4PJ0E

Structure of t.elongatus photosystem ii, rows of dimers crystal packing
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
AGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
pubmed doi rcsb
molecule tags Oxidoreductase, electron transport
molecule keywords Photosystem Q(B) protein 1
total genus 17
structure length 82
sequence length 82
chains with identical sequence e
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 4pj0E00
5B66E 4PJ0E 5B5EE 5KAIE 3JCUE 5E79E 3KZIE 4UB6E 3WU2E 5GTHE 5H2FE 5KAFE 1S5LE 1W5CE 3A0HE 3A0BE 4IL6E 4UB8E 2AXTE 5GTIE 5TISE
chains in the Genus database with same CATH superfamily
3W67A 2BCCG 1LWUB 2KB7P 3LW5J 1GW3A 1KB9D 4ASVA 1RF1A 3AEFC 3AEGC 3TGUJ 1MUUA 3BVHA 1CZQA 2HODB 2QIWA 4WB4A 4WY4A 3V2QA 2KP8A 3IN6A 1EDKA 2WSSH 1L0LG 2M5AA 1VQOP 2L91A 1J1EB 1SQBK 2R3CA 3RL0B 1GZLA 1DH3A 1GK4A 3H1JD 2YXRB 3G3ZA 2N9YB 3L71J 5BU8B 2W6JH 1FZEA 1K9MQ 1IFDA 2QE7H 3A5TA 1OX3A 1ZP0C 2K9JA 5CCGD 5AW3B 3TK1A 2R3SA 5C39A 2WMMA 3H1KD 1Y47A 2N1TA 3L71G 3CWBE 2IPPA 3H1JG 5DJUB 1EXJA 5K5GB 1VQ4P 1SQQK 2QJPB 2KS1B 1VQLP 1EDJA 1LT1A 4I6MC 4LLHA 2NPSA 1NVOA 1LT9A 3A3YB 3RK2C 4OH8B 2Q5UA 2QEXP 3H32A 1S9KE 2P2UA 1QX8A 2BCCD 2HG5D 1KZUB 1VF5D 3NMDA 1L2PA 1AQ5A 2I1KA 3SFDC 3WUUA 2OTJP 4ZKUA 1N7LA 1U57A 5APYA 3AE9C 2O1KA 1L0ND 1SVFA 2P7JA 4KHXA 4L76A 4N78D 2K1AA 3H1HJ 1PZQA 3VP8A 1RF1B 2OYIC 3Q5SA 1FC2C 1W5CE 1N7SA 3A0HE 3A0BE 2FBWC 2JDIH 4UB6H 5AW4B 5CCHC 2P1JA 1HWTC 1LWUC 4W80A 2KK7A 2QJYC 1EDLA 3PLNA 3NTNA 1T2KC 2YIUC 1EZVE 3HUSC 2A45H 1YTZI 1DEEG 1GMJA 4HKZH 3BCCD 3HD7B 3RK3E 3CXHD 2BEZF 1LTGC 3RL0D 3AEBC 2K9YA 3OA7A 2FYNB 1X8YA 4WWIA 1KB9I 3QH9A 2K3RA 2IBZE 2ZYDA 1NTKK 3L70E 1L4AC 2IBZD 2WSFH 3KZIE 1RHZB 4L73A 4LC1A 3UIAA 3CMAP 2OYIB 1SQBE 1ZOYC 2WSCH 3H1LE 4UB6E 5CCGC 3BCCG 2OTLP 1VQ5P 2O3JA 1KTMA 3AE5C 5B66H 1S5LH 1SS1A 2ZYGA 5CCHD 2H8PD 5AVYB 2O01N 1T2KD 3L75G 2P67A 2XKMA 1NTME 1S5LX 2H89C 3A2AA 2JWAA 2ZVNB 1S9KD 1N86A 3H6PA 3V6IA 3D70A 1RQVA 1M7LA 1GTWA 1KV4A 1PGOA 1SQVD 2OQQA 4C7RA 3D71A 2PP6A 3KYQA 2YXQB 3NXSA 3AE3C 4HH2A 1Q86Q 1RF0C 2KOGA 2LXBA 1GU5A 3FXDA 4N3YB 3TSIA 5GTIE 4U3FE 2QRXA 3L72J 4H13C 1KILA 3U59A 1DEBA 4H0LD 4ZMDA 1JOCA 1ZRTD 1GL2C 1Q2NA 1NTKD 2E74B 4NPEA 3ITKA 3KHUA 2JKVA 1PP9E 2FKWB 5E79E 2OTKE 3L73G 4RJTA 3LIDA 3VMYA 3HTKB 2QM8A 1SQPK 2PRRA 2YKOA 3SWFA 2R5DA 2UWJE 3L35A 3L37A 3PTZA 1JMMA 4JF7A 3CCQP 2AEMA 5APTA 5H2FE 2POHA 3AEDC 3HUSB 1PFIA 1JY3N 1LNQA 4HB1A 1JM0A 2IBZI 2ZXXA 1SQVK 1XTGB 5AVUB 3HE4B 2KSJA 1KFMA 3KPEA 1JNMA 1HTLC 3N4XA 5KJ7C 1ZR2A 1OXZA 2ZJSE 2FYUJ 3V2RA 4D6TG 2V7QJ 2NZ2A 5TJHA 1YHQP 1PPJE 1BE3G 1YYCA 5AW5B 1LTJB 1NKZB 4I7ZB 1URQC 5B66E 1KILD 2M8RA 3CC7P 1JO5A 2N9BA 2WSEH 3GG2A 3L36A 5AVRB 1EDIA 1GW4A 4AYCA 2Q7CA 5KJ7A 1VQPP 1RY3A 