4PJ0E

Structure of t.elongatus photosystem ii, rows of dimers crystal packing
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
b'AGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein 1
publication title Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
pubmed doi rcsb
molecule tags Oxidoreductase, electron transport
total genus 17
structure length 82
sequence length 82
chains with identical sequence e
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 4pj0E00
5TISE 5GTHE 2AXTE 3KZIE 4UB8E 5GTIE 3WU2E 4IL6E 5KAIE 1W5CE 5B5EE 3JCUE 4UB6E 5B66E 5E79E 5KAFE 3A0BE 1S5LE 3A0HE 4PJ0E 5H2FE
chains in the Genus database with same CATH superfamily
1PGOA 4WWIA 3CX5I 1CI6B 4U7JA 3ABVC 5KJ7C 3L75D 3TGUJ 1JNMA 1SFCA 1Z56A 2OYOA 2XV5A 2K3RA 2Y0EA 1CI6A 2XDJA 3MHVA 1Q82Q 1GZLA 3FWNA 3B71A 4LLHA 2OTLP 1GL2B 1T8ZA 3H1KJ 3VOPA 1NTMJ 1KILB 1EQ7A 3TK1A 3A3YB 1NOHA 5E79E 5KAFE 4IFDK 1J1DC 1S9KD 3RK2C 2A06G 3GF7A 4A7PA 3H1IJ 1K05A 1OW8A 3CCUP 3LW5H 1BSHA 3M9QA 2YKOA 3GG2A 3PHLA 3G71P 3CWBG 2AEFA 1JB0J 3LIDA 2E74D 3RL0C 1VQ8P 2KYVA 1FJPA 5APUA 1A02J 1NJIQ 1L4AD 2KIKA 2VRSA 3GMAA 4RO0A 1YQ3C 3L71J 3H1HJ 3HD7C 3KYQA 4R4MA 2WSSH 2JKVA 2Y9YA 5B5EH 1LTBC 1JCDA 5B66E 1KMIZ 2V7QH 3CL3D 1J1DB 1VQ6P 3IAOA 2QA4P 3V2NA 1M1JA 1DD4A 5GTIH 2OGUA 4EI2A 2KLVA 2E76C 3PP5A 1NGMB 1NTKD 1IJDB 2HFED 3O6QA 1FAVA 3RL0B 2WSCJ 5APTA 3H6PA 2QM7A 2OTJP 1GW4A 4KJMA 3M0AA 4WB4A 1DEBA 1SVFA 3L74J 3D70A 1XTGB 3M91A 3JCUH 5CCGA 1S3JA 3L70D 1PPJG 1Y8AA 3CCEP 1HUCA 3TSIA 1FC2C 3H1LE 3GHGC 2OYIC 2K1AA 1AA0A 2FKWB 1VQNP 4GDOA 3VMAA 4K35A 3B5ND 3AEBC 4JPZB 4GT1A 4PD4H 4IOIH 2NPSC 2Y9ZA 2YO3A 2Q1KA 2FXPA 3R4YA 1NU1G 1PGPA 2P7JA 1LGHB 5AVRB 2H7HA 3C1LA 3WMM0 2IFNA 2YO2A 1YQ4C 3ITKA 3AEFC 1RF0A 1M57D 4L74A 1FDIA 1JUNA 4I2LC 2Q6QA 3GHGB 2OYIB 2FYUG 1GL2D 2BCCJ 1JCCA 1MV8A 1KILD 2O1JA 3BCCG 1M56D 2KI7B 3CMAP 1SP4A 4D6TG 5APXA 3T97A 2BEZF 1JM0A 1IFMA 2R5DA 2JWAA 2ZYDA 2JO1A 3GHGA 2WSFJ 5KJ7D 4IFMA 1FZAA 4H0LC 1VQ9P 2B88A 5K5GB 3L72E 4PD4I 1RH5B 3L75G 2O01H 2K9JB 2M8RA 5KLVJ 1EDLA 1SQXE 3S1KA 5AVUB 1IC2A 3L73G 4ZNCA 4M3LA 3RL0g 3RK2D 3KDPB 2FBWC 2W90A 1MKMA 3VP8A 1AVYA 3H1KE 4H0LB 1KQLA 2FYZA 3RL0D 3U59A 3MUDA 3NXSA 1GMJA 3RGUA 2WPVB 1YJNP 1OIPA 1U7MA 1SQVJ 1HWTC 1HBWA 1EZVE 3H1IE 3HD7D 3FX0A 1Q81Q 2CPSA 1VQ4P 1S72P 3CXHE 1PGQA 4DZOA 1HJBA 2KSEA 1JEKA 2MJZA 1GD2E 2AEMA 1SLQA 4L76A 1P84H 3L71E 3TGUG 2IDBA 1GU5A 3MZWB 2E76D 2Q7CA 2A06D 2QJKC 4N78E 5KLIC 4IL6E 3V2RA 2PP6A 2YKPA 1NVOA 3RK3E 3H1JE 3P7KA 4JF7A 3W67A 5H2FE 2KS1B 3CWBD 3D6ZA 3C8VA 1NTMG 1T3JA 4GOEA 4WY4C 1N73A 1A02F 1SQBE 1NAYA 1NH4A 1OVUA 1G2CA 1WMKA 4NPEA 4TLFA 5CBNA 4NPDA 1S5LH 5H2FH 2B87B 3G9RA 3D71A 3FXEA 4W80A 2E5YA 3WUTA 1RY3A 3L70G 1YHQP 4OGQC 2ZVOB 2LXCB 4Y99B 3L74E 5KAIH 2QJKB 