4PJ0O

Structure of t.elongatus photosystem ii, rows of dimers crystal packing
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
242
structure length
242
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
pubmed doi rcsb
molecule tags Oxidoreductase, electron transport
molecule keywords Photosystem Q(B) protein 1
total genus 46
structure length 242
sequence length 242
chains with identical sequence o
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 4pj0O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 4pj0O02
5TISO 5B66O 3JCUO 3A0BO 5G38A 3KZIO 5GTHO 4UB6O 1S5LO 5KAIO 5H2FO 5B5EO 3A0HO 5KAFO 4IL6O 5E79O 5GTIO 5G3AA 5G39A 4UB8O 4PJ0O 2AXTO 3WU2O
chains in the Genus database with same CATH superfamily
4FESA 2X9KA 3BRZA 4G75A 4GF4A 4CTDA 5TISO 2GE4A 2R4OA 3AA7A 2IWWA 1MPFA 5T5FA 2LFUA 3RBHA 2QTKA 2JQYA 2MHLA 4G76A 3FYXA 2WJRA 4O3WA 4AYEC 2R4NA 4GCPA 2J1NA 4KR4A 3VY9X 3LK2A 3WI4A 4LSEA 4N75A 3KVDD 4LSIA 4C4VB 4QQ1A 3VZWX 2XTRA 5KAIO 1MM5A 5B5EO 3A0HO 3POUA 2YNKA 3T20A 1GFQA 1ZHYA 2M07A 3HOEA 4IL6O 4JCHA 3DWNA 4O3YA 2N2MA 4FUVA 5DL5A 5E79O 5G39A 3O0EA 4AKMA 2W81C 5GV0A 3DA3A 4FQEA 1ZHZA 4AYDC 4GCQA 1Q9FA 3AAAA 4AKRB 2ZLDA 3PQUA 4B61A 4GCSA 1E54A 4C4VA 2XG6A 2F1TA 2Y0KA 3UAQA 1PHOA 2YPVA 4U9CA 3SYBA 2F1VA 1HXTA 1HXUA 1ZHXA 2W80C 2PORA 3A0BO 3JCUO 3NJTA 3SY9A 3BRYA 2KXPB 3PGRA 5G38A 3V8UA 3VY8X 2FGRA 4E1SA 3PRNA 3KZIO 1YS5A 4KR8A 3SZDA 3HWBA 2R4LA 3TZGA 5ADXK 1P4TA 5ADXL 2WVPA 3AAAB 1Q9GA 3DWOX 5GTHO 2N2LA 1H6S1 1IZNA 4FSOA 4AZLA 4FZLA 3G7GA 5DL7A 4F4BA 3AA0A 4N58A 1PRNA 1T16A 4JFBA 4RJWA 1GFMA 4AFKA 4BUMX 3QRCA 7PRNA 1OPFA 2ODJA 3DA4A 4GHBA 6PRNA 2K0LA 3AA1B 4UB8O 4C69X 3VZUX 3AA6A 2Y7SA 1GFNA 3LK2B 3T24A 2J4UP 4O4XA 1ZHTA 2R89A 2XE2A 3A2SX 3WI5A 1T1LA 4Z3TA 1BH3A 1IZNB 2IWVA 2KC0A 4O4UA 2R8AA 3T0SA 4AYID 5AFUL 4XNLA 2M06A 4FRXA 4PUXA 4XNKA 1ZHWA 4LSFA 4KRAA 2PRNA 3LK3A 5EE2A 3AA1A 3DZMA 2X27X 3AA6B 3QRAA 4LSHA 3PGUA 4O3XB 1MM4A 1S5LO 4UB6O 4AKRA 4AYMC 4FMSA 4FRTA 4RLCA 5DL6A 3PGSA 4E1TA 3EMNX 2XE3A 3AA7B 3HW9A 4N74A 1QJPA 2O4VA 4AYNA 1QJ9A 5FVNA 3C5OA 2Y0HA 3SYSA 4C00A 5IYUA 2ERVA 2XE5A 3VE1A 