4PJ0E

Structure of t.elongatus photosystem ii, rows of dimers crystal packing
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
AGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein 1
publication title Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
pubmed doi rcsb
molecule tags Oxidoreductase, electron transport
total genus 17
structure length 82
sequence length 82
chains with identical sequence e
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 4pj0E00
5TISE 5GTIE 5B66E 5H2FE 1S5LE 3JCUE 3KZIE 2AXTE 1W5CE 5GTHE 3A0HE 4UB8E 5E79E 5KAFE 4UB6E 5KAIE 5B5EE 3A0BE 4IL6E 3WU2E 4PJ0E
chains in the Genus database with same CATH superfamily
3CPWO 1QLED 5B66E 5C39A 4I6MC 5KAIH 3HUSA 3USSA 1X9VA 3L71G 3RK2B 2P2UA 3WUVA 3CL3D 1JM0A 3GHGB 2B9BA 5KLVD 1SQXJ 1Q2NA 4UB6H 1QVGO 3AE7C 1IFNA 3L35A 2K1AA 1FZAA 4Y28J 5B5EE 2JR8A 3G3ZA 2J58A 2N1TD 3EFFK 1JMMA 3M91A 1RY3A 2WQYC 1PP9J 1GU5A 3MIWA 1KB9E 2ITAA 4JF7A 3KZIH 2GA1A 3L74G 1DX7A 1NTMD 2K9JA 5K5GB 3VMAA 1EDKA 1SLQA 1IK9A 1NTMK 2Q6QA 1R5SA 1NU1E 1KQSO 4PD4I 1DIPA 3H1KD 2YMYA 3VYIA 3V5BA 2AEJA 1QGKB 1KC8Q 3ZDMA 3H1JJ 1SQXD 1S5LE 2E74B 1NTKE 3CXHD 3C8VA 3R4YA 1FZCC 2ZXEB 3HD7B 2BEQD 2KS1B 2C0WA 1KILD 2KIKA 3AEEC 1IFJA 3GF3A 1NJIQ 3BASA 2YXRB 2HODA 1PV3A 1H8AA 1Q82Q 4RESB 2YIUB 1BGYG 5KTBA 1VF5C 5CCHC 1BE3G 1HJBA 4UB8E 2KXPB 1LTAC 2N9YB 1YITP 3CMAP 2QJKB 2KSJA 1ZV8A 1LWUC 4QMAA 2HLOA 2OYIC 1X22A 2RH0A 1YBKA 3H6PA 4OGQC 5H2FE 3OA7A 1SS1A 3BCCJ 3M0DC 3P8MC 4H13C 1NAYA 1S2EA 1N8RQ 1USEA 2LXBA 4N3YB 3RL0D 3ABVC 4PV1D 2WVRA 5CCGC 5BVZA 5AW8B 3GG2A 1FZCA 1SFCB 3Q5PA 4U3FG 4N6JA 5AVQB 2P1JA 3SWKA 2BCCG 2NPSC 1PZQA 1Y8AA 2W6BA 2H8PD 1FZEA 4K3AA 1OVUA 5CCHA 3RK3B 2AXTH 4WWIA 1LT9C 1LWUA 4ZKPA 3JCUE 1YJNP 4JBZA 2Y0CA 1AVOA 5AVVB 1YYCA 1NTZK 1GU4A 3M0DA 4JPZB 2E75B 3GMAA 2KK7A 4L73A 3CCUP 5CCGA 3E7KA 3RK2C 1N86A 1VQNP 4M3LA 1SQBJ 3GHGC 4HB1A 2L91A 1KZUB 3NXSA 2KYVA 3FWLA 4HYTB 1Q90D 2H88C 2NPSA 2AEMA 1KMIZ 3IF4A 2GUVA 3PJSK 3U1CA 1DEEG 3HRNA 3VP8A 1LT9A 5AW4B 3WU2H 1KQLA 1N73B 4L76A 3L72E 4UB6E 1KQFB 1EZVE 3O8ZA 3FGAD 3L75G 4C7NB 4ASVA 1FOSF 1SQPJ 4EI2A 1BCCE 4GT1A 3I55P 1GL2B 1KTMA 4EOTA 2WPRA 4TLFA 2L5GB 1VQ4P 1FDOA 1GW4A 3GHGA 4IL6X 2H43A 4W7YA 1G1JA 5KLVG 4NPFX 2Y0EA 1OVRA 2WPQA 3H1IJ 2E74C 1T2KC 1L4AB 2P58A 2FYUE 1BDDA 3HD7C 2FKWB 3V6IA 3V4QA 1LNQA 2ZYDA 1E79H 4ZKUA 5B5EH 2YIUC 2WTYA 1Q86Q 1VQ9P 2NRGA 5KJ7C 1G2CB 3Q1MA 2E76B 1IJDB 1S72P 1EDJA 3CLQA 5M1BA 1KYOD 2QJYB 4IFMA 1DH3A 3H1KG 1NU1J 2KB7P 1XTCC 1S9KE 1VF5D 5CCHD 1SQXG 2QIWA 2CK3H 3GF7A 2IFNA 1NVOA 4A7PA 1PPJD 1SFCC 3B71A 3H1ID 1NYHA 3HD7A 2KS1A 1LTGC 2ZYAA 1NTKJ 5AVYB 4OGQD 2WPVB 3L73J 3MZWB 4H13D 1S5LH 2Y9ZA 2R5DA 3PLNA 3WMM0 3RK3C 1NTZE 5CCGD 5KJ7A 5AVRB 2KUBA 2XU6A 4Y99B 2WITA 2KZIA 2JWDA 