4PIRA

X-ray structure of the mouse serotonin 5-ht3 receptor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
445
structure length
383
Chain Sequence
b'TQPALLRLSDHLLANYKKGVRPVRDWRKPTTVSIDVIMYAILNVDEKNQVLTTYIWYRQYWTDEFLQWTPEDFDNVTKLSIPTDSIWVPDILINEFVDVGKSPNIPYVYVHHRGEVQNYKPLQLVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDINITLWRSPEEVRSDKSIFINQGEWELLEVFPQFKEFSIDISNSYAEMKFYVIIRRRPLFYAVSLLLPSIFLMVVDIVGFCLPPDSGERVSFKITLLLGYSVFLIIVSDTLPATPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQRPVPDWLRHLVLDRIAWILCVRGLLQELSSIRHFLEKRDEMREVARDWLRVGYVLDRLLFRIYLLAVLAYSITLVTLWSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-hydroxytryptamine receptor 3A
publication title X-ray structure of the mouse serotonin 5-HT3 receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 100
structure length 383
sequence length 445
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
A PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4pirA01
4IREA 2WNLA 3TLSA 3ZDHA 3SH1A 2BG9C 4ALXA 4UM3S 3IGQA 5LXBA 2XZ5A 3WTIA 3U8NA 3P50A 5AFHA 3PMZA 4TNVA 3RQUA 2XQ6A 5LG3A 2XNUA 3WTHA 2XQ5A 2XQ4A 2XNTA 2BG9B 5AINA 2YOEA 4EZ1A 2Y57A 5HEGA 5TVCA 2X00D 4QH5A 3TLWA 4TNWA 3WIPA 4ZJSA 3UU4A 2VL0A 3U8JA 4COFA 4HQPA 3LSVA 3U8LA 2BR8A 2PH9A 4ILBA 3WTLA 4NZBA 4LMJA 5AFJA 2BYRA 3UUBA 3WTOA 4ZZBA 5BRXA 3SQ9A 5AFKA 3JAEA 3ZKRA 4ZR6A 2UZ6A 3UU5A 2XQ7A 4HFBA 5J5IA 5AFNA 3JADA 4UY2A 5AFMA 3WTKA 4ZK4A 3U8MA 4A97A 2Y54A 4HFDA 4ZZCA 2WNCA 3RHWA 5L4HA 3TLUA 5IUXA 5L4EA 4QACA 3ZDGA 5BP0A 4X5TA 4DBMA 1UW6A 2YMDA 3RIFA 3WTJA 5FJVA 4BQTA 4D01A 2BR7A 5AFLA 1UX2A 3EI0A 4UM3A 2BG9E 4HFIA 5HEJA 4TWFA 2XQ3A 2XQ9A 2QC1B 3TLTA 4HFEA 5SYOA 3EHZA 2YKSA 2BJ0A 4FRRA 3WTNA 3RI5A 5KZUA 2W8GA 4Z90A 3UU8A 3C79A 4IL4A 5KE4A 3JAFA 4QH1A 5BW2A 4ZRUA 2BYNA 4QH4A 2Y58A 4PIRA 3SQ6A 3TLVA 4QAAA 4LMKA 3SIOA 2XYSA 5J0ZA 5HCMA 3RQWA 1I9BA 4XHEA 5J5GA 5HCJA 4ZJTA 3WTMA 