4PIRA

X-ray structure of the mouse serotonin 5-ht3 receptor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
445
structure length
383
Chain Sequence
TQPALLRLSDHLLANYKKGVRPVRDWRKPTTVSIDVIMYAILNVDEKNQVLTTYIWYRQYWTDEFLQWTPEDFDNVTKLSIPTDSIWVPDILINEFVDVGKSPNIPYVYVHHRGEVQNYKPLQLVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDINITLWRSPEEVRSDKSIFINQGEWELLEVFPQFKEFSIDISNSYAEMKFYVIIRRRPLFYAVSLLLPSIFLMVVDIVGFCLPPDSGERVSFKITLLLGYSVFLIIVSDTLPATPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQRPVPDWLRHLVLDRIAWILCVRGLLQELSSIRHFLEKRDEMREVARDWLRVGYVLDRLLFRIYLLAVLAYSITLVTLWSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-hydroxytryptamine receptor 3A
publication title X-ray structure of the mouse serotonin 5-HT3 receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 100
structure length 383
sequence length 445
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
A PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4pirA01
2XQAA 4XHEA 3WTJA 3TLWA 4TWHA 5TVCA 2C9TA 4HFEA 3GUAA 5CO5A 2X00D 4UY2A 5L47A 5J0ZA 4Z91A 2W8FA 4ZJSA 3C84A 5CFBA 3RQUA 4ZJTA 1UW6A 3P4WA 2Y57A 4COFA 4NPPA 4Z90A 2Y58A 3U8NA 2BYRA 3ZKRA 4TNWA 5KE4A 2UZ6A 5HEHA 5AFLA 2BG9B 4PIRA 3U8MA 3PEOA 3JADA 4ILAA 2Y56A 2YN6A 2BG9E 4ILBA 5HEGA 5HEUA 3U8LA 4D01A 4LMKA 4DBMA 3LSVA 2XQ8A 4ZR6A 2BYQA 3ZDHA 5AFJA 2WNJA 4UXUA 4ZZBA 4FRRA 2XQ3A 2YKSA 2XYTA 4QAAA 4TNVA 5L4HA 2XYSA 2WN9A 2PH9A 3RHWA 4ZZCA 2XZ5A 2VL0A 2WZYA 2XNUA 2ZJUA 4UM3A 2QC1B 5JMEA 3UQ7A 3UU5A 2BG9C 2YMDA 4NZBA 3RIAA 3WTIA 4A97A 4XK9A 3UU3A 4QABA 1I9BA 4BQTA 3U8KA 5BP0A 5BW2A 3SQ6A 2XZ6A 3C79A 4HFCA 3SQ9A 4UM3S 3JAFA 2XNVA 2Y7YA 4TWDA 2X00A 2BJ0A 4IL9A 2BYNA 4WV9A 3EAMA 2XQ5A 4TWFA 5SYOA 4AFTA 3WTNA 5AFMA 2PGZA 2WNCA 2XQ4A 2XQ7A 3SIOA 3WTOA 4QH5A 5HCJA 4IL4A 4HQPA 4BFQA 5LG3A 4ILCA 3TLTA 3PMZA 2W8GA 3IGQA 3UU8A 3U8JA 4EZ1A 5KZUA 3JAEA 4IREA 2BR8A 5J5IA 4B5DA 2YOEA 3P50A 