 1W6UA 1W96A 1ECFA 4G23A 3T7DA 1A8SA 3SDBA 1XQXA 1A7AA 3L77A 2VRCA 4WT7A 1L5QA 2HLHA 2F62A 1XWIA 1FBTA 4MQEB 2O8DB 1G5FA 3L93A 4FYHA 1QLHA 2A30A 5AESA 3R0QA 5FUWA 1XMXA 4AG5A 1D2RA 2FZLA 4H1HA 5GGXA 4ZQHA 2UYQA 4XVRA 1Q83A 4GZLA 1XJ0A 2JJYA 2CJWB 3QE4A 4U63A 5KU1A 4GPEA 2EL9A 1E62A 1KS2A 2YY6A 2PLFA 3CXUA 2E18A 4G9GA 4P34A 3ONVA 3S2IA 1L4MA 3LUDA 1KWGA 3J81k 3VR2D 2WAYA 3JZAA 3LX4A 4PLCA 4RA6A 4ENUA 4RK0A 5CJ2A 5CPFA 1WKVA 2OA0A 3A6JA 2BW0A 3R3YA 3U62A 4PINA 4CMEA 2J33A 2JIZA 2QTVB 4YP5A 1DE0A 4BE7B 2WB4A 1L5YA 3RARA 4BLVA 9LDTA 4QVIA 4B3HA 5JC8A 2VO1A 1L5KA 2FF5A 1I7DA 1FFWA 3EC1A 1ELOA 4N7BA 2EERA 1C8KA 4P5DA 2REQA 1XZEA 5T4BA 1MO3A 2V1XA 3MT7A 1JI3A 5EHGA 1OH5A 4WFJA 4JKYA 2QMYA 2G1KA 2I6XA 2Z6VA 1I32A 4IHQA 4MVCA 3BMNB 4C0WA 4LC0A 1UK7A 3R3HA 4WV3A 3WMFA 4HNVA 6CHYA 2IEGA 2PU5A 3BK7A 4KREA 4RGBA 4RTMA 1JH9A 3QQ5A 5EZYF 5IZCC 2ISCA 2JLQA 1PEKE 1C2YA 3QFHA 3RC7A 2CVPA 4TLMB 3GLGE 2V6MA 5JS2A 4H7EA 2XB6A 3KSMA 3OCXA 4PX3A 5I01A 3UQYS 1A9PA 4BMOB 4AJNA 4HXEB 5EXTA 1CZNA 4TWJA 1NUSA 1SQ5A 2BSAA 3E0QA 2CFSA 1FX1A 2XUKA 1AK9A 3DGFC 4N1AA 4UZFA 4ZVKA 3X0DA 1GADO 2GFHA 4MP8A 1Y1SA 2DHEA 2XDQA 1I5EA 1KEEB 2P4HX 3GMSA 3KPVA 3Q1KA 4DSNA 2Q45A 2F1RA 4FC6A 5AMXA 5CPBA 5JHHB 1AH2A 5JAPA 2PKCA 1AKYA 2SCUB 2Z58A 4NYIR 4D8XA 1L7BA 1A8HA 2F67A 2V6GA 2XZDA 3GH1A 3L0CA 2H65A 4JC8A 3D6TB 4K3UA 3W77A 3DVAB 1YFKA 1EHCA 1KEVA 2I3BA 1P7YA 1ZU4A 2G4LA 2P9YA 2JCYA 2J3JA 1KJJA 1P6XA 2GD1O 2GXQA 1D2MA 2J0UA 5JAQA 1JTFA 3JW8A 4LECA 2WTEA 4RS4A 1GGFA 5LSAA 2Z1MA 4N6GA 2G28A 1UXGA 1W2HA 2YASA 3SKYA 1KPIA 4LIPD 5I51A 5M7EA 3KYDA 1QRDA 4MPRA 1E2EA 1ZM3A 3F2IA 5KCMA 1I3NA 4NARA 2VSOA 3OP4A 4DXDA 4UEKA 5DO9A 1EQAA 3MWLA 3PVSA 1P62B 1O3YA 1QNLA 1RCTE 1T29A 1T6YA 2JAHA 3UGKA 4HVLA 1RWMA 1BKSB 1VQ1A 3DOOA 2HIHA 4PN3A 1KU6A 1V8BA 4MVJF 1BMFA 4NICA 2QT0A 3F1KA 3NTVA 3ONEA 1BC5A 4E0BA 2FR1A 4IPTA 1ZXLA 1F2VA 2GGSA 4W5TA 1QRRA 2GQ0A 1N92A 2CJPA 4RVUA 5DCLA 5FL7A 4DGQA 2IXFA 2NXWA 3I6MA 2X3FA 2IP2A 2GCEA 1NYTA 4EG8A 1E1QA 4UUMA 2V7WA 3L0OA 4NCNA 1GGEA 2V7GA 3FSEA 4URYR 1ZQ9A 2AJ8A 3OD5A 1MIOA 4MDYA 4OH1A 2CK3A 3THYA 4OOFA 1XEXB 5L3ZA 2XTNA 3VNQA 8LDHA 4HX5A 1W36C 4JVSB 1FY2A 2FN8A 4XCVA 2R4UA 3CLVA 1FJHA 4QBIA 1I2AA 1RM4A 6REQA 2AX4A 1AKEA 3WGMA 2GEKA 1OBOA 2C4TA 1NUPA 3GXBA 2VP6A 5B36A 4V1CB 4ZEOA 5FWYB 3IOBA 1F0PA 4DSOA 1BHQ1 3DDUA 5FF9A 3QQPA 3GLIA 3RANA 1E4EA 4DSZA 5HS4A 5JAOA 4BVHA 1R4ZA 2X9VA 5IANA 1VLJA 2R7NA 3LO5A 3I2FA 5F12A 5JBNA 3PC4A 3LBFA 4EQ6B 4PTYA 1CSEE 1LK5A 1J8DA 2PLNA 4RA9A 2WA1A 2QYOA 1N4AA 5EEGA 3PUJA 5FBZA 5TVGA 3W8DA 2VSFA 1HOTA 1A9YA 2WICA 2CJXA 1P39A 2JLAA 1AN0A 3GJYA 3HFSA 4C6TB 1Q0QA 3VJLA 5LJLA 1SQFA 5AXBA 4R16A 1JB1A 4NMWA 3T34A 4KSBA 1ZN2A 1CS0A 3V97A 4DFDA 5LP6B 2NTEA 1KK0A 2QN8A 3P0JA 1M2HA 4FDAA 3AERB 3I9OA 4B3FX 2FP4A 3DQZA 4U7JA 3IHTA 3R5KA 2BM0A 4EGFA 4IS2A 2X41A 4L8VA 5FOQA 3W9YA 4OQZA 5H3CA 5COAA 1MF7A 3GL9A 3KKZA 2R1VB 5I7UA 1BS2A 3TX6A 4BFCA 1RJ9A 4P0TA 4BN5A 1KNXA 1Z62A 4BDTA 4Q01A 3ENVA 4UDNA 5BV1A 2IP1A 3LL4A 4Q4HB 4H9GA 5DP1A 1EE1A 1CP3A 4KXLA 4UM9D 5CBPB 2FW6A 4X95A 5JFOA 1OY1A 3P9ZA 1UP4A 2IX9A 5CB6A 5IK2A 2K5UA 2KBFA 3CH6A 3FZNA 3H4TA 3N5KA 3TE6A 1GPDG 1M8FA 2GR9A 2QRUA 3UAYA 4UNRA 4AY2A 5J3JA 3U9LA 1PW5A 4NZMA 1DAFA 1XVAA 1MOSA 3BXHA 1SIBE 2VQ3A 4G4SO 4LZZA 4FE7A 1KI2A 4V3BA 4W8HA 5BQ5A 1E2JA 1OX4B 1C0LA 2PPVA 1KEPA 4YDSA 2XCSB 5TEWA 3ZU6A 4AKIA 2Q5HA 2PTGA 3QWBA 2YW2A 2XJ9A 