2BYSA 4TWHA 2ZJVA 4UM3P 2YMEA 3EAMA 2PGZA 4WV9A 5HEUA 2WZYA 5HEOA 4UXUA 3C84A 3GUAA 5HEHA 3UQ4A 5J5HA 2ZJUA 4AFHA 2BYPA 2C9TA 4ILAA 4Z91A 4B5DA 4QABA 4NPPA 4LMLA 2WN9A 4UM1A 4XK9A 4AFGA 3UQ7A 5CFBA 4IL9A 5AFMB 3T4MA 4ZK1A 2XQAA 3UU6A 5J5FA 3RIAA 2Y56A 5JMEA 4A98A 4BFQA 2XZ6A 2XNVA 1UV6A 5L47A 3P4WA 3U8KA 2Y7YA 4F8HA 2XQ8A 4TWDA 4HFHA 5CO5A 3PEOA 2X00A 2BG9A 4AFTA 4ILCA 3UU3A 2WNJA 2YN6A 2XYTA 2W8FA 4HFCA 2BYQA
chains in the Genus database with same CATH superfamily
4IREA 2WNLA 3TLSA 3ZDHA 3SH1A 2BG9C 4ALXA 4UM3S 3IGQA 5LXBA 2XZ5A 3WTIA 3U8NA 3P50A 5AFHA 3PMZA 4TNVA 3RQUA 2XQ6A 5LG3A 2XNUA 3WTHA 2XQ5A 2XQ4A 2XNTA 2BG9B 5AINA 2YOEA 4EZ1A 2Y57A 5HEGA 5TVCA 2X00D 4QH5A 3TLWA 4TNWA 3WIPA 4ZJSA 3UU4A 2VL0A 3U8JA 4COFA 4HQPA 3LSVA 3U8LA 2BR8A 2PH9A 4ILBA 3WTLA 4NZBA 4LMJA 5AFJA 2BYRA 3UUBA 3WTOA 4ZZBA 5BRXA 3SQ9A 5AFKA 3JAEA 3ZKRA 4ZR6A 2UZ6A 3UU5A 2XQ7A 4HFBA 5J5IA 5AFNA 3JADA 4UY2A 5AFMA 3WTKA 4ZK4A 3U8MA 4A97A 2Y54A 4HFDA 4ZZCA 2WNCA 3RHWA 5L4HA 3TLUA 5IUXA 5L4EA 4QACA 3ZDGA 5BP0A 4X5TA 4DBMA 1UW6A 2YMDA 3RIFA 3WTJA 5FJVA 4BQTA 4D01A 2BR7A 5AFLA 1UX2A 3EI0A 4UM3A 2BG9E 4HFIA 5HEJA 4TWFA 2XQ3A 2XQ9A 2QC1B 3TLTA 4HFEA 5SYOA 3EHZA 2YKSA 2BJ0A 4FRRA 3WTNA 3RI5A 5KZUA 2W8GA 4Z90A 3UU8A 3C79A 4IL4A 5KE4A 3JAFA 4QH1A 5BW2A 4ZRUA 2BYNA 4QH4A 2Y58A 4PIRA 3SQ6A 3TLVA 4QAAA 4LMKA 3SIOA 2XYSA 5J0ZA 5HCMA 3RQWA 1I9BA 4XHEA 5J5GA 5HCJA 4ZJTA 3WTMA 2BYSA 4TWHA 2ZJVA 4UM3P 2YMEA 3EAMA 2PGZA 4WV9A 5HEUA 2WZYA 5HEOA 4UXUA 3C84A 3GUAA 5HEHA 3UQ4A 5J5HA 2ZJUA 4AFHA 2BYPA 2C9TA 4ILAA 4Z91A 4B5DA 4QABA 4NPPA 4LMLA 2WN9A 4UM1A 4XK9A 4AFGA 3UQ7A 5CFBA 4IL9A 5AFMB 3T4MA 4ZK1A 2XQAA 3UU6A 5J5FA 3RIAA 2Y56A 5JMEA 4A98A 4BFQA 2XZ6A 2XNVA 1UV6A 5L47A 3P4WA 3U8KA 2Y7YA 4F8HA 2XQ8A 4TWDA 4HFHA 5CO5A 3PEOA 2X00A 2BG9A 4AFTA 4ILCA 3UU3A 2WNJA 2YN6A 2XYTA 2W8FA 4HFCA 2BYQA
chains in the Genus database with same CATH topology