5TJHA 2CPSA 1OW6A 2IYPA 1YQ4C 2NPSD 2A45I 2E75C 2O01J 1EDIA 5KAFH 2RKLA 3CWBJ 3CCQP 2W83C 1SFCA 2Q5UA 2LXCB 3C9IA 5H2FH 3P32A 5APXA 3CCSP 3CX5D 1HWTC 1J1DB 2JWAA 1Y47A 2KSEA 1M57D 1SQQJ 1VQPP 3L73D 3PP5A 1UIXA 4NPDA 2YKQA 3RK2D 1GZLA 3AEDC 1URQB 3L71E 1NKZB 1SQVD 1L0LJ 4EDFA 1N73C 2E43A 3PRJA 1PL5A 4CPGA 1M8OB 4D6TJ 5CJ4A 1VQLP 4Z1MH 1N2DC 1K05A 1GW3A 1BSNA 1JCDA 2GUSA 3CD6P 3FWNA 1GL2C 1QL1A 5EFWB 3BCCG 5APVA 3H25A 2P10A 3CWBD 2R44A 3V2PA 1MFTA 1U7JA 4W80A 3CCLP 1K04A 2YKOA 1KB9I 2HFED 1KD1Q 3CC4P 5APUA 3A0HH 5AVXB 1KQGB 1SQQD 3L74E 3AE4C 2JJLA 3RBXA 3L70J 5AW3B 2VRSA 1N73A 2LKMA 2B88A 3AECC 3Q3DA 3CC7P 3M9HA 4H44B 1L0LD 4C7NA 1ZMEC 2G3AA 1P84D 4YXDC 3VMZA 2J5UA 4D6TD 1IC2A 2E74D 2IFMA 1T2KD 3L72J 1VPCA 1JY3O 2W90A 3JC22 1GL2A 1LJ2A 3CX5I 2E76C 1CI6B 2QM7A 1H88A 3MTUE 3HD7D 4IFDK 2QJYC 5KLVK 1BCCJ 1R8EA 3CI9A 2A06G 1RH5B 2WSSH 4N78E 1VQ8P 1RQVA 3MHVA 5KJ7D 1ZRTD 1J2JB 2I1KA 1BGYE 5CBNA 1BE3E 1GTWA 2NZ2A 2FBWC 3CXHH 2V7QH 2RN0A 2YO3A 3F89A 1NH4A 2B89A 3L70D 2P67A 4YTPC 3II6A 2FYUJ 3G71P 5AW0B 1G2CA 1ZR2A 4Y99C 2FXPA 1OVVA 4XA4A 1RF1C 1SFCD 5TISH 1GK4A 4BRYB 1N7SD 4U3FE 2C9LY 2IZ0A 4DCKA 5GTHE 1SQXK 3S4RA 2BCCE 3RK3D 1MFZA 1ZP0C 3HE4A 2WT7B 1MZ9A 1CZQA 4JYCA 1PPJG 1JY2O 2QJPB 3H1IG 4L74A 4YXWH 2HPCB 1PP9D 1P84I 1J1DC 3V4WA 2D2CB 3W67A 2E75D 1IFPA 5KAFE 2KNCB 5APQA 2IBZD 4R4LA 4WY4D 3OJAB 3A5TA 1Y9BA 3R2PA 1URQC 1RF1A 1K73Q 1YTZT 3CCVP 4KJMA 1NTZJ 1FS0E 2OYHB 3TGUJ 1ZN5A 4EIJA 2MJZA 3H1JD 4PD4E 1L0NJ 4EYYQ 4OVNF 5CMZA 3P8CE 2OQQA 4JYBA 3FX0A 3IFMA 2FXOA 2JO1A 1IZNB 3H1LE 3L75E 1EZVI 1NTKG 1FZGA 1GL2D 1FC2C 3KHUA 1AJYA 3L73G 1URQA 2OYIA 2QSIA 2Q1KA 2WZ7A 1EDLA 2YNYA 5AVWB 1SQVG 2PGDA 1RQUA 1VL2A 4H44C 2W8ZA 1AVYA 3L71J 4GOEA 3BCCD 4RKUJ 5KLVE 5AVSB 3TGUD 3A0HE 1T8ZA 4ASWA 1ZOYC 2YKPA 5CHXA 3HTKB 3AE9C 1RE4C 1OZHA 1OIPA 2WPSA 5BU8B 3CC2P 1EXIA 1JTHB 1L0ND 3CWBG 3VP9A 2IBZI 5AVUB 3M9QA 2UWJE 1XTGB 1Z56A 3W68A 1M1KQ 3FXDA 2ZFCA 2M3BA 3H1HJ 3TDKA 1ZLLA 5KLIB 2E76D 2OYOA 1VQ7P 2WSEJ 1WRGA 1SQQG 3G4SP 1NTME 2YXQB 1VQ5P 1UIIA 2ZJSE 2WSEH 3L74J 1NAFA 1CW5A 2ZXXA 3E1IA 1JCCA 2HR3A 1NGMB 1L0LG 3H1KE 1HVVA 1LTTC 1JO5A 4MN4C 4D6TG 1X8YA 1CI6A 2KLUA 3TNUB 2FFDB 1SQXE 5DJUB 4C7RA 2A06D 1RE4A 1SQBD 3SFEC 3CXHE 2XV5A 1GD2E 1LTJB 3AE5C 1RHZB 3KXDA 3KYQA 1KILE 1KYOH 2Q3IA 1HGZA 4B86A 3D70A 1HGVA 2B87B 5TISE 1GMJA 3H1HD 3EQ2A 1MKMA 1T6AA 2QJPC 2OTKE 2M8RA 4H0LB 2HG5D 2D2CC 2E42A 3SWYA 4WB4A 1BE3J 3ITKA 3L70G 2QJKC 3A2AA 5AW7B 1DD4A 1SQPD 3EFGA 1VQKP 3TSIA 2P7JA 1W5CE 4ZMDA 1JY3N 3L72G 3G6EP 2OYHC 2WMMA 2OTJP 3A3YB 2R3SA 4BRYA 1IFDA 1AQ5A 2M0BA 4HKZH 5KKZB 3VTPC 4L75A 4U3FJ 1URQD 5AW5B 3B8EB 2WT7A 3F5HA 2HPCA 1T3JA 2IDBA 3VN0A 1PP9G 2XDJA 5GTHH 2ZT9B 1FJKA 3Q2YA 1LT1A 2KNCA 1KB9D 3WUTA 1Q81Q 2IBZG 3T97B 2FYUG 1M1JB 