4PIXA

Unliganded cysteine dioxygenase c93a variant at ph 6.2
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHAFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4pixA00
3S7IA 2QVSB 1LB2A 3O14A 3QACA 2IXIA 3PLQA 2CV6A 5KHGA 3I54A 3CJXA 4KWLA 4IEUA 4LTAA 2BEOA 2VECA 4XFIA 4IETA 1O7FA 1O5LA 3C3VA 3CO2A 4BHPA 4XFAA 5JSOA 3QOPA 1RTVA 3LA7A 3U11A 4J1WA 4KU7A 4D7TA 1UIKA 2GC0A 4AQ6A 3CEWA 4JVAA 2GZWA 4XF4A 2UY8A 5EFUA 2QNKA 5KHHA 3RZZA 5JAXA 1O5UA 3M3IA 1V70A 4HMZA 2XHKA 2Y0OA 4KL1A 2PHLA 4UBHA 3R6SA 2UYAA 1ZRRA 3H3UA 3FJSA 1OFNA 1O4TA 1ZNPA 1FXZA 1VR3A 3D0SA 5I91A 3BU7A 1HW5A 4RD7A 1CAUB 4YRDA 1LKNA 5FQ0B 3H3ZA 1O3SA 3TNPB 4A2UA 3GYDA 4O9GA 3BALA 1PM7A 3KMHA 4AQ2A 1J58A 4MX3A 2VPVA 5I8TA 3KGZA 3SHRA 2ET7A 5FCCA 1UD1A 1LR5A 4Q29A 5BY5A 2XLAA 4IERA 1XE7A 4IEXA 4IEZA 4LLOA 4Q0SA 4META 3L2HA 2O8QA 3PNAA 2N7GA 4OLLA 4MV2A 2QCSB 5C8WA 5KBFA 1H1MA 4I0BA 4R8HA 5J48A 1G6NA 3E97A 4DINB 3H50A 2HJIA 1CAUA 4HVQA 5FQ0A 3OTFA 3FFQA 4HVRA 5I0UA 3NJZA 3FX3A 4ZU7A 2IXHA 2XKPA 4LUMA 5FLIA 3EJKA 3RDIA 1I5ZA 3ZDSA 4AVCA 3H7JA 1J3PA 1UCXA 3IWZA 4QGNA 4XF3A 4FT8A 2I45A 5FLHA 2ZCWA 1Y3TA 3LAGA 3FE5A 5I93A 1FI2A 2IXKA 1ZZ8A 3KCCA 4EWEA 1YFXA 2B9UA 3USSA 1DGWA 1YLLA 3OGJA 1XE8A 3H1MA 2PAEA 1TQ5A 4LUKA 2D5HA 3ES1A 2D93A 4KU8A 1OD5A 4X6QB 4ZU4A 4LEJA 3FWEA 1O3TA 2IXCA 1OMIA 2PQQA 3SMHA 2PHDA 3I7DA 4TLFA 5EZWA 2K0GA 1EY2A 5JR7B 5BV6A 4N9HA 4X6RB 4EWDA 3BCWA 3MPBA 2GC3A 4Z07A 5FDBA 1YFWA 3ELNA 3ST7A 3S0MA 4YNIA 4LA3A 3CF6E 3MYXA 3U10A 5CVRA 3LOIA 4AXOA 4PIZA 1Q43A 1RUNA 1H1IA 5FLJA 1DZTA 4D7SA 2PAKA 4KWKA 2Q1ZB 1ZVFA 2BNMA 1CAVB 3E5UA 4IEOA 4FAGA 1WGPA 2ATFA 4XF9A 1DZRA 2CAUA 3MDPA 1NZCA 2B8MA 1QXRA 2BGCA 3RYKA 1QWRA 5J3UA 2D40A 3H1WA 1J1LA 3SCFA 4PIXA 4E2SA 4E2QA 1SEFA 1OI6A 5E1RA 3H7YA 3LA2A 3RYPA 1U12A 4I2OA 4BYYA 2EA7A 2PYTA 4HSLA 4HN0A 5I0TA 1VP6A 4IEVA 4QGMA 4L11A 3HT2A 1ZZ6A 4H7LA 4MGZE 1RUOA 4YARA 5LRSA 1CAVA 3OF1A 2UY9A 2XL9A 3EHKA 4Q0PA 2CAVA 1YUDA 5J7MA 4Q0QA 4XFCA 3HT1A 1YWKA 1WA4A 4CYDA 1JUHA 4JTOA 1ZRCA 4IEYA 4QXKA 2PTMA 4Q0UA 2XL7A 3HIFA 5I0SA 4HBNA 3NL1A 1VJ2A 2MNGA 3FHIB 5JSRA 3NKTA 3RNSA 4EWAA 2ZKLA 1EYBA 3UKNA 1O3QA 2FMYA 3B02A 5AVPA 3DN7A 5CADA 1CAXA 4HVOA 2EVXA 4R52A 4J1XA 3DKWA 2Q4SA 2UYBA 3DL3A 3RYRA 4MZUA 4QGLA 2OA2A 3VHRA 2PAMA 3LWCA 5CU1A 5KHIA 1J3RA 4XFHA 4EV0A 2PA7A 4JV4A 1ZZCA 3E5QA 4I09A 4BH9A 3EBRA 3KGLA 4F7ZA 4XF1A 1GQHA 2ETEA 1QXJA 1NE4A 1YHFA 3MZHA 1FT9A 4I3PA 4XFGA 4XFFA 4F8AA 1Q3EA 4MUVA 2VQAA 1J59A 3SCHA 3E6CC 1L3JA 4WBBA 1X8EA 4WVZA 5KHKA 4E2GA 5I8YA 1UW8A 3LA3A 5BPXA 4XEZA 1SQ4A 5T3NA 4HN1A 4BIFA 3D82A 3WW2A 2XLGA 1IPKA 1J3QA 1GQGA 4IEPA 2F4PA 3WW1A 3EQEA 4Q0VA 2IXLA 3WW4A 2XLFA 4XF0A 3ETQA 1SFNA 3IIAA 2KXLA 2V09A 3UKTA 5FPXA 4NVPA 2PFWA 4MGIE 2HKXA 2WFPA 3H9AA 1EP0A 2CGPA 3JZVA 1YFYA 1ZZ7A 2XGXA 3GBFA 4QM8A 3E6DA 2K9ZA 1NXMA 3I59B 4I01A 3CL1A 4KWJA 3ACLA 3RPQA 1CGPA 2C0ZA 2H6CA 4Z82A 1UIJA 4MH0E 2IC1A 4QMAA 1NYWA 4MGYE 4IESA 4XFBA 4FBFA 3H1YA 2IXJA 1RGSA 2QJVA 4QM9A 2Q0AA 3UKVA 3SCGA 2QDRA 3PVBB 1ZZ9A 1X7NA 2WC2A 4HZFA 4I02A 2MPFA 2O1QA 1Y9QA 1RC6A 3NSTA 1CAXB 4HLTA 4HSJA 2ET1A 2MHFA 2H6BA 2P17A 1X8MA 5K8SA 4YYOA 1I6XA 3H8UA 3D0JA 4AVBA 2E9QA 4IEQA 3CLPA 3S7EA 2OPKA 1IPJA 3I59A 1RL3A 3DV8A 5LEJA 1UPIA 2GC2A 4PJYA 5JSPA 1PMIA 2GAUA 3G7DA 5HI0A 4AVAA 3SXWA 5C6CA 3LZZA 4PIYA 4YSFA 5BXXA 2OZJA 1CAWB 3IBMA 1QY4A 5FPZA 3N4MA 1ZRDA 4ONUA 3FZ3A 3M70A 2DCTA 4JTNA 5BUVA 2GU9A 2BNNA 2XKOA 3OCPA 5JCTA 1XRUA 3BPZA 4UXAA 4FAHA 2EAAA 3E5XA 2GH2A 2Q30A 1Q5OA 4IEWA 1YFUA 3ROUA 1LRHA 2FQPA 4EROA 3IDBB 4GULA 3HQXA 3KSCA 4QX5A 1CX4A 3EO6A 4P9GA 2BNOA 4UBGA 4LULA 1DGRA 3BB6A 1X82A 4L2NA 2OYZA 4ORFA 5KHJA 2H0VA 3WW3A 5LRRA 5LEKA 1CAWA 5I8SA 4O9EA 3ES4A 3U0ZA 4WZCA 3IDCB 5F1RA 1ZZBA 4ZU5A 2BYVE 3E6BA 4OFGA 1O3RA 4LA2A 2D5FA 2Z69A 2B5HA 4MGKE 5D1IA 5E16A 5I0RA 3OD0A 1ZREA 1ZX5A 4K8FA 4B29A 3NVCA 3TNQA 1NE6A 3NW4A 1WLTA 1ZRFA 1EPZA 2OZ6A 2Z2SB 4I0AA 4N9IA 2GC1A 4XETA
chains in the Genus database with same CATH superfamily
5FXXA 3GNEA 4YFWA 1OLQA 1LTEA 3KS7A 3O14A 3OJBA 4L9BA 3QACA 2ZGQA 4HG6B 3OPTA 3WOGA 5DUXA 2C9KA 3HD8B 2D6LX 5T50A 3PLQA 3MIHA 3I54A 3TOJA 1TZOA 2V4AA 2XB6C 3KT7A 1R64A 1S0JA 4XFIA 1CZSA 3HWJA 1ND3A 1PZ7A 1WLWA 4Y22A 2WNVA 3A23A 3ALQA 2FCTA 3FMGA 4MXWA 4BHPA 3POJA 1FAYA 4DMIA 4XFAA 4S2FA 1I5PA 1QJY3 5BNPB 4E8CA 3NAPB 1YRZA 3AMPA 2Q8EA 2W1UA 4N7UA 1V9U3 1UMHA 2VVFA 4WM8B 3TEXA 4J1WA 1JZ6A 2BTVC 5F37A 3T2QA 2BBAA 4AFMA 4URAA 1VBD1 5FP4A 2GZWA 4XF4A 1JMUB 3AL5A 4CPBA 5FZGA 5GLVA 4JDMA 1MZEA 2Z5WA 4RGKA 5EJ3A 5KHHA 3RZZA 2W5FA 4JC1A 5GM0A 1UX7A 2ZGUA 5IVCA 4OI1A 5JAXA 3KM5A 3KT1A 1BLZA 2QQWA 4I3GA 2I74A 4BQ2A 2WQ4A 2HWD1 1JBCA 1GWMA 1KD7A 4XDPA 1POV1 3C7HA 2RS32 1VAKA 1COV3 1UYPA 5EYXA 2AR6A 1UMZA 3N9PA 4UBHA 3R6SA 4DUXA 2UYAA 1ZRRA 3TYJA 3RZGA 3MFCA 1U5ZA 1O4TA 4L0PA 3N9QA 1R082 5K4LA 5LWBA 2A1XA 4QX2A 5FPBA 3M3QA 4L92A 1LKNA 1QIQA 4LBQB 2YROA 1B09A 1QJX3 1O3SA 4A2UA 3NWKA 1BBT3 4QHZA 2ZGRA 3B93A 4E8DA 1HRI2 1KXGA 1PM7A 3DYOA 4O9GA 4X8NA 4MG2A 3I49A 1J58A 1ULGA 1LGNA 1UWWA 4MX3A 3WP4A 