4IREA 2WNLA 3TLSA 3ZDHA 3SH1A 2BG9C 4ALXA 4UM3S 3IGQA 5LXBA 2XZ5A 3WTIA 3U8NA 3P50A 5AFHA 3PMZA 4TNVA 3RQUA 2XQ6A 5LG3A 2XNUA 3WTHA 2XQ5A 2XQ4A 2XNTA 2BG9B 5AINA 2YOEA 4EZ1A 2Y57A 5HEGA 5TVCA 2X00D 4QH5A 3TLWA 4TNWA 3WIPA 4ZJSA 3UU4A 2VL0A 3U8JA 4COFA 4HQPA 3LSVA 3U8LA 2BR8A 2PH9A 4ILBA 3WTLA 4NZBA 4LMJA 5AFJA 2BYRA 3UUBA 3WTOA 4ZZBA 5BRXA 3SQ9A 5AFKA 3JAEA 3ZKRA 4ZR6A 2UZ6A 3UU5A 2XQ7A 4HFBA 5J5IA 5AFNA 3JADA 4UY2A 5AFMA 3WTKA 4ZK4A 3U8MA 4A97A 2Y54A 4HFDA 4ZZCA 2WNCA 3RHWA 5L4HA 3TLUA 5IUXA 5L4EA 4QACA 3ZDGA 5BP0A 4X5TA 4DBMA 1UW6A 2YMDA 3RIFA 3WTJA 5FJVA 4BQTA 4D01A 2BR7A 5AFLA 1UX2A 3EI0A 4UM3A 2BG9E 4HFIA 5HEJA 4TWFA 2XQ3A 2XQ9A 2QC1B 3TLTA 4HFEA 5SYOA 3EHZA 2YKSA 2BJ0A 4FRRA 3WTNA 3RI5A 5KZUA 2W8GA 4Z90A 3UU8A 3C79A 4IL4A 5KE4A 3JAFA 4QH1A 5BW2A 4ZRUA 2BYNA 4QH4A 2Y58A 4PIRA 3SQ6A 3TLVA 4QAAA 4LMKA 3SIOA 2XYSA 5J0ZA 5HCMA 3RQWA 1I9BA 4XHEA 5J5GA 5HCJA 4ZJTA 3WTMA 2BYSA 4TWHA 2ZJVA 4UM3P 2YMEA 3EAMA 2PGZA 4WV9A 5HEUA 2WZYA 5HEOA 4UXUA 3C84A 3GUAA 5HEHA 3UQ4A 5J5HA 2ZJUA 4AFHA 2BYPA 2C9TA 4ILAA 4Z91A 4B5DA 4QABA 4NPPA 4LMLA 2WN9A 4UM1A 4XK9A 4AFGA 3UQ7A 5CFBA 4IL9A 5AFMB 3T4MA 4ZK1A 2XQAA 3UU6A 5J5FA 3RIAA 2Y56A 5JMEA 4A98A 4BFQA 2XZ6A 2XNVA 1UV6A 5L47A 3P4WA 3U8KA 2Y7YA 4F8HA 2XQ8A 4TWDA 4HFHA 5CO5A 3PEOA 2X00A 2BG9A 4AFTA 4ILCA 3UU3A 2WNJA 2YN6A 2XYTA 2W8FA 4HFCA 2BYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IRE A;  2WNL A;  3TLS A;  3ZDH A;  3SH1 A;  2BG9 C;  4ALX A;  4UM3 S;  3IGQ A;  5LXB A;  2XZ5 A;  3WTI A;  3U8N A;  3P50 A;  5AFH A;  3PMZ A;  4TNV A;  3RQU A;  2XQ6 A;  5LG3 A;  2XNU A;  3WTH A;  2XQ5 A;  2XQ4 A;  2XNT A;  2BG9 B;  5AIN A;  2YOE A;  4EZ1 A;  2Y57 A;  5HEG A;  5TVC A;  2X00 D;  4QH5 A;  3TLW A;  4TNW A;  3WIP A;  4ZJS A;  3UU4 A;  2VL0 A;  3U8J A;  4COF A;  4HQP A;  3LSV A;  3U8L A;  2BR8 A;  2PH9 A;  4ILB A;  3WTL A;  4NZB A;  4LMJ A;  5AFJ A;  2BYR A;  3UUB A;  3WTO A;  