4WXRA 4CWAA 3OH8A 1IE3A 5KQMA 1PQ4A 4AIRA 4EKYA 2RG1A 4D4KA 4RH1A 4L9WA 4L51A 4CN9A 4TVOA 4FHDA 5CBKA 2FPWA 3WLLA 4H6PA 4DHWA 2QIOA 1CULC 3B7WA 4GM4A 1XEAA 5TC4A 4CI0B 4NU0A 3TO5A 5C8XA 2J46A 2JCXA 4WBSA 5L3VA 4RJKA 1EXWA 1PQWA 2FWIA 4ZOLB 3DV9A 2VPTA 2UXBB 3CUKA 1DDGA 1OI2A 2IEDA 1U11A 3HNPA 3PHLA 5CYPA 2GO7A 2H7VA 4BNNA 3EVGA 1R0WA 1XDBA 1FVXA 1MJ5A 2YRWA 3L0SA 3QI7A 3GZ4A 1L3IA 1WXXA 2AVDA 4JYPA 1K4YA 2BYTA 1U28C 3OE7A 2R8ZA 3I9V6 4H31A 4PO1A 3W34A 4PC7A 1C7IA 1MB2A 3T3EA 4OLBA 3FTEA 4I5GA 2AL7A 2VHWA 2QUHA 4UXHA 2XBMA 3HCAA 1PCXA 2FVYA 3H2BA 3LAWA 4H0NA 1GTRA 3UJPA 4OGFA 2D1YA 4LZPA 6YASA 3AB3A 3H9QA 3ROGA 3HL0A 1JA0A 1DG9A 2MINA 2XH8A 2FZGA 4K6OA 1KFKB 3ES9A 4BB6A 3TEMA 2CLLB 2DWQA 3FMOB 2PR2A 1WIWA 4ZCMA 3N86A 3TLJA 1H4TA 4ZK2A 1T5LA 5EUBA 2DR2A 1JR3D 4XVHA 1ZBDA 3ZCXA 3O3NB 2OAGA 3BPSA 4X20A 5JDIC 1Z6XA 2ZRJA 1XR3A 3I0ZA 4ZQCB 3IKJA 2XSZD 2PA3A 2JLBA 3QHPA 4B6EA 1BGVA 3IKLA 1N5MA 2QQ0A 1C4KA 1TRHA 4BFSA 4M8LA 2JI7A 3QWAA 2GBGA 2OO7A 4P33A 4AULA 2NYAA 4OJQA 5IC5A 1KP9A 5IFKA 3C98A 3HK2A 3P2YA 1I13A 1LPNA 1P74A 1TJ5A 1T8SA 1KVTA 1FPMA 1GU7A 1RRFA 4Q9DA 4CQJA 3LT4A 1I4DD 1XA3A 4TM7A 1N2JA 3D31A 1BXRB 1F14A 2FKAA 1L3CA 1Y5MA 4TV8B 1KKLA 4MR9B 5AKXA 4CW7A 3IAS1 1RQPA 3FPJA 2I6SA 1YQ9A 1PFQA 5DHFA 2Y1XA 2KW5A 1PK8A 4F3YA 4OX9Y 1Q16A 4R51A 4DSUA 2WIBA 5IX8A 4UHCA 3QVUA 5FAXA 4CG1A 2PUFA 1PUIA 2AFIE 3DZIA 3Q3VA 4FFMA 2C5EA 3GLHE 1J33A 4WSOA 1ZOLA 2AJTA 4HNHA 2C1ZA 2IDZA 1NZDA 4KHZA 1Y9JA 4YYZA 3O8RA 3IJ5A 3GG2A 4YI3A 3U61B 3RUIA 5CDTA 2BDEA 1T36A 2Y1GA 1N6IA 2Q6KA 4H2DA 5L6LB 2AI1A 1HNWB 4OHPA 5SZHB 1SVUA 3LS2A 2VUIB 1FJXA 4MICA 1GRRA 1EINA 3RRBA 1FZTA 3EVEA 3RKSA 2OZLA 2WWGA 3ZD6A 1M34E 5JH7A 3I01A 3I0MA 4ZHQB 3RIXA 2P2DA 3STHA 2AOXA 3CC8A 1D0SA 3DOFA 3EEFA 3KPWA 2O7QA 4EA9A 1RM5A 3N8IA 1WXGA 2FWJA 1OPXA 2B61A 5JANA 1DU4A 1FP4B 2XF8A 5JG7A 1P3Y1 3C4VA 1Y89A 4XH9B 3I6BA 3KLOA 4IWXA 3MTGA 5AI8A 3ULKA 4D6XA 5I7FA 1OH6A 1X2EA 4TV9B 4DAEA 1VLMA 4CE6A 4JP1A 2PUJA 1UR5A 1ULTA 3OPYA 3TCXB 1N9ZA 1LVUA 4TZ0A 1Z0UA 1C0KA 2BR3A 4JENA 2OZPA 4G0MA 1OC4A 3O9MA 4DUGD 2ORIA 3LTEA 3S5UA 2P67A 2NNLD 1YB7A 3ENNA 2XWSA 4LZLA 4ANFA 1NYRA 4DIBA 3FTPA 3VGPA 1U7PA 5A6VA 2C8LA 4I0WB 3ZDXB 2HF2A 4LCEA 2GPBA 3UT6A 4ZMBA 3LF1A 1I3OA 1M5RA 2PUAA 5CT8A 3JAKB 1MO4A 2B5VA 2PQ2A 3AOEC 4IHJF 1UJ4A 3K4PA 1P0FA 3ITDA 3H04A 1PR9A 2FZWA 3NVMB 3MUEA 4DARA 4F9FA 5ABPA 3CIFA 4L5IA 3ZZ0A 4RETA 2ZSJA 2O3RA 1A9QA 2QL5A 1H2AS 2EJVA 4MJXA 4I81A 3S44A 2HF7A 3ELWA 3NORA 2WSLA 3T95A 5LU9A 1GZUA 2AW5A 2PNJA 3PNOA 1ZGCA 4NKRA 4ZRDA 2Y67A 1K1EA 2BZ0A 3PWTA 3GLSA 5IARA 4JROA 1PJ3A 4ND8A 3AVOA 5AM5A 5FHQA 2IVZA 1NQOA 1VL1A 1SBYA 2MSCB 2P75A 3P97A 4LV8B 5EKUA 4BCDA 3MK31 1PV1A 4J3JA 3RROA 3KVOA 1ISMA 1TT5A 3W6ZA 3G2NA 2YH2A 2SKDA 2L2QA 4NDNE 4NYMR 1UJCA 4MQLA 2CV0A 3CYFA 4QICA 4AB1A 3RS7A 3UQZA 3NI2A 2V7PA 5E3HA 3BIXA 4QRHA 4ED9A 4AJ4A 1OLXA 2BD0A 5EMJA 3H6KA 4CMIB 4FGUA 4FGJA 1T0UA 4XZ3A 3K0HA 1WS6A 2EEPA 3QIVA 4M54A 2OCGA 3AT1A 4TKMA 4JB0A 4PM4A 4TWBA 4BGEA 4E31A 3EVFA 3B82A 3MWFA 5KYTA 3BF7A 4PG5A 3S40A 2E55A 3ANMA 4CLDA 4FFOA 3CWZA 5A02A 1OB2A 4HFJA 3G9TA 5CNMA 1N8NA 1Z45A 3CGGA 4IVQA 4QM7A 1CR1A 1Y1TA 1N5OX 1VGVA 3K3PA 1PGQA 3PUVA 4JJZA 2W48A 4R9NA 4TWZA 2RHJA 2Q4RA 4LZAA 4GU5A 3VQTA 4AN0A 4DBZA 5IWAB 4GOXA 1H0KA 1N9KA 2XMRA 1JR6A 4E7PA 5JD5A 3TOXA 5A03A 2Q7XA 1KIMA 4ZT6A 3U3MA 5JNWA 5KYYB 3A9RA 3E1SA 4DR1B 1EWKA 1PJCA 4BBAA 1SK8A 4TXJA 