3OB8A 3KGZA 3B01A 4N43B 3SHRA 5IK4A 3AFGA 2YV8A 4QX3A 5FCCA 1G9DA 5HPOA 4FQZA 5BY5A 5IVEA 4IERA 4R9AA 1AYN3 2VGDA 1XE7A 2VOXA 4M00A 2YU2A 4LLOA 4YVSC 4X8PA 2HWF2 5LCWL 1NCRC 2A3YA 1SPPA 2W87A 5LBBA 4A4AA 1SLAA 1UOGA 3KZ4C 4MV2A 3JUUA 2O8OA 4I0BA 1XNCA 3RSJA 5J48A 1TME1 3PUQA 3J7HA 5FMOL 5BNQA 4NWWA 1ACCA 2VUAA 3MW4A 4DINB 1W6PA 2HJIA 1STMA 2WINB 2CGNA 2PLV1 3BKZA 1SG3A 1UY3A 3FL7A 5L9VA 1RUF1 3CKHA 4FI9A 5AFBA 4XHXA 1PX3A 3JQWA 2CU5A 2IXHA 4JKKA 4Y20A 4LUMA 4ZU7A 2DFCA 3R4UA 3LEIA 4ISRA 3EJKA 5IVBA 5DAQA 1FNZA 1I5ZA 2IVIB 5CFDB 1XU2A 2ZGPA 3IKWA 4CXXA 5KWRA 3VDCA 5HCHA 4W6XA 1MZFA 1GBGA 1RJ8A 4JHTA 4SLIA 2RDSA 3WNOA 2C1FA 5FY1A 3GALA 4XF3A 4EE2A 2I45A 5FLHA 2WNVB 4J6GA 2XOMA 3WINE 2ZCWA 1EAH2 1W6OA 4NHYA 5ACA1 5GZGA 3CZJA 3I2IA 1RMU3 2WZR3 1GICA 3JBG1 4INDA 2WWUA 4OZOA 2Q8DA 5I93A 4XAEA 1QQP1 2ZGSA 2WO1A 2HWE2 4H14A 2J22A 4IE7A 3NV3A 1Q8SA 4IE0A 4K9SA 1OQ1A 3P3NA 3USSA 1YLLA 2NM1A 3INAA 3OGJA 2XUEA 3OGRA 4QB1A 3RJRA 1WD3A 5IVFA 2ZX4A 2NLRA 4I0WB 3O0VA 2YPJA 2IWGB 2A6ZA 4X6QB 3AMQA 5C3SA 1JZ3A 2D6PA 4QB2A 1BJQA 1O3TA 4W4ZA 2A7AA 1YYNA 2BFUS 5A33A 1A8MA 3B7MA 2BUKA 1PO21 2VCBA 3MIBA 4FSJA 1VE0A 4C0BA 2VW0A 3A21A 4Y1ZA 5ABJB 1VLNA 1EY2A 1ZRIA 1VRH1 5EJ1B 5BV6A 3ZMOA 4N9HA 2JDHA 5FZOB 5A3NA 3MPBA 4GWNA 1QJU3 3WF3A 1N3PA 4Z07A 2QDNA 4QT6A 3JD73 3ELNA 5TSWA 2ZS6B 4LK6A 3ST7A 5IAXA 1MACA 4KWUA 2YC2A 2XVKA 4XQWA 2R042 1QF3A 3MYXA 3U10A 1W6MA 5C33A 5JPNB 1BYHA 1S0EA 1Z78A 5AFEA 3WXPA 2WS93 1HB1A 4YZ4A 1SLBA 1R1A3 1D4M1 1YQ8A 3IIIA 4LBNA 3WG4A 1W2OA 3A0NA 1NCRA 2Y0IA 4KI5M 2VQUA 3OBTA 2ZPXA 1OF3A 1X9TA 4DO0A 1ST8A 1ZBA1 2A70A 3FBMA 4XURA 5JIUA 3J8F2 2HEVF 3POWA 4Q4V3 3GCWA 1W90A 1VALA 3T0DA 2JICA 2HWB1 2EXJA 2ATFA 3D3AA 1XB9A 3IB3A 5DAWA 2QTWB 1KJRA 1OKOA 4AL9A 1DZRA 2JDUA 1K5JA 1AR83 1IHMA 1NZCA 2B8MA 4P5YA 3U14A 4D7YA 1DBNA 2DTWA 4CDXB 4B4RA 2BU9A 4CA9A 3RYKA 4FOQA 4QPGB 2EIGA 5J3UA 1MEC3 4JGYB 4YGCA 1HQNA 1YJKA 3H1WA 4AQTA 3K4DA 3WG2A 3X29B 1M06G 1G86A 4B7KA 1SEFA 3UETA 4Y20B 1U12A 4ASKA 5FYVA 2GNDA 3AZWA 4P02B 4GWJA 5FZ4A 3WUDA 4YM2A 2PYTA 4S2HA 3ZSJA 2BBVA 2D6MA 1Y9GA 2F4LA 2VZOA 4L11A 2X5IB 4XPVA 1F31A 1N3OA 2Y6JA 5EWSA 5FZ8A 4DXSA 1W6OB 3D6EA 4Q4X2 4XJWA 2P34A 4ASMB 2RR12 5C3PA 4Q0PA 1W6QB 3UT0A 1LOFA 2CAVA 2YPDA 4XAAA 1YUDA 4CCKA 1W3XA 3ACIA 4OMDA 2QUOA 1LOBA 2EXKA 3OSDA 1VMFA 2NZ9A 4IEYA 4QXKA 1CJPA 3THTA 5A1FA 4UWDA 1PGL1 5I0SA 2J1VA 1SMVA 4JRLA 2VZ3A 4AEJA 3TN92 4CCOA 3Q9OA 1VJ2A 1W9SA 3FHIB 1W8HA 2YUEA 3PDQA 1CPNA 5DN2A 3N36A 1S2KA 4QKFA 3WZ1A 5B4NA 5CFCC 1LHWA 3AYAA 2VO5A 5FPLA 2FDFA 5HCBA 5AVPA 1PZ9A 1OLRA 4P9LA 1DYPA 3DN7A 4QXCA 4P9YA 1IGOA 2WFF1 4WM7A 2VZVA 1CAXA 3M7AA 5CADA 1WKYA 2EVXA 3ZN6B 5A3LA 4ATEA 4YW5A 3TB0A 5IHRA 4YLZA 1OQEA 3DYMA 3H8OA 3RYRA 2JKXA 1E57A 3PL0A 1LGBA 1LAJA 1CJDA 2VH9A 4GH4A 5A3WA 3IAPA 4ATFA 3WNMA 1AF9A 1VAVA 3LWCA 2DBNA 3UGFA 3ZMNA 1K12A 3AP6A 2OS2A 1QOOA 5IUQA 3ZFGB 4BIOA 1U5IA 2W46A 4HXCA 4YVSB 3E5QA 4BQ4A 4I09A 4OCTA 2CL2A 4CXWA 3ZKUA 1Y4WA 1CESA 4XJ9A 3I2DA 5E6HA 4NAMA 4F7ZA 1LHNA 5JOZA 5FY7A 4CP1A 4LPLA 1GQHA 2ETEA 1QXJA 1NE4A 1YHFA 3WR0A 3MZHA 1DF0A 1UX6A 4HONA 4I3PA 1FPN2 4XFGA 3LEMA 5FKBA 1UYXA 3GJBA 5FR3A 2WN2A 4RSUA 1J59A 1M4WA 3VV1A 3E6CC 1L3JA 2J1RA 5JLVA 2XHNA 5GLZA 1X8EA 1QMJA 3IDAA 5KHKA 1YXWA 3VZKA 4CEWB 2V4VA 4KH9A 5C3OA 2NP0A 2QQIA 2HWC2 1RUH3 1QJEA 2V5DA 2VVEA 2A3XA 4QU1A 4EQVA 1WZXA 1H6XA 3VD9A 5A6XA 1DU3D 1JZ2A 3WW2A 1AZDA 5FZMA 3DXTA 1QU0A 2UWBA 5IK8A 1OURA 2O14A 2F4PA 4Q0VA 3THPA 3GGLA 2LALA 4W8JA 3G6JB 3WY6A 3OGVA 1PZ8A 1RHI2 3AC0A 5FPXA 1VBE1 3P5BA 4MGIE 4PBPA 2DVAA 5DPNA 3U4XA 1QHDA 2ERFA 2VUJA 3H9AA 1UYYA 4BE3A 1UYZA 3GZUC 2RDRA 1YFYA 2VOVA 2XGXA 2EIDA 3HVDA 2GMEA 4FPCA 3O1VA 5T5PA 1NXMA 3TEWA 2J7MA 5I0DA 1XE0A 4KWJA 1BKZA 3RPQA 4CU7A 5A7NA 4UFHA 5E8AA 5CFCA 3GHMA 2H6CA 4V1PA 2HBUA 1UIJA 2VQ0A 2GNTA 3TAYA 3VBRC 4CE8A 3H8RA 3ZR5A 1K5MC 4QPIC 4MGYE 4RS5A 3PIGA 1H6YA 3H1YA 5IFPA 1JUIA 3GZTB 1R1ZA 4Q1PA 3UL2A 2WNOA 1ZZ9A 4GWMA 2XQRA 5C4WB 5GZFA 3AZZA 1NXD1 2BVBA 1IPSA 1T2XA 1VPHA 1WMFA 4NROA 1HV1A 1JU4A 1CAXB 4XDOA 2WBKA 3N9LA 1XU1A 3QH6A 4HPKA 1VBD2 1YQ2A 4IE6A 2DFBA 5K8SA 1L7QA 4RQPB 1KQRA 5F3EA 5GKAC 4YYOA 1NA1C 3H8UA 4YFZA 2SLIA 4LBQD 4B1MA 2E9QA 2JDZA 3WDXA 1HN1A 3CLPA 1JHJA 3QBQA 2OPKA 2HWD2 1HKDA 3W20A 2JG9A 1UPIA 2OT7A 1LOEA 4CDWB 1KJLA 3LSDA 1JYIA 1QEXA 3GDBA 2AZ5A 2GAUA 1GWLA 1PM4A 4C91A 2RV9A 4UFMA 5H9RA 1UXXX 1ENXA 2ID4A 1REFA 5BXXA 2OZJA 4FTBA 4FPJA 3AB0A 4LHNA 1LHUA 1CX1A 3AYDA 1SLIA 2D43A 3JCIA 4JDNA 3T30A 1AX1A 1ZRDA 1V6JA 3ZO0B 1AR63 1WMDA 2B45X 2E7QA 4RN5A 5L9BA 3TBDA 3ZSLA 3OCPA 1COV1 2ZAHA 2HYKA 4FAHA 2DVFA 4AI9A 5JCTA 1Z7S1 2WWSA 5DG1A 3E5XA 4AYUA 2AACA 3ZSEA 1DQ5A 4AHXA 3WLUA 4EZ4A 1XOYA 1IQAA 4UI9L 4YW2A 3NNMA 2VCCA 3LD8A 1OA2A 1U5XA 3RJ2X 1LRHA 2QE3A 2FQPA 4JZRA 3IDBB 5H9PA 3ROUA 4E4DX 3WF2A 1JH5A 1ND2C 4P9GA 4Q4Y3 1ZBE1 1GV9A 2BNOA 3IN9A 4KQ7A 2UWAA 5C5TA 1OH4A 1NUKA 2BQPA 3OEBA 4NRMA 3BTZA 2Q1MA 5FO7B 3T4VA 1TMF1 2VNGA 2A75A 3C7OA 3PURA 3VD3A 4Z92B 3IPVA 1HQLA 1X82A 2BWCA 5BNPC 2YBPA 3KT4A 2XBO3 3NAPC 3PMSA 4XUNA 