3SWFA 2R32A 3IAOA 2FY8A 4IOIH 4IFFA 4OH8B 2OYHA 3M9BA 3L4FA 4I1LA 4DOJA 1NU1D 4GIFA 5CBOA 3GW6A 3AE2C 4PJ0H 1YIJP 1NU1K 3H1JG 3O6QB 1X79B 2ZAEB 2YMKA 1S5LX 2Y0DA 1GK6A 1PFIA 1NTKD 4H44D 1JY2N 1NTKK 2R5BA 4PD4H 5APWA 1K9MQ 2ZVNB 5KLIC 1PIXA 3H32B 1OX3A 3S1KA 3B5NB 1JY3P 3H1LJ 3L75J 1SQVK 2QRXA 1WT6A 2WSFJ 4I2LC 1QEXA 1DD3A 3AEBC 2WSFH 1NKNA 1T3UA 5BU5A 1NO4A 1ZW0A 4IL6E 2N9BA 1JOCA 2Q9IA 3TGUG 2FFDC 1TU3F 3HTKA 2W6AA 3VMXA 1YI2P 3MD0A 2KLVA 3I56P 3B4SA 1JTHA 1FJPA 1EQ7A 1L0NG 1LTJC 1H89A 1HTLC 1YQ3C 1W2EA 2M5AB 1L4AC 4AUWA 2I8DA 3BATA 2O01N 3M0AA 1SQQK 3S9OA 3LW5H 4GDOA 3CMEP 3A7OA 4H0LC 2JEEA 2AXCA 2BEZF 3V2QA 1VQOP 1L0LK 1A02J 1Q7YQ 1NTMJ 1YHQP 1KYOE 3C1LA 3TF5A 1W2BO 1HUCA 1J1EB 3TNUA 2FFDA 3H1KJ 1LP1B 4YPCA 3WUUA 1IO4A 1SQBG 1PPJE 2D2CD 3H1IE 1JY2P 1HBWA 1LTJA 5DJTB 1KN7A 1L4AA 2V7QJ 3D6ZA 5KKZC 2A45G 1HH0A 2B87A 1PGPA 3CCJP 3QH9A 2BASA 3E1RA 2KI7B 3H1HG 3RBZA 2ZT9C 3G9RA 2C9NY 3BVHA 3A0BH 1YJWP 3QWOC 3Q5RA 3IR9A 4RJTA 3EWKA 3AEAC 2FYNB 3L72D 1EZVD 1SQPG 1M1JC 1GDTA 1EXJA 2J59M 5GTIE 1LTBC 2R3CA 2GM4A 1DEBA 4U7JA 1JUNA 1BCCD 3MP7B 1SP4A 5AW2B 5AVTB 3CX5E 2W6JH 4C46A 2K37A 2O1KA 3L36A 4NPEA 1LGHB 3L73E 4KT0J 2Z4EA 2XZRA 2IX7C 3FXEA 4AQRD 2QVAA 1SQVE 2FYUD 1FBMA 4PJ0E 2FYUK 5E79H 2N1TB 3SSUA 1BSHA 3T97A 3KQGA 1M1JA 3B5NC 4KHXA 1R5LA 1H0TB 3L37A 3IN6A 2PRRA 2PFXA 1VQMP 3CWBE 3CCRP 1NU1G 1HJ0A 1VQ6P 3O6QA 5APYA 3P7KA 3PHLA 4DZOA 1ZXGA 1S9KD 1FAVA 1LTSC 1AQTA 1SQQE 2M3EA 1NHLA 3HE5B 2G8YA 3CCMP 2E5TA 1NOHA 4GODA 1N7SB 3N4XA 2Z5HA 2Y9YA 3H32A 2K9YA 1L0LE 3OAKA 1WMKA 5APTA 4DJGA 3B5NA 1OMIA 1P84E 2W27A 4D6TE 2H89C 1QX8A 4DT0A 4HJGH 1KILB 1NTZD 4HH2A 1G1IA 1RF0C 2K88A 2O3JA 1L4AD 3TYYA 3CXHI 1S3JA 3KPEA 1FZFA 1M56D 1J1EC 2YO2A 2Q7CA 1PGQA 2H7HA 4WY4B 1KFNA 1N7LA 4WVZA 4H0LD 1L0NK 1ZRTE 3UIAA 2WSCJ 3M06A 4OWFA 4LGDE 1LTIC 1FOSE 1MV8A 1CSBA 2M5AA 2WSCH 4IL6H 4WBAA 1JB0J 3AE6C 4I7ZB 2SPZA 3RL0B 5KAIE 1K8AQ 4PV1B 3L70E 2KOGA 1HF9A 2A45H 2E5YA 4O9BA 1RE3C 1FU1A 1RF0A 1NWQA 3L71D 3H1LG 3HUSB 2FYNC 3MUDC 3NMDA 1M90Q 3I5CA 1A02F 1SQBK 3RK3E 1LP1A 5B66H 2ZT9D 3AE3C 1OW8A 2V4HA 3A0BE 2C0XA 1PGOA 1PP9E 1OWAA 1U7MA 3JSVC 3KZIE 2XNDH 2JP3A 2JKVA 2IYOA 4LLHA 1U57A 3Q5SA 2ZYGA 1USDA 2IBZE 1BGYJ 3V2RA 2XNXA 1E5WA 1JMBA 1RE3A 2XKMA 3L74D 1FE6A 4JQ0D 5AW9B 1QL2A 3MUDA 1QVFO 2K9JB 1SQPK 2IPPA 2N1TC 2KP8A 2DW3A 2QA4P 2FYZA 3NTNA 1EZVG 2HYNA 2PP6A 1NTMG 3H1JE 2Q3EA 2PAJA 1KB9H 2QE7H 1AV1A 2K3RA 3D6YA 4AYCA 3TK1A 1YJ9P 1BCCG 2AEFA 3U59A 5E79E 5GTIH 2BCCJ 3B5ND 5AW1B 3GLMA 1X0TA 4N78D 3AEFC 3HE4B 4K35A 3BRVB 4TT3H 2Z5IA 3CX5H 2HODB 1BGYD 1YTZI 2WWWA 1BE3D 1ZR4A 3LIEA 1FZBA 5AVZB 1N7SC 1SVFA 2ZVOB 2N1TA 1KFMA 3OW2O 3BCCE 1SQVJ 3LIDA 4GKGA 3TGUE 4R4MA 1AFOA 1H0TA 1RF1B 1KILC 2FXMA 3PH0A 4W7ZA 2RMZA 3AEGC 1BDCA 3RGUA 1IK7A 