4PJ0O

Structure of t.elongatus photosystem ii, rows of dimers crystal packing
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
242
structure length
242
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein 1
publication title Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
pubmed doi rcsb
molecule tags Oxidoreductase, electron transport
total genus 46
structure length 242
sequence length 242
chains with identical sequence o
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 4pj0O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 4pj0O02
3A0BO 4UB8O 5G39A 5KAFO 5KAIO 5GTHO 5B5EO 5GTIO 3JCUO 4IL6O 4UB6O 5E79O 3A0HO 5H2FO 4PJ0O 5G3AA 3KZIO 5TISO 5B66O 5G38A 2AXTO 3WU2O 1S5LO
chains in the Genus database with same CATH superfamily
1PHOA 4GHBA 1G90A 2XE1A 5GV0A 6PRNA 3AAAB 1ZHXA 3PQSA 4C69X 5G39A 4XNLA 3VE2A 4O3XB 5KAIO 3BRZA 1ZHYA 2Y7SA 3SZVA 2F1TA 4FMSA 4FOZA 3SY7A 1GFMA 3LK2B 5GTIO 3LK2A 3NJTA 3HW9A 5DL7A 3WI4A 5DL6A 3RBHA 1Q9FA 3JTYA 2K4TA 4FQEA 4RLBA 4D65A 4PUXA 2KZ7B 1MPFA 5ADXL 2KZ7A 2W80C 1ZHZA 2XTRA 3A2SX 3NSGA 2XE3A 3DA3A 4RL9A 5H2FO 7PRNA 3UAQA 3GP6A 2KXPB 2XMXA 4KR8A 3KZIO 3DZMA 1IZNB 2Y0HA 4LSFA 5DL5A 5FVNA 2WVPA 2ERVA 2PORA 2XTQA 3G7GA 4JFBA 5G26A 1THQA 4KR4A 4QQ1A 2W81C 2WJRA 4RJWA 3WU2O 4RJXA 4AYDC 2O4VA 1BH3A 2YPVA 4N59A 2LHFA 4O4UA 4G75A 3PGUA 4AFKA 3SYSA 3VZUX 3SYBA 2XE2A 3PGSA 3AAAA 1Q9GA 2R8AA 4AKRB 5GTHO 3DA4A 3T0SA 1P4TA 2QTKA 2ZFGA 1T16A 3EMNX 4O3WA 4C00A 2MHLA 4AKMA 2KC0A 3VE1A 5EE2A 3LK42 4GCPA 4UB6O 3SZDA 2OMFA 4N58A 3KVDD 2WJQA 3UPGA 4C4VB 3A0HO 4C4VA 2J4UP 1GFNA 1ZHWA 2N2LA 2JQYA 4N75A 4AYMC 4PJ0O 2J1NA 4FZLA 3VY8X 4FUVA 4AUIA 4Z3TA 1QJPA 4FZNA 5DL8A 3HOLA 5PRNA 1QJ9A 3PRNA 3BS0A 2KXPA 3PGRA 3POQA 3C5OA 3T24A 1IZNA 3AA1B 4O4XA 5G38A 5T5FA 4O3YA 2GE4A 3AA0B 3BRYA 2X9KA 3AA0A 4KRAA 3VZWX 3PQUA 5JDPA 1HXXA 4UB8O 1HXUA 3HWBA 4D64A 4K3BA 3WI5A 4AYID 5B5EO 3POXA 4AKRA 2XE5A 4E1TA 1YS5A 1H6S1 3O0EA 2M07A 1QJ8A 2KDYA 4GF4A 2ZLDA 3PF1A 2ODJA 4LSHA 4F4BA 3AAEB 5IYUA 4B61A 2R89A 2Y0KA 4LSEA 8PRNA 2Y2XA 4FSPA 5AFUK 2N2MA 2K0LA 4JCHA 4FRXA 5G3AA 4AZLA 3VY9X 1E54A 4FRTA 4GCSA 1GFQA 