3W58A 2H0VA 3WW3A 5DAVA 3KLSA 4WM8C 2J42A 1TME2 1KRIA 1GOGA 3FLTA 5LEKA 2WAOA 5F5IA 1URXA 3RWKX 5HV0A 4DNYA 1GWKA 3OY8B 4OHWA 2R071 4BQYA 1WCSA 3AXEA 2PLV2 3S5QA 5CKQA 1K45A 5FY5A 3IDCB 1RUF2 3CQOA 5DXDA 2IFWA 5JI7A 5F1RA 4AEMA 1JOPA 1ZZBA 1LOCA 2WWJA 3H0OA 1JOBA 3N9NA 1W8NA 4XJAA 3VBRA 1DIWA 1K5MA 2VE1A 2FBEA 2D5FA 4QPIA 3WV6A 1GNZA 2ZMKA 1G9BA 5E16A 2XVGA 3U75A 3S57A 1ZX5A 2ENRA 1HLCA 4KGGA 5FYYA 4CUCA 1G9AA 1FMD1 3BOPA 1RVF1 4DIQA 3LEGA 2DWRA 3BIWE 2CWSA 1XXNA 1O8PA 5EIYB 5FZ1A 1OA4A 4AGGA 4BU2A 4N9IA 5FMDA 2GC1A 1LR5A 3GM8A 4XETA 5DUVA 4C1WA 5ACA2 2R063 3T2OA 1H30A 4QWNA 1XJAA 2D98A 5D8AB 3ZSKA 3JBG2 3OUHA 1UY1A 2LM3A 2V72A 2YU1A 5FIXA 5FFOC 4TYSA 5FZDA 1QQP2 2BW8A 2CV6A 3ME2A 1NA1A 1N1YA 4XOGA 5JZGC 3ZYGA 3MIFA 4CSWA 4CDUB 1AYM3 4HPKB 1W9WA 3AZVA 3AVRA 4QQLA 4YPJA 4LOSA 4ISQA 4NHXA 2E6VA 3KHCA 4XIKA 2JEMA 1NLRA 1V6OA 2YC4A 4DXZA 5A6ZA 1FV2A 2WZR1 3QOPA 1RTVA 1IS6A 4CVUA 3BIEA 1X9PA 1BEV1 2V73A 2C6SA 4A7ZA 4JVAA 1T6GC 1KFUL 2FZ1A 4LK7A 3AKTA 1EV11 4GWIA 1PO22 5FKCA 1LNSA 3UGGA 1F5FA 3ZXLA 4CEYC 5FO8B 1G9CA 1W8WA 5A7OA 3TRSB 1UN1A 4WVWA 1UZVA 1DQ6A 4FOVA 2WR9A 1VRH2 3UJOA 1SCRA 3O1RA 5LA0A 3J26N 1DGWX 3KD4A 4BMEA 1C8M1 4QU2A 4KL1A 2PHLA 2ILMA 3DGTA 3DPRC 3H3UA 1Z0HA 1A34A 2PQSA 3LB9A 4YM0A 1ND2A 1VR3A 3WCRA 4ZXKA 5I91A 2W92A 1LCLA 1S2BA 3WDTA 1D4M2 1TVGA 3ZX7A 5CFDC 4AEDB 1QJU1 3BPSA 3HMYA 1OHFA 3TNPB 1RYYA 3VL9A 1MVQA 2CY6A 2J1AA 4XILA 2DCZA 1AVBA 2A6XA 4XMAA 5JXIA 4UT5A 1ZBA2 4NIHA 5BNPA 5FY8A 2RS13 4S2DA 3NAPA 3V0BA 1K3IA 3K75B 4LKSA 4XXPA 4AFDA 4WM8A 2Y33A 1OVSA 2HWB2 2AGSA 1AX0A 4ZHNA 2ET7A 4GB31 3WF0A 1D0HA 1N1VA 3JQXA 4Q29A 5IK7A 1QH7A 5F2WA 2TUNA 2ZX3A 4E4ZA 3KQRA 1AUYA 2QZ2A 5APAA 4IEXA 1CN1A 1W8FA 1XPWA 2RE9A 4AR2A 3L2HA 2BWAA 2ZEYA 5FOJB 4IUGA 3NV1A 2Y34A 5FYTA 4BWOA 5F9TA 4XIOA 1D4VB 3BGAA 3HNMA 3SEEA 4AFBA 1E5SA 3VBRB 2VM9A 4PLNA 4R8HA 4BQ1A 5DDJ1 1AR81 4LO5B 4GD4A 2ZXQA 2EXHA 5EP9A 5J37A 3I3QA 1MZ5A 5A3MA 2Y38A 1MEC1 1OUSA 5ABJC 1VBC1 2FDHA 2G4IA 5EPAA 4UFLA 3FX3A 1HV0A 2B42B 2ZTNA 5A32B 4IL7A 2XKPA 5JZGA 1MS1A 2DVDA 2QQOA 5FLIA 4DY3A 4C0HA 1F4HA 3I8TA 4D3WA 2EIBA 3OBRA 4LMFA 3ZDSA 3PJYA 2ADDA 4AE2A 4COWA 1CIYA 3S30A 3GZAA 1NA1B 1ULEA 4DQAA 2DBIA 5C9AC 2Y6KA 2R32A 4QGNA 1OBNA 2ZX1A 2RS33 4MGSA 3ZIWA 1PGL2 4M4RA 4W6YA 4XQDA 1NAEA 1PK6B 2GN7A 3LAGA 4KNCA 4MADA 2BOJA 5EHDA 3ZYBA 1W8ZA 2WQ8A 1UMIA 2VL4A 4YM3A 4LO6B 1R083 1AR71 4B7EA 4XJ8A 3O12A 5C3QA 1XE8A 2PMWB 4BPZA 5M0TA 1H8TB 4P5HA 3VB9A 4LBOA 5CZKA 3LIGA 4JRAA 3GBGA 1HRI3 3MIGA 2P6CA 2WFF2 4NR1A 3HN1A 4RA0A 4ZU4A 4CDXC 3ZR6A 4LEJA 2YFZA 4QPGC 2Y6HA 1GR3A 4JGYC 4DEVA 5IVVA 5CFDA 4GIQA 3K3OA 5EZWA 2R0FA 2K0GA 1W0PA 1ND2B 4YW6A 5B2GB 3RZJA 1OPOA 4X6RB 1JU3A 2P4EA 4QX1A 5FUPA 4PDWC 4NWVA 4XC9A 1VIWB 4YGEA 1JYXA 2WZPP 5T52A 2H0BA 2X5IC 4ZONA 3V0BB 4OUMA 1US2A 1YO8A 4N90A 4HKLA 5SV8A 2PHWA 4LQRA 1H9WA 2WA3A 4V2VA 1GQPA 1L7RA 1LULA 2I2SA 2RM23 2WNEA 3M8LA 4PIZA 4AXOA 4CP9B 3H8XA 4ZZ8A 3KF3A 2VMEA 1RUNA 1H1IA 2PHXA 4AZZA 5CIRA 2RMU3 2F6BA 2WZ8A 4JAAA 1HRV3 2JE7A 2Q1ZB 4Q2FA 1ZVFA 4AW7A 2QQUA 2EXIA 2QQMA 3ENRA 1B35B 4TWTA 2X09A 1UZZA 4TZDA 1WGPA 5A1AA 3C8XA 3LKJA 2AENA 3JB8A 3QH7A 5L19A 3VHNA 4A41A 5ABJA 1XNBA 2XDVA 2A6VA 1QXRA 2OQ6A 4Q26A 2BGCA 3CDZB 1EAH3 1DGLA 5FZOA 2MEV1 4KGQA 2HEWF 2D40A 3ZXAC 3FLRA 3UGHA 4FFGA 1VBA3 1RUOA 4OHYA 4IGOA 4C8DA 4E2QA 4CXYA 3I2FA 2GH8A 2HWE3 2G9GA 5E1RA 3LA2A 2P5BA 4N53C 1D2QA 3HQRA 1VBE2 5JZGB 5C9AA 4BYYA 1RUD3 5IWFA 1JZ7A 1SHWB 1MS8A 2ZACA 5FXZA 4BQWA 2RDNA 3PUHA 3FN9A 2WNUB 1RITA 2WYFA 1C5HA 3POFA 4IEVA 4QGMA 3FUQA 2VJXA 1ZZ6A 3HT2A 5ERLA 1ULOA 3KVBA 2JE8A 1PO13 4DY5A 3ZFGC 1LJ7A 1ASJ1 5A1LA 2UY9A 2WT1A 1GZCA 3AFKA 4KG0A 3U37A 5CISA 5IYYA 1FNYA 1FOD3 2VU9A 3ZXKA 2OKXA 5FMBA 4CEYB 4XFCA 3HT1A 4NRPA 2O0OA 3MUY1 3AP9A 3ZYHA 4K21A 3SH4A 1BCXA 1O4ZA 3N3HA 4CDXA 1JUHA 3NJVA 1RUJ1 4G3YC 3RFRA 3PUAA 4NPRA 3RRDA 4QPGA 1BMV1 5FYZA 4Q0UA 1S4CA 4JGYA 3ABZA 5F5QA 3ZFEB 5BNOC 3MIDA 1F5JA 2R043 1VB2A 2ZGNA 4C1XA 4HBNA 3W9AA 3HBZA 2MNGA 3DPRB 3EXUA 4QDQA 3DF0A 1RUG1 3NKTA 4LHSA 1D2SA 3O7OA 4N7IA 3VN4A 3RNSA 4ARXA 2ZKLA 1X50A 3RI9A 5A7WA 1PGSA 2VW2A 4QQ2A 3UKNA 4CEWC 2ZGMA 3AVSA 1O3QA 5FZHA 4PDWA 3C7FA 1DYKA 1VB4A 1AR93 4Q27A 4OULA 2D7FA 2E33A 2X5IA 4XHBA 1N1TA 3K46A 4ZZ5A 4V2WA 5E88A 5LA1A 1LOGA 2BFUL 4J1XA 4Q8KA 2ORZA 3DL3A 3M2MA 1O59A 1WW7A 2VZPA 2Z79A 3ATGA 1KDMA 1W6QA 2J1EA 5DZGA 4EJRA 5CG9A 4QGLA 5DUUA 2PAMA 4OMCA 4M3CE 5CU1A 2GNBA 4TXWA 3W59A 2OX0A 4Z2WA 4LIUA 4QPWA 1UO9A 4EV0A 1GZTA 2RS51 1COV2 1ZZCA 2KA3A 2VCMA 1WW5A 1Z7S2 3AKQA 3M3OA 4LO7A 4BH9A 2K2SA 5GJ6A 3EBRA 5FZ0A 4AVVA 4A3ZA 3KV5A 4YZ2A 3AP7A 4MHRA 2PHUA 4E4HA 5JWPA 3P3PA 4PI2A 3URFA 2QQKA 4BQ3A 3ZPOA 4HKOA 2DCJA 1ZBE2 1W0OA 1I3HA 1Q3EA 4DUVA 2NMNA 2VQAA 3O1SA 4AQSA 3VDBA 3VL8A 2VG9A 1TMF2 4Q4X3 1OVPA 3ZN6A 4N53A 1SDDB 3FC0A 4WVVA 1AXZA 4E2GA 5C4WC 1DCSA 1DQ0A 3AP4A 3B69A 1J83A 3WG1A 3LA3A 5BPXA 1NY71 4BCUA 4IW3A 2DYCA 4XZPA 3CJIC 3NV2A 4Q4Y1 3JU9A 2YB7A 5C9AB 1KS5A 4PBOA 5BNNC 2JDYA 2R072 4CUAA 3ZYJB 4RQPC 1W2AX 3DCQA 5B4XA 1C4RA 3T08A 5FREA 