2FG7C 4WUVA 5IWCA 2HRDA 2Y1EA 5KSYA 3SBDA 2XW6A 3MW8A 4DCGA 3ETLA 1IWOA 3NX4A 2WKSA 3S7TA 1JXAA 2LPMA 1UC4B 5K3OA 2QXTA 4JXZA 1E69A 1I30A 1I8TA 1MJGA 1NOJA 2OB1A 3AUJB 1K7EB 2FETA 3DHYA 5LYJA 4HQLA 3L1VA 4OKSA 1W44A 1U7DA 2A58A 2XWBF 4ESHA 4F86A 5LQUA 2L18A 3H05A 4PANA 3LQQA 4DN6A 2FCRA 1VXOA 3U19A 3EVAA 2ZJ0A 1FFHA 3WGHA 2QX9A 1QO0D 4OAOA 4PONA 4L5BA 4PRZA 1C1XB 3ORQA 4BLTA 1H22A 1O77A 1O94C 4P31A 5G4KB 4WJKB 1XZQA 3JQAA 3TYXA 5B37A 4MAAA 2GBFA 2J4DA 1QS0B 4QFMA 2CXOA 5AW2A 1MH9A 3ZU3A 4WKNA 5DI3A 2W8BA 1ADYA 1HLPA 1X92A 2WVHA 3CURA 3N3BC 4LJYA 2L17A 4J6FA 4AF7A 4AL4A 2CCJA 3C3AA 1WB4A 2CDBA 1AT1A 3SSNA 3GH3A 3BWMA 1KE2A 1WPXA 2WQ7A 4DA9A 4WACA 4C7BA 3N28A 2JIQA 3GEGA 4RDIA 4EVSA 2CLDX 1SU8A 1IUPA 3JATA 1MBZA 1QZZA 2PT5A 4G0PA 4NJMA 4RL4A 3T8YA 5CDFA 1XNHA 2R87A 3ITKA 1BEEA 4E2XA 1Y6GA 5F64A 3K6SB 2FPIB 4GAEA 1Y5LA 1U8FO 5TPWA 3I9MA 4GHWA 1LWNA 4YREA 3VPGA 3W4KA 1E2HA 1LI4A 3N2ZB 4LBYA 1ULBA 1SQSA 1N7JA 1CDOA 2G72A 5MDHA 1XZLA 5CT5A 3SM3A 1IZ8A 3CPEA 1ECGA 2V9PA 5CW2A 3B12A 4B7ZA 4GBMA 1S4QA 4KFUA 2HOQA 3SHQA 4B76A 5EZ6B 5EJ7A 2JIMA 2WWXA 2C3PA 1DV2A 4II7A 4OPMA 1QAMA 1T8PA 2H9YA 3BEOA 3CW8X 4MYRA 2JIDA 2AUNA 3CLHA 2J07A 1FTYA 3CEAA 3EVCA 5JMPA 5FQNA 2ZBEA 1EX6A 1ULUA 2CVZA 2YN2A 3AF5A 4IDGA 4ZVSA 4C4YA 1GZ7A 3PXBA 4U7DA 1QYRA 2HMSA 4XDGA 2BGWA 4D9HA 1UWCA 1NN5A 1XTZA 2IHVA 3CCFA 3E84A 3EGOA 4FHCA 4KIFA 4OMFG 5IABA 3RUDA 4I2NA 3KOZA 3V1KA 4E4YA 3EG9A 1L5MA 4X8MA 5DP2A 1PFVA 5HZHA 2GM3A 4YRBA 1UDCA 3N3AC 3ZU4A 2ZS8A 1RAFA 2HA5A 3R23A 4MX8A 2OOKA 1UKAA 1KAHA 3GHYA 4PO9A 3MJFA 1TT7A 4TMWA 1VCOA 1G6HA 1KPHA 1LK7A 3AZQA 3PNKA 4YRQA 4JA0A 1QZXA 1K4KA 3LCRA 3RSHA 3RABA 2C3OA 4BFXA 5JS8A 1E1CA 3M1YA 5BYBA 1EESA 3TQTA 2LGJA 4M36A 3B1FA 4HI0E 3WJ1A 2EKDA 4NMMA 1CEQA 3LUJA 1Q0HA 1WUJS 4MSUA 4YS6A 4ICIA 1E9DA 1Y8QA 3F6EX 5GPBA 4V02A 1N2XA 1U9JA 3L9XA 1S7GA 3FW1A 3IPYA 3ZHYA 3BCRA 1Z5PA 2BMAA 1KSFX 3AGQA 3D4BA 4B3DA 4RYLA 5K8VA 1FMJA 1U8CB 4G5OA 4FSXA 4B3CA 3J7AC 1A27A 1JECA 3E5HA 4QOJA 3DWFA 1PKEA 5C5EA 4MYTA 3TJMA 5KNLA 3ZDRA 5TQ2B 1EEXB 2V8OA 4NBSA 2XTMA 5FTMA 1QFJA 3HEBA 4X92A 2VP4A 3WMXA 3WQSB 4EBFA 5IPFA 4MCAA 1XTPA 1RRGA 3DVRX 3MIIA 4NAHA 5CT6A 1ARZA 4BTEA 1WB5A 1N2OA 4U2KA 4BQSA 1Q77A 3G0IA 4I5IA 4HADA 5C8YA 1WZCA 1FQOA 1ZZGA 4ZEWA 4CTNA 3OOHA 2FMTA 2XYHA 2EZ4A 3LRTA 1J2JA 2ZT5A 4GI7A 5K1ZA 2H8KA 2VF2A 4BXOB 3ZGZA 4JJIA 1IEXA 1R2QA 3OE1A 2FQQA 4Z2YA 2CJYA 2NO6A 3HB4X 4HEJA 4IW3B 5F1KA 2ZTMA 1QAQA 4FYKA 1G2PA 1DP4A 2PD6A 2QAIA 4R81A 2VUSA 5AUPB 1ZM4A 1G6Q1 1K7FB 3PQCA 2IS1A 4RORA 1GZHB 4MUBA 1ZHHA 2X77A 2VHEA 1JMKC 3KG2A 1A9OA 3A3YA 4B09A 4MPPA 3UOGA 1IHOA 4FFLA 1K75A 3GOQA 1DXQA 1NP7A 2ZAYA 1ND6A 2GEDA 4OKIA 4XQGA 5EERA 3TNFA 3ZTYA 4CQLB 5K3AA 4KPFC 3KAQA 1G7RA 1WP9A 4ZGBA 3W2TA 1W5EA 4LK2A 4ZTZB 1FU8A 2OV8A 3OU6A 3A26A 1WBBA 3O0DA 1U1GA 5HQ3A 3IMCA 3D2BA 2D1SA 1M8KA 2YY5A 4WCFB 4BV2A 1E94E 2RI1A 1SPBS 4DXHA 2JK1A 3D0KA 5CD1A 2WYOA 2RGAA 1H0SA 3MJ4A 2BY4A 2ZU6A 2HF9A 1XDUA 4RBNA 3V2IA 5L45A 1OAOC 1MV8A 5JRZA 2A86A 5D86A 1G4UR 1CZRA 1J56A 3AETA 5E4YA 1SHJA 1UAGA 2IC5A 1Z4OA 2EYQA 1GPUA 3KT8A 3PKIA 721PA 4X1KA 4XDYA 4ES6A 4WESB 5CU7A 1X1BA 1Y8CA 4U0KA 1RMYA 3E7XA 4MHOA 2BGRA 4LXUA 1Q5PA 4FYMA 3KJIA 3C8MA 2PO7A 3GJQA 3K96A 4MEBA 3CO5A 4QVKA 1T0BA 2UVPA 2XPCA 4HB2A 4TQGA 4UPDA 4Y9RA 3S7ZA 3B70A 3UCXA 4X41A 1N9GA 2DUUA 2OFOA 3NHZA 3HWRA 1KI8A 5EGSA 3HVIA 5LP1A 3HDYA 3D5TA 2F1HA 3R5JA 1COWA 