2IWVA 5B66O 2F1CX 1ORMA 2R4NA 3AA7B 1ZHTA 4O49A 4K3CA 2XG6A 4G76A 2FGRA 5TISO 4O3ZA 3AA1A 1OSMA 1T1LA 4XNKA 1BXWA 1MM4A 4CTDA 2FGQX 3QRAA 3A0BO 4FT6A 5KAFO 2R4OA 3LK3B 2IWWA 1PRNA 3LK3A 4E1SA 2LFUA 5D5DA 1GFPA 3JCUO 5AFUL 2JMMA 3LK41 4RLCA 3DWOX 2Y0LA 4GCQA 2F1VA 4IL6O 4N74A 3TZGA 4BUMX 2M06A 2MNHA 3PORA 5E79O 4FZMA 3AAEA 3POUA 3UU2A 2X27X 4PR7A 1OPFA 4FSOA 1HXTA 3FYXA 2PRNA 3AA6B 1GFOA 2YNKA 3K19A 1MM5A 3AA6A 3HOEA 1BT9A 2R4PA 3QRCA 4U9CA 4D5UA 5ADXK 3VZTX 2R4LA 2R88A 3DWNA 4LSIA 3T20A 3SY9A 4AYNA 2AXTO 4AYEC 3V8UA 4FESA 3AA7A 1S5LO
chains in the Genus database with same CATH topology
3A0BO 4UB8O 5G39A 5KAFO 5KAIO 5GTHO 5B5EO 5GTIO 3JCUO 4IL6O 4UB6O 5E79O 3A0HO 5H2FO 4PJ0O 5G3AA 3KZIO 5TISO 5B66O 5G38A 2AXTO 3WU2O 1S5LO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0B O;  4UB8 O;  5G39 A;  5KAF O;  5KAI O;  5GTH O;  5B5E O;  5GTI O;  3JCU O;  4IL6 O;  4UB6 O;  5E79 O;  3A0H O;  5H2F O;  4PJ0 O;  5G3A A;  3KZI O;  5TIS O;  5B66 O;  5G38 A;  2AXT O;  3WU2 O;  1S5L O; 
#chains in the Genus database with same CATH topology
 1PHO A;  4GHB A;  1G90 A;  2XE1 A;  5GV0 A;  6PRN A;  3AAA B;  1ZHX A;  3PQS A;  4C69 X;  5G39 A;  4XNL A;  3VE2 A;  4O3X B;  5KAI O;  3BRZ A;  1ZHY A;  2Y7S A;  3SZV A;  2F1T A;  4FMS A;  4FOZ A;  3SY7 A;  1GFM A;  3LK2 B;  5GTI O;  3LK2 A;  3NJT A;  3HW9 A;  5DL7 A;  3WI4 A;  5DL6 A;  3RBH A;  1Q9F A;  3JTY A;  2K4T A;  4FQE A;  4RLB A;  4D65 A;  4PUX A;  2KZ7 B;  1MPF A;  5ADX L;  2KZ7 A;  2W80 C;  1ZHZ A;  2XTR A;  3A2S X;  3NSG A;  2XE3 A;  3DA3 A;  4RL9 A;  5H2F O;  7PRN A;  3UAQ A;  3GP6 A;  2KXP B;  2XMX A;  4KR8 A;  3KZI O;  3DZM A;  1IZN B;  2Y0H A;  4LSF A;  5DL5 A;  5FVN A;  2WVP A;  2ERV A;  2POR A;  2XTQ A;  3G7G A;  4JFB A;  5G26 A;  1THQ A;  4KR4 A;  4QQ1 A;  2W81 C;  2WJR A;  4RJW A;  3WU2 O;  4RJX A;  4AYD C;  2O4V A;  1BH3 A;  2YPV A;  4N59 A;  2LHF A;  4O4U A;  4G75 A;  3PGU A;  4AFK A;  3SYS A;  3VZU X;  3SYB A;  2XE2 A;  3PGS A;  3AAA A;  1Q9G A;  2R8A A;  4AKR B;  5GTH O;  3DA4 A;  3T0S A;  1P4T A;  2QTK A;  2ZFG A;  1T16 A;  3EMN X;  4O3W A;  4C00 A;  2MHL A;  4AKM A;  