3VBUB 1IPKA 1J3QA 2J1SA 2VBBA 3PIJA 3ZFGA 4YVSA 1JI6A 1HXS3 1YQCA 4WV8A 1X36A 3EQEA 3TN93 2IXLA 4M3CB 4A3XA 1SFPA 1S2EA 4XF0A 4DEQA 4NIDA 3BODA 3OGSA 1S0DA 4PLOA 4NIIA 1SFNA 3IIAA 4GQ7A 3WD5A 2KXLA 2V09A 3K48A 3UKTA 4MGQA 1UF2C 4CDWC 1XNKA 2PFWA 5AVAA 2HKXA 2HEYF 2WFPA 4A7KA 1GMMA 5JOWA 2CDOA 1FMD2 4UW4A 1RVF2 4IGQA 3N7LA 2B4KA 4DRRA 5K9YA 3JZVA 5KXBA 2CGPA 2DU0A 4MYEA 3GBFA 2R1BA 3RG0A 5BNOA 2FDGA 2VZRA 5FMCA 3HPNA 3I59B 1QDCA 4YWAA 5E89A 5HXVA 4B4PA 2D3PA 1HJFA 3ACLA 4K40A 1LESA 4A45A 1CGPA 1JYCA 1S0GA 5FYUA 4BZ4A 3W5NA 4FPKA 4MH0E 4CEWA 1P8JA 2IC1A 2P37A 4QMAA 4CDQB 4FTSA 2ARAA 1NYWA 4IESA 1PVC3 4IGPA 4FBFA 2C4XA 1S0FA 1RGSA 1XSQA 2QJVA 4FPEA 4QM9A 5A7WB 1G7YA 3UKVA 3SCGA 4CCNA 3U4SA 2Q1FA 3ASIA 3W21A 1X7NA 4NPMA 4HZFA 2R061 4PDWB 5C70A 4ZS2A 2WZR2 2P3KA 1RC6A 1XQNA 5FZBA 3VHPA 4HLTA 1BEV2 1VMJA 2ET1A 4Q4W1 4Y1VA 4YG6A 3WF4A 5FY0A 2HBTA 1YI7A 3ILNA 1EV12 1FPN3 4Y26A 4PCRA 5D21A 2ARXA 5CBLA 2JWPA 4JKLA 2W91A 4WVMB 5FYHA 3CBNA 4FFHA 3NNGA 3WDYA 1ODMA 1IPJA 2D6NA 2KM2A 2VMIA 3DV8A 1QXPA 2GC2A 3KV9A 1C8M2 4PJYA 1ONAA 3Q8FA 3ZXDA 4BISA 2YY1A 4Z2AA 1F35A 5FZIA 4EN6B 5HI0A 3PUSA 2EALA 5C6CA 2FD8A 4YSFA 1CAWB 4AGRA 1DQ1A 4TSVA 2IUWA 1QY4A 5FPZA 1QJU2 4ONUA 5JMCA 3FZ3A 3M70A 2DCTA 3MBWA 4FCAA 2XKOA 1XRUA 5L73A 5C4WA 1QOSA 2EAAA 4P9WA 3SNMA 1Q5OA 2XUMA 4IEWA 1RHI3 5L9RA 5FYBA 3CJIA 3NNFA 4N53B 1YFUA 3AMMA 3IM0A 3POIA 2ZX2A 3MICA 5D8AC 4DOUA 4GB32 3T1MA 5C3RA 5BNNA 3OG2A 4RGGA 4RQPA 3KSCA 3OOXA 2E53A 4QX5A 1CZTA 2VMHA 2XWBB 5J98B 4XJZA 4CDUC 4OVEA 2YFUA 5IW0A 2RS11 1RUC1 3O1MA 2W2IA 3MLJA 3VBSC 4CDWA 1DGRA 2HYXA 2YHJA 3I2KA 4L2NA 4GJYA 3VBOC 1OC1A 2IZWA 2OYZA 1E5RA 3L9JT 5DDJ2 5LRRA 1AR82 4A7YA 1JZ5A 3WQ1A 3NQHA 1XYNA 1RUE3 1ULDA 3ES4A 5DG2A 5GLUA 1MEC2 1VBC2 1ULCA 1PMHX 3FLPA 3R4SA 1IKPA 3ILRA 2X10A 4LKFA 5GZEA 2CSGA 5BNOB 4ZU5A 5A3PA 1AL21 2QQVA 5AC93 3J9SA 1VBB3 2VMCA 5F3GA 3PHMA 2ZZQA 5D1IA 4K3UA 3NJXA 3FFZA 5JI9A 3NVCA 1S1AA 1UZ0A 3TNQA 1NE6A 4H7MA 4AI3A 1ZRFA 3HAGA 1EPZA 4FVVA 2HWD3 3LDRA 4NN0A 1WCQA 2OZ6A 5K7PA 2Z2SB 1POV3 1LENA 2AUYA 3D5OA 2GALA 5LK7B 4OHXA 4RFT0 2Y6LA 3S7IA 1Y7BA 2A71A 4IXLA 5DABA 4AEDC 1LB2A 1XNDA 2GP5A 1H1AA 1G9FA 1V6LA 2P3YA 2IXIA 2XWJB 3WVJA 5KHGA 3CJXA 4KWLA 4IEUA 1AR72 1HX6A 2P3JA 4L99A 4Y5SA 1BQPA 1YJLA 2VECA 3PJQA 3VDAA 3OBZA 1APNA 4IETA 4ZXEA 1A3KA 1HB2A 4R4ZA 1O5LA 2D97A 3OY8A 1PHMA 4YVWC 4YG3A 2VNOA 5JSOA 4E4SA 2K46A 4JQRA 3TEYA 3O5SA 3DKQA 1TEIA 4IV1B 3LA7A 4Q5OA 1Y43B 4QDSA 3K3NA 3T0BA 3U11A 4CU9A 5FZ3A 1UIKA 2SBAA 1H4HA 3CEWA 3MO4A 4XZUG 1WBFA 3AXDA 1OLMA 1W28A 4LORA 2ZHLA 2DUQA 5EFUA 1G8WA 4RHV1 2QNKA 2BGPA 2E51A 1W8OA 2W68A 3C7GA 1O5UA 4H3WA 1H8VA 3GHNA 3M3IA 2W3JA 1V70A 4HMZA 4GMP1 2DTYA 1IS4A 2BGOA 3MW3A 5CAZA 2W94A 4OHVA 1BVP1 2Y0OA 1NQJA 5D8AA 1F15A 3FJSA 1R093 2QQNA 4K1ZA 3ZOIA 5FZCA 3CJIB 3WNNA 5G04L 1WUVA 4CDUA 2WDBA 2BJSA 4RD7A 1CAUB 1OQDA 4OZXA 1V0AA 4AVSA 5FQ0B 5BNNB 5JXJA 1RUF3 1ULFA 2DUPA 2YBSA 3AMHA 4L97A 3VKLA 3E1F1 3WHTA 3GYDA 1JZ8A 4UW5A 3VBSA 5JXGA 4BLJA 5K0UB 3VBOA 4COYA 1MQTB 3HQUA 1QJY1 3Q8BA 2CNAA 2WLQA 5A6YA 1TE1B 3KMHA 4FQ4A 4AQ2A 4CU8A 1V9U1 1Y9MA 4QHOA 1PK6C 4IV3C 4QXHA 1UZWA 2BPA2 3RZMA 2RM21 4NMIA 2F17A 2LRPA 3OUJA 4MHUA 1DHKB 5CKNA 1JYTA 2YGMA 1QKQA 2XLAA 2XVLA 4LBLA 1NZIA 2RMU1 4PT6A 4XUPA 1HRV1 1LHVA 2AEZA 5GZDA 2MEV2 5FTTC 5EXOA 1BVVA 1H8TC 3OYWB 4META 5F32A 2O8QA 3ZIXA 3PNAA 4PLMA 2VOWA 1OLME 4OUEA 1UXZA 2UWCA 3LF7A 5KBFA 3R4DB 2X05A 3VHOA 2VTFA 3A4UA 1G6NA 5F6KA 3E97A 4NHLA 3U1XA 5C71A 4JHZA 5JR2A 1SBEA 4AEDA 4NIGA 3FHAA 4JX0A 1VBA1 1DFQA 3NJZA 1QJX1 2VZTA 3MEPA 1BBT1 2FDJA 4C90A 3MUZ1 3VBFC 1OPMA 2DVGA 1ASJ2 2D3SA 2JG8C 1PO23 1V6KA 4ARYA 3VLBB 1RUD1 1GP4A 1IG3A 4HETA 4AVCA 1RB8G 1OA3A 1J3PA 1QDOA 3KWVA 1VRH3 2A6WA 3SH5A 2R0HA 1UCXA 2JX9A 5G05L 3IWZA 1XSRA 3AK0A 1FATA 4YM1A 4BM8A 2RJLA 1OF4A 3AKSA 1RUJ2 1AYN1 2ZGKA 4QQPA 1BMV2 1PO11 3CU7A 4UF0B 5A7QA 4A44A 4RFRB 2ADEA 1Y3TA 4LO8A 1I9RA 3RS6A 1SZBA 1YI9A 4M4PA 4OUSA 2IXKA 3PVNA 4R4XA 3HN3A 2VZQA 3KCCA 3F2ZA 4QX0A 5L7OC 1YFXA 1FOD1 1JS9A 1RUG2 2B9UA 2GP3A 3HJRA 1MPXA 1B35C 4LHLA 1D4M3 5A3OA 2ZGTA 4Y1UA 4ZPIA 4LBKA 5J09A 1E5IA 2PAEA 1XBFA 3USUB 3ZXGA 1JXNA 3T4HB 4LUKA 3ES1A 3UV9A 2D93A 4FP3A 4KU8A 4AK3A 1BXHA 2W47A 3FBYA 3LPGA 4BXFA 4COZA 3FWEA 2CWMA 3POGA 3MIEA 2WT2A 4ES8A 5A32A 2HWB3 3N9OA 4ZKTB 2IXCA 1OMIA 3AKRA 1WLDA 4TLFA 3QCWA 4OI2A 3BTYA 4XYXA 1LODA 4BXSV 4LE4A 2ZAAA 2FCVA 2TNFA 1AR91 5A80A 3CMGA 3ZM8A 3BCWA 2FCUA 2RS52 2VNVA 5FDBA 1FYUA 3NRUA 2WNUC 5BYNA 4OI4A 4G4FA 3N9MA 1PK6A 4YNIA 3VBSB 4PF5A 5FYCA 3CF6E 5JVVA 3VBOB 1US3A 1JHNA 2WRAA 1RMU1 5CVRA 1F2NA 2QZ3A 2Q8CA 4R9BA 3LOIA 1PIV3 3WDVA 3V64A 5EV7A 4B3NA 3POEA 5FAXA 4CCLA 1WCUA 5T55A 4OI0A 1Q43A 1UY0A 5A6QA 4XXAA 3ZYRA 4K8RB 1H8TA 4NOTA 3VBHC 5FZ7A 2C26A 1WD4A 1NQDA 1W2NA 1W9YA 2PAKA 4KWKA 3AYCA 3SEPA 4FXKB 2AYHA 3P6BA 3R05A 4XUTA 2W9XA 4Z1VA 1IZ3A 1CAVB 3A0KA 4XTPA 4LNVA 3E5UA 1AHSA 4EN0A 3T09A 4IEOA 4XBNA 4IE4A 3U07A 3ZFEC 4AI8A 4FAGA 1NY72 4XF9A 2CAUA 2KD7A 3MDPA 1W9TA 3HNBM 4Q4Y2 4B8EA 4E9KA 5F3CA 4XE9A 1UL9A 1JW6A 