3MGNA 1L0NE 2O1JA 3VMYA 2OTLP 2CPBA 4UB8H 3D71A 3VOPA 1FZCB 4U3FD 2AXTE 2O01H 4WY4C 1D7MA 1PGJA 2KZJA 3V2NA 2BCCD 1S1CX 3HE5A 3KDPB 3BRTB 3AE1C 2MKVA 4I7ZC 1JEKA 1N7SA 1FDMA 4LC1A 1VF5B 3RL0C 2LR2A 4PV1C 3U1AA 5CJ0A 2POHA 1FDIA 1KYOI 2JDIH 1LWUB 2QM8A 3SFDC 2OYIB 1KILA 3AE8C 4BWNA 3N7NA 4RO0A 1L2PA 4OGQB 1MUUA 4H13B 1NTZG 2A06E 3HUSC 1SQBE 2IZ1A 3PTZA 2QG4A 1P84H 1VDFA 5KLVJ 1KORA 4WY4A 1JNMA 1OXZA 3JCUH 1OW7A 4BXLA 2QEXP 1S4XA 1IFMA 2OGUA 1OFCX 3WU2E 3CCEP 3LW5J 1AA0A 3H1HE 2NPSB 4PD4D 4XE5B 4XFJA 3RL0g 4GOFA 3P8CD 4ZNCA 1M7LA 5L8RJ 1LT9B 5AW6B 3NFQA 1IFIA 3K5BA 2OARA 2I1JA 3H1LD 3L75D 1EC5A 1SQPE 1KV4A 5APSA
chains in the Genus database with same CATH topology
5TISE 5GTIE 5B66E 5H2FE 1S5LE 3JCUE 3KZIE 2AXTE 1W5CE 5GTHE 3A0HE 4UB8E 5E79E 5KAFE 4UB6E 5KAIE 5B5EE 3A0BE 4IL6E 3WU2E 4PJ0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS E;  5GTI E;  5B66 E;  5H2F E;  1S5L E;  3JCU E;  3KZI E;  2AXT E;  1W5C E;  5GTH E;  3A0H E;  4UB8 E;  5E79 E;  5KAF E;  4UB6 E;  5KAI E;  5B5E E;  3A0B E;  4IL6 E;  3WU2 E;  4PJ0 E; 
#chains in the Genus database with same CATH topology
 3CPW O;  1QLE D;  5B66 E;  5C39 A;  4I6M C;  5KAI H;  3HUS A;  3USS A;  1X9V A;  3L71 G;  3RK2 B;  2P2U A;  3WUV A;  3CL3 D;  1JM0 A;  3GHG B;  2B9B A;  5KLV D;  1SQX J;  1Q2N A;  4UB6 H;  1QVG O;  3AE7 C;  1IFN A;  3L35 A;  2K1A A;  1FZA A;  4Y28 J;  5B5E E;  2JR8 A;  3G3Z A;  2J58 A;  2N1T D;  3EFF K;  1JMM A;  3M91 A;  1RY3 A;  2WQY C;  1PP9 J;  1GU5 A;  3MIW A;  1KB9 E;  2ITA A;  4JF7 A;  3KZI H;  2GA1 A;  3L74 G;  1DX7 A;  1NTM D;  2K9J A;  5K5G B;  3VMA A;  1EDK A;  1SLQ A;  1IK9 A;  1NTM K;  2Q6Q A;  1R5S A;  1NU1 E;  1KQS O;  4PD4 I;  1DIP A;  3H1K D;  2YMY A;  3VYI A;  3V5B A;  2AEJ A;  1QGK B;  1KC8 Q;  3ZDM A;  3H1J J;  1SQX D;  1S5L E;  2E74 B;  1NTK E;  3CXH D;  3C8V A;  3R4Y A;  1FZC C;  2ZXE B;  3HD7 B;  2BEQ D;  2KS1 B;  2C0W A;  1KIL D;  2KIK A;  3AEE C;  1IFJ A;  3GF3 A;  1NJI Q;  3BAS A;  2YXR B;  2HOD A;  1PV3 A;  1H8A A;  1Q82 Q;  4RES B;  2YIU B;  1BGY G;  5KTB A;  1VF5 C;  5CCH C;  1BE3 G;  1HJB A;  4UB8 E;  2KXP B;  1LTA C;  2N9Y B;  1YIT P;  3CMA P;  2QJK B;  2KSJ A;  1ZV8 A;  1LWU C;  4QMA A;  2HLO A;  2OYI C;  1X22 A;  2RH0 A;  1YBK A;  3H6P A;  4OGQ C;  5H2F E;  3OA7 A;  1SS1 A;  3BCC J;  3M0D C;  3P8M C;  4H13 C;  1NAY A;  1S2E A;  1N8R Q;  1USE A;  2LXB A;  4N3Y B;  3RL0 D;  3ABV C;  4PV1 D;  2WVR A;  5CCG C;  5BVZ A;  5AW8 B;  3GG2 A;  1FZC A;  1SFC B;  3Q5P A;  4U3F G;  4N6J A;  5AVQ B;  2P1J A;  3SWK A;  2BCC G;  2NPS C;  1PZQ A;  1Y8A A;  2W6B A;  2H8P D;  1FZE A;  4K3A A;  1OVU A;  5CCH A;  3RK3 B;  2AXT H;  4WWI A;  1LT9 C;  1LWU A;  4ZKP A;  3JCU E;  1YJN P;  4JBZ A;  2Y0C A;  1AVO A;  5AVV