1RI2A 3VNBA 1E4YA 3P9PA 3GEBA 1IM5A 1A5AB 3JXEA 4LRUA 4UAGA 5E7QA 4AY6A 4MR7B 1BXZA 3K2IA 5AXCA 4YXWD 4PN7A 3G0GA 4TTSA 5CG2A 4COOA 1JHQA 4PFSA 3EUAA 3RRMA 3THXB 5U1PA 4RYDA 3LXRA 3KPJA 4BE9A 4IXMA 1HUQA 3PXDA 1KKUA 1ZPDA 2FWAA 4QOSA 5EIFA 5C80A 4LBWA 3KD3A 1W4RA 3GP5A 4EM6A 4AJKA 2K7ZA 2B1GA 5DVZA 2I8AA 1CUCA 5DN9A 1AXEA 1FDRA 1ODIA 2C4KA 5KAPA 4YUZA 4QODA 2L42A 3GQBA 4RESA 5D8DA 5BY2A 1OTXA 1H85A 2ZCJA 2GF9A 5ALUA 4GS5A 4MI3A 4RVSA 4WX2B 3GRRA 3HCPA 1A96A 3O1IC 3O47A 4OY3A 5EY5B 5IDQA 2GKSA 2EFHB 2GCIA 1ADJA 3O84A 3UOAB 3AKZA 4LWZA 4UNIA 1IRXA 2FTKE 4ETWA 2E3JA 1UJNA 3AY3A 5B6JA 2PKEA 4FCTA 3PC7A 2X6TA 4LZNA 5CHEA 5EJ5A 3L4JA 3PEYA 3SXPA 3KT0A 1R4MB 1ZEMA 4IGEA 4MWSA 4D9BA 3LT5A 3DW1X 2FSIA 2PD3A 3UUEA 4DMLA 4MUGA 3ZIDA 5J4VA 1QVAA 4IV8A 1O7JA 3L4BA 4BE4A 5KNBA 3UGTA 3RM3A 4AO6A 5KPJA 2IH5A 5FWAA 5LBUA 1DQPA 5EN4A 2OYCA 3PPXA 3ZY6A 3FOFC 1X94A 2FR8C 3KXDA 2IWRA 2GS9A 3E2PA 1YMQA 4JQCA 4JT9A 5LLDA 3LY7A 4RU1A 4AMUA 4M2LA 4QOFA 3OM1A 1FW8A 3THSA 3ND6A 2EP7A 4JOBA 3E48A 2DHRA 2BLLA 3N8GA 3U9SA 2HSGA 3VBEA 2CNOA 3SSOA 3ZNPA 3SR3A 3WY9A 4B7XA 4CMKA 3V80A 1F8UA 4RZIA 4L72A 5A9SA 3ZWKA 2UXDB 1IZ7A 2PT9A 2YHAA 4RK1A 3T5GA 5CIYA 1EK1A 1TPZA 4H3SA 4M7PA 1M2OA 1GRVA 3F0TA 3M6AA 4PAWA 1Z13A 2WHPB 2HSJA 3PPIA 2QL9A 1Y48E 4B80A 1DRVA 4DLYA 2Y77A 1Z7WA 3GFOA 1XUOA 1IVNA 1N8KA 2VCEA 1XZMA 2WPDD 3CEMA 1BN6A 1WM1A 2R8RA 4GQIA 4P98A 3ONNA 4XD2A 4HPXB 1N3LA 4QDTA 3NNDA 3T1TA 3D02A 2VNSA 4ZOQI 3UO8B 3G8YA 1TQ2A 1DPFA 1TZCA 2OK7A 2H1OA 1FQJA 5KX5F 3OX4A 2CZQA 3DAPA 3MERA 1I7SB 1E6CA 2BJVA 4UUQA 1L7XA 2YVAA 3QEJA 3U13A 3QKSA 3ETGA 2IHZA 2V7XA 3ABZA 1TUGA 2PKWA 3AHEA 2R5FA 5IDVA 3V7FA 3E9MA 2FJ0A 5I8WA 4DTCA 2PZGA 4HRAA 5CD9A 5GVRA 1W29A 5KYUA 1NR5A 3HVRA 4A10A 3FSGD 1F51E 3I9V1 1UPFA 2PGNA 3ZWMA 2WFLB 3SEZA 4KR7A 3SQWA 3DVQX 3OHMA 2A35A 1G0OA 3II6X 4W5JA 1A4IA 1RJGA 5FOTA 1W4LA 4WZZA 1GRCA 3B6ZA 1ADGA 3GYGA 3LUPA 5DBIA 1LSUA 4B46A 2WD7B 2JCBA 4WUTA 1ZW6A 3OPXA 3MBKA 1Z6AA 4ZCTA 3I0NA 3U7JA 4DZTA 2JGNA 1RT9A 1U2GA 3OEWA 4QQKA 2Y92A 3K6JA 3KU4A 1XX6A 1G2QA 3MM4A 4US2R 3WGJA 4IDBA 2P5TB 2X5OA 4LQLA 4OUKX 4RABA 1RXYA 3S2FA 5LOVA 2GCPA 2XMZA 2ACKA 4QHYA 4AWBA 2VOEA 4E94A 2ZRQA 4XWOA 2RSLA 3B6KA 4C5BA 1AQYA 2ODTX 2GF0A 4IQ4A 4OREX 1O0CA 2IHTA 3O0TA 4LJ4A 4CU2A 1J90A 2AJLI 4RLSA 1NUUA 3HYRA 4CIWA 4OO3A 5IJ0B 1L4BA 3GRVA 3I01M 3QYAA 1W581 1JKFA 1GLNA 1AB5A 1GRNA 1THZA 1YMUA 1D1SA 2KMLA 2Q5JA 4EUEA 5K8CA 3RS5A 5IMSA 1RZRD 3OIYA 3PGVA 4QEKA 1Y6FA 5F52A 3VR6A 3QPWA 3Q7PA 5F5XA 1BDBA 1NVFA 2FWMX 3I76A 1YXMA 3FUVA 3LQ1A 4M1QA 4XWAA 4YAEA 3S99A 3ZU2A 3DUFA 4R8SA 4UNPA 2QBYB 4RFLA 2GUWA 1FNMA 2AZXA 4RVNA 4Z0PA 2AMVA 2Z3ZA 3H86A 2RH9B 4UTPA 2B8WA 2NO1A 4D9JA 4D0RA 3NP7A 3DCYA 1NP3A 1SXJC 2R8YA 3QVXA 1TD9A 3TRHA 2YS6A 3BKWA 4W1SA 4Z1OA 1UUFA 3VC1A 2VLIA 1OWMA 3KB6A 2ZZKA 3LKVA 4MINA 4MJ3A 2YHBA 4PCAA 1R6XA 5B2FA 3PQ5A 5JW6A 2IEBA 3G5AA 1WEHA 2VLBA 2Q3MA 2XXAA 4FE4A 4XWYA 2DFKB 3WNZA 3B9RA 4D9CA 2YJNA 5G53C 4QYWA 3RBXA 2EBUA 3TBKA 2VNJA 3MPUA 2CUKA 1IQUA 1WCYA 2D54A 2GFIA 2POQX 1NUHA 1P2DA 4MMZB 4EL0A 4ID9A 1X6VA 3QMVA 2BFFB 5CR9A 3AHCA 3DMDA 1IM2A 4G36A 3ROXA 4AQDA 3L8ZA 3AKYA 4PWYA 3N8KA 3PTLA 6Q21A 1YZQA 2IYTA 3AL2A 1XRNA 3VPBA 5EIAA 1SXQA 3VPXA 5T8KC 3U4AA 4CR8A 2VQ6A 2JJ1D 4LRWA 4X8LA 3VPDA 2NYUA 5KOHB 4JWTA 2NU8A 4FGSA 5ALDA 5E6SA 4U00A 5J2UB 3RWBA 5BR8B 4DMGA 1NULA 5IH3A 5CJJA 1YE8A 1J21A 3DFKA 4CKWB 3C3DA 4Q16A 4PEVA 2VJLA 3RS8A 4XRGA 2Q3HA 3C8ZA 3CLSD 2HIAA 3JALB 2C54A 1EK0A 5JPDA 5B3KA 4FFRA 4BB5A 2HWWA 1O9GA 5ICEA 4LDNA 3ND5A 2W4QA 3CM0A 3TUIC 1DIRA 1E2UA 4CLRA 3QLUC 1MEEA 2PT6A 4B48A 1XVLA 5CNJA 1K89A 3G82C 2OOSA 3I42A 2OE2A 1X13A 3D6AA 5AQ1A 1E2LA 2VPYA 5AXDA 1X77A 2XMSA 3AP3A 1QO7A 3WMEA 4IINA 5GWXA 5HJEA 1KJ8A 4BYMA 4TN5A 2JGDB 4R01A 4U1RA 2A9VA 2QMEA 2ZTHA 3QPAA 1V16A 3G68A 4I8XA 3H3JA 3V48A 3VNSA 3QOFA 1FA9A 2GPTA 5BRJA 3ZGYA 1VRCA 1HZZA 2YFHA 1EWTA 4JLSA 1U81A 4XJVA 5HIIA 4YDHB 2XVAA 2E87A 4KE8A 4K6CA 1H0RA 1WVIA 3LOUA 3SHVA 3ZZTA 3WK9A 3RVJA 4I4CA 2JD0A 2AT1A 1EH5A 4R3NA 1I4LD 4ERNA 4QT4A 4H16A 4CL3A 3QJYA 4W5OA 1DTWB 1K9VF 1R5OA 2F00A 2YXEA 4ZALA 5CDUA 3VH1A 4D7AA 1KQGA 4DV5B 1RLIA 4Z3OA 3DHVA 1H2XA 2JFXA 4I36A 3WGGA 2HT6A 2RHBA 3GGPA 4LYYA 4QEDA 2P4UA 5JSUA 1NI3A 4L27A 4DDUA 1KDTA 4R0MA 2XMBA 1SRQA 1HE1C 4YJGA 2H7YA 2OHFA 3T1HB 3DTYA 4YMHA 2P6OA 1C8BA 4URWR 4TS3A 4Z4IA 4CMJA 1X9GA 2OGSA 2HAEA 3K31A 3M5CA 5CDYA 2DXIA 1XNQB 3ETHA 4RM2A 4XUCA 1T6ZA 4Z7OB 2JGRA 4KLCA 2PO5A 2FRXA 2PXHA 4OBXA 1QHFA 4W1PA 2ISQA 3WBFA 3G0OA 2RI6A 2F3RA 3AWDA 3M82A 5TJHA 1YUNA 3ZCQA 1VJDA 4MWGA 2GYUA 4N7JA 1EWRA 1TVCA 2R751 3DLPX 2ILTA 4DCUA 1XWFA 1HKUA 3A0RB 2XTAA 4X63A 3ZWQA 4TLBA 4B2PA 2AHOA 1M0SA 5DCYA 5MFPA 4AJLA 3G2IA 2G06A 3NATA 4H17A 5KQGA 2OXTA 3DLCA 3U44A 4R2HA 3M6MD 4C22A 2P2LA 3CRVA 4ASUA 4OYYA 1K2VN 4LZWA 4OHBA 3MRVA 1BWSA 2Z4SA 2GOYA 1Y9DA 2CLKB 3W78A 5FX2A 1ORRA 2CN1A 3T0GA 1N4DA 2IH2A 4YQYA 1EUCB 4P3OA 1QIEA 2ONYA 1NVMB 5I8PA 4F8YA 3DCIA 2JJ2D 4B75A 1UC5B 3C85A 4AYWA 4F3NA 1NVTA 5FFMA 2ZIFA 4LJ5A 1RWWA 3CUEF 2NQ2C 3LBIA 3CUYA 5IN5A 5EGNA 3PE3A 4F84A 1VKOA 2AFHA 2IX3A 4Q1EA 1YTLA 3GROA 4Q39A 4WINA 4L0CA 1H6CA 4Z2AA 1DJLA 3K6RA 3AIMA 4M9QA 2ZBGA 4MUAA 4US0R 4EHJA 2H4WA 3O8QB 3EF1A 1I14A 1RM0A 3BGOS 2ODBA 1GZ6A 4MUNA 2P9EA 1EE2A 3EDYA 4WKOA 4OGWA 1TCAA 2GYYA 3OLCX 5EE9A 3DHNA 4TOIA 4XCQA 1TAGA 1R0SA 7ADHA 2D2VA 4F6LA 3QOYA 4R9SA 1L1EA 5KYXB 3AR7A 4PBSA 1DXYA 5I3ZA 2GARA 1P4JA 1L7EA 1RP7A 2A57A 3GP3A 3RWOA 1M1YE 2GBCA 4O4IF 4ZYZA 5GTDA 2J9FB 2WKWA 2SKCA 1KC3A 3AIIA 1KK1A 4FHZA 3BS4A 4IUBS 3UENA 3ETNA 1GCGA 4N65A 2V5VA 1J06A 5JOQA 3EZGA 1M6VB 2O06A 4FW8A 3KUDA 4HGOA 4OI1A 1XF1A 4YVFA 3RUPA 4E2YA 1WJGA 1T5HX 2HHJA 2RJOA 2F8TA 1GKKA 5M5BA 1SFRA 2VA8A 5JZMA 2EEZA 1ORTA 4MO9A 1TEZA 1RQXA 3L1HA 2XYRA 3TPFA 4CLHA 2ZJYA 1F7UA 3GCXA 2G63A 3TX2A 2AOTB 3IR6A 2GK6A 3VU1A 3OFND 4DC0A 5IKEA 2IYAA 1K5DA 1ZUD1 2H4XA 3L7DA 2OORA 1GFSA 5EWLB 3TRJA 3W3AD 2R2GA 2M6KA 3AVQA 5B3LA 3WLHA 4OF4A 5B3JA 1BYIA 1YR7A 4P53A 4ZAZA 3RRXA 3W3AH 3F3KA 3WDMA 2YJGA 3OZAA 4MV9A 4NH0A 3WKEA 3CPSA 4ALNA 5EFOA 2ZZMA 3ADOA 2WSBA 1BS9A 4UOEA 1G5HA 5ALMA 5GONF 3A9WA 3ZWDA 2XT0A 2JKVA 4I5EA 3O73A 2B3TA 3FRJA 1ULAA 5A6SB 1XN1A 2Y1CA 4YCDA 3D5QA 5JDCC 1NSFA 4BJHB 4CIDA 5HKBA 1W0KD 1ABBA 3KYBA 4MRNA 3RKRA 1UH5A 4B8ZA 2QT9A 3GCGA 3UK6A 5FDFA 3OSZA 4Z1MD 1E60A 4GXRA 4P7GA 1PTKA 4ZI5A 1I1HA 2OPBA 1YQDA 5KOYA 2VJYA 1VJTA 2YQ4A 3DFZA 3HFGA 3T1NA 4KIUA 2PD4A 3V6LA 4C7KA 1F60A 4LX0A 2EOAA 1GQOA 4XPIB 1CQJA 3K15A 1NVAA 1PGPA 1AM4D 4XB6B 5B6PA 3UWSA 1O8BA 2FPPA 3R5XA 2XMQA 4JLAA 4P84A 4CF4A 4LE2A 2A0YA 2P9GA 4P86A 3RLFA 1KP3A 4IM7A 4OXKA 4Q3CA 1Z2NX 5JCPA 4Q6BA 1TDJA 5EIBC 1A1SA 3BRCA 1XQ6A 5JTTA 2EZUA 3WGOA 4BAUA 3DNFA 2AUTA 1V71A 4RL6A 3TH5A 4E6PA 4TMVA 3ZPXA 3I5XA 3I72A 2YXDA 5EYPA 2VJQA 3TXAA 3Q5EA 4DMFA 2ZJ3A 3QLTA 2FB9A 1J99A 3T5TA 3UH0A 3JQEA 