2V5YA 3AJYA 2C24A 1OOPC 4OHZA 2Z42A 4M3CF 1MR5A 4HFSA 5IVYA 2JG8A 1XNAA 3SCFA 3JD71 3ORJA 4PIXA 3WF1A 1OI6A 2WJSA 2RDQA 2WABA 2YGLA 3RYPA 3U78A 5IATA 1BK0A 5LBEA 1RUI3 5FZ6A 4HSLA 4CP9A 4HN0A 1UY4A 2VULA 2WS91 1S0BA 5HCAA 2OUHA 1VRBA 1JTZX 4YVWB 1R1A1 3NNLA 1A6CA 1IOAA 1HXS1 4XTMA 3N7MA 4GALA 4H7LA 4HK9A 4LBJA 4MGZE 3MF6A 4LBMA 5ISLA 1QOTA 5L7OA 2A73B 3ZPYA 4YARA 2OUJA 3DECA 3OF1A 1B35A 2XL9A 5C8CC 1GZWB 4Q4V1 1AJKA 4Y5Z0 3ZFFB 2NQYA 3MV01 3J4UH 2GMPA 3UJQA 2OW4A 1O8SA 4I30A 4Q0QA 1MS0A 1YWKA 5DZEA 1WA4A 5CB7A 2I07B 3SLIA 1RINA 1SLCA 4COUA 1ZRCA 5FZLA 2R062 3VD5A 4Y4YA 1JYWA 2XL7A 3HIFA 5A3TA 3TEZA 1UKGA 5FY9A 3QLQA 1Q8QA 1QNWA 5JXHA 3NL1A 4Q4W2 2DCKA 4Y3OA 5JSRA 4DXRA 2NYYA 2W95A 3T2TA 1OH3A 4E27A 1JZ4A 1PVC1 1UQXA 4CZSA 4EWAA 5CEHA 5LY1A 1EYBA 1JN2P 3WSOA 4FPHA 3B02A 4LT5A 2WNUA 4QX7A 1WMXA 4OQ9A 4YG0A 4QKBA 1NKGA 4CCMA 3VKOA 4CUBA 2X29A 3VBUC 1HIXA 1UKRA 3DKWA 2Q4SA 2UYBA 3ACFA 1O6UA 1W04A 4IV3B 4XCAA 4AVTA 4GKXA 5J36A 2E7TA 5FUNA 3VHRA 4CEYA 4S2GA 5KXDA 2VR4A 3RZLA 2R30A 4XFHA 3ZVXA 3M3EA 3BTAA 1DQ2A 2ZEZA 3SKVA 4AFCA 3DXUA 4PQQA 3ZLIA 3P1IA 4M0NA 2ZBJA 4M01A 4XDQA 3PTRB 3ZFEA 2P2KA 3WQBA 1EUTA 5JUVA 4U2AA 1ENRA 1VBE3 4FFFA 1MVEA 2NN8A 3NNJA 2Y60A 4JGZB 1WMEA 3DPRA 4XF1A 5FZ9A 5LY2A 4AHWA 1CVNA 2XJRA 3VZLA 4DB5A 4EN7B 5HBAA 2VZ1A 4CDQC 3UNPA 4LKDA 4MUVA 4DXTA 1RXGA 4D94A 2G1MA 3NKGA 5A3UA 2ARBA 2RS12 3OPZA 4MO3M 1RUC2 1F4AA 1NT0A 1ALYA 2HWF3 2PXJA 4WBBA 3VBFB 2WO7A 4MGTA 3APBA 3KV4A 4WVZA 4AHYA 2JG8B 1NCQC 1QJFA 5FXWA 1TNRA 2ZOEB 1WBLA 1YEWA 1UPSA 5LZ6A 4W50A 3THDA 4ZS3A 5T3NA 2FZ2A 1MZ6A 4NHKA 3D82A 1K42A 1PMJX 4FFIA 1LHOA 2EAKA 2XLGA 1ZM1A 3AMNA 1GQGA 4XW3A 1S55A 3WW1A 2YXSA 3WW4A 5C8CA 3BU0A 1AL22 1O91A 4QQHA 3B9IA 4AI1A 3RGBA 2BV4A 4XCBA 4CRQA 2BOIA 5L7OB 1ZYBA 3V0AB 4NVPA 5D2AA 3S5AA 1C57A 4K20A 2G19A 1RUE1 2JIGA 2RHPA 1LU1A 3SISA 3ZXJA 5JMOA 5JOYA 3LOBA 4AWDA 4EN9B 1ZZ7A 4RR3B 1JYNA 2JJ6A 4YGBA 3GXUA 4MOAA 5F5CA 5AC91 1VBB1 3FUOA 2NPIA 2J1UA 4IQPA 1VMHA 4CCCA 1V00A 4YW4A 4XFBA 4D6RA 1RUH1 2IXJA 5GALA 5FPAA 3VD4A 5FWJA 2B7YA 4LKEA 5GZCA 4XMIA 2XJUA 1NX9A 1PX4A 1C1LA 1Z7S3 2ZABA 4GZ9A 3VBUA 3KQ4B 4I02A 3F95A 4QKDA 2MPFA 1Y9QA 4FOWA 4M3CA 3NSTA 3M3CA 3M4FA 2H6BA 3O1UA 2JD9A 2DDUA 2LROA 1X8MA 2P17A 4FXGB 4UFKA 1ZBE3 1JYVA 1I6XA 4RHV2 3WT3A 4UW3A 3VKNA 3ZYIB 4AVBA 2LTNA 1AXYA 4MVTA 3VBHB 3VDDB 1C5IA 1HDKA 2VOTA 2WLPA 1J1TA 1TMF3 2IFRA 3I59A 2ZMNA 1QH6A 2VMFA 3D8CA 1W8TA 3BTXA 4FPFA 4H2AA 3WDUA 5HV4A 3LDKA 2GMMA 5FPUA 4XUOA 4DRVA 4AVAA 1LGCA 4CDQA 2XJVA 3JB4C 1W03A 2R073 3N7JA 4ZY9A 2P1BA 4NHMA 3W5MA 3ZKYA 3NMBA 2BERA 4TLGA 4KBBA 3ZSMA 4D69A 4IDZA 4NPLA 2VXRA 2Y26A 4RL7A 1OOPB 4YW3A 5BUVA 2P3IA 2ZHKA 2VMDA 4UXAA 2OQ7A 2VBDA 1NCQA 1QJY2 2GH2A 3K2OA 3J8F3 4WZFA 4NUBA 3WHUA 1NLQA 1R091 1V9U2 2W1WA 3M1HA 1SDWA 3ON7A 3R0RA 2X53S 4R9DA 2RM22 1POV0 1FMD3 1RVF3 3OBAA 3HQXA 3LDBA 1CX4A 3EO6A 1ZA7A 1H4GA 4Y24A 2RMU2 2BP6A 1HRV2 4WVMA 2ES3A 4HK8A 3MGUA 4J25A 4H55A 3THCA 4DUWA 1H9PA 3QD6A 3Q8AA 2OPWA 3TWIA 1WLCA 2AEYA 4FOYA 2ZJCA 3HBKA 1GZ9A 5C8CB 4IV1C 3SKJE 1A78A 4W65A 2KR2A 5FV3A 5FUIA 2ZGOA 4P9JA 5C5UA 5HXMA 1ND3B 4Y22B 4YZ3A 1CAWA 4MXWB 5FMOS 4L8QA 3U0ZA 2D44A 4WZCA 3IDEA 1VBA2 2DVBA 1DLCA 1QJX2 5LBCA 1AR61 2UURA 1BBT2 2JECA 1BEV3 1DGRN 2BYVE 3AZXA 3CIHA 4BK4A 3I3BA 2JDAA 4LA2A 1EV13 2WA4A 2Z69A 1LOFC 1RUD2 2B5HA 4MGKE 2RR13 3OD0A 2G9ZA 3RZKA 4HT1T 3WNXA 2J1TA 2VZUA 4B29A 1GYKA 1EUUA 2LS6A 2ZHNA 1SCSA 3NW4A 1WLTA 2X8KA 1RJ7A 1AYN2 4R9CA 1O4YA 3O0WA 1PO12 1C8M3 4QB6A 2QVSB 4P14A 2XH6A 1H2KA 3WNLA 4FPOB 3AX4A 2ZGLA 3VZOA 4UFJA 5K0UC 1BZWA 1MQTC 3PU3A 1FOD2 3V65A 1W9FA 2XBO1 2DUOA 1DG6A 3NJYA 4LTAA 2BEOA 3VZMA 1N1SA 2P6HA 4NAOA 5EYYA 2PN5A 5L36A 1O7FA 2JIJA 2YG0A 1W99A 3C3VA 1HJGA 3CO2A 3VD7A 2W39A 4CCDA 4WM7C 2VTXJ 2JE9A 2GN3A 2VUCA 2TBVA 4ASLA 2HLEA 2RVAA 3PU8A 2QQPA 4KU7A 4D7TA 2D3RA 2GC0A 5DQ0A 4AQ6A 3B00A 3OUIA 4GB33 4LITA 1XYPA 5SV5A 1UOBA 2UY8A 4YZ1A 4GH4C 4QHBA 1WA6X 1FX5A 3GJAA 1NLSA 1AR92 3MLKA 3O1PA 2UU8A 2GSYA 1N47A 1GLHA 2PHRA 4B4QA 5FOBB 5CNAA 4BQXA 5A7SA 1SPPB 5F8PA 3WP5A 2XHKA 3I3DA 3RVHA 3RWNA 5LW9A 2XJTA 5KXEA 1NCQB 1RMU2 5DDJ3 3AZYA 3MPPG 1OFNA 3I4IA 2BRTA 2Q8OA 1ZNPA 1FXZA 3D0SA 4XJUA 1H2MA 3BU7A 4LIVA 1HW5A 4YGDA 5FJHA 5FP8A 1W6PB 4QQOA 1AYM1 4Y5TA 4YRDA 1DZQA 1N3QA 1GU3A 1VBC3 3H3ZA 5H9SA 2NMOA 4BA6A 2VW1A 5A70A 5KXCA 2A3WA 1W39A 3VKFC 3BALA 2XG3A 4IV1A 5F5AA 5FWEA 1JOJA 4O61A 1F9KA 4FPGA 2VPVA 5FP9A 1HN0A 1PIV1 5I8TA 1CZVA 4GKYA 3LGRA 1S0IA 1CR7A 1UD1A 2HWC3 3ACHA 4EYUA 1CIWA 5F7UA 4A6OA 3VZNA 5DMYA 2YZ4A 1I1EA 2CHHA 4CUGA 1KDKA 4IEZA 4Q0SA 4MXVA 1QNYA 4AHZA 4P9IA 4UYBA 4YZ5A 3RMXA 1W2UA 3JD72 1W05A 2N7GA 3ACGA 3MW2A 4OLLA 4CTEA 5FO9B 2QCSB 1AR73 5C8WA 2R49A 1PGW1 5JIAA 3ZXEA 1H1MA 3KCYA 1Q56A 3T3YA 3T1LA 1SACA 3RZHA 1AXKA 4PF1A 3WP3A 2WS92 3KV6A 4DS0A 3H50A 3WCSA 1CAUA 3J7NA 1WCKA 1R1A2 4HVQA 2DF7A 5FQ0A 3OTFA 2RJ2A 3MFAA 3FFQA 4HVRA 1HXS2 4EN8B 1RIRA 4JKMA 5I0UA 2CDPA 3MHZA 4YW7A 5K0UA 3VZJA 1MQTA 1C1FA 5T5JA 1WCDJ 4BDVB 4DFSA 1UOJA 1IG0A 4PI0A 3RDIA 4KBZA 3WDWA 4Q4V2 