2N9BA 2H88C 2KZIA 1NTMK 5KLIB 4WVZA 1VQPP 2PFXA 2NPSD 3PTZA 3AEAC 1NTZE 2QJPC 2O01N 5GTHE 3H32A 4BXLA 4CPGA 3Q2YA 5AVSB 1S4XA 4QMAA 1YBKA 4WY4B 1N86A 1EDIA 1SQQJ 5C39A 4YPCA 1MFZA 1JO5A 2KNCA 4OWFA 3S9OA 3CCLP 1ZOYC 3H1LJ 3M0DA 2AXTE 2I1KA 3KZIE 3I55P 1N7SA 3V5BA 5DJUB 2P58A 3A7OA 1N2DC 1ZR2A 4PV1D 3P32A 3F89A 3U1CA 3I5CA 2QJPB 1FS0E 1KZUB 2BCCE 4H0LD 1E79H 1SQPJ 1YTZT 3WU2H 4UB6E 1DH3A 5KKZB 1PP9J 2FXOA 3G3ZA 3N7NA 1FZEA 3RK3C 3AE1C 3GLMA 3CD6P 3HE4A 4Z1MH 1ZMEC 1N8RQ 4L73A 2W6JH 2O3JA 4UB6H 1YYCA 2IBZE 1W2EA 2N1TB 1NKZB 2ZXEB 2H43A 1RHZB 3PLNA 5APSA 5KLVE 4C7RA 2QSIA 2R44A 2NZ2A 3RBZA 3L37A 1H0TA 2P10A 4JYBA 4GODA 3AECC 1QLED 1LT9B 2N1TA 2FXMA 4H13C 3K5BA 4K3AA 4B86A 5CHXA 3RK3B 3BASA 1L0LJ 1PL5A 1SQXJ 4RKUJ 1BGYE 2V4HA 1LT9A 2ZYGA 2RN0A 1Q86Q 1SQVE 2YNYA 1LTJC 3L73D 1R8EA 4DT0A 1M1JC 2WZ7A 1NHLA 1GK6A 1RF1B 5BVZA 1R5LA 2ZXXA 1RE4C 2R3SA 3SFEC 1S5LX 4H13B 4ASVA 4RJTA 4WY4D 4UB8E 4EDFA 1RF1A 1FE6A 3C9IA 1BE3E 2R32A 5CCGC 2KXPB 2ZVNB 5E79H 5KAFH 3FXDA 1DX7A 3L72D 1LTJB 4U3FD 4OGQD 1M1JB 4BRYA 1L0NJ 2M5AA 3EWKA 5KLVK 3AE5C 3H1JJ 3O6QB 3TGUD 2HR3A 1FZFA 2KSJA 1PIXA 2Q5UA 4RESB 1LTJA 1JY3O 1BCCJ 3V6IA 1PFIA 1SQBJ 1URQC 2HODB 2E42A 1OW7A 1FU1A 1IFIA 3R2PA 5B66H 1RE4A 5AW9B 1RF0C 2OQQA 1OWAA 3H1KD 4C46A 1NTMD 1HVVA 3E1RA 3AEEC 1Q90D 1K8AQ 1SQVK 3B8EB 3EFGA 1Q7YQ 3CMEP 4R4LA 2OYHA 1EZVD 3H1ID 3VP9A 3M9BA 2HODA 3AE7C 1P84D 1USEA 2QG4A 1SQQE 3OJAB 1IFDA 3S4RA 1NTZJ 2E5TA 3P8CD 2LR2A 1R5SA 1T2KD 1Q2NA 1SFCD 5AW6B 2XZRA 1LTIC 2IX7C 1BSNA 3L71D 3CCRP 1URQB 3H1HD 1KD1Q 1JMBA 1NO4A 1CSBA 3IR9A 3MD0A 2RH0A 2KZJA 3RK3D 3CCMP 2YIUC 4Y28J 3WUUA 1JY3N 3AE9C 1ZV8A 1SQPE 2Z5HA 1OFCX 1URQA 1D7MA 3T97B 1PP9E 1LJ2A 1AFOA 2BASA 4HKZH 5KTBA 2YKQA 4ZKUA 1YJWP 3AE8C 1L2PA 3MUDC 5CMZA 4H44C 3L74D 1NAFA 3A0HE 1LTGC 3H1LG 4H13D 1MZ9A 1MUUA 3VMZA 2YIUB 1KYOE 1VQMP 2GM4A 2WVRA 2L5GB 3D6YA 2R3CA 1S9KE 1KFMA 1T6AA 1SQQK 2ZAEB 1KYOH 4YTPC 3BATA 1M1KQ 2FFDA 4L75A 1L0LE 2E43A 3CCSP 3RBXA 3BVHA 3KQGA 4ZMDA 1KV4A 2ZT9C 1K73Q 4H44B 3PJSK 5AVYB 3HTKA 1LP1B 3W68A 2IYPA 3CCQP 3V4QA 2Z4EA 2C0WA 2I8DA 1AQTA 4O9BA 1N73C 3CPWO 5CCGD 1BGYJ 2OARA 1SQPK 2M0BA 2AXCA 5AW0B 2BCCD 2YXRB 3TF5A 2WT7A 3L35A 2KUBA 1QEXA 3NMDA 1LP1A 3MP7B 4GIFA 1IFJA 3TYYA 1NTKE 2Y0CA 1IFNA 5CCHA 2OTKE 2RKLA 4YXDC 2XNXA 5AW1B 3Q5SA 3L72G 2ZT9B 4U3FG 5L8RJ 3SWYA 1SQXG 1GTWA 3LW5J 4EIJA 1L0NE 3CXHH 1N73B 4Y99C 1BE3J 1G2CB 3M06A 5KLVD 2QM8A 3AE6C 1ZLLA 1RQVA 3M0DC 5TISE 2HPCB 3U1AA 3GW6A 4HYTB 1N7SC 1HJ0A 3H1KG 2ZYAA 1L0LK 4KHXA 1BCCE 1SQXK 1JY2O 2Q3EA 3KHUA 4IL6H 1HF9A 3L4FA 1VQ7P 3VMYA 1J1EC 2QIWA 4HJGH 4XFJA 1EZVG 3H1IG 5EFWB 1LTTC 2HPCA 3H32B 1SQVD 1LWUA 4I1LA 1KB9E 2IYOA 1FZCA 5TJHA 2W8ZA 2WQYC 2WSCH 2KNCB 5AW7B 3L71G 1EZVI 3TDKA 3H1HG 2QE7H 1NU1J 1IZNB 3Q3DA 1P84I 