1ORMA 4FT6A 3PQSA 3PORA 2XE1A 1G90A 2MNHA 5AFUK 3GP6A 2ZFGA 4K3BA 3VE2A 4D64A 3VZTX 2OMFA 2F1CX 2Y0LA 3AAEB 5B66O 4D65A 4RJXA 1OSMA 3PF1A 3AA0B 2R4PA 2R88A 4FOZA 5PRNA 1HXXA 5JDPA 1BT9A 3BS0A 4N59A 2K4TA 3LK42 2KDYA 4O3ZA 5G26A 3SZVA 2JMMA 1GFPA 5DL8A 2KZ7B 2Y2XA 3NSGA 3UPGA 4AUIA 5GTIO 5H2FO 2WJQA 3UU2A 1THQA 5KAFO 3SY7A 3AAEA 4K3CA 3LK41 2KXPA 5D5DA 8PRNA 3JTYA 4FZNA 3POXA 2XTQA 4O49A 2FGQX 4FZMA 3POQA 4RL9A 3K19A 4RLBA 4PR7A 5G3AA 4D5UA 3HOLA 3LK3B 1GFOA 2XMXA 1QJ8A 4FSPA 4PJ0O 1BXWA 2AXTO 2LHFA 2KZ7A 3WU2O
chains in the Genus database with same CATH topology
5TISO 5B66O 3JCUO 3A0BO 5G38A 3KZIO 5GTHO 4UB6O 1S5LO 5KAIO 5H2FO 5B5EO 3A0HO 5KAFO 4IL6O 5E79O 5GTIO 5G3AA 5G39A 4UB8O 4PJ0O 2AXTO 3WU2O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS O;  5B66 O;  3JCU O;  3A0B O;  5G38 A;  3KZI O;  5GTH O;  4UB6 O;  1S5L O;  5KAI O;  5H2F O;  5B5E O;  3A0H O;  5KAF O;  4IL6 O;  5E79 O;  5GTI O;  5G3A A;  5G39 A;  4UB8 O;  4PJ0 O;  2AXT O;  3WU2 O; 
#chains in the Genus database with same CATH topology
 4FES A;  2X9K A;  3BRZ A;  4G75 A;  4GF4 A;  4CTD A;  5TIS O;  2GE4 A;  2R4O A;  3AA7 A;  2IWW A;  1MPF A;  5T5F A;  2LFU A;  3RBH A;  2QTK A;  2JQY A;  2MHL A;  4G76 A;  3FYX A;  2WJR A;  4O3W A;  4AYE C;  2R4N A;  4GCP A;  2J1N A;  4KR4 A;  3VY9 X;  3LK2 A;  3WI4 A;  4LSE A;  4N75 A;  3KVD D;  4LSI A;  4C4V B;  4QQ1 A;  3VZW X;  2XTR A;  5KAI O;  1MM5 A;  5B5E O;  3A0H O;  3POU A;  2YNK A;  3T20 A;  1GFQ A;  1ZHY A;  2M07 A;  3HOE A;  4IL6 O;  4JCH A;  3DWN A;  4O3Y A;  2N2M A;  4FUV A;  5DL5 A;  5E79 O;  5G39 A;  3O0E A;  4AKM A;  2W81 C;  5GV0 A;  3DA3 A;  4FQE A;  1ZHZ A;  4AYD C;  4GCQ A;  1Q9F A;  3AAA A;  4AKR B;  2ZLD A;  3PQU A;  4B61 A;  4GCS A;  1E54 A;  4C4V A;  2XG6 A;  2F1T A;  2Y0K A;  3UAQ A;  1PHO A;  2YPV A;  4U9C A;  3SYB A;  2F1V A;  1HXT A;  1HXU A;  1ZHX A;  2W80 C;  2POR A;  3A0B O;  3JCU O;  3NJT A;  3SY9 A;  3BRY A;  2KXP B;  3PGR A;  5G38 A;  3V8U A;  3VY8 X;  2FGR A;  4E1S A;  3PRN A;  3KZI O;  1YS5 A;  4KR8 A;  3SZD A;  3HWB A;  2R4L A;  3TZG A;  5ADX K;  1P4T A;  5ADX L;  2WVP