5A33B 5FBZA 5HCFA 4LOTA 3UESA 1RUI1 4RS5C 2WSVA 3H7JA 4O7XA 4W6WA 1CD3G 3HEIA 5EJZB 4FT8A 3I3MA 4G9SB 5F39A 5T5OA 1Q8VA 3A22A 1XC6A 3OYWA 1GOHA 1KEXA 4COVA 3FE5A 3RMYA 1CQ9A 2RG4A 1FI2A 3J7MA 3JXSA 1W6MB 3WX5A 5IK5A 1ZZ8A 4BQ5A 2DV9A 4LHKA 4EWEA 3T2PA 4QXBA 4ET7A 2IVJA 1PVC2 2QQJA 3GZEA 1DGWA 1VBD3 4AI2A 3I3EA 1H0BA 4XQ4A 3H1MA 5FY4A 3WUCA 1NCRB 4QPYA 1EPWA 2E7AA 1GOFA 4Y4RA 1TQ5A 3K4ZA 2OVUA 1FV3A 2D5HA 4KMQA 1OD5A 5JPMB 4QKNA 2EICA 1Q8PA 2JG9C 2C9AA 2YYOA 3O1TA 4AG4A 3LEKA 2Y64A 3SMHA 2PQQA 2AREA 2PHDA 1MS5A 3I7DA 4XABA 2R1DA 2VAUA 2E32A 3WP6A 1KFXL 1U0AA 1YCIA 3OD4A 5JR7B 2WAAA 1XNTA 2MEV3 4EWDA 2W08A 4AGVA 1H2NA 1XYOA 3KB5A 4AEKA 2YBKA 1QJZA 2GC3A 1YFWA 4LO4B 4B1LA 5FZEA 4AF9A 2RS31 2XR4A 3BYWA 4UF0A 4AAXA 3V56A 5IJRA 3S0MA 1W8UA 3LIHA 4LA3A 3BUCA 3IZOA 1AX2A 1OXCA 3POSA 5DAPA 3SH3A 4GAZA 3K77A 3SQOA 1C3HA 1DYOA 4P00B 3J7LA 1R081 2E63A 5FXVA 5JOXA 4CP2A 3ZFFC 1DDLA 2VQTA 3OPWA 2JDPA 3C2UA 4D8MA 1W3VA 3B9CA 3A7QA 4UW6A 3USUA 5FLJA 1DZTA 1ULPA 2OXBA 1LEDA 3DYPA 4D7SA 3ZN4A 1GNHA 3D4KA 1WW4A 5FK7A 4DPNA 4CCEA 5KC5A 1H2LA 2XMLA 1HRI1 3B94A 1ASJ3 1LECA 2RJKA 2BNMA 2VY0A 4XUQA 1PVXA 4Y1YA 3ZDVA 2JDKA 3LCPA 2JKBA 4LXLA 5F2SA 2WSUA 5F6LB 1U5YA 2VD7A 3H42B 4DZGA 3HNYM 1POQA 2YDEA 3ETPA 2AC1A 1TME3 4PQ9A 2ZHMA 5FP3A 5GLWA 1RUJ3 3GF6A 5FBJA 4AAPA 3K51A 2WUHA 1UNBA 2PLV3 3MLLA 1QWRA 2CTVA 3BOWA 3GCXA 2XPJA 2HWF1 2B9VA 3CHXA 1J1LA 4YW1A 4A6SA 1ENSA 4E2SA 1BHGA 2VBPA 4ES9A 1RUG3 3ITQA 3LFIA 4IE5A 2FDKA 3MF9A 3H7YA 2A5ZA 4LJHA 2WO3A 4I2OA 2W52A 4BOWA 3ZYPA 3NV4A 4RGAA 2EA7A 1F8VA 2YMZA 2WL1A 2XJQA 1RUE2 2YC0A 5C7GA 3IT8A 5I0TA 1VP6A 1T6BX 3LPFA 1SLLA 3WNPA 4WM7B 1QGLA 3I2OA 5AC92 1V6IA 1VBB2 1W06A 3N35A 5LRSA 1CAVA 5DAXA 5ACA3 2ORXA 3EHKA 1IS3A 2D6KA 3JBG3 3ILFA 2R6QA 3LQCA 4AOCA 5J1XA 1QQP3 2VXJA 3DEMA 4JQTA 4GH4B 5J7MA 1E5HA 2AH2A 1LU2A 3EB7A 4JGZC 1RUH2 1ENQA 2L9LA 2DCYA 2GNMA 5FYSA 4CYDA 2JB8A 3PVOA 2RS53 4JTOA 1TG7A 2LUWA 3SITA 2FMDA 2R16A 2PTMA 3EYPA 1EAH1 4FP2A 4KG8A 3RQ0A 1HQWA 1PNFA 3C7EA 4A42A 4BB3A 3AM2A 2QBXA 2HWE1 4P08A 3WNKA 3K4AA 5CYYA 4TN7A 4QX8A 1YC61 1YIPA 2Y6GA 2FMYA 2ZKNA 1ZA4A 4YVWA 3AL6A 1UU4A 2XXZA 4HVOA 1ODNA 2ZEXA 2QKDA 3WEZA 4R52A 3WQ0A 3IAQA 4GMP0 4EZHA 5FYMA 2PHFA 5LA2A 4Y1XA 1GANA 1GZWA 1LEMA 3B5LB 4MZUA 3ZFFA 5IVJA 1CONA 2ARCA 2OA2A 4FPLA 2W1QA 2DU1A 5KHIA 1J3RA 1IKQA 3FHQA 2PA7A 4JV4A 5LK5A 5IAVA 4RR3C 4AI0A 2G9FA 1ZBA3 5FRAA 2QFEA 3KGLA 2R041 1R092 5FZAA 2VOKA 3POBA 5LASA 5T54A 4K1YA 1SFYA 2EIEA 1C28A 2OIIA 3Q8EA 5FZKA 3IMNA 1FT9A 1W0NA 4XVHA 4Q8LA 4XFFA 3ZN5A 2B39A 3OGGA 4F8AA 4SBVA 2W1SA 5CKMA 4TTGA 2VCAA 2QQLA 2ZMLA 1CWPA 2BVVA 3SCHA 4PHZA 1X33A 4MLOA 1UOFA 3J8F1 3LFMA 2WIIB 3NO8A 5CFCB 4D0QA 4NIAA 2LW8A 1W6NA 2WQZC 1OT5A 3WG3A 1UW8A 3RI8A 4CPBD 5I8YA 5J96B 4IV3A 4RS5B 1DP0A 1GP6A 2Y6FA 3HR9A 4UAPA 1SQ4A 4XEZA 3I2GA 2XONA 4NRQA 5FYIA 4CCJA 4HN1A 1REEA 1IQDC 4BIFA 1KGYA 1YQ6A 3VUOA 4MSVA 2JDNA 2E31A 2BDRA 1SLTA 2PHTA 1AR62 4JCKA 3KCXA 4IEPA 4NO4A 3VDDC 4Y33A 4Q4W3 2XLFA 1NOVA 1KITA 3IMMA 5LA9A 3ETQA 3L2YA 3O1OA 3Q8CA 4JGZA 4N43C 1J84A 1SBDA 3KHBA 4NJ4A 2PELA 2VVDA 3PMEA 4O65A 1REDA 1EP0A 3BN6A 3GBWA 4QM8A 2VNRA 5ANNA 1MS3A 1AL0G 3E6DA 2K9ZA 3I2HA 3UYJA 4I01A 4HOOA 3CL1A 2JG9B 4D6SA 1VAMA 4GJZA 3ECQA 2VMGA 1HB4A 3VBFA 4FTEA 4Q4X1 4LE3A 1UY2A 2C0ZA 5A7PA 3S6PA 4CU6A 5FZFA 2RR11 2W0XA 4Z82A 5CA6A 4K6BA 1SBFA 1V6NA 2XBO2 2Z4FA 1GFF2 3HOBA 4ITCA 2Q0AA 4NE9A 2HH9A 2QDRA 2BZDA 4FO9A 1IS5A 3I2JA 3PVBB 2B46X 2WC2A 4P9XA 1W2TA 2O1QA 2WFF3 4HSJA 3TN91 1S0CA 2Y8KA 3OEAA 5JDBA 4D6QA 2MHFA 2E26A 2VC9A 3MI8A 1D7PM 2Q5TA 3PUIA 4XBLA 5IFTA 2VTXA 5DZFA 3V0AA 2JXAA 4BMBA 4F3JA 1KS4A 3D0JA 2D6OX 1RXFA 1OKQA 5KR7A 4IEQA 1ND3C 4RR3A 1RUC3 3S7EA 2WNVC 1GKBA 2WT0A 2VUDA 3O0XA 2A6YA 4LLFA 3AKPA 2JDMA 4F83A 4UOJA 1RL3A 2GDFA 3LE0A 5F3IA 5LEJA 5IT6A 4BLIA 3I97A 3IPVB 3VKMA 5JSPA 1PMIA 3KF5A 3ZYFA 1UAIA 1GNYA 4M0HA 3BVCA 3G7DA 1WWYA 1OFSA 4HKWA 2DURA 4AFAA 2WZEA 3SXWA 4FPYA 1GSLA 3LZZA 4PIYA 5H9QA 1YQ5A 3POYA 4HL0A 4XACA 4XBQA 5FJKA 3IBMA 3N4MA 1AYM2 1C8NA 1YNAA 3B3QE 1TNFA 4QDRA 1CPMA 1NG0A 4JTNA 1UU6A 2GU9A 2BNNA 4QD2A 2CGOA 1AL23 3BPZA 2WKKA 4N8MA 4URTA 1HB3A 5KC6A 2C5DA 2Q30A 2WYSA 5DUWA 4GXLA 1K5MB 3AYEA 1AJOA 3AJZA 4JDOA 4QPIB 2FHRA 1PIV2 4K7JA 2JD4A 1DLLA 2CYFA 5LATA 5ANQA 1W6NB 4EROA 3LSEA 1MS4A 3BI3A 4GULA 4LBQA 4QAWA 1OUXA 1FPN1 1UZYA 2FDIA 5LB6A 1YIFA 4UBGA 4OYUA 3VDDA 3KVAA 3VBHA 3DUIA 3PTYA 1OSGA 4LULA 5FPVA 2TEPA 3H3LA 1GP5A 2XJSA 1LOAA 3VGIA 1V6MA 1Q8OA 2R7EB 1BK1A 1OD3A 2VZSA 2XJPA 3BB6A 4N43A 5GLTA 3SC7X 3ZXFA 1PGW2 4ORFA 4RYDA 5KHJA 2HWC1 3N7KA 4UFIA 3PVEA 1WW6A 2ZA9A 4HANA 3WQ7A 5FP7A 4OQ8A 1DQ4A 1A8DA 4U36A 5I8SA 3UK9A 4O9EA 4GA9A 5T5LA 2ZZJA 4BJ0A 5CG8A 3AP5A 1MS9A 1D0GA 1OOPA 1GUIA 2XQXA 2ZEWA 1JODA 5FK8A 3E6BA 4OFGA 2ZX0A 1O3RA 2EF6A 3CZUA 3T0AA 1RHI1 2WO2A 3MV11 2JENA 1RUI2 2JB4A 4RHV3 5LBFA 4BK5A 4Z8BA 5I0RA 1ZREA 4Q1RA 1PNGA 4K8FA 4LR4A 4CP0A 5EQUA 4I0AA 4GMP3 3CNAA 3EMRA 1L7LA 2WN3A 1UU5A
chains in the Genus database with same CATH topology