2Z5IA 1BSNA 1HJBA 1NTKE 1OMIA 1EZVD 3L74G 5KKZB 1NKNA 3KXDA 3PP5A 5KLVJ 3CC4P 1X79B 3VOPA 1L0NK 3GF7A 1D7MA 1NTMK 1BGYJ 4YTPC 1KMIZ 3H1HE 1L4AB 3TDKA 3CX5D 1FBMA 5APXA 1IK7A 3CX5E 2OYHB 2YMYA 3CXHE 2KXPB 3F89A 4Y28J 1LWUA 2I1JA 3USSA 1JB0J 3L72D 3P8CD 2L5GB 1S1CX 1JY3O 2KI7B 3H1ID 2A45G 1NHLA 2Z5HA 3L75E 4DZOA 1S3JA 2LXCB 5APWA 1VQMP 1M1KQ 1M56D 1SQQE 4ZNCA 1K8AQ 1A02J 2Y9YA 1M1JC 1NTZE 2J58A 1KN7A 1KILC 1BGYD 2KZJA 2BEQD 2M0BA 3H1JJ 3H1LG 3RK3C 1SQBG 3R4YA 3VP9A 4R4MA 3D6ZA 1E5WA 1YJWP 2HPCB 2YIUB 1A02F 1BCCJ 1IFMA 1BE3D 1PPJD 2Y0DA 3H1IJ 2VRSA 3A7OA 3F5HA 1EZVI 3P32A 5APUA 1NAYA 2A06G 4OVNF 4I2LC 3HRNA 1LT9C 1PGQA 3CWBJ 1E79H 3FWLA 5KLVG 1IFJA 1NTZG 1EZVG 3JC22 5KJ7D 1LTAC 1U7MA 4H0LB 1SQQG 1JUNA 1AA0A 3CCVP 2KS1A 1SQXG 3M06A 3SWYA 2FYUD 4IL6H 1IFNA 3VMZA 1NGMB 1N73A 1HF9A 1QVFO 2OARA 3CI9A 2M3BA 3RBZA 2AXTH 1SQXE 4C7NA 3AECC 2HR3A 3L72G 1MKMA 4MN4C 2WTYA 1W2BO 1YIJP 3HE4A 3U1CA 1P84E 1KQFB 1FS0E 1OVVA 3L74E 4EIJA 1LP1B 1JTHB 3H1LD 4H44B 1PGJA 1BCCG 1HH0A 2CPBA 1MFZA 2GUSA 2SPZA 3KDPB 1R5SA 2A45I 4PD4I 5APVA 1BE3E 1PPJG 2MKVA 3AE8C 1RF1C 2N1TD 1FZAA 1SLQA 5APQA 5KTBA 1VQ6P 1VDFA 2A06D 1JCDA 1QL2A 2JR8A 3BCCJ 4XE5B 3WMM0 5DJTB 2FYUK 1M57D 3GHGB 1K05A 3B5NB 3TGUG 2E75D 1VPCA 1OWAA 3E1IA 1YI2P 1QLED 1NU1D 4WBAA 4XA4A 1SQPE 2YO2A 1KQSO 3D6YA 3CMEP 1VQNP 1NH4A 2E43A 2QA4P 2NPSC 2ZYAA 1DD3A 1ZLLA 3M9BA 3CCLP 2Q3IA 1G1JA 5AW7B 3FWNA 1RH5B 1GK6A 1IFIA 1YJ9P 1PP9G 5CJ0A 3AE6C 1TU3F 1KYOE 2E76C 1NTMJ 4TT3H 5CJ4A 1M1JB 3RGUA 5B5EH 2BCCE 4HYTB 5KLIC 3RK3B 2R32A 2QG4A 5AW2B 1GDTA 4D6TE 3MIWA 4C46A 2D2CD 1JY2N 3RK2B 2B88A 3CCUP 1JY2O 3WU2E 3GF3A 1EXIA 3B71A 3O6QA 2E75B 1SQPG 1OVUA 1ZR4A 1NTMD 2YKQA 3M0AA 5TISH 3JSVC 2WPSA 1FDOA 4WY4C 3H1KG 4PV1B 4GOFA 4N78E 3L75J 3R2PA 3VYIA 5BVZA 2XZRA 4BRYA 1U7JA 2BASA 3H1LJ 1IFPA 2HODA 3CLQA 3G9RA 1NU1G 1SFCB 2J5UA 2FXMA 1SQPD 2M3EA 4JBZA 3RBXA 4BWNA 2Y9ZA 1N7SD 2JO1A 2FXPA 2WSEJ 3AE4C 1S4XA 1L0NJ 2IYPA 3V4QA 1N73C 1MFTA 2V7QH 1FZCB 4IFMA 4YXWH 1OVRA 3FXEA 1BCCE 5KAIE 1DIPA 2D2CC 3LW5H 5APSA 3W68A 2V4HA 4GODA 3QWOC 1L0NG 2FXOA 3VTPC 4PD4E 4U3FG 3CWBD 2NRGA 1S72P 4PV1C 2K37A 3L72E 3P8CE 3HE5A 4BXLA 1VQ8P 2NPSD 3A0BH 3CCMP 1FJKA 2W27A 3C1LA 4H13D 1Y8AA 2W83C 3S1KA 1M90Q 4GIFA 1WT6A 2C0XA 3H1KJ 3Q3DA 1NTMG 4UB8E 1KC8Q 2GUVA 2IZ0A 1L0LD 1OIPA 1AVOA 1M1JA 1FZBA 2KSEA 1Q82Q 1QGKB 1OW7A 1URQB 3M9QA 5KLVE 3RL0g 2ZXEB 1FDIA 1KB9H 1J1DC 2IDBA 3B5NC 2QSIA 1G2CA 4YPCA 3TNUA 4CPGA 2A06E 2O01H 2W8ZA 3CC2P 5AVVB 4GOEA 1P84H 2IBZG 5B5EE 3CCEP 3SWKA 2FFDC 1VF5C 2W90A 2IX7C 3C9IA 1KYOH 2PFXA 3HD7C 4H44D 2RKLA 3T97B 5AW1B 3JCUH 1MZ9A 2FYNC 1SQQJ 2FYUE 4JYCA 5M1BA 3CCSP 3H1HD 2B89A 3U1AA 2E76B 4OWFA 2LR2A 2KLUA 3CWBG 1FZCA 1AQTA 1ZN5A 2E5YA 5AW0B 1NJIQ 1VQKP 2AEJA 4NPFX 1RQUA 3SFEC 2AEFA 