3TLSA 3WTLA 4ALXA 5BRXA 5J5HA 4AFGA 5HEJA 2BG9A 3UU4A 4A98A 4ZK4A 2WNLA 4LMLA 4HFIA 5LXBA 5HCMA 5AFKA 5IUXA 5AINA 5J5FA 1UV6A 3EI0A 4UM1A 4F8HA 3WTMA 4HFDA 4X5TA 2XQ9A 3WTHA 2XNTA 4QACA 2BYSA 2BYPA 2XQ6A 3TLVA 1UX2A 3UUBA 4QH4A 5HEOA 4AFHA 3RQWA 4LMJA 5FJVA 3T4MA 4ZRUA 3UU6A 4QH1A 4UM3P 3WIPA 4ZK1A 2YMEA 4HFBA 2BR7A 3EHZA 2ZJVA 3SH1A 5AFHA 4HFHA 3RIFA 3ZDGA 5AFMB 5L4EA 3UQ4A 5AFNA 2Y54A 3WTKA 3TLUA 3RI5A 5J5GA
chains in the Genus database with same CATH superfamily
2XQAA 4XHEA 3WTJA 3TLWA 4TWHA 5TVCA 2C9TA 4HFEA 3GUAA 5CO5A 2X00D 4UY2A 5L47A 5J0ZA 4Z91A 2W8FA 4ZJSA 3C84A 5CFBA 3RQUA 4ZJTA 1UW6A 3P4WA 2Y57A 4COFA 4NPPA 4Z90A 2Y58A 3U8NA 2BYRA 3ZKRA 4TNWA 5KE4A 2UZ6A 5HEHA 5AFLA 2BG9B 4PIRA 3U8MA 3PEOA 3JADA 4ILAA 2Y56A 2YN6A 2BG9E 4ILBA 5HEGA 5HEUA 3U8LA 4D01A 4LMKA 4DBMA 3LSVA 2XQ8A 4ZR6A 2BYQA 3ZDHA 5AFJA 2WNJA 4UXUA 4ZZBA 4FRRA 2XQ3A 2YKSA 2XYTA 4QAAA 4TNVA 5L4HA 2XYSA 2WN9A 2PH9A 3RHWA 4ZZCA 2XZ5A 2VL0A 2WZYA 2XNUA 2ZJUA 4UM3A 2QC1B 5JMEA 3UQ7A 3UU5A 2BG9C 2YMDA 4NZBA 3RIAA 3WTIA 4A97A 4XK9A 3UU3A 4QABA 1I9BA 4BQTA 3U8KA 5BP0A 5BW2A 3SQ6A 2XZ6A 3C79A 4HFCA 3SQ9A 4UM3S 3JAFA 2XNVA 2Y7YA 4TWDA 2X00A 2BJ0A 4IL9A 2BYNA 4WV9A 3EAMA 2XQ5A 4TWFA 5SYOA 4AFTA 3WTNA 5AFMA 2PGZA 2WNCA 2XQ4A 2XQ7A 3SIOA 3WTOA 4QH5A 5HCJA 4IL4A 4HQPA 4BFQA 5LG3A 4ILCA 3TLTA 3PMZA 2W8GA 3IGQA 3UU8A 3U8JA 4EZ1A 5KZUA 3JAEA 4IREA 2BR8A 5J5IA 4B5DA 2YOEA 3P50A 3TLSA 3WTLA 4ALXA 5BRXA 5J5HA 4AFGA 5HEJA 2BG9A 3UU4A 4A98A 4ZK4A 2WNLA 4LMLA 4HFIA 5LXBA 5HCMA 5AFKA 5IUXA 5AINA 5J5FA 1UV6A 3EI0A 4UM1A 4F8HA 3WTMA 4HFDA 4X5TA 2XQ9A 3WTHA 2XNTA 4QACA 2BYSA 2BYPA 2XQ6A 3TLVA 1UX2A 3UUBA 4QH4A 5HEOA 4AFHA 3RQWA 4LMJA 5FJVA 3T4MA 4ZRUA 3UU6A 4QH1A 4UM3P 3WIPA 4ZK1A 2YMEA 4HFBA 2BR7A 3EHZA 2ZJVA 3SH1A 5AFHA 4HFHA 3RIFA 3ZDGA 5AFMB 5L4EA 3UQ4A 5AFNA 2Y54A 3WTKA 3TLUA 3RI5A 5J5GA
chains in the Genus database with same CATH topology