3UXYA 2C2OA 2C20A 1TTPB 4ZAYA 4LFBB 3E58A 4J1TC 3EULA 2FSGA 1VLZA 3TIFA 3CH4B 3KZNA 4H6WA 4JDPA 2AOUB 1HTTA 1BXKA 1MGPA 4R2MA 4OBEA 2UUPA 5AW1A 1QV6A 2ZFUA 2GBIA 3Q15C 2R6R1 3P94A 5CB4A 1JFFB 1FUIA 1OBCA 1HY3A 4P3XA 4FQ8A 3DYIA 3M34A 4ZT3A 2HY7A 4HTAA 3PFNA 2RH8A 3FPKA 4JKIA 2WIAA 2OCIA 2HU2A 4QUEA 3LSTA 4D81A 3PSAA 5DGCA 5FRDA 4KO8A 4P82A 2O3TA 5LP6F 1DXHA 1Y3BE 3GNSA 4BIMA 2RGEA 4JBHA 4P6VF 3MTQA 2Q41A 2D1TA 1L9XA 4MAMA 3W2IA 1CJUC 3BGIA 4CNBA 3K16A 4C0SA 4NP6A 2JIRA 2ZBFA 3UYKA 5DM0A 5ALRA 1RWBA 1HEIA 4E07A 2XE7A 3NTOA 4M55A 3D64A 3QKWA 4J0CA 2JEZA 4OHRA 1YZGA 5DU2A 4EAAA 4K03A 1HO3A 3KUXA 2I2FA 4YRGA 2OZEA 2EG5A 2ZK7A 1Q0ZA 5FBRB 4F4FA 4C06A 2MR6A 3IAEA 5E4TA 4GOMD 3ZLVA 3AHFA 1DZ3A 4OXQA 1SUWA 5IHPA 5FNVA 5EAIA 4MPTA 3QUQA 3D8RA 4BWFB 3UGQA 2C0PA 4PZLA 1A7KA 4XUGB 5ADWA 5AVXA 2Z8ZA 4RPIA 3G2JA 1GNTA 1DQZA 1A4UA 1TE2A 4QFBA 1YBHA 3PGA1 1ZH6A 1NKVA 1UPCA 2JFVA 2HV9A 1H2YA 4GKBA 3CEHA 4JIGA 2D2IA 1PT9A 5ALJA 4CQMA 3WO1A 4EY6A 2VH5R 3ZE8A 4QPPA 1JTEA 3QV1A 4B43A 4XX0B 1BO6A 5ESDA 5HZKA 1QJCA 5CP8A 4MIOA 4WZBE 1Q84A 4RADA 2Z95A 5AKIA 4ZOLF 1CIPA 2DUNA 3HRIA 1NI4A 1TVKB 4R2WA 4WAUA 2WM9B 2N1MA 3EDOA 4NPCA 5C2JB 1CZOA 3IOYA 1AXGA 3D59A 4O33A 4RQUA 2G67A 4D41A 3CKKA 4TUYA 2ZQZA 4YECA 4YRDA 3KYIB 4N8EA 1MB4A 3HB9A 1ZHOA 4RTQA 1G8PA 3N2EA 4YMTA 4RKRA 4JI5B 1XL0A 3DBVO 1VYUA 2W43A 1Z2EA 2OESA 1XMQB 1V3TA 4RTNA 2JLWA 1LJ8A 1A9ZA 1WSBA 2ZJ1A 4LYHA 4PYJA 2YNMA 4YV7A 1JLRA 2O8BA 1NBIA 2W6IA 3MSXA 3NDIA 4HMPA 1WVGA 4O0LA 2B37A 1I24A 1JEQB 2GNAA 1RTTA 3C5EA 3MGKA 1ZGAA 4GEKA 4KFSA 2NZWA 3W5IA 3WLAA 4EHLA 3B36A 1C7JA 3VKFA 1A1VA 3A8TA 1NP6A 1Y42X 4FONA 3BQMB 3WIVA 5JUWA 1R6TA 1HDIA 1DT3A 3PHBE 3PQDA 2QDKA 4QECA 3ZE1B 4CL2A 3QSGA 4BLSA 4B6QA 3PITA 4DJ5X 2J67A 3GD7A 5KQSA 4IEFB 5HM6A 2GJKA 4GR5A 3TKAA 3MYYA 5E95A 4FFBA 3D5EA 1G63A 2FKNA 1ML4A 3T7RA 5IBCA 3PQ3A 3HB1A 4ATNA 3L7MA 4RDHA 1CRLA 2X4LA 3LRXA 3SIXA 3MCVA 4V0LA 3LC2O 4LY9A 2PH7A 2Y3IA 3NETA 4PXYA 4MLDA 3IPCA 4LDJA 4Q9LA 1H1LA 2QNIA 3DDZX 4Y2QA 4S1VA 3I8SA 4IR7A 4ND6A 3GB9A 3T0IA 1Y5RA 3ZIAA 1L5ZA 2HCTA 4TV8F 4KO1S 2HO4A 3SEAA 3USES 1KVUA 1GDTA 2GERA 3R3UA 3NBYC 4EEXA 4E51A 4I1UA 2VDMB 1C8LA 4DC1A 3CR3C 2MJLA 3P27A 4IFTA 1X7XB 1OFIA 3JTEA 5CNKA 1YH3A 2PCJA 3BRWA 1EDEA 4D8WA 5B58C 4DWVA 3ZH9B 3KAKA 1JLSA 1GTZA 2ZANA 4IIYA 2HK7A 3R3VA 4INAA 2G4CA 2CSUA 3O2NA 1AHNA 4PX5A 3HDTA 1KTIA 3QVGA 3FPEA 2X2FA 3MHTA 1XMIA 3IXMA 3PBKA 5CH5A 4X93A 1TA9A 1KPGA 1AQJA 5EZQA 4MUIA 4O0MA 2OD9A 3QKIA 3HBLA 1P0MA 4Y2SA 4AYTA 2HEGA 2WWRA 4FUQA 2GPWA 1E6UA 2P91A 5HIMA 2GM5A 3CJQA 4BLQA 1ONOA 1RRVA 2NUTA 3U49A 1X8KA 5DTQA 4E1VA 4RKEA 1OH7A 3CIOA 3A4IA 1NN1A 1QUFA 3JQPA 3GP8A 3K9CA 1RYHA 4NJEA 1I1OA 4ZHQF 3EGXB 5ILOA 4C14A 1ZRHA 3QPDA 4FOTA 3AO0B 4DY6A 5L51A 3OAAA 3N8DA 3OIUA 1PWYE 3RQSA 5KQLA 1IC6A 1E98A 5KEIA 3UN1A 1CFJA 1FUEA 1TF5A 4GGPA 4L22A 2XMPA 1WDTA 3LDUA 1OZFA 3MB5A 3LKDA 3PGXA 4OQMA 1ZD2P 4QOEA 4TV9F 1IJFA 521PA 5DN6A 1ZMTA 1ZMRA 4OJTA 2ONJA 4PZ9A 1QPBA 2GEVA 4CDGA 3AEUB 1XGKA 2OECA 3NOQA 1Z4MA 3DTVD 2DLNA 2P8SA 1JKMA 3INYA 2OEPA 1L7RA 1N5JA 1E0AA 3GR6A 3C24A 4UM8B 4LW8A 1Z0FA 4BKOA 1WW2A 1VSBA 4D57A 2ZIZA 1JHPA 3RUAA 1BJRE 3BGDA 4U5QA 3SC2A 1W6RA 2KYRA 5CLFA 1LPAB 2HHAA 4LBVA 1KO4A 4IEEA 4RKWA 3SR4A 3DTTA 3WYCA 3C6ZA 2RHLA 3NIDB 4M6WB 3O31A 2DG2A 3GV0A 4S12A 1L5HA 1D7AA 1AMOA 2GLXA 1MG0A 3A1SA 1VLVA 2FPSA 2R65A 4ZVNA 3AW8A 3TR0A 5T7BA 1DMRA 2A7QA 2O2EA 