4ZZB A;  5BRX A;  3SQ9 A;  5AFK A;  3JAE A;  3ZKR A;  4ZR6 A;  2UZ6 A;  3UU5 A;  2XQ7 A;  4HFB A;  5J5I A;  5AFN A;  3JAD A;  4UY2 A;  5AFM A;  3WTK A;  4ZK4 A;  3U8M A;  4A97 A;  2Y54 A;  4HFD A;  4ZZC A;  2WNC A;  3RHW A;  5L4H A;  3TLU A;  5IUX A;  5L4E A;  4QAC A;  3ZDG A;  5BP0 A;  4X5T A;  4DBM A;  1UW6 A;  2YMD A;  3RIF A;  3WTJ A;  5FJV A;  4BQT A;  4D01 A;  2BR7 A;  5AFL A;  1UX2 A;  3EI0 A;  4UM3 A;  2BG9 E;  4HFI A;  5HEJ A;  4TWF A;  2XQ3 A;  2XQ9 A;  2QC1 B;  3TLT A;  4HFE A;  5SYO A;  3EHZ A;  2YKS A;  2BJ0 A;  4FRR A;  3WTN A;  3RI5 A;  5KZU A;  2W8G A;  4Z90 A;  3UU8 A;  3C79 A;  4IL4 A;  5KE4 A;  3JAF A;  4QH1 A;  5BW2 A;  4ZRU A;  2BYN A;  4QH4 A;  2Y58 A;  4PIR A;  3SQ6 A;  3TLV A;  4QAA A;  4LMK A;  3SIO A;  2XYS A;  5J0Z A;  5HCM A;  3RQW A;  1I9B A;  4XHE A;  5J5G A;  5HCJ A;  4ZJT A;  3WTM A;  2BYS A;  4TWH A;  2ZJV A;  4UM3 P;  2YME A;  3EAM A;  2PGZ A;  4WV9 A;  5HEU A;  2WZY A;  5HEO A;  4UXU A;  3C84 A;  3GUA A;  5HEH A;  3UQ4 A;  5J5H A;  2ZJU A;  4AFH A;  2BYP A;  2C9T A;  4ILA A;  4Z91 A;  4B5D A;  4QAB A;  4NPP A;  4LML A;  2WN9 A;  4UM1 A;  4XK9 A;  4AFG A;  3UQ7 A;  5CFB A;  4IL9 A;  5AFM B;  3T4M A;  4ZK1 A;  2XQA A;  3UU6 A;  5J5F A;  3RIA A;  2Y56 A;  5JME A;  4A98 A;  4BFQ A;  2XZ6 A;  2XNV A;  1UV6 A;  5L47 A;  3P4W A;  3U8K A;  2Y7Y A;  4F8H A;  2XQ8 A;  4TWD A;  4HFH A;  5CO5 A;  3PEO A;  2X00 A;  2BG9 A;  4AFT A;  4ILC A;  3UU3 A;  2WNJ A;  2YN6 A;  2XYT A;  2W8F A;  4HFC A;  2BYQ A; 
#chains in the Genus database with same CATH topology
 4IRE A;  2WNL A;  3TLS A;  3ZDH A;  3SH1 A;  2BG9 C;  4ALX A;  4UM3 S;  3IGQ A;  5LXB A;  2XZ5 A;  3WTI A;  3U8N A;  3P50 A;  5AFH A;  3PMZ A;  4TNV A;  3RQU A;  2XQ6 A;  5LG3 A;  2XNU A;  3WTH A;  2XQ5 A;  2XQ4 A;  2XNT A;  2BG9 B;  5AIN A;  2YOE A;  4EZ1 A;  2Y57 A;  5HEG A;  5TVC A;  2X00 D;  4QH5 A;  3TLW A;  4TNW A;  3WIP