3GNEA 4YFWA 1OLQA 1LTEA 3KS7A 3O14A 3OJBA 4L9BA 3QACA 2ZGQA 3SLIA 3WOGA 5DUXA 3HD8B 2D6LX 5T50A 3PLQA 3MIHA 3I54A 3TOJA 2XB6C 3KT7A 1S0JA 4XFIA 3HWJA 1ND3A 1PZ7A 1WLWA 4Y22A 2WNVA 3ALQA 3FMGA 4MXWA 4BHPA 1FAYA 4DMIA 4XFAA 4S2FA 1QJY3 5BNPB 3NAPB 1YRZA 3AMPA 4N7UA 1V9U3 2VVFA 4WM8B 4J1WA 2BTVC 4AFMA 1VBD1 2GZWA 4XF4A 5GLVA 4JDMA 1MZEA 2Z5WA 5EJ3A 5KHHA 3RZZA 4JC1A 5GM0A 2ZGUA 5JAXA 4OI1A 3KM5A 3KT1A 4I3GA 2I74A 2WQ4A 2HWD1 1JBCA 1KD7A 1POV1 2RS32 1VAKA 1COV3 5EYXA 2AR6A 1UMZA 4UBHA 3R6SA 2UYAA 1ZRRA 3TYJA 3MFCA 1U5ZA 1O4TA 1R082 3M3QA 4L92A 1LKNA 4LBQB 2YROA 1B09A 1QJX3 1O3SA 4A2UA 3NWKA 1BBT3 2ZGRA 3B93A 1HRI2 1KXGA 1PM7A 4O9GA 4X8NA 1J58A 1ULGA 1LGNA 4MX3A 3WP4A 3KGZA 3B01A 4N43B 3SHRA 5IK4A 3AFGA 2YV8A 5FCCA 1G9DA 4FQZA 5BY5A 4IERA 4R9AA 1AYN3 2VGDA 1XE7A 2VOXA 4M00A 4LLOA 4YVSC 4X8PA 2HWF2 1NCRC 2A3YA 1SLAA 3KZ4C 4MV2A 3JUUA 2O8OA 4I0BA 1XNCA 3RSJA 5J48A 1TME1 5FMOL 5BNQA 4NWWA 2VUAA 3MW4A 4DINB 2WINB 1W6PA 2HJIA 2CGNA 2PLV1 1RUF1 5AFBA 4XHXA 4ZU7A 3JQWA 2IXHA 4Y20A 4LUMA 2DFCA 3R4UA 4ISRA 3EJKA 1FNZA 1I5ZA 5CFDB 1XU2A 2ZGPA 3IKWA 5KWRA 4W6XA 1MZFA 1GBGA 1RJ8A 4SLIA 2C1FA 3GALA 4XF3A 2I45A 5FLHA 2WNVB 4J6GA 3WINE 2ZCWA 1EAH2 1W6OA 5ACA1 5GZGA 4INDA 1RMU3 2WZR3 1GICA 3JBG1 5I93A 1QQP1 2ZGSA 2HWE2 4H14A 4K9SA 3NV3A 1Q8SA 1OQ1A 3P3NA 3USSA 1YLLA 2NM1A 3INAA 3OGJA 3RJRA 1WD3A 2ZX4A 2NLRA 4I0WB 3O0VA 2YPJA 2IWGB 2A6ZA 4X6QB 3AMQA 2D6PA 1BJQA 1O3TA 2A7AA 1YYNA 2BFUS 5A33A 1A8MA 3B7MA 2BUKA 1PO21 3MIBA 4FSJA 4C0BA 2VW0A 4Y1ZA 5ABJB 1VLNA 1EY2A 1VRH1 5BV6A 3ZMOA 4N9HA 3MPBA 4GWNA 1QJU3 1N3PA 4Z07A 2QDNA 4QT6A 3JD73 3ELNA 5TSWA 2ZS6B 3ST7A 1MACA 4XQWA 2XVKA 2R042 1QF3A 3MYXA 3U10A 1W6MA 5C33A 5JPNB 1BYHA 1S0EA 1Z78A 5AFEA 3WXPA 2WS93 4YZ4A 1SLBA 1R1A3 1D4M1 4LBNA 3WG4A 3A0NA 1NCRA 2Y0IA 3OBTA 2ZPXA 3FBMA 1ZBA1 2A70A 5JIUA 3J8F2 2HEVF 3POWA 4Q4V3 1VALA 2JICA 2HWB1 2EXJA 2ATFA 1KJRA 1DZRA 1NZCA 1AR83 1IHMA 2B8MA 4D7YA 1DBNA 2DTWA 4CDXB 4B4RA 3RYKA 4FOQA 4QPGB 2EIGA 5J3UA 1MEC3 4JGYB 4YGCA 1HQNA 1YJKA 3H1WA 4AQTA 3WG2A 3X29B 1M06G 1G86A 4B7KA 1SEFA 4Y20B 1U12A 2GNDA 3AZWA 3WUDA 4YM2A 2PYTA 4S2HA 3ZSJA 2BBVA 2D6MA 4L11A 2X5IB 4XPVA 1F31A 1N3OA 5EWSA 1RUOA 1W6OB 3D6EA 4Q4X2 4XJWA 2P34A 4ASMB 2RR12 4Q0PA 1W6QB 1LOFA 2CAVA 1YUDA 2QUOA 1LOBA 2EXKA 2NZ9A 4IEYA 4QXKA 1CJPA 3THTA 1PGL1 5I0SA 1SMVA 4JRLA 4AEJA 3TN92 3Q9OA 1VJ2A 3FHIB 2YUEA 1CPNA 3N36A 1S2KA 5CFCC 3WZ1A 1LHWA 3AYAA 5HCBA 5AVPA 1PZ9A 1OLRA 4P9LA 1DYPA 3DN7A 4P9YA 1IGOA 2WFF1 4WM7A 5CADA 1CAXA 3M7AA 2EVXA 3ZN6B 5A3LA 4ATEA 4YW5A 3TB0A 4YLZA 1OQEA 3RYRA 1E57A 1LGBA 1CJDA 2VH9A 4GH4A 4ATFA 1AF9A 1VAVA 3LWCA 3ZMNA 3AP6A 1QOOA 5IUQA 3ZFGB 4BIOA 1U5IA 4YVSB 3E5QA 4I09A 2CL2A 1CESA 4XJ9A 3I2DA 4F7ZA 1LHNA 5JOZA 4CP1A 1GQHA 2ETEA 1QXJA 1NE4A 1YHFA 3WR0A 3MZHA 1DF0A 1UX6A 4I3PA 1FPN2 4XFGA 4RSUA 1J59A 1M4WA 3VV1A 3E6CC 1L3JA 5JLVA 5GLZA 1X8EA 1QMJA 5KHKA 1YXWA 3VZKA 4CEWB 4KH9A 2NP0A 2HWC2 1RUH3 2VVEA 2A3XA 1DU3D 3WW2A 1AZDA 1QU0A 2UWBA 5IK8A 2F4PA 4Q0VA 3THPA 2LALA 3G6JB 3WY6A 1PZ8A 1RHI2 5FPXA 1VBE1 4MGIE 4PBPA 2DVAA 3U4XA 1QHDA 2ERFA 2VUJA 3H9AA 4BE3A 3GZUC 1YFYA 2VOVA 2XGXA 2GMEA 4FPCA 5T5PA 1NXMA 4KWJA 1BKZA 3RPQA 5CFCA 5E8AA 3GHMA 2H6CA 4V1PA 1UIJA 2VQ0A 2GNTA 3TAYA 3VBRC 1K5MC 4QPIC 4MGYE 4RS5A 3H1YA 1JUIA 3GZTB 1R1ZA 4Q1PA 3UL2A 1ZZ9A 4GWMA 5C4WB 5GZFA 3AZZA 1NXD1 2BVBA 1WMFA 1HV1A 1CAXB 1XU1A 3QH6A 4HPKA 1VBD2 2DFBA 5K8SA 4YYOA 4RQPB 1KQRA 5GKAC 1NA1C 3H8UA 4YFZA 2SLIA 4LBQD 2E9QA 2JDZA 3WDXA 3CLPA 3QBQA 2OPKA 2HWD2 1HKDA 2JG9A 1UPIA 1LOEA 4CDWB 1KJLA 3LSDA 1JYIA 2AZ5A 2GAUA 4C91A 5H9RA 1ENXA 1REFA 5BXXA 2OZJA 4FTBA 4FPJA 3AB0A 4LHNA 1LHUA 3AYDA 1SLIA 2D43A 3JCIA 4JDNA 1ZRDA 1AX1A 1V6JA 3ZO0B 1AR63 1WMDA 2B45X 2E7QA 3ZSLA 3TBDA 3OCPA 1COV1 2ZAHA 2HYKA 4FAHA 2DVFA 5JCTA 2WWSA 1Z7S1 5DG1A 3E5XA 4AYUA 3ZSEA 1DQ5A 4AHXA 3WLUA 1IQAA 4YW2A 1OA2A 1U5XA 3RJ2X 1LRHA 2QE3A 2FQPA 5H9PA 3IDBB 3ROUA 4E4DX 1JH5A 1ND2C 4P9GA 4Q4Y3 1ZBE1 1GV9A 2BNOA 3IN9A 4KQ7A 2UWAA 2BQPA 2Q1MA 5FO7B 1TMF1 2VNGA 2A75A 4Z92B 3IPVA 1HQLA 1X82A 2BWCA 5BNPC 3NAPC 3KT4A 2XBO3 3PMSA 3W58A 2H0VA 3WW3A 3KLSA 4WM8C 1TME2 1KRIA 3FLTA 5LEKA 1URXA 4DNYA 3OY8B 4OHWA 2R071 1WCSA 3AXEA 2PLV2 3IDCB 1RUF2 5DXDA 5JI7A 2IFWA 5F1RA 4AEMA 1ZZBA 1LOCA 3H0OA 3VBRA 4XJAA 1DIWA 1K5MA 4QPIA 2FBEA 2D5FA 3WV6A 1GNZA 2ZMKA 1G9BA 5E16A 2XVGA 1ZX5A 2ENRA 1HLCA 4KGGA 1G9AA 1FMD1 3BOPA 1RVF1 2DWRA 3BIWE 2CWSA 1XXNA 1OA4A 4AGGA 4N9IA 2GC1A 1LR5A 4XETA 5DUVA 4C1WA 5ACA2 2R063 1H30A 2D98A 5D8AB 3ZSKA 3JBG2 2LM3A 5FFOC 4TYSA 1QQP2 2BW8A 2CV6A 3ME2A 1NA1A 1N1YA 4XOGA 5JZGC 3ZYGA 3MIFA 4CDUB 1AYM3 4HPKB 3AZVA 4QQLA 4ISQA 2E6VA 4XIKA 2JEMA 1NLRA 1V6OA 4DXZA 1FV2A 2WZR1 3QOPA 1RTVA 1IS6A 1BEV1 2V73A 4A7ZA 4JVAA 1T6GC 1KFUL 2FZ1A 3AKTA 1EV11 1PO22 5FO8B 1F5FA 3ZXLA 4CEYC 1G9CA 3TRSB 1UN1A 4WVWA 1DQ6A 4FOVA 1VRH2 3UJOA 1SCRA 3J26N 1DGWX 3KD4A 4BMEA 1C8M1 4QU2A 4KL1A 2PHLA 2ILMA 3DGTA 3DPRC 3H3UA 1Z0HA 3LB9A 4YM0A 1ND2A 1VR3A 3WCRA 4ZXKA 5I91A 1LCLA 1S2BA 3WDTA 1D4M2 3ZX7A 5CFDC 4AEDB 1QJU1 3HMYA 1OHFA 3TNPB 3VL9A 1MVQA 2CY6A 4XILA 2DCZA 1AVBA 