5EVCA 3CVOA 3F6YA 1PU2A 4RDXA 3GLUA 1V8DA 1FFDA 1TJYA 1ETHA 2D1FA 1I4EB 2R4QA 3JYPA 4LF6B 5C8VA 1RYZA 1HQKA 3RFXA 2CLFB 5B1IA 2ALJA 1UINA 2WUDA 4KUEA 2OCPA 5JAUA 3IIKA 3WE7A 1NJ2A 2I6GA 4RW0A 1UMCB 2VA9A 3K0FA 3MWDA 4PPFA 1CR2A 4KW7A 1C0EA 2A67A 1DEKA 5HF6A 4NU6A 4MUJA 2AJCA 3KTAB 1ADFA 1XJCA 3ZG6A 4RFSB 3IP9A 5K0TA 1PWEA 3VZCA 1ZNZA 3U4QB 2HXGA 2CSXA 5AOAA 3EIUA 3VSDA 1KJNA 3HRHA 2GWRA 1IG3A 2XNDD 4MMXB 1NMSA 3PF9A 3I73A 2CHGA 3B38A 3NP9A 5TPZA 3GFRA 4AMYA 1Y8RB 2Q5EA 4JASB 4CMAA 5B30A 4BVEA 1VL5A 1CE8A 3DE6X 3U40A 4ENRA 5JY6A 3L3BA 1U4SA 2P3SA 5BUQA 1Z39A 2RGWA 1JKIA 3I4LA 1MZPA 3ZDDA 2HJVA 1UCFA 3RG8A 4HV4A 5DBEX 1XAIA 1C30A 3Q2KA 4K9MA 1I3CA 4A0HA 4CM6A 1ACLA 1Y4ZA 4MHSA 1OA0A 5JALA 4B3RB 5I7VA 5AI5A 4D02A 2NZYA 1CLUA 4HDKA 3RYFA 3SYLA 4DNFA 3VSBA 4RMNA 5LXTB 1I2ZA 4Y7CA 4H7IA 1JPNA 1RADA 4ZANA 4YJ2F 3HKCA 2XE4A 2DSNA 4GO1A 3FOZA 2EP5A 1G66A 3KRTA 2Z2JA 5CX4A 2RI0A 1ZINA 3DOJA 4GH5A 3L1UA 1EM8A 5K6TA 3M6XA 4MWOA 4UNNA 1IM8A 5ALVA 2V98A 3RRFA 3VM6A 4ZICA 1P5FA 5CX1A 1QGUB 1ZK0A 5AICA 1LLDA 3GG9A 5LMCA 3OQIB 3DKRA 1EUYA 2A5YB 2P3QA 3RAPR 4CM4A 3COZA 3A9SA 5H5JA 4ZGWA 5B55A 1YL5A 3FDIA 1TC1A 3U6BA 4LF7B 2B0CA 4QOIA 3LVQE 1HH4A 2E4YA 4X7PA 4L0MA 1FLNA 4TMTA 1JQDA 1VJGA 1N6HA 3LCCA 4IKPA 4PYNA 3RVMA 1ZWKA 4O1MA 1H8HD 5AUQA 5HEKA 3CV3A 4YCSA 1CF4A 3KOWA 3E9NA 2AQKA 5H80A 1IB0A 1S8NA 4NENB 4MIYA 3OEEA 1BOOA 1C3JA 4J49A 4ZO8A 2ZTVA 1NM5C 2GN1A 2RDMA 2VHQA 3M5DA 3SIRA 5A4KA 2FQYA 3BRQA 4Y1RB 5AHRA 5MFZA 1E66A 3JQFA 4OYLA 1G8SA 1SUIA 1YR6A 4QTXA 4FS3A 4PPNA 1J9GA 3RUFA 3FBWA 3A6DA 1PYGA 2NSJA 3G0HA 4PVCA 2HA2A 2CFOA 2IPOA 2WVAA 3I4FA 1F8GA 1NRXA 1OXTA 2DM6A 3QKRA 4LSMA 4NY1A 4B5KA 5AVVA 1HYEA 1D2AA 4XQ9A 2F1JA 2QR5A 2Y93A 4QU9A 5TR9A 3K8YA 3EIEA 2NU9B 4A0GA 2Q8NA 2VS1A 1GGVA 5FI0B 5A7HA 3VO8A 2AZTA 1XKQA 2Q0HA 3BMOB 4I3GA 3UWMA 5C18A 2NN3C 4EWLA 4Q1FA 2NM0A 5FJIA 3F74A 4ARUA 1R8JA 1ZXBA 1PTJC 1U2PA 4KRXA 1JFVA 2CLIB 4Y2UA 3S1LA 4ZK6A 4DR2B 2O8CA 1AXRA 1DB3A 2IITA 1U8EA 3I9FA 2VHJA 2DAPA 2PKQP 4MMYB 4MR8B 4RPJA 1UKEA 3KB8A 2VT6A 2VJCA 3E61A 4Q4AB 5JV5A 5F76A 3WLTA 3ZQJA 4OQNA 2BZSA 4E03A 1BQEA 2HQSA 3LLMA 3LZ6A 4ZZ2A 5JZOA 1XOIA 2EKLA 4FJ2A 4EYOA 1RAEA 4JI8B 5JVDA 3F90A 3FI9A 4IUDS 2CVOA 1T1SA 3E27A 3K2BA 1F2UA 4AX8A 5L4SA 5EKDA 4JI0B 2CD9A 3WK5A 1UBRS 4A23A 3BGWA 3NDRA 1U65A 4MW5A 1J1ZA 3Q8LA 1PR2A 1EDOA 1TMOA 5LKRA 4GP7A 4WCFC 3TF5A 2KM1A 3Q7RA 3TQQA 2HGSA 2X5KO 3NGMA 4Z9XA 2CDCA 2GJ8A 1LW6E 1IY1A 2F1IA 3AFHA 2ODEA 3EZ7A 2BGUA 3GFPA 3ZV7A 4EARA 5L6MB 5CVTA 4QG3A 1M5TA 1KJIA 2JDIA 3FOBA 3JWJA 4U02A 2FSPA 3GFGA 3R6DA 4OMCA 4OQEA 4EUFA 1JGTA 1K88A 3SICE 2NSDA 4KQ9A 3ZHSA 5FORA 1JE0A 2JIZD 4JUIA 5D5QA 4EKDA 4X00A 1C1DB 4PZYA 4O02B 1ZSYA 4P22A 1NY5A 3COVA 5AQEA 4H1WA 5JZ9A 1QHSA 2DPLA 1LDEA 1J0EA 4QLBA 3DF9A 3RRJA 3HP1A 4HQFA 3IUSA 3GUUA 3DMRA 1XCOA 3S2EA 1IXSB 2PFSA 2DQKA 4Q4CA 4RE5A 2BFBB 1JT2A 1D6NA 3IBCA 3ZHZA 5BN1A 2OBYA 5KVQA 2YWBA 3CX4A 1RD4A 3BTUA 4MV0A 5AI4A 2ZATA 1OFVA 5BQFA 1EXMA 3AUAA 3FCSB 1JQJC 1XTJA 2HK9A 3P1JA 3ZS8A 1QP0A 2W22A 4NULA 2ZU0C 4R1OA 3QVSA 3V8QA 3ZZ1A 1A9XA 1PZFA 5DGHA 3DEAA 2CNKA 2CFCA 1SKBA 1ABFA 1K4MA 2BKAA 5ICFA 3U2QA 4BO5A 3JQGA 5KREA 2FOLA 1YA4A 5ALWA 2JJMA 2XEDA 2VHXA 1RTKA 4YP6A 4M8NE 3KUKA 1MC4A 1DAGA 1A04A 2BELA 3B3GA 2JARA 2P5SA 3JASA 3KZVA 3SHTA 4UASA 1P1RA 2CCKA 2ZI3A 4OOEA 1YNOA 3B8HA 4QJIA 4UQPA 5DM2A 4E70A 2F2TA 4KR3A 4YCAA 5ITWA 3W2HA 3DL4A 1KMIY 