2XQAA 4XHEA 3WTJA 3TLWA 4TWHA 5TVCA 2C9TA 4HFEA 3GUAA 5CO5A 2X00D 4UY2A 5L47A 5J0ZA 4Z91A 2W8FA 4ZJSA 3C84A 5CFBA 3RQUA 4ZJTA 1UW6A 3P4WA 2Y57A 4COFA 4NPPA 4Z90A 2Y58A 3U8NA 2BYRA 3ZKRA 4TNWA 5KE4A 2UZ6A 5HEHA 5AFLA 2BG9B 4PIRA 3U8MA 3PEOA 3JADA 4ILAA 2Y56A 2YN6A 2BG9E 4ILBA 5HEGA 5HEUA 3U8LA 4D01A 4LMKA 4DBMA 3LSVA 2XQ8A 4ZR6A 2BYQA 3ZDHA 5AFJA 2WNJA 4UXUA 4ZZBA 4FRRA 2XQ3A 2YKSA 2XYTA 4QAAA 4TNVA 5L4HA 2XYSA 2WN9A 2PH9A 3RHWA 4ZZCA 2XZ5A 2VL0A 2WZYA 2XNUA 2ZJUA 4UM3A 2QC1B 5JMEA 3UQ7A 3UU5A 2BG9C 2YMDA 4NZBA 3RIAA 3WTIA 4A97A 4XK9A 3UU3A 4QABA 1I9BA 4BQTA 3U8KA 5BP0A 5BW2A 3SQ6A 2XZ6A 3C79A 4HFCA 3SQ9A 4UM3S 3JAFA 2XNVA 2Y7YA 4TWDA 2X00A 2BJ0A 4IL9A 2BYNA 4WV9A 3EAMA 2XQ5A 4TWFA 5SYOA 4AFTA 3WTNA 5AFMA 2PGZA 2WNCA 2XQ4A 2XQ7A 3SIOA 3WTOA 4QH5A 5HCJA 4IL4A 4HQPA 4BFQA 5LG3A 4ILCA 3TLTA 3PMZA 2W8GA 3IGQA 3UU8A 3U8JA 4EZ1A 5KZUA 3JAEA 4IREA 2BR8A 5J5IA 4B5DA 2YOEA 3P50A 3TLSA 3WTLA 4ALXA 5BRXA 5J5HA 4AFGA 5HEJA 2BG9A 3UU4A 4A98A 4ZK4A 2WNLA 4LMLA 4HFIA 5LXBA 5HCMA 5AFKA 5IUXA 5AINA 5J5FA 1UV6A 3EI0A 4UM1A 4F8HA 3WTMA 4HFDA 4X5TA 2XQ9A 3WTHA 2XNTA 4QACA 2BYSA 2BYPA 2XQ6A 3TLVA 1UX2A 3UUBA 4QH4A 5HEOA 4AFHA 3RQWA 4LMJA 5FJVA 3T4MA 4ZRUA 3UU6A 4QH1A 4UM3P 3WIPA 4ZK1A 2YMEA 4HFBA 2BR7A 3EHZA 2ZJVA 3SH1A 5AFHA 4HFHA 3RIFA 3ZDGA 5AFMB 5L4EA 3UQ4A 5AFNA 2Y54A 3WTKA 3TLUA 3RI5A 5J5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQA A;  4XHE A;  3WTJ A;  3TLW A;  4TWH A;  5TVC A;  2C9T A;  4HFE A;  3GUA A;  5CO5 A;  2X00 D;  4UY2 A;  5L47 A;  5J0Z A;  4Z91 A;  2W8F A;  4ZJS A;  3C84 A;  5CFB A;  3RQU A;  4ZJT A;  1UW6 A;  3P4W A;  2Y57 A;  4COF A;  4NPP A;  4Z90 A;  2Y58 A;  3U8N A;  2BYR A;  3ZKR A;  4TNW A;  5KE4 A;  2UZ6 A;  5HEH A;  5AFL A;  2BG9 B;  4PIR A;  3U8M A;  3PEO A;  3JAD A;  4ILA A;  2Y56 A;  2YN6 A;  2BG9 E;  4ILB A;  5HEG A;  5HEU A;  3U8L A;  4D01 A;  4LMK A;  4DBM A;  3LSV A;  2XQ8 A;  4ZR6 A;  2BYQ A;  3ZDH A;  5AFJ A;  2WNJ A;  4UXU A;  4ZZB A;  4FRR A;  2XQ3 A;  2YKS A;  2XYT A;  4QAA A;  4TNV A;  5L4H A;  2XYS A;  2WN9 A;  2PH9 A;  3RHW A;  4ZZC A;  2XZ5 A;  2VL0 A;  2WZY A;  2XNU A;  2ZJU A;  4UM3 A;  2QC1 B;  5JME A;  3UQ7 A;  3UU5 A;  2BG9 C;  2YMD A;  4NZB A;  3RIA A;  3WTI A;  4A97 A;  4XK9 A;  3UU3 A;  4QAB A;  1I9B A;  4BQT A;  3U8K A;  5BP0 A;  5BW2 A;  3SQ6 A;  2XZ6 A;  3C79 A;  4HFC A;  3SQ9 A;  4UM3 S;  3JAF A;  2XNV A;  2Y7Y A;  4TWD A;  2X00 A;  2BJ0 A;  4IL9 A;  2BYN A;  4WV9 A;  3EAM A;  2XQ5 A;  4TWF A;  5SYO A;  4AFT A;  3WTN A;  5AFM A;  2PGZ A;  2WNC A;  2XQ4 A;  2XQ7 A;  3SIO A;  3WTO A;  4QH5 A;  5HCJ A;  4IL4 A;  4HQP A;  4BFQ A;  5LG3 A;  4ILC A;  3TLT A;  3PMZ A;  2W8G A;  3IGQ A;  3UU8 A;  3U8J A;  4EZ1 A;  5KZU A;  3JAE A;  4IRE A;  2BR8 A;  5J5I A;  4B5D A;  2YOE A;  3P50 A;  3TLS A;  3WTL A;  4ALX A;  5BRX A;  5J5H A;  4AFG A;  5HEJ A;  2BG9 A;  3UU4 A;  4A98 A;  4ZK4 A;  2WNL A;  4LML A;  4HFI A;  5LXB A;  5HCM A;  5AFK A;  5IUX A;  5AIN A;  5J5F A;  1UV6 A;  3EI0 A;  4UM1 A;  4F8H A;  3WTM A;  4HFD A;  4X5T A;  2XQ9 A;  3WTH A;  2XNT A;  4QAC A;  2BYS A;  2BYP A;  2XQ6 A;  3TLV A;  1UX2 A;  3UUB A;  4QH4 A;  5HEO A;  4AFH A;  3RQW A;  4LMJ A;  5FJV A;  3T4M A;  4ZRU A;  3UU6 A;  4QH1 A;  4UM3 P;  3WIP A;  4ZK1 A;  2YME A;  4HFB A;  2BR7 A;  3EHZ A;  2ZJV A;  3SH1 A;  5AFH A;  4HFH A;  3RIF A;  3ZDG A;  5AFM B;  5L4E A;  3UQ4 A;  5AFN A;  2Y54 A;  3WTK A;  3TLU A;  3RI5 A;  5J5G A; 
#chains in the Genus database with same CATH topology
 2XQA A;  4XHE A;  3WTJ A;  3TLW A;  4TWH A;  5TVC A;  2C9T A;  4HFE A;  3GUA A;  5CO5 A;  2X00 D;  4UY2 A;  5L47 A;  5J0Z A;  4Z91 A;  2W8F A;  4ZJS A;  3C84 A;  5CFB A;  3RQU A;  4ZJT A;  1UW6 A;  3P4W A;  2Y57 A;  4COF A;  4NPP A;  4Z90 A;  2Y58 A;  3U8N A;  2BYR A;  3ZKR A;  4TNW A;  5KE4 A;  2UZ6 A;  5HEH A;  5AFL A;  2BG9 