2QJPC 3EWKA 3EFGA 1R8EA 1NTKJ 2Q1KA 3H1HG 3IR9A 3BRTB 4JPZB 3SSUA 4RKUJ 1L0LE 3L71D 3FGAD 1RE4A 2LKMA 1NU1J 3AE2C 1X0TA 3P7KA 5AW8B 1BGYE 2H7HA 1BDCA 4B86A 1CSBA 1NTKG 1VQ7P 3M0DC 2QJKC 1BDDA 1SQXK 3MUDA 1ZV8A 3MZWB 3OJAB 1PL5A 2QM7A 3RL0C 4DT0A 1L4AD 3Q5RA 2W6AA 1IJDB 3E1RA 1DD4A 2ZVOB 1EQ7A 3MHVA 2HPCA 3E7KA 3S4RA 1G2CB 4D6TJ 1N73B 2FYZA 4GT1A 2RN0A 3G4SP 3CPWO 3H1JE 4KJMA 3CX5H 5GTHE 3MD0A 2IZ1A 2D2CB 1OW8A 2B87A 3RK2D 2O1JA 1YTZT 1K04A 1LTBC 1Z56A 2G8YA 3KQGA 1AVYA 4JQ0D 4EDFA 4R4LA 2C0WA 3EQ2A 3B4SA 1N2DC 2ITAA 3HE5B 4K3AA 2E75C 2IYOA 3Q5PA 3WUTA 1CW5A 1JEKA 4RESB 1LP1A 1WMKA 3K5BA 1JTHA 1CI6A 2JJLA 3HTKA 2OYHC 3L75D 4JYBA 2OGUA 1P84I 1RE3C 4HJGH 4EI2A 4ZKPA 2XNDH 1KD1Q 3L73E 5BU5A 1GL2D 1URQA 3Q1MA 2WSFJ 3CXHI 2RMZA 4A7PA 1SQVG 3CX5I 4H0LC 2Q9IA 1FDMA 2YO3A 1SP4A 4W7ZA 2KLVA 1KILB 3IAOA 1W2EA 1J1DB 2C9NY 1NU1K 5CCGA 4KT0J 2WT7A 1Y9BA 1JCCA 1ZXGA 3AEEC 4OGQC 1ZMEC 1RE3A 2K9JB 1YBKA 2XDJA 3L74J 2MJZA 3II6A 1USDA 3PH0A 3VMXA 4ASWA 1FZGA 1X22A 2ZAEB 4IFDK 5H2FH 2I8DA 3H1IG 5KAFH 3BATA 1J1EC 2Q3EA 1J2JB 2AXCA 3C8VA 4WY4D 1BE3J 1T8ZA 3HUSA 1ZRTE 5KAIH 4DCKA 1L0LK 2H88C 3AEAC 4RO0A 1NTZJ 2WVRA 4M3LA 2AXTE 5CMZA 1UIIA 3I56P 1Q7YQ 2E42A 3BCCE 2WWWA 3GW6A 2RH0A 3IF4A 2WZ7A 4L75A 1KORA 4GDOA 1NYHA 4GKGA 3TYYA 1GL2A 5KLIB 1N7SC 1VL2A 3G71P 4L74A 5GTHH 2FY8A 4PD4D 3L70G 1FAVA 5GTIH 2E5TA 1SQVJ 1IO4A 3CD6P 1LTIC 4OGQD 1OZHA 3AE7C 2R44A 1FE6A 1PP9J 2QVAA 2KUBA 1KYOI 1NTZD 2C9LY 1CI6B 1NAFA 1HJ0A 1KB9E 1RF0A 1SQQD 2P10A 2WPQA 2WQYC 3HD7D 3L73D 3M0DA 3PJSK 4QMAA 3G6EP 2Y0CA 4XFJA 4LGDE 1H88A 1RE4C 1LTTC 3BRVB 1IC2A 2CK3H 3LIEA 3O8ZA 4PV1D 3WU2H 4AUWA 1S5LE 1ZW0A 1LJ2A 1IK9A 2ZT9D 3PRJA 3I5CA 2GA1A 2Q6QA 2WPVB 1FJPA 2BCCJ 4TLFA 1SQXJ 5CBNA 2E74D 2PGDA 1NOHA 2YNYA 1QVGO 1FOSE 1N7SB 5KLVK 3TF5A 3MGNA 5AVSB 1PIXA 2N1TC 5AW9B 1HVVA 1T3UA 2XNXA 4PD4H 1L4AA 2WITA 3CXHH 2OYHA 3FX0A 1BCCD 1WRGA 1KQLA 3CCRP 4OGQB 2CPSA 1FOSF 1S2EA 3L4FA 5E79H 2XV5A 1SQXD 2KYVA 4DJGA 1G1IA 3HD7A 3JCUE 1NTZK 2YKPA 2KNCB 3L70D 5AVQB 4D6TD 1NWQA 1QL1A 2FFDA 1JY2P 1HGZA 1BGYG 1XTCC 2QJKB 4Y99C 1H0TB 1YJNP 1HGVA 1SQBD 2JWDA 1YQ3C 4WVZA 2DW3A 2ZT9C 3L74D 3B8EB 1GL2B 2E74C 1P84D 1FU1A 2WSCJ 4NPDA 4U3FJ 3L71E 3MTUE 4K35A 3WUVA 2J59M 3BASA 4C7NB 1X9VA 5AVWB 2XU6A 1AJYA 1OW6A 3L70J 3GLMA 1UIXA 5CHXA 5EFWB 3S9OA 4EOTA 2OYIA 1DX7A 1OFCX 4I7ZC 5KLVD 3V4WA 1SQBJ 2ZFCA 4DOJA 3CCJP 3CL3D 1AV1A 2K88A 3MUDC 2IFMA 4I1LA 4UB8H 3T97A 2WPRA 3V5BA 2O01J 3VMAA 2G3AA 2H43A 2B9BA 2FYUG 3NFQA 5KKZC 1BSHA 2P58A 4EYYQ 2GM4A 1KILE 1QEXA 3L73J 4O9BA 1PGPA 4N6JA 4W7YA 3V2NA 1M8OB 1SFCC 3TNUB 4H13B 3VN0A 2R5BA 1H8AA 1Q81Q 3GHGA 1LTJC 2KIKA 3RK3D 1FZCC 3M9HA 1T6AA 1URQD 5KAFE 5CBOA 2QJYB 3OW2O 3EFFK 1H0TA 5AVZB 1YQ4C 3A0HH 4IFFA 1Q90D 3H25A 2M5AB 1GU4A 3GMAA 