B;  1YYC A;  1NTZ K;  1GU4 A;  3M0D A;  4JPZ B;  2E75 B;  3GMA A;  2KK7 A;  4L73 A;  3CCU P;  5CCG A;  3E7K A;  3RK2 C;  1N86 A;  1VQN P;  4M3L A;  1SQB J;  3GHG C;  4HB1 A;  2L91 A;  1KZU B;  3NXS A;  2KYV A;  3FWL A;  4HYT B;  1Q90 D;  2H88 C;  2NPS A;  2AEM A;  1KMI Z;  3IF4 A;  2GUV A;  3PJS K;  3U1C A;  1DEE G;  3HRN A;  3VP8 A;  1LT9 A;  5AW4 B;  3WU2 H;  1KQL A;  1N73 B;  4L76 A;  3L72 E;  4UB6 E;  1KQF B;  1EZV E;  3O8Z A;  3FGA D;  3L75 G;  4C7N B;  4ASV A;  1FOS F;  1SQP J;  4EI2 A;  1BCC E;  4GT1 A;  3I55 P;  1GL2 B;  1KTM A;  4EOT A;  2WPR A;  4TLF A;  2L5G B;  1VQ4 P;  1FDO A;  1GW4 A;  3GHG A;  4IL6 X;  2H43 A;  4W7Y A;  1G1J A;  5KLV G;  4NPF X;  2Y0E A;  1OVR A;  2WPQ A;  3H1I J;  2E74 C;  1T2K C;  1L4A B;  2P58 A;  2FYU E;  1BDD A;  3HD7 C;  2FKW B;  3V6I A;  3V4Q A;  1LNQ A;  2ZYD A;  1E79 H;  4ZKU A;  5B5E H;  2YIU C;  2WTY A;  1Q86 Q;  1VQ9 P;  2NRG A;  5KJ7 C;  1G2C B;  3Q1M A;  2E76 B;  1IJD B;  1S72 P;  1EDJ A;  3CLQ A;  5M1B A;  1KYO D;  2QJY B;  4IFM A;  1DH3 A;  3H1K G;  1NU1 J;  2KB7 P;  1XTC C;  1S9K E;  1VF5 D;  5CCH D;  1SQX G;  2QIW A;  2CK3 H;  3GF7 A;  2IFN A;  1NVO A;  4A7P A;  1PPJ D;  1SFC C;  3B71 A;  3H1I D;  1NYH A;  3HD7 A;  2KS1 A;  1LTG C;  2ZYA A;  1NTK J;  5AVY B;  4OGQ D;  2WPV B;  3L73 J;  3MZW B;  4H13 D;  1S5L H;  2Y9Z A;  2R5D A;  3PLN A;  3WMM 0;  3RK3 C;  1NTZ E;  5CCG D;  5KJ7 A;  5AVR B;  2KUB A;  2XU6 A;  4Y99 B;  2WIT A;  2KZI A;  2JWD A;  5TJH A;  2CPS A;  1OW6 A;  2IYP A;  1YQ4 C;  2NPS D;  2A45 I;  2E75 C;  2O01 J;  1EDI A;  5KAF H;  2RKL A;  3CWB J;  3CCQ P;  2W83 C;  1SFC A;  2Q5U A;  2LXC B;  3C9I A;  5H2F H;  3P32 A;  5APX A;  3CCS P;  3CX5 D;  1HWT C;  1J1D B;  2JWA A;  1Y47 A;  2KSE A;  1M57 D;  1SQQ J;  1VQP P;  3L73 D;  3PP5 A;  1UIX A;  4NPD A;  2YKQ A;  3RK2 D;  1GZL A;  3AED C;  1URQ B;  3L71 E;  1NKZ B;  1SQV D;  1L0L J;  4EDF A;  1N73 C;  2E43 A;  3PRJ A;  1PL5 A;  4CPG A;  1M8O B;  4D6T J;  5CJ4 A;  1VQL P;  4Z1M H;  1N2D C;  1K05 A;  1GW3 A;  1BSN A;  1JCD A;  2GUS A;  3CD6 P;  3FWN A;  1GL2 C;  1QL1 A;  5EFW B;  3BCC G;  5APV A;  3H25 A;  2P10 A;  3CWB D;  2R44 A;  3V2P A;  1MFT A;  1U7J A;  4W80 A;  3CCL P;  1K04 A;  2YKO A;  1KB9 I;  2HFE D;  1KD1 Q;  3CC4 P;  5APU A;  3A0H H;  5AVX B;  1KQG B;  1SQQ D;  3L74 E;  3AE4 C;  2JJL A;  3RBX A;  3L70 J;  5AW3 B;  2VRS A;  1N73 A;  2LKM A;  2B88 A;  3AEC C;  3Q3D A;  3CC7 P;  3M9H A;  4H44 B;  1L0L D;  4C7N A;  1ZME C;  2G3A A;  1P84 D;  4YXD C;  3VMZ A;  2J5U A;  4D6T D;  1IC2 A;  2E74 D;  2IFM A;  1T2K D;  3L72 J;  1VPC A;  1JY3 O;  2W90 A;  3JC2 2;  1GL2 A;  1LJ2 A;  3CX5 I;  2E76 C;  1CI6 B;  2QM7 A;  1H88 A;  3MTU E;  3HD7 D;  4IFD K;  2QJY C;  5KLV K;  1BCC J;  1R8E