B;  4PIR A;  3U8M A;  3PEO A;  3JAD A;  4ILA A;  2Y56 A;  2YN6 A;  2BG9 E;  4ILB A;  5HEG A;  5HEU A;  3U8L A;  4D01 A;  4LMK A;  4DBM A;  3LSV A;  2XQ8 A;  4ZR6 A;  2BYQ A;  3ZDH A;  5AFJ A;  2WNJ A;  4UXU A;  4ZZB A;  4FRR A;  2XQ3 A;  2YKS A;  2XYT A;  4QAA A;  4TNV A;  5L4H A;  2XYS A;  2WN9 A;  2PH9 A;  3RHW A;  4ZZC A;  2XZ5 A;  2VL0 A;  2WZY A;  2XNU A;  2ZJU A;  4UM3 A;  2QC1 B;  5JME A;  3UQ7 A;  3UU5 A;  2BG9 C;  2YMD A;  4NZB A;  3RIA A;  3WTI A;  4A97 A;  4XK9 A;  3UU3 A;  4QAB A;  1I9B A;  4BQT A;  3U8K A;  5BP0 A;  5BW2 A;  3SQ6 A;  2XZ6 A;  3C79 A;  4HFC A;  3SQ9 A;  4UM3 S;  3JAF A;  2XNV A;  2Y7Y A;  4TWD A;  2X00 A;  2BJ0 A;  4IL9 A;  2BYN A;  4WV9 A;  3EAM A;  2XQ5 A;  4TWF A;  5SYO A;  4AFT A;  3WTN A;  5AFM A;  2PGZ A;  2WNC A;  2XQ4 A;  2XQ7 A;  3SIO A;  3WTO A;  4QH5 A;  5HCJ A;  4IL4 A;  4HQP A;  4BFQ A;  5LG3 A;  4ILC A;  3TLT A;  3PMZ A;  2W8G A;  3IGQ A;  3UU8 A;  3U8J A;  4EZ1 A;  5KZU A;  3JAE A;  4IRE A;  2BR8 A;  5J5I A;  4B5D A;  2YOE A;  3P50 A;  3TLS A;  3WTL A;  4ALX A;  5BRX A;  5J5H A;  4AFG A;  5HEJ A;  2BG9 A;  3UU4 A;  4A98 A;  4ZK4 A;  2WNL A;  4LML A;  4HFI A;  5LXB A;  5HCM A;  5AFK A;  5IUX A;  5AIN A;  5J5F A;  1UV6 A;  3EI0 A;  4UM1 A;  4F8H A;  3WTM A;  4HFD A;  4X5T A;  2XQ9 A;  3WTH A;  2XNT A;  4QAC A;  2BYS A;  2BYP A;  2XQ6 A;  3TLV A;  1UX2 A;  3UUB A;  4QH4 A;  5HEO A;  4AFH A;  3RQW A;  4LMJ A;  5FJV A;  3T4M A;  4ZRU A;  3UU6 A;  4QH1 A;  4UM3 P;  3WIP A;  4ZK1 A;  2YME A;  4HFB A;  2BR7 A;  3EHZ A;  2ZJV A;  3SH1 A;  5AFH A;  4HFH A;  3RIF A;  3ZDG A;  5AFM B;  5L4E A;  3UQ4 A;  5AFN A;  2Y54 A;  3WTK A;  3TLU A;  3RI5 A;  5J5G A; 
#chains in the Genus database with same CATH homology