A;  4ZJS A;  3UU4 A;  2VL0 A;  3U8J A;  4COF A;  4HQP A;  3LSV A;  3U8L A;  2BR8 A;  2PH9 A;  4ILB A;  3WTL A;  4NZB A;  4LMJ A;  5AFJ A;  2BYR A;  3UUB A;  3WTO A;  4ZZB A;  5BRX A;  3SQ9 A;  5AFK A;  3JAE A;  3ZKR A;  4ZR6 A;  2UZ6 A;  3UU5 A;  2XQ7 A;  4HFB A;  5J5I A;  5AFN A;  3JAD A;  4UY2 A;  5AFM A;  3WTK A;  4ZK4 A;  3U8M A;  4A97 A;  2Y54 A;  4HFD A;  4ZZC A;  2WNC A;  3RHW A;  5L4H A;  3TLU A;  5IUX A;  5L4E A;  4QAC A;  3ZDG A;  5BP0 A;  4X5T A;  4DBM A;  1UW6 A;  2YMD A;  3RIF A;  3WTJ A;  5FJV A;  4BQT A;  4D01 A;  2BR7 A;  5AFL A;  1UX2 A;  3EI0 A;  4UM3 A;  2BG9 E;  4HFI A;  5HEJ A;  4TWF A;  2XQ3 A;  2XQ9 A;  2QC1 B;  3TLT A;  4HFE A;  5SYO A;  3EHZ A;  2YKS A;  2BJ0 A;  4FRR A;  3WTN A;  3RI5 A;  5KZU A;  2W8G A;  4Z90 A;  3UU8 A;  3C79 A;  4IL4 A;  5KE4 A;  3JAF A;  4QH1 A;  5BW2 A;  4ZRU A;  2BYN A;  4QH4 A;  2Y58 A;  4PIR A;  3SQ6 A;  3TLV A;  4QAA A;  4LMK A;  3SIO A;  2XYS A;  5J0Z A;  5HCM A;  3RQW A;  1I9B A;  4XHE A;  5J5G A;  5HCJ A;  4ZJT A;  3WTM A;  2BYS A;  4TWH A;  2ZJV A;  4UM3 P;  2YME A;  3EAM A;  2PGZ A;  4WV9 A;  5HEU A;  2WZY A;  5HEO A;  4UXU A;  3C84 A;  3GUA A;  5HEH A;  3UQ4 A;  5J5H A;  2ZJU A;  4AFH A;  2BYP A;  2C9T A;  4ILA A;  4Z91 A;  4B5D A;  4QAB A;  4NPP A;  4LML A;  2WN9 A;  4UM1 A;  4XK9 A;  4AFG A;  3UQ7 A;  5CFB A;  4IL9 A;  5AFM B;  3T4M A;  4ZK1 A;  2XQA A;  3UU6 A;  5J5F A;  3RIA A;  2Y56 A;  5JME A;  4A98 A;  4BFQ A;  2XZ6 A;  2XNV A;  1UV6 A;  5L47 A;  3P4W A;  3U8K A;  2Y7Y A;  4F8H A;  2XQ8 A;  4TWD A;  4HFH A;  5CO5 A;  3PEO A;  2X00 A;  2BG9 A;  4AFT A;  4ILC A;  3UU3 A;  2WNJ A;  2YN6 A;  2XYT A;  2W8F A;  4HFC A;  2BYQ A; 
#chains in the Genus database with same CATH homology
