4PJ0O

Structure of t.elongatus photosystem ii, rows of dimers crystal packing
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
242
structure length
242
Chain Sequence
b'TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein 1
publication title Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
pubmed doi rcsb
molecule tags Oxidoreductase, electron transport
total genus 46
structure length 242
sequence length 242
chains with identical sequence o
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 4pj0O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 4pj0O02
3JCUO 3KZIO 5G38A 5B66O 1S5LO 5E79O 3WU2O 5G3AA 5GTHO 3A0BO 4UB6O 5GTIO 5G39A 5KAFO 2AXTO 4UB8O 4IL6O 4PJ0O 5B5EO 3A0HO 5H2FO 5KAIO 5TISO
chains in the Genus database with same CATH superfamily
3WI5A 3NSGA 4C4VB 3VZUX 3HOEA 2KC0A 4GCSA 1IZNB 5DL7A 2PORA 2XMXA 2W80C 1HXTA 2FGQX 2ZFGA 4GHBA 4LSFA 3TZGA 4AYMC 5IYUA 4LSIA 2K4TA 3A0BO 4QQ1A 1G90A 2O4VA 3LK42 2KZ7A 1THQA 2XTRA 1ZHWA 2MNHA 2Y7SA 4AFKA 3PQSA 4AKMA 5JDPA 1QJPA 3AAAA 3LK41 1GFPA 4N59A 3VZWX 4LSEA 3PQUA 3AA7B 2IWWA 2R4PA 1T16A 3SY7A 4FSOA 2Y0LA 4O49A 5DL5A 2X27X 5DL8A 3FYXA 3O0EA 4E1SA 4FZLA 3V8UA 2R4NA 3LK2A 5EE2A 3A0HO 3DWOX 2GE4A 2M06A 3QRCA 2FGRA 2PRNA 1BXWA 2IWVA 4Z3TA 2N2MA 3T20A 4O3WA 2QTKA 4AYEC 4D64A 1BH3A 4XNLA 1YS5A 5B66O 4AUIA 4FRTA 5T5FA 3UPGA 1MPFA 4G76A 3UAQA 2KZ7B 4FOZA 4FMSA 2LHFA 3VE2A 4LSHA 1OPFA 2KXPA 3VY8X 3AAAB 3BS0A 3SYSA 1GFMA 2Y0HA 3NJTA 3POUA 5GTIO 3PRNA 5G39A 4AKRA 5GV0A 5KAFO 2XE2A 2MHLA 2Y2XA 3AA6A 3VY9X 1P4TA 2WVPA 4IL6O 2WJQA 4FUVA 1BT9A 2LFUA 3G7GA 2XTQA 3KVDD 3LK2B 1QJ9A 2JQYA 3PORA 3QRAA 4O3YA 3SYBA 2OMFA 5G26A 1OSMA 1PHOA 3DA4A 4RL9A 4C69X 2R4LA 2ODJA 3C5OA 2F1VA 2X9KA 3KZIO 4O4UA 4PUXA 4RJWA 3JCUO 2W81C 4G75A 5ADXL 4PR7A 3GP6A 4FQEA 4FZMA 3HW9A 3HOLA 3WI4A 2K0LA 4D5UA 1HXXA 3DWNA 1GFQA 4K3BA 2XE3A 4N75A 3PF1A 3AA0A 2R89A 2KXPB 2WJRA 4N58A 4B61A 4GCPA 2F1CX 2F1TA 5E79O 4JFBA 1E54A 3DA3A 1Q9FA 3AA1A 3SZVA 4AKRB 4F4BA 5FVNA 4K3CA 1MM4A 4KR4A 3PGSA 3AA6B 1H6S1 4UB6O 4XNKA 5PRNA 4O4XA 3UU2A 2XE1A 3BRZA 4AYID 2R88A 1T1LA 2AXTO 4FRXA 2ERVA 2YPVA 4N74A 4UB8O 5DL6A 