3SSUA 3Q1MA 1RQUA 1N7SB 2KOGA 3CXHI 3PRJA 3SWKA 1OZHA 2N9YB 3NTNA 5KKZC 2QJYC 1BE3D 4W7YA 1J1EB 1VDFA 3VTPC 3ZDMA 1JTHB 1Y9BA 1FJKA 1X0TA 2E75C 2XKMA 5GTHH 1EXIA 3VMXA 1SQBG 1JY2N 2Q3IA 2FYUJ 4TT3H 3LIEA 1L0NK 2W6BA 1H89A 2BEQD 2ZFCA 4H44D 4D6TJ 3FGAD 1RE3A 2N1TC 2E74B 1JTHA 1TU3F 1AV1A 1U7JA 3CX5E 2CK3H 2AXTH 4ASWA 1T3UA 1G1JA 3HE4B 3KZIH 3L74G 1FBMA 1J2JB 3VN0A 4C7NB 1SQBK 3TNUB 3CC7P 1DEEG 1JOCA 1NTZG 1ZRTE 1LT9C 1LTAC 2QJYB 4PJ0E 3CX5H 2Y0DA 1L4AA 2E75B 3IF4A 5BU5A 5AW3B 5AVTB 1BDCA 1VQKP 5CBOA 3V2QA 3B5NC 2NRGA 2ZT9D 1N7LA 5M1BA 1VQ5P 1OVVA 4C7NA 2WMMA 3TNUA 1H0TB 4PJ0H 1Y47A 1KQSO 3HUSC 4I7ZC 1SQQD 1NTZK 2WSFH 2JR8A 1RF1C 1FDMA 1NYHA 3H1LD 1IO4A 2PGDA 1BDDA 3L36A 4ZKPA 1OVRA 4OH8B 2O01J 1EXJA 4DCKA 2A06E 2BCCG 1X79B 2YXQB 3B5NB 3CCVP 2M3EA 1PGJA 3O8ZA 3HE5B 1SQPD 3CWBE 1IFPA 1EDJA 3Q5RA 2HG5D 3HUSB 2PAJA 4I7ZB 1VQLP 3A2AA 4EYYQ 1PP9D 2WWWA 1H88A 4BWNA 3B5NA 2IBZG 3HE5A 1VQOP 1S2EA 1YITP 4IL6X 1VF5C 3B4SA 2IZ0A 3HUSA 1AJYA 5KLVG 1NTKJ 1N7SD 2WPRA 4BRYB 4W7ZA 2OYHC 1KYOD 2M5AB 2R5BA 5APYA 4XA4A 4XE5B 1LT1A 2IBZI 4HH2A 2KB7P 4WBAA 4UB8H 1BGYG 3L70J 4AYCA 1GL2A 3QH9A 1KILA 1NKNA 1VL2A 1W5CE 1L0LD 5B5EE 1SQXD 1QX8A 1SQVG 3H25A 2W6AA 3N4XA 2KP8A 1VF5B 4AQRD 1PPJE 3II6A 3Q5PA 3M9HA 1IK7A 1W2BO 4OVNF 1GK4A 5KJ7A 1XTCC 5GTIE 2OYHB 2FYNC 5CJ4A 2WSEJ 2E75D 3RK2B 5BU8B 1NU1E 1KC8Q 3AE3C 1BE3G 4EOTA 2PRRA 1QL2A 1KN7A 2D2CC 2C0XA 3QWOC 3JCUE 1GU4A 2N1TD 5AVVB 3CXHD 5AVQB 2P2UA 4NPFX 3CCJP 4KT0J 1CW5A 4YXWH 3HD7B 1QGKB 2Q9IA 2FYUE 2FY8A 2FYNB 3BCCE 2B89A 1L0ND 1X9VA 4D6TE 2YMYA 4N78D 4PD4E 3H1JD 1GW3A 3WUVA 2AEJA 1U57A 1HH0A 2FFDC 5AVXB 2B9BA 3HD7A 4LGDE 2E76B 2JEEA 1M8OB 2D2CB 2DW3A 4LC1A 1BCCD 1OX3A 1SQBD 4HB1A 3L75E 3GF3A 1YIJP 1VPCA 2WPSA 1SQQG 1UIXA 3AE4C 3JC22 3L73E 1KB9D 5DJTB 2O1KA 2HYNA 3A5TA 1FZGA 5CCHC 1YJ9P 1NU1K 2FFDB 1NTZD 2W83C 3SWFA 3I56P 3P8MC 1IK9A 2JJLA 2JDIH 3A0HH 4GOFA 4PV1C 2J58A 2NPSB 3HTKB 1YTZI 2OYIA 2GA1A 5APVA 1SQPG 1OXZA 2FYUK 2WPQA 1KFNA 5AVWB 1HTLC 1PP9G 1VF5D 3MGNA 4U3FE 2WT7B 1M90Q 2NPSA 1SS1A 2I1JA 3VYIA 1ZR4A 2KLUA 2GUSA 3KXDA 2KK7A 3TGUE 3CX5D 3E1IA 2ZJSE 1K04A 1HGZA 3EQ2A 1KQFB 1JY3P 3PH0A 1H8AA 3CWBJ 3A0BE 5AW2B 4PV1B 4IFFA 2K9JA 1WRGA 1ZRTD 1HGVA 1LWUC 2IZ1A 1AVOA 2Z5IA 1FZCC 1NTME 3V4WA 3V2PA 1GDTA 3A0BH 1YI2P 3CC4P 1KYOI 2IBZD 1L0LG 4DOJA 1M7LA 1ZW0A 1K9MQ 1P84E 5APQA 2QRXA 3L70E 2G3AA 1URQD 2HLOA 3G4SP 2JP3A 3P8CE 2QEXP 2YMKA 2LXBA 2QVAA 3SFDC 2POHA 5AW5B 3H1HE 1DD3A 1LWUB 2D2CD 1FZCB 1ZP0C 2H89C 2K9YA 1RE3C 1S5LE 1BGYD 2V7QJ 1NTKG 5TISH 2P67A 3AEDC 3MIWA 1PZQA 2XNDH 1NWQA 2UWJE 1CZQA 5KAIE 2C9LY 2WSEH 2E74C 4AUWA 1L4AC 1KILE 2KS1A 1UIIA 1L0NG 1WT6A 2GUVA 1NTKK 1FOSE 1KB9H 2J59M 1QVGO 3H1JG 1KTMA 2B87A 2LKMA 4N3YB 2A45H 1MFTA 1BCCG 1X22A 1ZN5A 2P1JA 1JMMA 3BCCJ 