 4IRE A;  2WNL A;  3TLS A;  3ZDH A;  3SH1 A;  2BG9 C;  4ALX A;  4UM3 S;  3IGQ A;  5LXB A;  2XZ5 A;  3WTI A;  3U8N A;  3P50 A;  5AFH A;  3PMZ A;  4TNV A;  3RQU A;  2XQ6 A;  5LG3 A;  2XNU A;  3WTH A;  2XQ5 A;  2XQ4 A;  2XNT A;  2BG9 B;  5AIN A;  2YOE A;  4EZ1 A;  2Y57 A;  5HEG A;  5TVC A;  2X00 D;  4QH5 A;  3TLW A;  4TNW A;  3WIP A;  4ZJS A;  3UU4 A;  2VL0 A;  3U8J A;  4COF A;  4HQP A;  3LSV A;  3U8L A;  2BR8 A;  2PH9 A;  4ILB A;  3WTL A;  4NZB A;  4LMJ A;  5AFJ A;  2BYR A;  3UUB A;  3WTO A;  4ZZB A;  5BRX A;  3SQ9 A;  5AFK A;  3JAE A;  3ZKR A;  4ZR6 A;  2UZ6 A;  3UU5 A;  2XQ7 A;  4HFB A;  5J5I A;  5AFN A;  3JAD A;  4UY2 A;  5AFM A;  3WTK A;  4ZK4 A;  3U8M A;  4A97 A;  2Y54 A;  4HFD A;  4ZZC A;  2WNC A;  3RHW A;  5L4H A;  3TLU A;  5IUX A;  5L4E A;  4QAC A;  3ZDG A;  5BP0 A;  4X5T A;  4DBM A;  1UW6 A;  2YMD A;  3RIF A;  3WTJ A;  5FJV A;  4BQT A;  4D01 A;  2BR7 A;  5AFL A;  1UX2 A;  3EI0 A;  4UM3 A;  2BG9 E;  4HFI A;  5HEJ A;  4TWF A;  2XQ3 A;  2XQ9 A;  2QC1 B;  3TLT A;  4HFE A;  5SYO A;  3EHZ A;  2YKS A;  2BJ0 A;  4FRR A;  3WTN A;  3RI5 A;  5KZU A;  2W8G A;  4Z90 A;  3UU8 A;  3C79 A;  4IL4 A;  5KE4 A;  3JAF A;  4QH1 A;  5BW2 A;  4ZRU A;  2BYN A;  4QH4 A;  2Y58 A;  4PIR A;  3SQ6 A;  3TLV A;  4QAA A;  4LMK A;  3SIO A;  2XYS A;  5J0Z A;  5HCM A;  3RQW A;  1I9B A;  4XHE A;  5J5G A;  5HCJ A;  4ZJT A;  3WTM A;  2BYS A;  4TWH A;  2ZJV A;  4UM3 P;  2YME A;  3EAM A;  2PGZ A;  4WV9 A;  5HEU A;  2WZY A;  5HEO A;  4UXU A;  3C84 A;  3GUA A;  5HEH A;  3UQ4 A;  5J5H A;  2ZJU A;  4AFH A;  2BYP A;  2C9T A;  4ILA A;  4Z91 A;  4B5D A;  4QAB A;  4NPP A;  4LML A;  2WN9 A;  4UM1 A;  4XK9 A;  4AFG A;  3UQ7 A;  5CFB A;  4IL9 A;  5AFM B;  3T4M A;  4ZK1 A;  2XQA A;  3UU6 A;  5J5F A;  3RIA A;  2Y56 A;  5JME A;  4A98 A;  4BFQ A;  2XZ6 A;  2XNV A;  1UV6 A;  5L47 A;  3P4W A;  3U8K A;  2Y7Y A;  4F8H A;  2XQ8 A;  4TWD A;  4HFH A;  5CO5 A;  3PEO A;  2X00 A;  2BG9 A;  4AFT A;  4ILC A;  3UU3 A;  2WNJ A;  2YN6 A;  2XYT A;  2W8F A;  4HFC A;  2BYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...