3A2SX 4D65A 5AFUL 4PJ0O 6PRNA 1ZHXA 3DZMA 2R4OA 4O3ZA 4RLBA 1Q9GA 3AAEA 3PGUA 3EMNX 2M07A 5H2FO 5KAIO 3LK3A 4C00A 4AYDC 4BUMX 2JMMA 2ZLDA 2N2LA 3AA0B 4FT6A 1HXUA 2J1NA 4GCQA 4C4VA 4KRAA 3K19A 3JTYA 2J4UP 1ZHTA 5D5DA 1QJ8A 5G38A 5ADXK 2YNKA 1S5LO 1IZNA 4AYNA 1PRNA 4KR8A 3AA1B 1ORMA 2KDYA 3VZTX 3WU2O 3VE1A 5G3AA 1MM5A 4E1TA 3T24A 5GTHO 3SZDA 4FESA 3RBHA 3PGRA 1GFNA 3BRYA 4FSPA 2XE5A 4FZNA 4U9CA 3T0SA 4CTDA 2Y0KA 1ZHZA 1ZHYA 3AAEB 4JCHA 1GFOA 3POXA 7PRNA 3AA7A 3LK3B 4O3XB 4AZLA 2R8AA 3POQA 5AFUK 5B5EO 8PRNA 4GF4A 4RJXA 3HWBA 2XG6A 3SY9A 5TISO 4RLCA
chains in the Genus database with same CATH topology
3JCUO 3KZIO 5G38A 5B66O 1S5LO 5E79O 3WU2O 5G3AA 5GTHO 3A0BO 4UB6O 5GTIO 5G39A 5KAFO 2AXTO 4UB8O 4IL6O 4PJ0O 5B5EO 3A0HO 5H2FO 5KAIO 5TISO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCU O;  3KZI O;  5G38 A;  5B66 O;  1S5L O;  5E79 O;  3WU2 O;  5G3A A;  5GTH O;  3A0B O;  4UB6 O;  5GTI O;  5G39 A;  5KAF O;  2AXT O;  4UB8 O;  4IL6 O;  4PJ0 O;  5B5E O;  3A0H O;  5H2F O;  5KAI O;  5TIS O; 
#chains in the Genus database with same CATH topology
 3WI5 A;  3NSG A;  4C4V B;  3VZU X;  3HOE A;  2KC0 A;  4GCS A;  1IZN B;  5DL7 A;  2POR A;  2XMX A;  2W80 C;  1HXT A;  2FGQ X;  2ZFG A;  4GHB A;  4LSF A;  3TZG A;  4AYM C;  5IYU A;  4LSI A;  2K4T A;  3A0B O;  4QQ1 A;  1G90 A;  2O4V A;  3LK4 2;  2KZ7 A;  1THQ A;  2XTR A;  1ZHW A;  2MNH A;  2Y7S A;  4AFK A;  3PQS A;  4AKM A;  5JDP A;  1QJP A;  3AAA A;  3LK4 1;  1GFP A;  4N59 A;  3VZW X;  4LSE A;  3PQU A;  3AA7 B;  2IWW A;  2R4P A;  1T16 A;  3SY7 A;  4FSO A;  2Y0L A;  4O49 A;  5DL5 A;  2X27 X;  5DL8 A;  3FYX A;  3O0E A;  4E1S A;  4FZL A;  3V8U A;  2R4N A;  3LK2 A;  5EE2 A;  3A0H O;  3DWO X;  2GE4 A;  2M06 A;  3QRC A;  2FGR A;  2PRN A;  1BXW A;  2IWV A;  4Z3T A;  2N2M A;  3T20 A;  4O3W A;  2QTK A;  4AYE C;  4D64 A;  1BH3 A;  4XNL A;  1YS5 A;  5B66 O;  4AUI A;  4FRT A;  5T5F A;  3UPG A;  1MPF A;  4G76 A;  3UAQ A;  2KZ7 B;  4FOZ A;  4FMS A;  2LHF A;  3VE2 A;  4LSH A;  1OPF A;  2KXP A;  3VY8 X;  3AAA B;  3BS0 A;  3SYS A;  1GFM A;  2Y0H A;  3NJT A;  3POU A;  5GTI O;  3PRN A;  5G39 A;  4AKR A;  5GV0 