A;  3CI9 A;  2A06 G;  1RH5 B;  2WSS H;  4N78 E;  1VQ8 P;  1RQV A;  3MHV A;  5KJ7 D;  1ZRT D;  1J2J B;  2I1K A;  1BGY E;  5CBN A;  1BE3 E;  1GTW A;  2NZ2 A;  2FBW C;  3CXH H;  2V7Q H;  2RN0 A;  2YO3 A;  3F89 A;  1NH4 A;  2B89 A;  3L70 D;  2P67 A;  4YTP C;  3II6 A;  2FYU J;  3G71 P;  5AW0 B;  1G2C A;  1ZR2 A;  4Y99 C;  2FXP A;  1OVV A;  4XA4 A;  1RF1 C;  1SFC D;  5TIS H;  1GK4 A;  4BRY B;  1N7S D;  4U3F E;  2C9L Y;  2IZ0 A;  4DCK A;  5GTH E;  1SQX K;  3S4R A;  2BCC E;  3RK3 D;  1MFZ A;  1ZP0 C;  3HE4 A;  2WT7 B;  1MZ9 A;  1CZQ A;  4JYC A;  1PPJ G;  1JY2 O;  2QJP B;  3H1I G;  4L74 A;  4YXW H;  2HPC B;  1PP9 D;  1P84 I;  1J1D C;  3V4W A;  2D2C B;  3W67 A;  2E75 D;  1IFP A;  5KAF E;  2KNC B;  5APQ A;  2IBZ D;  4R4L A;  4WY4 D;  3OJA B;  3A5T A;  1Y9B A;  3R2P A;  1URQ C;  1RF1 A;  1K73 Q;  1YTZ T;  3CCV P;  4KJM A;  1NTZ J;  1FS0 E;  2OYH B;  3TGU J;  1ZN5 A;  4EIJ A;  2MJZ A;  3H1J D;  4PD4 E;  1L0N J;  4EYY Q;  4OVN F;  5CMZ A;  3P8C E;  2OQQ A;  4JYB A;  3FX0 A;  3IFM A;  2FXO A;  2JO1 A;  1IZN B;  3H1L E;  3L75 E;  1EZV I;  1NTK G;  1FZG A;  1GL2 D;  1FC2 C;  3KHU A;  1AJY A;  3L73 G;  1URQ A;  2OYI A;  2QSI A;  2Q1K A;  2WZ7 A;  1EDL A;  2YNY A;  5AVW B;  1SQV G;  2PGD A;  1RQU A;  1VL2 A;  4H44 C;  2W8Z A;  1AVY A;  3L71 J;  4GOE A;  3BCC D;  4RKU J;  5KLV E;  5AVS B;  3TGU D;  3A0H E;  1T8Z A;  4ASW A;  1ZOY C;  2YKP A;  5CHX A;  3HTK B;  3AE9 C;  1RE4 C;  1OZH A;  1OIP A;  2WPS A;  5BU8 B;  3CC2 P;  1EXI A;  1JTH B;  1L0N D;  3CWB G;  3VP9 A;  2IBZ I;  5AVU B;  3M9Q A;  2UWJ E;  1XTG B;  1Z56 A;  3W68 A;  1M1K Q;  3FXD A;  2ZFC A;  2M3B A;  3H1H J;  3TDK A;  1ZLL A;  5KLI B;  2E76 D;  2OYO A;  1VQ7 P;  2WSE J;  1WRG A;  1SQQ G;  3G4S P;  1NTM E;  2YXQ B;  1VQ5 P;  1UII A;  2ZJS E;  2WSE H;  3L74 J;  1NAF A;  1CW5 A;  2ZXX A;  3E1I A;  1JCC A;  2HR3 A;  1NGM B;  1L0L G;  3H1K E;  1HVV A;  1LTT C;  1JO5 A;  4MN4 C;  4D6T G;  1X8Y A;  1CI6 A;  2KLU A;  3TNU B;  2FFD B;  1SQX E;  5DJU B;  4C7R A;  2A06 D;  1RE4 A;  1SQB D;  3SFE C;  3CXH E;  2XV5 A;  1GD2 E;  1LTJ B;  3AE5 C;  1RHZ B;  3KXD A;  3KYQ A;  1KIL E;  1KYO H;  2Q3I A;  1HGZ A;  4B86 A;  3D70 A;  1HGV A;  2B87 B;  5TIS E;  1GMJ A;  3H1H D;  3EQ2 A;  1MKM A;  1T6A A;  2QJP C;  2OTK E;  2M8R A;  4H0L B;  2HG5 D;  2D2C C;  2E42 A;  3SWY A;  4WB4 A;  1BE3 J;  3ITK A;  3L70 G;  2QJK C;  3A2A A;  5AW7 B;  1DD4 A;  1SQP D;  3EFG A;  1VQK P;  3TSI A;  2P7J A;  1W5C E;  4ZMD A;  1JY3 N;  3L72 G;  3G6E P;  2OYH C;  2WMM A;  2OTJ P;  3A3Y B;  2R3S A;  4BRY A;  1IFD A;  1AQ5 A;  2M0B A;  4HKZ H;  5KKZ B;  3VTP C;  4L75 A;  4U3F J;  1URQ D;  5AW5 B;  3B8E B;  2WT7 A;  3F5H A;  2HPC A;  1T3J A;  2IDB A;  3VN0 A;  1PP9 G;  2XDJ A;  5GTH H;  2ZT9 B;  