3CLQA 3EFFK 2W27A 3BRTB 3OAKA 1FOSF 1G1IA 4N6JA 1DIPA 1USDA 1L4AB 4MN4C 4JBZA 5CCHD 3USSA 4OGQB 1PPJD 3UIAA 4WY4A 5AW4B 3WU2E 2WTYA 3BRVB 1E5WA 2H8PD 3MTUE 3AEGC 1FZBA 1QVFO 2JWDA 2A45G 3L75J 2M3BA 5AVZB 4JYCA 1OW6A 4JQ0D 3OA7A 1T2KC 2CPBA 3IFMA 1FDOA 1SFCC 1KORA 1KB9I 2K37A 1NU1D 1S1CX 2J5UA 3L73J 2ITAA 3HRNA 3AE2C 1X8YA 5AW8B 3KPEA 4DJGA 2XU6A 4I6MC 2A45I 1LNQA 1PV3A 3OW2O 3G6EP 3IN6A 2MKVA 2WITA 1QL1A 3FWLA 2C9NY 2IPPA 1KQGB 3CC2P 1EC5A 4GKGA 5CJ0A 2FYUD 3BCCD 2RMZA 3JSVC 5APWA 2K88A 3F5HA 4D6TD 3NFQA 2G8YA 1ZXGA 4PD4D 1EDKA 1OMIA 1GL2C 2IFMA 1SFCB 1KILC 2L91A 1AQ5A 3E7KA 2SPZA 3L72J 3CI9A 1JY2P 4U3FJ 1LTSC
chains in the Genus database with same CATH topology
5TISE 5GTHE 2AXTE 3KZIE 4UB8E 5GTIE 3WU2E 4IL6E 5KAIE 1W5CE 5B5EE 3JCUE 4UB6E 5B66E 5E79E 5KAFE 3A0BE 1S5LE 3A0HE 4PJ0E 5H2FE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS E;  5GTH E;  2AXT E;  3KZI E;  4UB8 E;  5GTI E;  3WU2 E;  4IL6 E;  5KAI E;  1W5C E;  5B5E E;  3JCU E;  4UB6 E;  5B66 E;  5E79 E;  5KAF E;  3A0B E;  1S5L E;  3A0H E;  4PJ0 E;  5H2F E; 
#chains in the Genus database with same CATH topology
 1PGO A;  4WWI A;  3CX5 I;  1CI6 B;  4U7J A;  3ABV C;  5KJ7 C;  3L75 D;  3TGU J;  1JNM A;  1SFC A;  1Z56 A;  2OYO A;  2XV5 A;  2K3R A;  2Y0E A;  1CI6 A;  2XDJ A;  3MHV A;  1Q82 Q;  1GZL A;  3FWN A;  3B71 A;  4LLH A;  2OTL P;  1GL2 B;  1T8Z A;  3H1K J;  3VOP A;  1NTM J;  1KIL B;  1EQ7 A;  3TK1 A;  3A3Y B;  1NOH A;  5E79 E;  5KAF E;  4IFD K;  1J1D C;  1S9K D;  3RK2 C;  2A06 G;  3GF7 A;  4A7P A;  3H1I J;  1K05 A;  1OW8 A;  3CCU P;  3LW5 H;  1BSH A;  3M9Q A;  2YKO A;  3GG2 A;  3PHL A;  3G71 P;  3CWB G;  2AEF A;  1JB0 J;  3LID A;  2E74 D;  3RL0 C;  1VQ8 P;  2KYV A;  1FJP A;  5APU A;  1A02 J;  1NJI Q;  1L4A D;  2KIK A;  2VRS A;  3GMA A;  4RO0 A;  1YQ3 C;  3L71 J;  3H1H J;  3HD7 C;  3KYQ A;  4R4M A;  2WSS H;  2JKV A;  2Y9Y A;  5B5E H;  1LTB C;  1JCD A;  5B66 E;  1KMI Z;  2V7Q H;  3CL3 D;  1J1D B;  1VQ6 P;  3IAO A;  2QA4 P;  3V2N A;  1M1J A;  1DD4 A;  5GTI H;  2OGU A;  4EI2 A;  2KLV A;  2E76 C;  3PP5 A;  1NGM B;  1NTK D;  1IJD B;  2HFE D;  3O6Q A;  1FAV A;  3RL0 B;  2WSC J;  5APT A;  3H6P A;  2QM7 A;  2OTJ P;  1GW4 A;  4KJM A;  3M0A A;  4WB4 A;  1DEB A;  1SVF A;  3L74 J;  3D70 A;  1XTG B;  3M91 A;  3JCU H;  5CCG A;  1S3J A;  3L70 D;  1PPJ G;  1Y8A A;  3CCE P;  1HUC A;  3TSI A;  1FC2 C;  3H1L E;  3GHG C;  2OYI C;  2K1A A;  1AA0 A;  2FKW B;  1VQN P;  4GDO A;  3VMA A;  4K35 A;  3B5N D;  3AEB C;  4JPZ B;  4GT1 A;  4PD4 H;  4IOI H;  2NPS C;  2Y9Z A;  2YO3 A;  2Q1K A;  2FXP A;  3R4Y A;  1NU1 G;  1PGP A;  2P7J A;  1LGH B;  5AVR B;  2H7H A;  3C1L A;  3WMM 0;  2IFN A;  2YO2 A;  1YQ4 C;  3ITK A;  3AEF C;  1RF0 A;  1M57 D;  4L74 A;  1FDI A;  