1H89A 1T3JA 1VF5B 1KQGB 4WY4B 1K73Q 2IFNA 1HUCA 5TISE 1L0NE 1SFCD 3ABVC 3B5NA 3M91A 3V2PA 1FZFA 3Q2YA 2E76D 4PJ0E 2B87B 1LTSC 1IZNB 1HBWA 1VQ9P 1SQVE 3ZDMA 2FFDB 2KZIA 2JP3A 2N1TB 4U3FD 4U7JA 1YITP 1LTJA 1PV3A 5AW6B 1LGHB 2YMKA 3GHGC 2HFED 1KFNA 3MP7B 1L0LJ 3KZIH 1USEA 5AVXB 3TGUE 1GD2E 1NU1E 1AFOA 1PP9D 2KNCA 1R5LA 1SFCA 2OYOA 3B5ND 1JY3P 2W6BA 4Z1MH 3P8MC 4IL6X 4YXDC 5CCHA 3I55P 1MV8A 4BRYB 1EC5A 2HYNA 2Z4EA 5L8RJ 4Y99B 2NPSB 3H1KE 2Y0EA 1LT9B 4IL6E 3H1IE 4AQRD 1N8RQ 3O6QB 3H32B 2ZT9B 5AVTB 3TGUD 2PAJA 2JEEA 4H44C 1SQPJ 1KYOD 1NO4A 3AE1C 1JMBA 3IFMA 3OAKA 2HLOA 4IOIH 4PJ0H 3N7NA 2WT7B 3PHLA
chains in the Genus database with same CATH topology
5B66E 4PJ0E 5B5EE 5KAIE 3JCUE 5E79E 3KZIE 4UB6E 3WU2E 5GTHE 5H2FE 5KAFE 1S5LE 1W5CE 3A0HE 3A0BE 4IL6E 4UB8E 2AXTE 5GTIE 5TISE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B66 E;  4PJ0 E;  5B5E E;  5KAI E;  3JCU E;  5E79 E;  3KZI E;  4UB6 E;  3WU2 E;  5GTH E;  5H2F E;  5KAF E;  1S5L E;  1W5C E;  3A0H E;  3A0B E;  4IL6 E;  4UB8 E;  2AXT E;  5GTI E;  5TIS E; 
#chains in the Genus database with same CATH topology
 3W67 A;  2BCC G;  1LWU B;  2KB7 P;  3LW5 J;  1GW3 A;  1KB9 D;  4ASV A;  1RF1 A;  3AEF C;  3AEG C;  3TGU J;  1MUU A;  3BVH A;  1CZQ A;  2HOD B;  2QIW A;  4WB4 A;  4WY4 A;  3V2Q A;  2KP8 A;  3IN6 A;  1EDK A;  2WSS H;  1L0L G;  2M5A A;  1VQO P;  2L91 A;  1J1E B;  1SQB K;  2R3C A;  3RL0 B;  1GZL A;  1DH3 A;  1GK4 A;  3H1J D;  2YXR B;  3G3Z A;  2N9Y B;  3L71 J;  5BU8 B;  2W6J H;  1FZE A;  1K9M Q;  1IFD A;  2QE7 H;  3A5T A;  1OX3 A;  1ZP0 C;  2K9J A;  5CCG D;  5AW3 B;  3TK1 A;  2R3S A;  5C39 A;  2WMM A;  3H1K D;  1Y47 A;  2N1T A;  3L71 G;  3CWB E;  2IPP A;  3H1J G;  5DJU B;  1EXJ A;  5K5G B;  1VQ4 P;  1SQQ K;  2QJP B;  2KS1 B;  1VQL P;  1EDJ A;  1LT1 A;  4I6M C;  4LLH A;  2NPS A;  1NVO A;  1LT9 A;  3A3Y B;  3RK2 C;  4OH8 B;  2Q5U A;  2QEX P;  3H32 A;  1S9K E;  2P2U A;  1QX8 A;  2BCC D;  2HG5 D;  1KZU B;  1VF5 D;  3NMD A;  1L2P A;  1AQ5 A;  2I1K A;  3SFD C;  3WUU A;  2OTJ P;  4ZKU A;  1N7L A;  1U57 A;  5APY A;  3AE9 C;  2O1K A;  1L0N D;  1SVF A;  2P7J A;  4KHX A;  4L76 A;  4N78 D;  2K1A A;  3H1H J;  1PZQ A;  3VP8 A;  1RF1 B;  2OYI C;  3Q5S A;  1FC2 C;  1W5C E;  1N7S A;  3A0H E;  3A0B E;  2FBW C;  2JDI H;  4UB6 H;  5AW4 B;  5CCH C;  2P1J A;  1HWT C;  1LWU C;  4W80 A;  2KK7 A;  2QJY C;  1EDL A;  3PLN A;  3NTN A;  1T2K C;  2YIU C;  1EZV E;  3HUS C;  2A45 H;  1YTZ I;  1DEE G;  1GMJ A;  4HKZ H;  3BCC D;  3HD7 B;  3RK3 E;  3CXH D;  2BEZ F;  1LTG C;  3RL0 D;  3AEB C;  2K9Y A;  3OA7 A;  2FYN B;  1X8Y A;  4WWI A;  1KB9 I;  3QH9 A;  2K3R A;  2IBZ E;  2ZYD A;  1NTK K;  3L70 E;  1L4A C;  2IBZ D;  2WSF H;  3KZI E;  1RHZ B;  4L73 A;  4LC1 A;  3UIA A;  3CMA P;  