1FJK A;  3Q2Y A;  1LT1 A;  2KNC A;  1KB9 D;  3WUT A;  1Q81 Q;  2IBZ G;  3T97 B;  2FYU G;  1M1J B;  3SWF A;  2R32 A;  3IAO A;  2FY8 A;  4IOI H;  4IFF A;  4OH8 B;  2OYH A;  3M9B A;  3L4F A;  4I1L A;  4DOJ A;  1NU1 D;  4GIF A;  5CBO A;  3GW6 A;  3AE2 C;  4PJ0 H;  1YIJ P;  1NU1 K;  3H1J G;  3O6Q B;  1X79 B;  2ZAE B;  2YMK A;  1S5L X;  2Y0D A;  1GK6 A;  1PFI A;  1NTK D;  4H44 D;  1JY2 N;  1NTK K;  2R5B A;  4PD4 H;  5APW A;  1K9M Q;  2ZVN B;  5KLI C;  1PIX A;  3H32 B;  1OX3 A;  3S1K A;  3B5N B;  1JY3 P;  3H1L J;  3L75 J;  1SQV K;  2QRX A;  1WT6 A;  2WSF J;  4I2L C;  1QEX A;  1DD3 A;  3AEB C;  2WSF H;  1NKN A;  1T3U A;  5BU5 A;  1NO4 A;  1ZW0 A;  4IL6 E;  2N9B A;  1JOC A;  2Q9I A;  3TGU G;  2FFD C;  1TU3 F;  3HTK A;  2W6A A;  3VMX A;  1YI2 P;  3MD0 A;  2KLV A;  3I56 P;  3B4S A;  1JTH A;  1FJP A;  1EQ7 A;  1L0N G;  1LTJ C;  1H89 A;  1HTL C;  1YQ3 C;  1W2E A;  2M5A B;  1L4A C;  4AUW A;  2I8D A;  3BAT A;  2O01 N;  3M0A A;  1SQQ K;  3S9O A;  3LW5 H;  4GDO A;  3CME P;  3A7O A;  4H0L C;  2JEE A;  2AXC A;  2BEZ F;  3V2Q A;  1VQO P;  1L0L K;  1A02 J;  1Q7Y Q;  1NTM J;  1YHQ P;  1KYO E;  3C1L A;  3TF5 A;  1W2B O;  1HUC A;  1J1E B;  3TNU A;  2FFD A;  3H1K J;  1LP1 B;  4YPC A;  3WUU A;  1IO4 A;  1SQB G;  1PPJ E;  2D2C D;  3H1I E;  1JY2 P;  1HBW A;  1LTJ A;  5DJT B;  1KN7 A;  1L4A A;  2V7Q J;  3D6Z A;  5KKZ C;  2A45 G;  1HH0 A;  2B87 A;  1PGP A;  3CCJ P;  3QH9 A;  2BAS A;  3E1R A;  2KI7 B;  3H1H G;  3RBZ A;  2ZT9 C;  3G9R A;  2C9N Y;  3BVH A;  3A0B H;  1YJW P;  3QWO C;  3Q5R A;  3IR9 A;  4RJT A;  3EWK A;  3AEA C;  2FYN B;  3L72 D;  1EZV D;  1SQP G;  1M1J C;  1GDT A;  1EXJ A;  2J59 M;  5GTI E;  1LTB C;  2R3C A;  2GM4 A;  1DEB A;  4U7J A;  1JUN A;  1BCC D;  3MP7 B;  1SP4 A;  5AW2 B;  5AVT B;  3CX5 E;  2W6J H;  4C46 A;  2K37 A;  2O1K A;  3L36 A;  4NPE A;  1LGH B;  3L73 E;  4KT0 J;  2Z4E A;  2XZR A;  2IX7 C;  3FXE A;  4AQR D;  2QVA A;  1SQV E;  2FYU D;  1FBM A;  4PJ0 E;  2FYU K;  5E79 H;  2N1T B;  3SSU A;  1BSH A;  3T97 A;  3KQG A;  1M1J A;  3B5N C;  4KHX A;  1R5L A;  1H0T B;  3L37 A;  3IN6 A;  2PRR A;  2PFX A;  1VQM P;  3CWB E;  3CCR P;  1NU1 G;  1HJ0 A;  1VQ6 P;  3O6Q A;  5APY A;  3P7K A;  3PHL A;  4DZO A;  1ZXG A;  1S9K D;  1FAV A;  1LTS C;  1AQT A;  1SQQ E;  2M3E A;  1NHL A;  3HE5 B;  2G8Y A;  3CCM P;  2E5T A;  1NOH A;  4GOD A;  1N7S B;  3N4X A;  2Z5H A;  2Y9Y A;  3H32 A;  2K9Y A;  1L0L E;  3OAK A;  1WMK A;  5APT A;  4DJG A;  3B5N A;  1OMI A;  1P84 E;  2W27 A;  4D6T E;  2H89 C;  1QX8 A;  4DT0 A;  4HJG H;  1KIL B;  1NTZ D;  4HH2 A;  1G1I A;  1RF0 C;  2K88 A;  2O3J A;  1L4A D;  3TYY A;  3CXH I;  1S3J A;  3KPE A;  1FZF A;  1M56 D;  1J1E C;  2YO2 A;  2Q7C A;  1PGQ A;  2H7H A;  4WY4 B;  1KFN A;  1N7L A;  4WVZ A;  4H0L