1JUN A;  4I2L C;  2Q6Q A;  3GHG B;  2OYI B;  2FYU G;  1GL2 D;  2BCC J;  1JCC A;  1MV8 A;  1KIL D;  2O1J A;  3BCC G;  1M56 D;  2KI7 B;  3CMA P;  1SP4 A;  4D6T G;  5APX A;  3T97 A;  2BEZ F;  1JM0 A;  1IFM A;  2R5D A;  2JWA A;  2ZYD A;  2JO1 A;  3GHG A;  2WSF J;  5KJ7 D;  4IFM A;  1FZA A;  4H0L C;  1VQ9 P;  2B88 A;  5K5G B;  3L72 E;  4PD4 I;  1RH5 B;  3L75 G;  2O01 H;  2K9J B;  2M8R A;  5KLV J;  1EDL A;  1SQX E;  3S1K A;  5AVU B;  1IC2 A;  3L73 G;  4ZNC A;  4M3L A;  3RL0 g;  3RK2 D;  3KDP B;  2FBW C;  2W90 A;  1MKM A;  3VP8 A;  1AVY A;  3H1K E;  4H0L B;  1KQL A;  2FYZ A;  3RL0 D;  3U59 A;  3MUD A;  3NXS A;  1GMJ A;  3RGU A;  2WPV B;  1YJN P;  1OIP A;  1U7M A;  1SQV J;  1HWT C;  1HBW A;  1EZV E;  3H1I E;  3HD7 D;  3FX0 A;  1Q81 Q;  2CPS A;  1VQ4 P;  1S72 P;  3CXH E;  1PGQ A;  4DZO A;  1HJB A;  2KSE A;  1JEK A;  2MJZ A;  1GD2 E;  2AEM A;  1SLQ A;  4L76 A;  1P84 H;  3L71 E;  3TGU G;  2IDB A;  1GU5 A;  3MZW B;  2E76 D;  2Q7C A;  2A06 D;  2QJK C;  4N78 E;  5KLI C;  4IL6 E;  3V2R A;  2PP6 A;  2YKP A;  1NVO A;  3RK3 E;  3H1J E;  3P7K A;  4JF7 A;  3W67 A;  5H2F E;  2KS1 B;  3CWB D;  3D6Z A;  3C8V A;  1NTM G;  1T3J A;  4GOE A;  4WY4 C;  1N73 A;  1A02 F;  1SQB E;  1NAY A;  1NH4 A;  1OVU A;  1G2C A;  1WMK A;  4NPE A;  4TLF A;  5CBN A;  4NPD A;  1S5L H;  5H2F H;  2B87 B;  3G9R A;  3D71 A;  3FXE A;  4W80 A;  2E5Y A;  3WUT A;  1RY3 A;  3L70 G;  1YHQ P;  4OGQ C;  2ZVO B;  2LXC B;  4Y99 B;  3L74 E;  5KAI H;  2QJK B;  2N9B A;  2H88 C;  2KZI A;  1NTM K;  5KLI B;  4WVZ A;  1VQP P;  2PFX A;  2NPS D;  3PTZ A;  3AEA C;  1NTZ E;  2QJP C;  2O01 N;  5GTH E;  3H32 A;  4BXL A;  4CPG A;  3Q2Y A;  5AVS B;  1S4X A;  4QMA A;  1YBK A;  4WY4 B;  1N86 A;  1EDI A;  1SQQ J;  5C39 A;  4YPC A;  1MFZ A;  1JO5 A;  2KNC A;  4OWF A;  3S9O A;  3CCL P;  1ZOY C;  3H1L J;  3M0D A;  2AXT E;  2I1K A;  3KZI E;  3I55 P;  1N7S A;  3V5B A;  5DJU B;  2P58 A;  3A7O A;  1N2D C;  1ZR2 A;  4PV1 D;  3P32 A;  3F89 A;  3U1C A;  3I5C A;  2QJP B;  1FS0 E;  1KZU B;  2BCC E;  4H0L D;  1E79 H;  1SQP J;  1YTZ T;  3WU2 H;  4UB6 E;  1DH3 A;  5KKZ B;  1PP9 J;  2FXO A;  3G3Z A;  3N7N A;  1FZE A;  3RK3 C;  3AE1 C;  3GLM A;  3CD6 P;  3HE4 A;  4Z1M H;  1ZME C;  1N8R Q;  4L73 A;  2W6J H;  2O3J A;  4UB6 H;  1YYC A;  2IBZ E;  1W2E A;  2N1T B;  1NKZ B;  2ZXE B;  2H43 A;  1RHZ B;  3PLN A;  5APS A;  5KLV E;  4C7R A;  2QSI A;  2R44 A;  2NZ2 A;  3RBZ A;  3L37 A;  1H0T A;  2P10 A;  4JYB A;  4GOD A;  3AEC C;  1QLE D;  1LT9 B;  2N1T A;  2FXM A;  4H13 C;  3K5B A;  4K3A A;  4B86 A;  5CHX A;  3RK3 B;  3BAS A;  1L0L J;  1PL5 A;  1SQX J;  4RKU J;  1BGY E;  2V4H A;  1LT9 A;  2ZYG A;  2RN0 A;  1Q86 Q;  1SQV E;  2YNY A;  1LTJ C;  3L73 D;  1R8E A;  4DT0 A;  1M1J C;  2WZ7 A;  1NHL A;  1GK6 