2OYI B;  1SQB E;  1ZOY C;  2WSC H;  3H1L E;  4UB6 E;  5CCG C;  3BCC G;  2OTL P;  1VQ5 P;  2O3J A;  1KTM A;  3AE5 C;  5B66 H;  1S5L H;  1SS1 A;  2ZYG A;  5CCH D;  2H8P D;  5AVY B;  2O01 N;  1T2K D;  3L75 G;  2P67 A;  2XKM A;  1NTM E;  1S5L X;  2H89 C;  3A2A A;  2JWA A;  2ZVN B;  1S9K D;  1N86 A;  3H6P A;  3V6I A;  3D70 A;  1RQV A;  1M7L A;  1GTW A;  1KV4 A;  1PGO A;  1SQV D;  2OQQ A;  4C7R A;  3D71 A;  2PP6 A;  3KYQ A;  2YXQ B;  3NXS A;  3AE3 C;  4HH2 A;  1Q86 Q;  1RF0 C;  2KOG A;  2LXB A;  1GU5 A;  3FXD A;  4N3Y B;  3TSI A;  5GTI E;  4U3F E;  2QRX A;  3L72 J;  4H13 C;  1KIL A;  3U59 A;  1DEB A;  4H0L D;  4ZMD A;  1JOC A;  1ZRT D;  1GL2 C;  1Q2N A;  1NTK D;  2E74 B;  4NPE A;  3ITK A;  3KHU A;  2JKV A;  1PP9 E;  2FKW B;  5E79 E;  2OTK E;  3L73 G;  4RJT A;  3LID A;  3VMY A;  3HTK B;  2QM8 A;  1SQP K;  2PRR A;  2YKO A;  3SWF A;  2R5D A;  2UWJ E;  3L35 A;  3L37 A;  3PTZ A;  1JMM A;  4JF7 A;  3CCQ P;  2AEM A;  5APT A;  5H2F E;  2POH A;  3AED C;  3HUS B;  1PFI A;  1JY3 N;  1LNQ A;  4HB1 A;  1JM0 A;  2IBZ I;  2ZXX A;  1SQV K;  1XTG B;  5AVU B;  3HE4 B;  2KSJ A;  1KFM A;  3KPE A;  1JNM A;  1HTL C;  3N4X A;  5KJ7 C;  1ZR2 A;  1OXZ A;  2ZJS E;  2FYU J;  3V2R A;  4D6T G;  2V7Q J;  2NZ2 A;  5TJH A;  1YHQ P;  1PPJ E;  1BE3 G;  1YYC A;  5AW5 B;  1LTJ B;  1NKZ B;  4I7Z B;  1URQ C;  5B66 E;  1KIL D;  2M8R A;  3CC7 P;  1JO5 A;  2N9B A;  2WSE H;  3GG2 A;  3L36 A;  5AVR B;  1EDI A;  1GW4 A;  4AYC A;  2Q7C A;  5KJ7 A;  1VQP P;  1RY3 A;  2Z5I A;  1BSN A;  1HJB A;  1NTK E;  1OMI A;  1EZV D;  3L74 G;  5KKZ B;  1NKN A;  3KXD A;  3PP5 A;  5KLV J;  3CC4 P;  1X79 B;  3VOP A;  1L0N K;  3GF7 A;  1D7M A;  1NTM K;  1BGY J;  4YTP C;  1KMI Z;  3H1H E;  1L4A B;  3TDK A;  3CX5 D;  1FBM A;  5APX A;  1IK7 A;  3CX5 E;  2OYH B;  2YMY A;  3CXH E;  2KXP B;  3F89 A;  4Y28 J;  1LWU A;  2I1J A;  3USS A;  1JB0 J;  3L72 D;  3P8C D;  2L5G B;  1S1C X;  1JY3 O;  2KI7 B;  3H1I D;  2A45 G;  1NHL A;  2Z5H A;  3L75 E;  4DZO A;  1S3J A;  2LXC B;  5APW A;  1VQM P;  1M1K Q;  1M56 D;  1SQQ E;  4ZNC A;  1K8A Q;  1A02 J;  2Y9Y A;  1M1J C;  1NTZ E;  2J58 A;  1KN7 A;  1KIL C;  1BGY D;  2KZJ A;  2BEQ D;  2M0B A;  3H1J J;  3H1L G;  3RK3 C;  1SQB G;  3R4Y A;  3VP9 A;  4R4M A;  3D6Z A;  1E5W A;  1YJW P;  2HPC B;  2YIU B;  1A02 F;  1BCC J;  1IFM A;  1BE3 D;  1PPJ D;  2Y0D A;  3H1I J;  2VRS A;  3A7O A;  3F5H A;  1EZV I;  3P32 A;  5APU A;  1NAY A;  2A06 G;  4OVN F;  4I2L C;  3HRN A;  1LT9 C;  1PGQ A;  3CWB J;  1E79 H;  3FWL A;  5KLV G;  1IFJ A;  1NTZ G;  1EZV G;  3JC2 2;  5KJ7 D;  1LTA C;  1U7M A;  4H0L B;  1SQQ G;  1JUN A;  1AA0 A;  3CCV P;  2KS1 A;  1SQX G;  3M06 A;  3SWY A;  2FYU D;  4IL6 H;  1IFN A;  3VMZ A;  1NGM B;  1N73 A;  1HF9 A;  1QVF O;  2OAR A;  