 2XQA A;  4XHE A;  3WTJ A;  3TLW A;  4TWH A;  5TVC A;  2C9T A;  4HFE A;  3GUA A;  5CO5 A;  2X00 D;  4UY2 A;  5L47 A;  5J0Z A;  4Z91 A;  2W8F A;  4ZJS A;  3C84 A;  5CFB A;  3RQU A;  4ZJT A;  1UW6 A;  3P4W A;  2Y57 A;  4COF A;  4NPP A;  4Z90 A;  2Y58 A;  3U8N A;  2BYR A;  3ZKR A;  4TNW A;  5KE4 A;  2UZ6 A;  5HEH A;  5AFL A;  2BG9 B;  4PIR A;  3U8M A;  3PEO A;  3JAD A;  4ILA A;  2Y56 A;  2YN6 A;  2BG9 E;  4ILB A;  5HEG A;  5HEU A;  3U8L A;  4D01 A;  4LMK A;  4DBM A;  3LSV A;  2XQ8 A;  4ZR6 A;  2BYQ A;  3ZDH A;  5AFJ A;  2WNJ A;  4UXU A;  4ZZB A;  4FRR A;  2XQ3 A;  2YKS A;  2XYT A;  4QAA A;  4TNV A;  5L4H A;  2XYS A;  2WN9 A;  2PH9 A;  3RHW A;  4ZZC A;  2XZ5 A;  2VL0 A;  2WZY A;  2XNU A;  2ZJU A;  4UM3 A;  2QC1 B;  5JME A;  3UQ7 A;  3UU5 A;  2BG9 C;  2YMD A;  4NZB A;  3RIA A;  3WTI A;  4A97 A;  4XK9 A;  3UU3 A;  4QAB A;  1I9B A;  4BQT A;  3U8K A;  5BP0 A;  5BW2 A;  3SQ6 A;  2XZ6 A;  3C79 A;  4HFC A;  3SQ9 A;  4UM3 S;  3JAF A;  2XNV A;  2Y7Y A;  4TWD A;  2X00 A;  2BJ0 A;  4IL9 A;  2BYN A;  4WV9 A;  3EAM A;  2XQ5 A;  4TWF A;  5SYO A;  4AFT A;  3WTN A;  5AFM A;  2PGZ A;  2WNC A;  2XQ4 A;  2XQ7 A;  3SIO A;  3WTO A;  4QH5 A;  5HCJ A;  4IL4 A;  4HQP A;  4BFQ A;  5LG3 A;  4ILC A;  3TLT A;  3PMZ A;  2W8G A;  3IGQ A;  3UU8 A;  3U8J A;  4EZ1 A;  5KZU A;  3JAE A;  4IRE A;  2BR8 A;  5J5I A;  4B5D A;  2YOE A;  3P50 A;  3TLS A;  3WTL A;  4ALX A;  5BRX A;  5J5H A;  4AFG A;  5HEJ A;  2BG9 A;  3UU4 A;  4A98 A;  4ZK4 A;  2WNL A;  4LML A;  4HFI A;  5LXB A;  5HCM A;  5AFK A;  5IUX A;  5AIN A;  5J5F A;  1UV6 A;  3EI0 A;  4UM1 A;  4F8H A;  3WTM A;  4HFD A;  4X5T A;  2XQ9 A;  3WTH A;  2XNT A;  4QAC A;  2BYS A;  2BYP A;  2XQ6 A;  3TLV A;  1UX2 A;  3UUB A;  4QH4 A;  5HEO A;  4AFH A;  3RQW A;  4LMJ A;  5FJV A;  3T4M A;  4ZRU A;  3UU6 A;  4QH1 A;  4UM3 P;  3WIP A;  4ZK1 A;  2YME A;  4HFB A;  2BR7 A;  3EHZ A;  2ZJV A;  3SH1 A;  5AFH A;  4HFH A;  3RIF A;  3ZDG A;  5AFM B;  5L4E A;  3UQ4 A;  5AFN A;  2Y54 A;  3WTK A;  3TLU A;  3RI5 A;  5J5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...