A;  1RF1 B;  5BVZ A;  1R5L A;  2ZXX A;  1RE4 C;  2R3S A;  3SFE C;  1S5L X;  4H13 B;  4ASV A;  4RJT A;  4WY4 D;  4UB8 E;  4EDF A;  1RF1 A;  1FE6 A;  3C9I A;  1BE3 E;  2R32 A;  5CCG C;  2KXP B;  2ZVN B;  5E79 H;  5KAF H;  3FXD A;  1DX7 A;  3L72 D;  1LTJ B;  4U3F D;  4OGQ D;  1M1J B;  4BRY A;  1L0N J;  2M5A A;  3EWK A;  5KLV K;  3AE5 C;  3H1J J;  3O6Q B;  3TGU D;  2HR3 A;  1FZF A;  2KSJ A;  1PIX A;  2Q5U A;  4RES B;  1LTJ A;  1JY3 O;  1BCC J;  3V6I A;  1PFI A;  1SQB J;  1URQ C;  2HOD B;  2E42 A;  1OW7 A;  1FU1 A;  1IFI A;  3R2P A;  5B66 H;  1RE4 A;  5AW9 B;  1RF0 C;  2OQQ A;  1OWA A;  3H1K D;  4C46 A;  1NTM D;  1HVV A;  3E1R A;  3AEE C;  1Q90 D;  1K8A Q;  1SQV K;  3B8E B;  3EFG A;  1Q7Y Q;  3CME P;  4R4L A;  2OYH A;  1EZV D;  3H1I D;  3VP9 A;  3M9B A;  2HOD A;  3AE7 C;  1P84 D;  1USE A;  2QG4 A;  1SQQ E;  3OJA B;  1IFD A;  3S4R A;  1NTZ J;  2E5T A;  3P8C D;  2LR2 A;  1R5S A;  1T2K D;  1Q2N A;  1SFC D;  5AW6 B;  2XZR A;  1LTI C;  2IX7 C;  1BSN A;  3L71 D;  3CCR P;  1URQ B;  3H1H D;  1KD1 Q;  1JMB A;  1NO4 A;  1CSB A;  3IR9 A;  3MD0 A;  2RH0 A;  2KZJ A;  3RK3 D;  3CCM P;  2YIU C;  4Y28 J;  3WUU A;  1JY3 N;  3AE9 C;  1ZV8 A;  1SQP E;  2Z5H A;  1OFC X;  1URQ A;  1D7M A;  3T97 B;  1PP9 E;  1LJ2 A;  1AFO A;  2BAS A;  4HKZ H;  5KTB A;  2YKQ A;  4ZKU A;  1YJW P;  3AE8 C;  1L2P A;  3MUD C;  5CMZ A;  4H44 C;  3L74 D;  1NAF A;  3A0H E;  1LTG C;  3H1L G;  4H13 D;  1MZ9 A;  1MUU A;  3VMZ A;  2YIU B;  1KYO E;  1VQM P;  2GM4 A;  2WVR A;  2L5G B;  3D6Y A;  2R3C A;  1S9K E;  1KFM A;  1T6A A;  1SQQ K;  2ZAE B;  1KYO H;  4YTP C;  3BAT A;  1M1K Q;  2FFD A;  4L75 A;  1L0L E;  2E43 A;  3CCS P;  3RBX A;  3BVH A;  3KQG A;  4ZMD A;  1KV4 A;  2ZT9 C;  1K73 Q;  4H44 B;  3PJS K;  5AVY B;  3HTK A;  1LP1 B;  3W68 A;  2IYP A;  3CCQ P;  3V4Q A;  2Z4E A;  2C0W A;  2I8D A;  1AQT A;  4O9B A;  1N73 C;  3CPW O;  5CCG D;  1BGY J;  2OAR A;  1SQP K;  2M0B A;  2AXC A;  5AW0 B;  2BCC D;  2YXR B;  3TF5 A;  2WT7 A;  3L35 A;  2KUB A;  1QEX A;  3NMD A;  1LP1 A;  3MP7 B;  4GIF A;  1IFJ A;  3TYY A;  1NTK E;  2Y0C A;  1IFN A;  5CCH A;  2OTK E;  2RKL A;  4YXD C;  2XNX A;  5AW1 B;  3Q5S A;  3L72 G;  2ZT9 B;  4U3F G;  5L8R J;  3SWY A;  1SQX G;  1GTW A;  3LW5 J;  4EIJ A;  1L0N E;  3CXH H;  1N73 B;  4Y99 C;  1BE3 J;  1G2C B;  3M06 A;  5KLV D;  2QM8 A;  3AE6 C;  1ZLL A;  1RQV A;  3M0D C;  5TIS E;  2HPC B;  3U1A A;  3GW6 A;  4HYT B;  1N7S C;  1HJ0 A;  3H1K G;  2ZYA A;  1L0L K;  4KHX A;  1BCC E;  1SQX K;  1JY2 O;  2Q3E A;  3KHU A;  4IL6 H;  1HF9 A;  3L4F A;  1VQ7 P;  3VMY A;  1J1E C;  2QIW A;  4HJG H;  4XFJ A;  1EZV G;  3H1I G;  5EFW B;  1LTT C;  2HPC A;  3H32 B;  1SQV D;  1LWU A;  4I1L A;  1KB9 E;  2IYO A;  1FZC A;  5TJH A;  2W8Z A;  2WQY C;  2WSC H;  