2A6XA 4XMAA 1ZBA2 5BNPA 2RS13 4S2DA 3NAPA 3V0BA 4XXPA 4AFDA 4WM8A 2HWB2 2AGSA 1AX0A 2ET7A 4GB31 1D0HA 1N1VA 3JQXA 4Q29A 5IK7A 1QH7A 2TUNA 2ZX3A 4E4ZA 3KQRA 1AUYA 2QZ2A 4IEXA 1CN1A 2RE9A 3L2HA 2BWAA 5FOJB 3NV1A 4BWOA 5F9TA 4XIOA 1D4VB 4AFBA 3VBRB 4PLNA 4R8HA 4BQ1A 5DDJ1 1AR81 4LO5B 2EXHA 5J37A 1MZ5A 5A3MA 2Y38A 1MEC1 5ABJC 1VBC1 2G4IA 3FX3A 1HV0A 2B42B 2ZTNA 5A32B 4IL7A 2XKPA 5JZGA 1MS1A 2DVDA 5FLIA 4DY3A 4C0HA 3I8TA 4D3WA 3OBRA 4COWA 3ZDSA 3PJYA 4AE2A 3S30A 3GZAA 1NA1B 1ULEA 4DQAA 5C9AC 2R32A 4QGNA 2ZX1A 2RS33 3ZIWA 1PGL2 4W6YA 4XQDA 1PK6B 2GN7A 4KNCA 3LAGA 4YM3A 4LO6B 1R083 1AR71 4B7EA 4XJ8A 3O12A 1XE8A 4BPZA 1H8TB 4P5HA 4LBOA 4JRAA 3GBGA 1HRI3 3MIGA 2WFF2 4NR1A 3HN1A 4RA0A 4ZU4A 4CDXC 4LEJA 4QPGC 1GR3A 4JGYC 5CFDA 4GIQA 5EZWA 2R0FA 2K0GA 1W0PA 1ND2B 5B2GB 1OPOA 4X6RB 4PDWC 4NWVA 1VIWB 4YGEA 2WZPP 5T52A 2H0BA 2X5IC 3V0BB 4OUMA 1YO8A 4N90A 4HKLA 5SV8A 2PHWA 1H9WA 2WA3A 2I2SA 1LULA 2WNEA 4AXOA 2RM23 3M8LA 4PIZA 1RUNA 1H1IA 2PHXA 5CIRA 2RMU3 2F6BA 4JAAA 1HRV3 2JE7A 2Q1ZB 4Q2FA 1ZVFA 4AW7A 2EXIA 3ENRA 1B35B 4TWTA 1UZZA 4TZDA 1WGPA 3LKJA 2AENA 3JB8A 3QH7A 5L19A 3VHNA 5ABJA 1XNBA 2A6VA 1QXRA 4Q26A 2BGCA 1EAH3 1DGLA 2MEV1 4KGQA 2HEWF 2D40A 3ZXAC 3FLRA 1VBA3 4OHYA 4E2QA 2GH8A 2HWE3 2G9GA 5E1RA 3LA2A 4N53C 1D2QA 1VBE2 5JZGB 5C9AA 4BYYA 1RUD3 1MS8A 2ZACA 2WNUB 1RITA 1C5HA 4IEVA 4QGMA 3FUQA 3HT2A 1ZZ6A 1PO13 4DY5A 3ZFGC 1LJ7A 1ASJ1 2UY9A 2WT1A 1GZCA 3AFKA 4KG0A 1FNYA 1FOD3 2VU9A 3ZXKA 4CEYB 4XFCA 3HT1A 2O0OA 3AP9A 4K21A 3SH4A 1BCXA 1O4ZA 3N3HA 4CDXA 1JUHA 1RUJ1 4G3YC 3RRDA 4NPRA 4QPGA 1BMV1 4Q0UA 4JGYA 5F5QA 3ZFEB 5BNOC 3MIDA 1F5JA 2R043 1VB2A 2ZGNA 4C1XA 4HBNA 3W9AA 3HBZA 2MNGA 3DPRB 3EXUA 3DF0A 1RUG1 3NKTA 1D2SA 3O7OA 4N7IA 3VN4A 3RNSA 2ZKLA 1X50A 3RI9A 1PGSA 2VW2A 4QQ2A 3UKNA 4CEWC 2ZGMA 1O3QA 4PDWA 1DYKA 1VB4A 1AR93 4Q27A 4OULA 2D7FA 2X5IA 4XHBA 1N1TA 5E88A 1LOGA 2BFUL 4J1XA 4Q8KA 3DL3A 3M2MA 1WW7A 2Z79A 3ATGA 5DZGA 1KDMA 1W6QA 4EJRA 5CG9A 4QGLA 5DUUA 2PAMA 5CU1A 4M3CE 3W59A 2GNBA 4Z2WA 4EV0A 2RS51 1COV2 1ZZCA 2KA3A 1WW5A 1Z7S2 3AKQA 3M3OA 4LO7A 4BH9A 2K2SA 5GJ6A 3EBRA 4AVVA 4YZ2A 3AP7A 2PHUA 5JWPA 3P3PA 3URFA 4HKOA 2DCJA 1ZBE2 1W0OA 1I3HA 1Q3EA 2NMNA 2VQAA 4AQSA 3VL8A 2VG9A 1TMF2 4Q4X3 3ZN6A 4N53A 3FC0A 4WVVA 1AXZA 4E2GA 5C4WC 1DQ0A 3AP4A 3B69A 3WG1A 4BCUA 3LA3A 5BPXA 1NY71 2DYCA 4XZPA 3CJIC 3NV2A 4Q4Y1 3JU9A 5C9AB 1KS5A 4PBOA 5BNNC 2R072 3ZYJB 4RQPC 3VBUB 1C4RA 5FREA 3ZFGA 1IPKA 1J3QA 4YVSA 3TN93 1HXS3 4WV8A 1X36A 3EQEA 4A3XA 2IXLA 4M3CB 4XF0A 3BODA 1S0DA 4PLOA 1SFNA 3IIAA 4GQ7A 3WD5A 2KXLA 2V09A 3K48A 3UKTA 1UF2C 4CDWC 1XNKA 2PFWA 5AVAA 2HKXA 2HEYF 2WFPA 4A7KA 5JOWA 1FMD2 4UW4A 1RVF2 2CGPA 3N7LA 4DRRA 5K9YA 3JZVA 5KXBA 2DU0A 4MYEA 3GBFA 2R1BA 3RG0A 5BNOA 3I59B 1QDCA 5E89A 5HXVA 4B4PA 2D3PA 3ACLA 4K40A 1CGPA 1LESA 1JYCA 1S0GA 4BZ4A 4FPKA 4MH0E 4CEWA 2IC1A 2P37A 4QMAA 4CDQB 4FTSA 1NYWA 4IESA 1PVC3 4FBFA 1S0FA 1RGSA 2QJVA 4FPEA 4QM9A 3UKVA 1G7YA 3SCGA 3ASIA 1X7NA 4HZFA 2R061 4PDWB 2WZR2 2P3KA 1RC6A 1XQNA 3VHPA 4HLTA 1BEV2 2ET1A 4Q4W1 4Y1VA 4YG6A 1YI7A 3ILNA 1EV12 1FPN3 4Y26A 4PCRA 2ARXA 5CBLA 4WVMB 3WDYA 1IPJA 2D6NA 2KM2A 2VMIA 3DV8A 1QXPA 2GC2A 1C8M2 4PJYA 1ONAA 3ZXDA 2YY1A 5HI0A 4EN6B 2EALA 5C6CA 4YSFA 1CAWB 4AGRA 1DQ1A 4TSVA 1QY4A 5FPZA 1QJU2 4ONUA 5JMCA 3FZ3A 3M70A 2DCTA 4FCAA 2XKOA 1XRUA 5L73A 5C4WA 1QOSA 2EAAA 4P9WA 3SNMA 1Q5OA 2XUMA 4IEWA 1RHI3 3CJIA 4N53B 1YFUA 3AMMA 3IM0A 4DOUA 2ZX2A 3MICA 5D8AC 4GB32 3T1MA 5BNNA 4RGGA 4RQPA 3KSCA 4QX5A 2E53A 2VMHA 2XWBB 5J98B 4XJZA 4CDUC 4OVEA 2RS11 1RUC1 3MLJA 3VBSC 4CDWA 1DGRA 4L2NA 2YHJA 3VBOC 2IZWA 2OYZA 3L9JT 5DDJ2 5LRRA 1AR82 4A7YA 3WQ1A 1XYNA 1RUE3 1ULDA 3ES4A 5DG2A 5GLUA 1MEC2 1ULCA 1VBC2 3FLPA 3R4SA 1IKPA 3ILRA 5GZEA 5BNOB 4ZU5A 1AL21 5AC93 3J9SA 1VBB3 3PHMA 2ZZQA 5D1IA 4K3UA 3FFZA 5JI9A 3NVCA 1S1AA 3TNQA 4AI3A 1NE6A 4H7MA 1ZRFA 3HAGA 1EPZA 4FVVA 2HWD3 4NN0A 5K7PA 2OZ6A 2Z2SB 1POV3 1LENA 2AUYA 3D5OA 2GALA 5LK7B 4OHXA 4RFT0 3S7IA 4AEDC 1Y7BA 2A71A 4IXLA 1LB2A 1XNDA 1H1AA 1G9FA 1V6LA 2IXIA 2XWJB 3WVJA 5KHGA 3CJXA 4KWLA 4IEUA 1AR72 1HX6A 2P3JA 4L99A 1BQPA 1YJLA 2VECA 3PJQA 4IETA 1APNA 1A3KA 4R4ZA 1O5LA 2D97A 3OY8A 1PHMA 4YVWC 4YG3A 2VNOA 5JSOA 4E4SA 4JQRA 3O5SA 1TEIA 4IV1B 3LA7A 1Y43B 3U11A 1UIKA 2SBAA 1H4HA 3CEWA 1WBFA 3AXDA 2ZHLA 2DUQA 5EFUA 1G8WA 4RHV1 2QNKA 2E51A 2W68A 1O5UA 4H3WA 1H8VA 3GHNA 3M3IA 1V70A 4HMZA 4GMP1 2DTYA 1IS4A 3MW3A 5CAZA 4OHVA 1BVP1 2Y0OA 1NQJA 5D8AA 3FJSA 1R093 4K1ZA 3CJIB 1WUVA 4CDUA 4RD7A 1CAUB 1OQDA 4OZXA 5BNNB 4AVSA 5FQ0B 1RUF3 1ULFA 2DUPA 4L97A 3AMHA 3VKLA 3WHTA 3GYDA 4UW5A 3VBSA 4BLJA 5K0UB 3VBOA 4COYA 1MQTB 1QJY1 2CNAA 2WLQA 1TE1B 3KMHA 4FQ4A 4AQ2A 1V9U1 1PK6C 4IV3C 2BPA2 2RM21 1DHKB 2YGMA 1QKQA 2XLAA 2XVLA 4LBLA 2RMU1 1HRV1 1LHVA 5GZDA 2MEV2 5FTTC 5EXOA 1BVVA 1H8TC 3OYWB 4META 2O8QA 3ZIXA 3PNAA 4PLMA 2VOWA 2UWCA 5KBFA 3R4DB 3VHOA 3A4UA 1G6NA 5F6KA 3E97A 4NHLA 1SBEA 4AEDA 1VBA1 1DFQA 3NJZA 1QJX1 3MEPA 1BBT1 4C90A 3VBFC 1OPMA 2DVGA 1ASJ2 2D3SA 2JG8C 1PO23 1V6KA 3VLBB 1RUD1 4HETA 4AVCA 1RB8G 1OA3A 1J3PA 1QDOA 1VRH3 2A6WA