3CI9 A;  2M3B A;  3RBZ A;  2AXT H;  1SQX E;  4C7N A;  3AEC C;  2HR3 A;  3L72 G;  1MKM A;  4MN4 C;  2WTY A;  1W2B O;  1YIJ P;  3HE4 A;  3U1C A;  1P84 E;  1KQF B;  1FS0 E;  1OVV A;  3L74 E;  4EIJ A;  1LP1 B;  1JTH B;  3H1L D;  4H44 B;  1PGJ A;  1BCC G;  1HH0 A;  2CPB A;  1MFZ A;  2GUS A;  2SPZ A;  3KDP B;  1R5S A;  2A45 I;  4PD4 I;  5APV A;  1BE3 E;  1PPJ G;  2MKV A;  3AE8 C;  1RF1 C;  2N1T D;  1FZA A;  1SLQ A;  5APQ A;  5KTB A;  1VQ6 P;  1VDF A;  2A06 D;  1JCD A;  1QL2 A;  2JR8 A;  3BCC J;  4XE5 B;  3WMM 0;  5DJT B;  2FYU K;  1M57 D;  3GHG B;  1K05 A;  3B5N B;  3TGU G;  2E75 D;  1VPC A;  1OWA A;  3E1I A;  1YI2 P;  1QLE D;  1NU1 D;  4WBA A;  4XA4 A;  1SQP E;  2YO2 A;  1KQS O;  3D6Y A;  3CME P;  1VQN P;  1NH4 A;  2E43 A;  2QA4 P;  2NPS C;  2ZYA A;  1DD3 A;  1ZLL A;  3M9B A;  3CCL P;  2Q3I A;  1G1J A;  5AW7 B;  3FWN A;  1RH5 B;  1GK6 A;  1IFI A;  1YJ9 P;  1PP9 G;  5CJ0 A;  3AE6 C;  1TU3 F;  1KYO E;  2E76 C;  1NTM J;  4TT3 H;  5CJ4 A;  1M1J B;  3RGU A;  5B5E H;  2BCC E;  4HYT B;  5KLI C;  3RK3 B;  2R32 A;  2QG4 A;  5AW2 B;  1GDT A;  4D6T E;  3MIW A;  4C46 A;  2D2C D;  1JY2 N;  3RK2 B;  2B88 A;  3CCU P;  1JY2 O;  3WU2 E;  3GF3 A;  1EXI A;  3B71 A;  3O6Q A;  2E75 B;  1SQP G;  1OVU A;  1ZR4 A;  1NTM D;  2YKQ A;  3M0A A;  5TIS H;  3JSV C;  2WPS A;  1FDO A;  4WY4 C;  3H1K G;  4PV1 B;  4GOF A;  4N78 E;  3L75 J;  3R2P A;  3VYI A;  5BVZ A;  2XZR A;  4BRY A;  1U7J A;  2BAS A;  3H1L J;  1IFP A;  2HOD A;  3CLQ A;  3G9R A;  1NU1 G;  1SFC B;  2J5U A;  2FXM A;  1SQP D;  2M3E A;  4JBZ A;  3RBX A;  4BWN A;  2Y9Z A;  1N7S D;  2JO1 A;  2FXP A;  2WSE J;  3AE4 C;  1S4X A;  1L0N J;  2IYP A;  3V4Q A;  1N73 C;  1MFT A;  2V7Q H;  1FZC B;  4IFM A;  4YXW H;  1OVR A;  3FXE A;  1BCC E;  5KAI E;  1DIP A;  2D2C C;  3LW5 H;  5APS A;  3W68 A;  2V4H A;  4GOD A;  3QWO C;  1L0N G;  2FXO A;  3VTP C;  4PD4 E;  4U3F G;  3CWB D;  2NRG A;  1S72 P;  4PV1 C;  2K37 A;  3L72 E;  3P8C E;  3HE5 A;  4BXL A;  1VQ8 P;  2NPS D;  3A0B H;  3CCM P;  1FJK A;  2W27 A;  3C1L A;  4H13 D;  1Y8A A;  2W83 C;  3S1K A;  1M90 Q;  4GIF A;  1WT6 A;  2C0X A;  3H1K J;  3Q3D A;  1NTM G;  4UB8 E;  1KC8 Q;  2GUV A;  2IZ0 A;  1L0L D;  1OIP A;  1AVO A;  1M1J A;  1FZB A;  2KSE A;  1Q82 Q;  1QGK B;  1OW7 A;  1URQ B;  3M9Q A;  5KLV E;  3RL0 g;  2ZXE B;  1FDI A;  1KB9 H;  1J1D C;  2IDB A;  3B5N C;  2QSI A;  1G2C A;  4YPC A;  3TNU A;  4CPG A;  2A06 E;  2O01 H;  2W8Z A;  3CC2 P;  5AVV B;  4GOE A;  1P84 H;  2IBZ G;  5B5E E;  3CCE P;  3SWK A;  2FFD C;  1VF5 C;  2W90 A;  2IX7 C;  3C9I A;  1KYO H;  2PFX A;  3HD7 C;  4H44 D;  2RKL A;  3T97 B;  5AW1 B;  3JCU H;  1MZ9 A;  2FYN C;  1SQQ J;  2FYU E;  4JYC A;  5M1B A;  3CCS P;  3H1H D;  2B89 A;  3U1A A;  2E76 B;  4OWF A;  2LR2 A;  