A;  3AAA B;  1Q9G A;  3DWO X;  5GTH O;  2N2L A;  1H6S 1;  1IZN A;  4FSO A;  4AZL A;  4FZL A;  3G7G A;  5DL7 A;  4F4B A;  3AA0 A;  4N58 A;  1PRN A;  1T16 A;  4JFB A;  4RJW A;  1GFM A;  4AFK A;  4BUM X;  3QRC A;  7PRN A;  1OPF A;  2ODJ A;  3DA4 A;  4GHB A;  6PRN A;  2K0L A;  3AA1 B;  4UB8 O;  4C69 X;  3VZU X;  3AA6 A;  2Y7S A;  1GFN A;  3LK2 B;  3T24 A;  2J4U P;  4O4X A;  1ZHT A;  2R89 A;  2XE2 A;  3A2S X;  3WI5 A;  1T1L A;  4Z3T A;  1BH3 A;  1IZN B;  2IWV A;  2KC0 A;  4O4U A;  2R8A A;  3T0S A;  4AYI D;  5AFU L;  4XNL A;  2M06 A;  4FRX A;  4PUX A;  4XNK A;  1ZHW A;  4LSF A;  4KRA A;  2PRN A;  3LK3 A;  5EE2 A;  3AA1 A;  3DZM A;  2X27 X;  3AA6 B;  3QRA A;  4LSH A;  3PGU A;  4O3X B;  1MM4 A;  1S5L O;  4UB6 O;  4AKR A;  4AYM C;  4FMS A;  4FRT A;  4RLC A;  5DL6 A;  3PGS A;  4E1T A;  3EMN X;  2XE3 A;  3AA7 B;  3HW9 A;  4N74 A;  1QJP A;  2O4V A;  4AYN A;  1QJ9 A;  5FVN A;  3C5O A;  2Y0H A;  3SYS A;  4C00 A;  5IYU A;  2ERV A;  2XE5 A;  3VE1 A;  1ORM A;  4FT6 A;  3PQS A;  3POR A;  2XE1 A;  1G90 A;  2MNH A;  5AFU K;  3GP6 A;  2ZFG A;  4K3B A;  3VE2 A;  4D64 A;  3VZT X;  2OMF A;  2F1C X;  2Y0L A;  3AAE B;  5B66 O;  4D65 A;  4RJX A;  1OSM A;  3PF1 A;  3AA0 B;  2R4P A;  2R88 A;  4FOZ A;  5PRN A;  1HXX A;  5JDP A;  1BT9 A;  3BS0 A;  4N59 A;  2K4T A;  3LK4 2;  2KDY A;  4O3Z A;  5G26 A;  3SZV A;  2JMM A;  1GFP A;  5DL8 A;  2KZ7 B;  2Y2X A;  3NSG A;  3UPG A;  4AUI A;  5GTI O;  5H2F O;  2WJQ A;  3UU2 A;  1THQ A;  5KAF O;  3SY7 A;  3AAE A;  4K3C A;  3LK4 1;  2KXP A;  5D5D A;  8PRN A;  3JTY A;  4FZN A;  3POX A;  2XTQ A;  4O49 A;  2FGQ X;  4FZM A;  3POQ A;  4RL9 A;  3K19 A;  4RLB A;  4PR7 A;  5G3A A;  4D5U A;  3HOL A;  3LK3 B;  1GFO A;  2XMX A;  1QJ8 A;  4FSP A;  4PJ0 O;  1BXW A;  2AXT O;  2LHF A;  2KZ7 A;  3WU2 O; 
#chains in the Genus database with same CATH homology
 5TIS O;  5B66 O;  3JCU O;  3A0B O;  5G38 A;  3KZI O;  5GTH O;  4UB6 O;  1S5L O;  5KAI O;  5H2F O;  5B5E O;  3A0H O;  5KAF O;  4IL6 O;  5E79 O;  5GTI O;  5G3A A;  5G39 A;  4UB8 O;  4PJ0 O;  2AXT O;  3WU2 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...