A;  5KAF O;  2XE2 A;  2MHL A;  2Y2X A;  3AA6 A;  3VY9 X;  1P4T A;  2WVP A;  4IL6 O;  2WJQ A;  4FUV A;  1BT9 A;  2LFU A;  3G7G A;  2XTQ A;  3KVD D;  3LK2 B;  1QJ9 A;  2JQY A;  3POR A;  3QRA A;  4O3Y A;  3SYB A;  2OMF A;  5G26 A;  1OSM A;  1PHO A;  3DA4 A;  4RL9 A;  4C69 X;  2R4L A;  2ODJ A;  3C5O A;  2F1V A;  2X9K A;  3KZI O;  4O4U A;  4PUX A;  4RJW A;  3JCU O;  2W81 C;  4G75 A;  5ADX L;  4PR7 A;  3GP6 A;  4FQE A;  4FZM A;  3HW9 A;  3HOL A;  3WI4 A;  2K0L A;  4D5U A;  1HXX A;  3DWN A;  1GFQ A;  4K3B A;  2XE3 A;  4N75 A;  3PF1 A;  3AA0 A;  2R89 A;  2KXP B;  2WJR A;  4N58 A;  4B61 A;  4GCP A;  2F1C X;  2F1T A;  5E79 O;  4JFB A;  1E54 A;  3DA3 A;  1Q9F A;  3AA1 A;  3SZV A;  4AKR B;  4F4B A;  5FVN A;  4K3C A;  1MM4 A;  4KR4 A;  3PGS A;  3AA6 B;  1H6S 1;  4UB6 O;  4XNK A;  5PRN A;  4O4X A;  3UU2 A;  2XE1 A;  3BRZ A;  4AYI D;  2R88 A;  1T1L A;  2AXT O;  4FRX A;  2ERV A;  2YPV A;  4N74 A;  4UB8 O;  5DL6 A;  3A2S X;  4D65 A;  5AFU L;  4PJ0 O;  6PRN A;  1ZHX A;  3DZM A;  2R4O A;  4O3Z A;  4RLB A;  1Q9G A;  3AAE A;  3PGU A;  3EMN X;  2M07 A;  5H2F O;  5KAI O;  3LK3 A;  4C00 A;  4AYD C;  4BUM X;  2JMM A;  2ZLD A;  2N2L A;  3AA0 B;  4FT6 A;  1HXU A;  2J1N A;  4GCQ A;  4C4V A;  4KRA A;  3K19 A;  3JTY A;  2J4U P;  1ZHT A;  5D5D A;  1QJ8 A;  5G38 A;  5ADX K;  2YNK A;  1S5L O;  1IZN A;  4AYN A;  1PRN A;  4KR8 A;  3AA1 B;  1ORM A;  2KDY A;  3VZT X;  3WU2 O;  3VE1 A;  5G3A A;  1MM5 A;  4E1T A;  3T24 A;  5GTH O;  3SZD A;  4FES A;  3RBH A;  3PGR A;  1GFN A;  3BRY A;  4FSP A;  2XE5 A;  4FZN A;  4U9C A;  3T0S A;  4CTD A;  2Y0K A;  1ZHZ A;  1ZHY A;  3AAE B;  4JCH A;  1GFO A;  3POX A;  7PRN A;  3AA7 A;  3LK3 B;  4O3X B;  4AZL A;  2R8A A;  3POQ A;  5AFU K;  5B5E O;  8PRN A;  4GF4 A;  4RJX A;  3HWB A;  2XG6 A;  3SY9 A;  5TIS O;  4RLC A; 
#chains in the Genus database with same CATH homology
 3JCU O;  3KZI O;  5G38 A;  5B66 O;  1S5L O;  5E79 O;  3WU2 O;  5G3A A;  5GTH O;  3A0B O;  4UB6 O;  5GTI O;  5G39 A;  5KAF O;  2AXT O;  4UB8 O;  4IL6 O;  4PJ0 O;  5B5E O;  3A0H O;  5H2F O;  5KAI O;  5TIS O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...