2KLU A;  3CWB G;  1FZC A;  1AQT A;  1ZN5 A;  2E5Y A;  5AW0 B;  1NJI Q;  1VQK P;  2AEJ A;  4NPF X;  1RQU A;  3SFE C;  2AEF A;  2QJP C;  3EWK A;  3EFG A;  1R8E A;  1NTK J;  2Q1K A;  3H1H G;  3IR9 A;  3BRT B;  4JPZ B;  3SSU A;  4RKU J;  1L0L E;  3L71 D;  3FGA D;  1RE4 A;  2LKM A;  1NU1 J;  3AE2 C;  1X0T A;  3P7K A;  5AW8 B;  1BGY E;  2H7H A;  1BDC A;  4B86 A;  1CSB A;  1NTK G;  1VQ7 P;  3M0D C;  2QJK C;  1BDD A;  1SQX K;  3MUD A;  1ZV8 A;  3MZW B;  3OJA B;  1PL5 A;  2QM7 A;  3RL0 C;  4DT0 A;  1L4A D;  3Q5R A;  2W6A A;  1IJD B;  3E1R A;  1DD4 A;  2ZVO B;  1EQ7 A;  3MHV A;  2HPC A;  3E7K A;  3S4R A;  1G2C B;  4D6T J;  1N73 B;  2FYZ A;  4GT1 A;  2RN0 A;  3G4S P;  3CPW O;  3H1J E;  4KJM A;  3CX5 H;  5GTH E;  3MD0 A;  2IZ1 A;  2D2C B;  1OW8 A;  2B87 A;  3RK2 D;  2O1J A;  1YTZ T;  1K04 A;  1LTB C;  1Z56 A;  2G8Y A;  3KQG A;  1AVY A;  4JQ0 D;  4EDF A;  4R4L A;  2C0W A;  3EQ2 A;  3B4S A;  1N2D C;  2ITA A;  3HE5 B;  4K3A A;  2E75 C;  2IYO A;  3Q5P A;  3WUT A;  1CW5 A;  1JEK A;  4RES B;  1LP1 A;  1WMK A;  3K5B A;  1JTH A;  1CI6 A;  2JJL A;  3HTK A;  2OYH C;  3L75 D;  4JYB A;  2OGU A;  1P84 I;  1RE3 C;  4HJG H;  4EI2 A;  4ZKP A;  2XND H;  1KD1 Q;  3L73 E;  5BU5 A;  1GL2 D;  1URQ A;  3Q1M A;  2WSF J;  3CXH I;  2RMZ A;  4A7P A;  1SQV G;  3CX5 I;  4H0L C;  2Q9I A;  1FDM A;  2YO3 A;  1SP4 A;  4W7Z A;  2KLV A;  1KIL B;  3IAO A;  1W2E A;  1J1D B;  2C9N Y;  1NU1 K;  5CCG A;  4KT0 J;  2WT7 A;  1Y9B A;  1JCC A;  1ZXG A;  3AEE C;  4OGQ C;  1ZME C;  1RE3 A;  2K9J B;  1YBK A;  2XDJ A;  3L74 J;  2MJZ A;  3II6 A;  1USD A;  3PH0 A;  3VMX A;  4ASW A;  1FZG A;  1X22 A;  2ZAE B;  4IFD K;  5H2F H;  2I8D A;  3H1I G;  5KAF H;  3BAT A;  1J1E C;  2Q3E A;  1J2J B;  2AXC A;  3C8V A;  4WY4 D;  1BE3 J;  1T8Z A;  3HUS A;  1ZRT E;  5KAI H;  4DCK A;  1L0L K;  2H88 C;  3AEA C;  4RO0 A;  1NTZ J;  2WVR A;  4M3L A;  2AXT E;  5CMZ A;  1UII A;  3I56 P;  1Q7Y Q;  2E42 A;  3BCC E;  2WWW A;  3GW6 A;  2RH0 A;  3IF4 A;  2WZ7 A;  4L75 A;  1KOR A;  4GDO A;  1NYH A;  4GKG A;  3TYY A;  1GL2 A;  5KLI B;  1N7S C;  1VL2 A;  3G71 P;  4L74 A;  5GTH H;  2FY8 A;  4PD4 D;  3L70 G;  1FAV A;  5GTI H;  2E5T A;  1SQV J;  1IO4 A;  3CD6 P;  1LTI C;  4OGQ D;  1OZH A;  3AE7 C;  2R44 A;  1FE6 A;  1PP9 J;  2QVA A;  2KUB A;  1KYO I;  1NTZ D;  2C9L Y;  1CI6 B;  1NAF A;  1HJ0 A;  1KB9 E;  1RF0 A;  1SQQ D;  2P10 A;  2WPQ A;  2WQY C;  3HD7 D;  3L73 D;  3M0D A;  3PJS K;  4QMA A;  3G6E P;  2Y0C A;  4XFJ A;  4LGD E;  1H88 A;  1RE4 C;  1LTT C;  3BRV B;  1IC2 A;  2CK3 H;  3LIE A;  3O8Z A;  4PV1 D;  3WU2 H;  4AUW A;  1S5L E;  1ZW0 A;  1LJ2 A;  1IK9 A;  2ZT9 D;  3PRJ A;  3I5C A;  2GA1 A;  2Q6Q A;  2WPV B;  1FJP A;  2BCC J;  4TLF A;  1SQX J;  5CBN A;  2E74 D;  2PGD A;  1NOH A;  