2KNC B;  5AW7 B;  3L71 G;  1EZV I;  3TDK A;  3H1H G;  2QE7 H;  1NU1 J;  1IZN B;  3Q3D A;  1P84 I;  3SSU A;  3Q1M A;  1RQU A;  1N7S B;  2KOG A;  3CXH I;  3PRJ A;  3SWK A;  1OZH A;  2N9Y B;  3NTN A;  5KKZ C;  2QJY C;  1BE3 D;  4W7Y A;  1J1E B;  1VDF A;  3VTP C;  3ZDM A;  1JTH B;  1Y9B A;  1FJK A;  1X0T A;  2E75 C;  2XKM A;  5GTH H;  1EXI A;  3VMX A;  1SQB G;  1JY2 N;  2Q3I A;  2FYU J;  4TT3 H;  3LIE A;  1L0N K;  2W6B A;  1H89 A;  2BEQ D;  2ZFC A;  4H44 D;  4D6T J;  3FGA D;  1RE3 A;  2N1T C;  2E74 B;  1JTH A;  1TU3 F;  1AV1 A;  1U7J A;  3CX5 E;  2CK3 H;  2AXT H;  4ASW A;  1T3U A;  1G1J A;  3HE4 B;  3KZI H;  3L74 G;  1FBM A;  1J2J B;  3VN0 A;  4C7N B;  1SQB K;  3TNU B;  3CC7 P;  1DEE G;  1JOC A;  1NTZ G;  1ZRT E;  1LT9 C;  1LTA C;  2QJY B;  4PJ0 E;  3CX5 H;  2Y0D A;  1L4A A;  2E75 B;  3IF4 A;  5BU5 A;  5AW3 B;  5AVT B;  1BDC A;  1VQK P;  5CBO A;  3V2Q A;  3B5N C;  2NRG A;  2ZT9 D;  1N7L A;  5M1B A;  1VQ5 P;  1OVV A;  4C7N A;  2WMM A;  3TNU A;  1H0T B;  4PJ0 H;  1Y47 A;  1KQS O;  3HUS C;  4I7Z C;  1SQQ D;  1NTZ K;  2WSF H;  2JR8 A;  1RF1 C;  1FDM A;  1NYH A;  3H1L D;  1IO4 A;  2PGD A;  1BDD A;  3L36 A;  4ZKP A;  1OVR A;  4OH8 B;  2O01 J;  1EXJ A;  4DCK A;  2A06 E;  2BCC G;  1X79 B;  2YXQ B;  3B5N B;  3CCV P;  2M3E A;  1PGJ A;  3O8Z A;  3HE5 B;  1SQP D;  3CWB E;  1IFP A;  1EDJ A;  3Q5R A;  2HG5 D;  3HUS B;  2PAJ A;  4I7Z B;  1VQL P;  3A2A A;  4EYY Q;  1PP9 D;  2WWW A;  1H88 A;  4BWN A;  3B5N A;  2IBZ G;  3HE5 A;  1VQO P;  1S2E A;  1YIT P;  4IL6 X;  1VF5 C;  3B4S A;  2IZ0 A;  3HUS A;  1AJY A;  5KLV G;  1NTK J;  1N7S D;  2WPR A;  4BRY B;  4W7Z A;  2OYH C;  1KYO D;  2M5A B;  2R5B A;  5APY A;  4XA4 A;  4XE5 B;  1LT1 A;  2IBZ I;  4HH2 A;  2KB7 P;  4WBA A;  4UB8 H;  1BGY G;  3L70 J;  4AYC A;  1GL2 A;  3QH9 A;  1KIL A;  1NKN A;  1VL2 A;  1W5C E;  1L0L D;  5B5E E;  1SQX D;  1QX8 A;  1SQV G;  3H25 A;  2W6A A;  3N4X A;  2KP8 A;  1VF5 B;  4AQR D;  1PPJ E;  3II6 A;  3Q5P A;  3M9H A;  1IK7 A;  1W2B O;  4OVN F;  1GK4 A;  5KJ7 A;  1XTC C;  5GTI E;  2OYH B;  2FYN C;  5CJ4 A;  2WSE J;  2E75 D;  3RK2 B;  5BU8 B;  1NU1 E;  1KC8 Q;  3AE3 C;  1BE3 G;  4EOT A;  2PRR A;  1QL2 A;  1KN7 A;  2D2C C;  2C0X A;  3QWO C;  3JCU E;  1GU4 A;  2N1T D;  5AVV B;  3CXH D;  5AVQ B;  2P2U A;  4NPF X;  3CCJ P;  4KT0 J;  1CW5 A;  4YXW H;  3HD7 B;  1QGK B;  2Q9I A;  2FYU E;  2FY8 A;  2FYN B;  3BCC E;  2B89 A;  1L0N D;  1X9V A;  4D6T E;  2YMY A;  4N78 D;  4PD4 E;  3H1J D;  1GW3 A;  3WUV A;  2AEJ A;  1U57 A;  1HH0 A;  2FFD C;  5AVX B;  2B9B A;  3HD7 A;  4LGD E;  2E76 B;  2JEE A;  1M8O B;  2D2C B;  2DW3 A;  4LC1 A;  1BCC D;  1OX3 A;  1SQB D;  4HB1 A;  3L75 E;  3GF3 A;  1YIJ P;  1VPC A;  2WPS A;  1SQQ G;  1UIX A;  3AE4 C;  3JC2 2;  3L73 E;  1KB9 