D;  1L0N K;  1ZRT E;  3UIA A;  2WSC J;  3M06 A;  4OWF A;  4LGD E;  1LTI C;  1FOS E;  1MV8 A;  1CSB A;  2M5A A;  2WSC H;  4IL6 H;  4WBA A;  1JB0 J;  3AE6 C;  4I7Z B;  2SPZ A;  3RL0 B;  5KAI E;  1K8A Q;  4PV1 B;  3L70 E;  2KOG A;  1HF9 A;  2A45 H;  2E5Y A;  4O9B A;  1RE3 C;  1FU1 A;  1RF0 A;  1NWQ A;  3L71 D;  3H1L G;  3HUS B;  2FYN C;  3MUD C;  3NMD A;  1M90 Q;  3I5C A;  1A02 F;  1SQB K;  3RK3 E;  1LP1 A;  5B66 H;  2ZT9 D;  3AE3 C;  1OW8 A;  2V4H A;  3A0B E;  2C0X A;  1PGO A;  1PP9 E;  1OWA A;  1U7M A;  3JSV C;  3KZI E;  2XND H;  2JP3 A;  2JKV A;  2IYO A;  4LLH A;  1U57 A;  3Q5S A;  2ZYG A;  1USD A;  2IBZ E;  1BGY J;  3V2R A;  2XNX A;  1E5W A;  1JMB A;  1RE3 A;  2XKM A;  3L74 D;  1FE6 A;  4JQ0 D;  5AW9 B;  1QL2 A;  3MUD A;  1QVF O;  2K9J B;  1SQP K;  2IPP A;  2N1T C;  2KP8 A;  2DW3 A;  2QA4 P;  2FYZ A;  3NTN A;  1EZV G;  2HYN A;  2PP6 A;  1NTM G;  3H1J E;  2Q3E A;  2PAJ A;  1KB9 H;  2QE7 H;  1AV1 A;  2K3R A;  3D6Y A;  4AYC A;  3TK1 A;  1YJ9 P;  1BCC G;  2AEF A;  3U59 A;  5E79 E;  5GTI H;  2BCC J;  3B5N D;  5AW1 B;  3GLM A;  1X0T A;  4N78 D;  3AEF C;  3HE4 B;  4K35 A;  3BRV B;  4TT3 H;  2Z5I A;  3CX5 H;  2HOD B;  1BGY D;  1YTZ I;  2WWW A;  1BE3 D;  1ZR4 A;  3LIE A;  1FZB A;  5AVZ B;  1N7S C;  1SVF A;  2ZVO B;  2N1T A;  1KFM A;  3OW2 O;  3BCC E;  1SQV J;  3LID A;  4GKG A;  3TGU E;  4R4M A;  1AFO A;  1H0T A;  1RF1 B;  1KIL C;  2FXM A;  3PH0 A;  4W7Z A;  2RMZ A;  3AEG C;  1BDC A;  3RGU A;  1IK7 A;  3MGN A;  1L0N E;  2O1J A;  3VMY A;  2OTL P;  2CPB A;  4UB8 H;  3D71 A;  3VOP A;  1FZC B;  4U3F D;  2AXT E;  2O01 H;  4WY4 C;  1D7M A;  1PGJ A;  2KZJ A;  3V2N A;  2BCC D;  1S1C X;  3HE5 A;  3KDP B;  3BRT B;  3AE1 C;  2MKV A;  4I7Z C;  1JEK A;  1N7S A;  1FDM A;  4LC1 A;  1VF5 B;  3RL0 C;  2LR2 A;  4PV1 C;  3U1A A;  5CJ0 A;  2POH A;  1FDI A;  1KYO I;  2JDI H;  1LWU B;  2QM8 A;  3SFD C;  2OYI B;  1KIL A;  3AE8 C;  4BWN A;  3N7N A;  4RO0 A;  1L2P A;  4OGQ B;  1MUU A;  4H13 B;  1NTZ G;  2A06 E;  3HUS C;  1SQB E;  2IZ1 A;  3PTZ A;  2QG4 A;  1P84 H;  1VDF A;  5KLV J;  1KOR A;  4WY4 A;  1JNM A;  1OXZ A;  3JCU H;  1OW7 A;  4BXL A;  2QEX P;  1S4X A;  1IFM A;  2OGU A;  1OFC X;  3WU2 E;  3CCE P;  3LW5 J;  1AA0 A;  3H1H E;  2NPS B;  4PD4 D;  4XE5 B;  4XFJ A;  3RL0 g;  4GOF A;  3P8C D;  4ZNC A;  1M7L A;  5L8R J;  1LT9 B;  5AW6 B;  3NFQ A;  1IFI A;  3K5B A;  2OAR A;  2I1J A;  3H1L D;  3L75 D;  1EC5 A;  1SQP E;  1KV4 A;  5APS A; 
#chains in the Genus database with same CATH homology
 5TIS E;  5GTI E;  5B66 E;  5H2F E;  1S5L E;  3JCU E;  3KZI E;  2AXT E;  1W5C E;  5GTH E;  3A0H E;  4UB8 E;  5E79 E;  5KAF E;  4UB6 E;  5KAI E;  5B5E E;  3A0B E;  4IL6 E;  3WU2 E;  4PJ0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...