4OQYA 3W3ZB 4YJ3F 4KJZA 1QNFA 3NAGA 2RHTA 1ECLA 3LBAA 2J0QA 1J0AA 3U9TA 5D7NA 4K8OA 1PNRA 3I83A 4IV0A 3UHFA 1XRMA 4CL0A 2CNNA 3OTGA 4MUFA 1TRKA 2QLTA 4WCVA 4BO2A 3AOGA 1PGNA 2IA5A 1Y4DE 2RGUA 1M83A 3S3TA 5L53A 4P93A 5D7BA 1M2NA 3V32A 3V4OA 4Y30A 1N0HA 3ZJVA 5K0ZA 3WLKX 2JANA 3OZXA 3WISA 1B0AA 1E1RA 2UYYA 3AV0B 1BZYA 3ZH2A 3S29A 2EU8A 3SC4A 5JO0A 1SOVA 2WJ6A 3DT6A 1UMDB 3TOZA 2BJHA 3N2IA 4YX9A 2GTIA 4ZI2A 1SVIA 5DT9A 4G84A 3L1JA 1DI0A 3GJXC 1L5HB 4HATA 4LF9B 1QUEA 3DE1X 4L2IB 5T4FA 1KH3A 3GCWA 2PT7A 2NVUB 3WLNA 5A3RA 4XDHA 1L7OA 1BMTA 2O4CA 2PS3A 3COYA 3EVDA 3FA2A 3JWIA 5I4CA 4QYIB 3E23A 3IQFA 4O5AA 4HTFA 1VZ3A 3RYIB 1G21E 1H9AA 4M46A 1CR4A 4ZT7A 4UHHA 4OYHA 4PC3A 3ZWAA 2CHEA 1P18A 2R44A 4L95C 2QSZA 1V11B 4EB6B 4LE1A 4DV1B 1P4SA 5GJCA 5EE5B 2CK3D 3N74A 2YJ3A 1EFVB 4BNDA 1HXHA 3S8MA 2BZGA 3UAVA 1OBFO 2DECA 3H9JA 3GJ4A 1CJCA 3KTDA 2PBLA 4NOJA 4US1R 3UBTA 1BCRA 1BJTA 4S24A 2QU8A 3P52A 1CUDA 3DEHA 5DXJA 1IPEA 4Y9DA 3LY5A 3OCJA 2ZI5A 1CVLA 1OT5A 3B3JA 3DTVB 1BHO1 1WUYA 4MGHA 1N3BA 1CUFA 4KR6A 3A58B 5J40A 3SF8B 2V03A 3PWKA 1N6RA 2YHSA 2WBLC 1K27A 3G59A 2UZ4A 2QAJA 3ROPA 3EPHA 3KJGA 2GBPA 3M4YA 2Q1SA 2VF7A 3DBRA 4KR0A 4AK9A 4BUCA 2I0FA 2WMYA 1JIUA 5TF0A 3O4VA 4I6JA 3F7NA 1ZJ6A 3DZCA 2REOA 3E05A 1UOQA 3MQ2A 4L6IA 3R8CA 4KSYA 1JIVA 1N32B 2PEZA 4Q1AA 4NONA 2QE7D 2EHDA 1X42A 1KS9A 3LP8A 3QBEA 3RO7A 3URMA 3GEEA 2AB0A 3I6IA 1CHDA 1GY8A 5KS2A 4AUMA 1WY7A 4BMXA 2FN4A 1Q0UA 4BAGA 3L06A 3B48A 1I7QB 4GEGA 4H77A 1QMGA 2TECE 4CDRA 1L7DA 4Z4QA 3NOXA 3NKFA 3PHHA 1J2UA 3B6JA 4Y0VA 2O3QA 1JAHA 1N5KA 1NQTA 1IUKA 1GAWA 1N8SA 1XF9A 1JLLB 3FIUA 3TQFA 2JCGA 3ZWWA 4XYMA 4BVFA 4F9EA 1SOMA 1B7GO 4QASA 4R84A 3RS9A 3UXHA 4GSLA 3D4NA 2GPYA 1USGA 2ZRKA 1PN3A 2QRJA 3CX8A 3EGCA 3ZD8A 4IYRA 2AR9A 1M66A 1KEWA 3SKXA 4JBNA 1NG9A 2Z5LA 2C92A 1QGYA 1UBNA 5IC4A 3IIIA 2K87A 1CQXA 1ZONA 3DZJA 2QHXA 1DZIA 1D2CA 5AHKA 5B3AA 4HFMA 7ABPA 4YEDA 3H2ZA 1CQZA 3KQNA 3G1TA 1B8VA 1WPGA 3UKJA 1U3UA 1VCNA 4UJ3A 3U37A 1T13A 1AQLA 4KE7A 1WB6A 3RVRA 3FWYA 4CV1A 3IP3A 3AM3A 3UMJA 4BX8A 1RYYA 3GT7A 5DWQA 4MRMB 1EBFA 3AY0A 1YRQA 4U6SA 5I3CA 1J97A 1FL9A 2L19A 2OVBA 3WB1A 3Q11A 5AW0A 5A4JA 3DBLA 3S2SA 5JQGF 3TZBA 5I7SA 1T8TA 1FFAA 1UBJS 4W6ZA 4JHXA 1B6TA 1P6QA 3KKOA 2RGDA 3U0VA 1ZMXA 1MHTA 3MSCA 3F4LA 2W2TA 2B4YA 1DIGA 1TLLA 4MKFA 2O8EB 4A1FA 4JLKA 3RT1A 1S2GA 3P8ZA 3UZUA 3DOIA 3PRKE 3IULA 3IESA 1EFRA 3TTTA 4GG1A 1RACA 2QAGB 3JYHA 1D04A 3A31A 5ERXA 2EGGA 4DABA 1E9VA 3MGGA 5CDGA 1ODFA 5TEVA 4RJTA 1ESNA 4YLGA 3QVJA 4WNAB 3FWNA 4MR9A 2Y27A 4KZKA 2IZ7A 4UEOA 5DSTA 2WWYA 5DCWA 4LJ8A 1J9ZA 2PGXA 1V48A 5CA0F 4NATA 4EHHA 2V6FA 4QARA 5B4VA 3U6KA 3U5ZB 3E7FA 5IXSA 1DARA 1B8PA 1PJTA 1SCQA 1SC4A 2CFIA 4QOHA 4Q4DA 1VG1A 4W7SA 5KDDA 1P7ZA 2FFJA 2BFCA 3UW1A 3E5MA 3OMLA 1UAYA 4C4PA 4NCXA 1CUJA 1T3GA 3LFUA 3P0EA 4A8PA 2AUMA 5JNRA 2J59A 3ODGA 3P9IA 3BORA 1O95A 3VR5H 3H4IA 3LKBA 1DHTA 2O7NA 2OILA 4ML3A 5EJFA 3NBKA 4CIYA 2HCJB 1LWOA 1FMFA 3JZDA 2V6IA 2Y1DA 4HEQA 5G0WA 1HT0A 4JOQA 1GA4A 1FXWA 1KRXA 1ZIOA 2ORED 3JAWA 1IWPB 2NO4A 2FZ4A 2J5BA 3JX9A 3WBJA 1BGWA 1M73E 3HR8A 1QTQA 2W6QA 3IT0A 1YI8A 4FXPA 1M9NA 1W25A 1UANA 4CKXA 3IPAA 3HGQA 3VYRB 3ZWNA 3GRYA 4PZAA 1GNVA 2D00A 4H60A 2XKAA 4NFYA 3UUWA 4KRYA 4Z7JA 2GI4A 2NO0A 3HCDA 4TRNA 3P5BA 3IGFA 3JYLA 3LBNA 3EXG1 2H4YA 3OC6A 4DMMA 1U6JA 2FSVA 2HJ9A 2ZSFA 3KKLA 1EJ6A 1TO1E 3H1AA 1VECA 3QHQA 1LSSA 1VGQA 4QGSA 3KM0A 2IIPA 4YUYA 2IPNA