D;  5DJT B;  2O1K A;  2HYN A;  3A5T A;  1FZG A;  5CCH C;  1YJ9 P;  1NU1 K;  2FFD B;  1NTZ D;  2W83 C;  3SWF A;  3I56 P;  3P8M C;  1IK9 A;  2JJL A;  2JDI H;  3A0H H;  4GOF A;  4PV1 C;  2J58 A;  2NPS B;  3HTK B;  1YTZ I;  2OYI A;  2GA1 A;  5APV A;  1SQP G;  1OXZ A;  2FYU K;  2WPQ A;  1KFN A;  5AVW B;  1HTL C;  1PP9 G;  1VF5 D;  3MGN A;  4U3F E;  2WT7 B;  1M90 Q;  2NPS A;  1SS1 A;  2I1J A;  3VYI A;  1ZR4 A;  2KLU A;  2GUS A;  3KXD A;  2KK7 A;  3TGU E;  3CX5 D;  3E1I A;  2ZJS E;  1K04 A;  1HGZ A;  3EQ2 A;  1KQF B;  1JY3 P;  3PH0 A;  1H8A A;  3CWB J;  3A0B E;  5AW2 B;  4PV1 B;  4IFF A;  2K9J A;  1WRG A;  1ZRT D;  1HGV A;  1LWU C;  2IZ1 A;  1AVO A;  2Z5I A;  1FZC C;  1NTM E;  3V4W A;  3V2P A;  1GDT A;  3A0B H;  1YI2 P;  3CC4 P;  1KYO I;  2IBZ D;  1L0L G;  4DOJ A;  1M7L A;  1ZW0 A;  1K9M Q;  1P84 E;  5APQ A;  2QRX A;  3L70 E;  2G3A A;  1URQ D;  2HLO A;  3G4S P;  2JP3 A;  3P8C E;  2QEX P;  2YMK A;  2LXB A;  2QVA A;  3SFD C;  2POH A;  5AW5 B;  3H1H E;  1DD3 A;  1LWU B;  2D2C D;  1FZC B;  1ZP0 C;  2H89 C;  2K9Y A;  1RE3 C;  1S5L E;  1BGY D;  2V7Q J;  1NTK G;  5TIS H;  2P67 A;  3AED C;  3MIW A;  1PZQ A;  2XND H;  1NWQ A;  2UWJ E;  1CZQ A;  5KAI E;  2C9L Y;  2WSE H;  2E74 C;  4AUW A;  1L4A C;  1KIL E;  2KS1 A;  1UII A;  1L0N G;  1WT6 A;  2GUV A;  1NTK K;  1FOS E;  1KB9 H;  2J59 M;  1QVG O;  3H1J G;  1KTM A;  2B87 A;  2LKM A;  4N3Y B;  2A45 H;  1MFT A;  1BCC G;  1X22 A;  1ZN5 A;  2P1J A;  1JMM A;  3BCC J;  3CLQ A;  3EFF K;  2W27 A;  3BRT B;  3OAK A;  1FOS F;  1G1I A;  4N6J A;  1DIP A;  1USD A;  1L4A B;  4MN4 C;  4JBZ A;  5CCH D;  3USS A;  4OGQ B;  1PPJ D;  3UIA A;  4WY4 A;  5AW4 B;  3WU2 E;  2WTY A;  3BRV B;  1E5W A;  2H8P D;  3MTU E;  3AEG C;  1FZB A;  1QVF O;  2JWD A;  2A45 G;  3L75 J;  2M3B A;  5AVZ B;  4JYC A;  1OW6 A;  4JQ0 D;  3OA7 A;  1T2K C;  2CPB A;  3IFM A;  1FDO A;  1SFC C;  1KOR A;  1KB9 I;  2K37 A;  1NU1 D;  1S1C X;  2J5U A;  3L73 J;  2ITA A;  3HRN A;  3AE2 C;  1X8Y A;  5AW8 B;  3KPE A;  4DJG A;  2XU6 A;  4I6M C;  2A45 I;  1LNQ A;  1PV3 A;  3OW2 O;  3G6E P;  3IN6 A;  2MKV A;  2WIT A;  1QL1 A;  3FWL A;  2C9N Y;  2IPP A;  1KQG B;  3CC2 P;  1EC5 A;  4GKG A;  5CJ0 A;  2FYU D;  3BCC D;  2RMZ A;  3JSV C;  5APW A;  2K88 A;  3F5H A;  4D6T D;  3NFQ A;  2G8Y A;  1ZXG A;  4PD4 D;  1EDK A;  1OMI A;  1GL2 C;  2IFM A;  1SFC B;  1KIL C;  2L91 A;  1AQ5 A;  3E7K A;  2SPZ A;  3L72 J;  3CI9 A;  1JY2 P;  4U3F J;  1LTS C; 
#chains in the Genus database with same CATH homology
 5TIS E;  5GTH E;  2AXT E;  3KZI E;  4UB8 E;  5GTI E;  3WU2 E;  4IL6 E;  5KAI E;  1W5C E;  5B5E E;  3JCU E;  4UB6 E;  5B66 E;  5E79 E;  5KAF E;  3A0B E;  1S5L E;  3A0H E;  4PJ0 E;  5H2F E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...