2YNY A;  1QVG O;  1FOS E;  1N7S B;  5KLV K;  3TF5 A;  3MGN A;  5AVS B;  1PIX A;  2N1T C;  5AW9 B;  1HVV A;  1T3U A;  2XNX A;  4PD4 H;  1L4A A;  2WIT A;  3CXH H;  2OYH A;  3FX0 A;  1BCC D;  1WRG A;  1KQL A;  3CCR P;  4OGQ B;  2CPS A;  1FOS F;  1S2E A;  3L4F A;  5E79 H;  2XV5 A;  1SQX D;  2KYV A;  4DJG A;  1G1I A;  3HD7 A;  3JCU E;  1NTZ K;  2YKP A;  2KNC B;  3L70 D;  5AVQ B;  4D6T D;  1NWQ A;  1QL1 A;  2FFD A;  1JY2 P;  1HGZ A;  1BGY G;  1XTC C;  2QJK B;  4Y99 C;  1H0T B;  1YJN P;  1HGV A;  1SQB D;  2JWD A;  1YQ3 C;  4WVZ A;  2DW3 A;  2ZT9 C;  3L74 D;  3B8E B;  1GL2 B;  2E74 C;  1P84 D;  1FU1 A;  2WSC J;  4NPD A;  4U3F J;  3L71 E;  3MTU E;  4K35 A;  3WUV A;  2J59 M;  3BAS A;  4C7N B;  1X9V A;  5AVW B;  2XU6 A;  1AJY A;  1OW6 A;  3L70 J;  3GLM A;  1UIX A;  5CHX A;  5EFW B;  3S9O A;  4EOT A;  2OYI A;  1DX7 A;  1OFC X;  4I7Z C;  5KLV D;  3V4W A;  1SQB J;  2ZFC A;  4DOJ A;  3CCJ P;  3CL3 D;  1AV1 A;  2K88 A;  3MUD C;  2IFM A;  4I1L A;  4UB8 H;  3T97 A;  2WPR A;  3V5B A;  2O01 J;  3VMA A;  2G3A A;  2H43 A;  2B9B A;  2FYU G;  3NFQ A;  5KKZ C;  1BSH A;  2P58 A;  4EYY Q;  2GM4 A;  1KIL E;  1QEX A;  3L73 J;  4O9B A;  1PGP A;  4N6J A;  4W7Y A;  3V2N A;  1M8O B;  1SFC C;  3TNU B;  4H13 B;  3VN0 A;  2R5B A;  1H8A A;  1Q81 Q;  3GHG A;  1LTJ C;  2KIK A;  3RK3 D;  1FZC C;  3M9H A;  1T6A A;  1URQ D;  5KAF E;  5CBO A;  2QJY B;  3OW2 O;  3EFF K;  1H0T A;  5AVZ B;  1YQ4 C;  3A0H H;  4IFF A;  1Q90 D;  3H25 A;  2M5A B;  1GU4 A;  3GMA A;  1H89 A;  1T3J A;  1VF5 B;  1KQG B;  4WY4 B;  1K73 Q;  2IFN A;  1HUC A;  5TIS E;  1L0N E;  1SFC D;  3ABV C;  3B5N A;  3M91 A;  3V2P A;  1FZF A;  3Q2Y A;  2E76 D;  4PJ0 E;  2B87 B;  1LTS C;  1IZN B;  1HBW A;  1VQ9 P;  1SQV E;  3ZDM A;  2FFD B;  2KZI A;  2JP3 A;  2N1T B;  4U3F D;  4U7J A;  1YIT P;  1LTJ A;  1PV3 A;  5AW6 B;  1LGH B;  2YMK A;  3GHG C;  2HFE D;  1KFN A;  3MP7 B;  1L0L J;  3KZI H;  1USE A;  5AVX B;  3TGU E;  1GD2 E;  1NU1 E;  1AFO A;  1PP9 D;  2KNC A;  1R5L A;  1SFC A;  2OYO A;  3B5N D;  1JY3 P;  2W6B A;  4Z1M H;  3P8M C;  4IL6 X;  4YXD C;  5CCH A;  3I55 P;  1MV8 A;  4BRY B;  1EC5 A;  2HYN A;  2Z4E A;  5L8R J;  4Y99 B;  2NPS B;  3H1K E;  2Y0E A;  1LT9 B;  4IL6 E;  3H1I E;  4AQR D;  1N8R Q;  3O6Q B;  3H32 B;  2ZT9 B;  5AVT B;  3TGU D;  2PAJ A;  2JEE A;  4H44 C;  1SQP J;  1KYO D;  1NO4 A;  3AE1 C;  1JMB A;  3IFM A;  3OAK A;  2HLO A;  4IOI H;  4PJ0 H;  3N7N A;  2WT7 B;  3PHL A; 
#chains in the Genus database with same CATH homology
 5B66 E;  4PJ0 E;  5B5E E;  5KAI E;  3JCU E;  5E79 E;  3KZI E;  4UB6 E;  3WU2 E;  5GTH E;  5H2F E;  5KAF E;  1S5L E;  1W5C E;  3A0H E;  3A0B E;  4IL6 E;  4UB8 E;  2AXT E;  5GTI E;  5TIS E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...