2KC0 A;  3VE1 A;  5EE2 A;  3LK4 2;  4GCP A;  4UB6 O;  3SZD A;  2OMF A;  4N58 A;  3KVD D;  2WJQ A;  3UPG A;  4C4V B;  3A0H O;  4C4V A;  2J4U P;  1GFN A;  1ZHW A;  2N2L A;  2JQY A;  4N75 A;  4AYM C;  4PJ0 O;  2J1N A;  4FZL A;  3VY8 X;  4FUV A;  4AUI A;  4Z3T A;  1QJP A;  4FZN A;  5DL8 A;  3HOL A;  5PRN A;  1QJ9 A;  3PRN A;  3BS0 A;  2KXP A;  3PGR A;  3POQ A;  3C5O A;  3T24 A;  1IZN A;  3AA1 B;  4O4X A;  5G38 A;  5T5F A;  4O3Y A;  2GE4 A;  3AA0 B;  3BRY A;  2X9K A;  3AA0 A;  4KRA A;  3VZW X;  3PQU A;  5JDP A;  1HXX A;  4UB8 O;  1HXU A;  3HWB A;  4D64 A;  4K3B A;  3WI5 A;  4AYI D;  5B5E O;  3POX A;  4AKR A;  2XE5 A;  4E1T A;  1YS5 A;  1H6S 1;  3O0E A;  2M07 A;  1QJ8 A;  2KDY A;  4GF4 A;  2ZLD A;  3PF1 A;  2ODJ A;  4LSH A;  4F4B A;  3AAE B;  5IYU A;  4B61 A;  2R89 A;  2Y0K A;  4LSE A;  8PRN A;  2Y2X A;  4FSP A;  5AFU K;  2N2M A;  2K0L A;  4JCH A;  4FRX A;  5G3A A;  4AZL A;  3VY9 X;  1E54 A;  4FRT A;  4GCS A;  1GFQ A;  2IWV A;  5B66 O;  2F1C X;  1ORM A;  2R4N A;  3AA7 B;  1ZHT A;  4O49 A;  4K3C A;  2XG6 A;  4G76 A;  2FGR A;  5TIS O;  4O3Z A;  3AA1 A;  1OSM A;  1T1L A;  4XNK A;  1BXW A;  1MM4 A;  4CTD A;  2FGQ X;  3QRA A;  3A0B O;  4FT6 A;  5KAF O;  2R4O A;  3LK3 B;  2IWW A;  1PRN A;  3LK3 A;  4E1S A;  2LFU A;  5D5D A;  1GFP A;  3JCU O;  5AFU L;  2JMM A;  3LK4 1;  4RLC A;  3DWO X;  2Y0L A;  4GCQ A;  2F1V A;  4IL6 O;  4N74 A;  3TZG A;  4BUM X;  2M06 A;  2MNH A;  3POR A;  5E79 O;  4FZM A;  3AAE A;  3POU A;  3UU2 A;  2X27 X;  4PR7 A;  1OPF A;  4FSO A;  1HXT A;  3FYX A;  2PRN A;  3AA6 B;  1GFO A;  2YNK A;  3K19 A;  1MM5 A;  3AA6 A;  3HOE A;  1BT9 A;  2R4P A;  3QRC A;  4U9C A;  4D5U A;  5ADX K;  3VZT X;  2R4L A;  2R88 A;  3DWN A;  4LSI A;  3T20 A;  3SY9 A;  4AYN A;  2AXT O;  4AYE C;  3V8U A;  4FES A;  3AA7 A;  1S5L O; 
#chains in the Genus database with same CATH homology
 3A0B O;  4UB8 O;  5G39 A;  5KAF O;  5KAI O;  5GTH O;  5B5E O;  5GTI O;  3JCU O;  4IL6 O;  4UB6 O;  5E79 O;  3A0H O;  5H2F O;  4PJ0 O;  5G3A A;  3KZI O;  5TIS O;  5B66 O;  5G38 A;  2AXT O;  3WU2 O;  1S5L O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...