4PJ0O

Structure of t.elongatus photosystem ii, rows of dimers crystal packing
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
242
structure length
242
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
pubmed doi rcsb
molecule tags Oxidoreductase, electron transport
molecule keywords Photosystem Q(B) protein 1
total genus 46
structure length 242
sequence length 242
chains with identical sequence o
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 4pj0O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 4pj0O02
3JCUO 3KZIO 5KAFO 5H2FO 2AXTO 5GTIO 3A0BO 4UB6O 5E79O 5G3AA 5TISO 4UB8O 5G38A 5GTHO 3WU2O 5B5EO 4PJ0O 5G39A 3A0HO 1S5LO 4IL6O 5B66O 5KAIO
chains in the Genus database with same CATH superfamily
3JCUO 5FVNA 4PR7A 2R4OA 2MHLA 4O3ZA 3QRCA 5JDPA 3VZWX 3UU2A 3DA3A 4FZLA 5PRNA 7PRNA 1BH3A 4RJXA 2X27X 4G76A 4JCHA 1T16A 3RBHA 4KR4A 4O4XA 3AA0B 2N2LA 2YNKA 3VE2A 4O4UA 5G3AA 2FGRA 5DL6A 4PUXA 3JTYA 3PGUA 1YS5A 3VY9X 4AKRA 3AA6A 3VZTX 4C00A 4FSPA 2R4LA 4KRAA 1OSMA 4O3XB 2XE3A 4AKMA 2GE4A 3WU2O 4F4BA 2R8AA 2XE5A 3HOEA 2ZFGA 3PGRA 4BUMX 1S5LO 4AFKA 8PRNA 2IWVA 2YPVA 3SZVA 2QTKA 3PORA 3G7GA 3C5OA 3VZUX 3TZGA 3PQUA 5G26A 3A2SX 1ZHYA 1ZHXA 2KDYA 2LFUA 2O4VA 2LHFA 1BT9A 1MPFA 2Y0LA 2ZLDA 3AA6B 3AAEB 3HW9A 3DA4A 3KZIO 4FMSA 4AYEC 5IYUA 3UPGA 3VE1A 3WI4A 3WI5A 1HXXA 2R89A 2Y2XA 3BRYA 4UB6O 5DL7A 3K19A 3POXA 4JFBA 4D64A 2IWWA 4B61A 5AFUK 4GCPA 2FGQX 4XNKA 2W80C 3O0EA 4FOZA 2XMXA 4N58A 5TISO 4AKRB 1G90A 6PRNA 2Y7SA 1PRNA 3SYSA 2XE1A 3VY8X 2KXPA 5GTHO 4O49A 5ADXK 1GFOA 4FRXA 4LSEA 2OMFA 4PJ0O 5G39A 5T5FA 4KR8A 4N75A 1QJ8A 1ZHTA 2F1CX 1BXWA 1HXUA 2X9KA 3HWBA 4FRTA 2XTQA 1IZNA 3AAAB 3PRNA 4IL6O 2N2MA 4O3WA 2XG6A 4U9CA 3T24A 3BRZA 3V8UA 2WJQA 4K3CA 3EMNX 1PHOA 3AA7A 1ORMA 2MNHA 3SYBA 4LSIA 2W81C 3PF1A 4LSHA 3AA7B 5DL8A 4N59A 4D5UA 1MM4A 4FESA 5EE2A 3GP6A 3HOLA 2AXTO 2KC0A 2K4TA 3LK2A 3POQA 4FQEA 4GCQA 3DZMA 4AZLA 5GV0A 1IZNB 4GCSA 1HXTA 3AA1A 5E79O 2M07A 4C4VB 5D5DA 2KXPB 4LSFA 4D65A 5ADXL 2PRNA 2WJRA 4FT6A 3LK3B 5B5EO 3QRAA 4QQ1A 1QJPA 2F1VA 2R4NA 4FZMA 4K3BA 1T1LA 2PORA 4FUVA 4RL9A 3UAQA 3AA1B 2ERVA 4FSOA 2JQYA 4AYMC 4RLCA 3DWNA 5KAIO 3FYXA 4XNLA 4C69X 4GF4A 4CTDA 2J1NA 3AAEA 3BS0A 1OPFA 1QJ9A 3KVDD 4RJWA 1E54A 3SY9A 1H6S1 5KAFO 5H2FO 2K0LA 1Q9FA 2R4PA 4GHBA 1MM5A 3A0BO 3DWOX 5GTIO 3NSGA 2M06A 4N74A 3NJTA 3PGSA 2JMMA 3LK41 5DL5A 4AUIA 3T20A 4Z3TA 3AAAA 1GFMA 4RLBA 4E1SA 3AA0A 1ZHWA 2KZ7A 2ODJA 2R88A 2Y0HA 1THQA 4UB8O 5G38A 1P4TA 4FZNA 3SY7A 3T0SA 1GFPA 2WVPA 4AYID 2Y0KA 2XE2A 3PQSA 3A0HO 3LK3A 3LK2B 2J4UP 4O3YA 1GFQA 4G75A 1ZHZA 3SZDA 4C4VA 5AFUL 2F1TA 4AYNA 3LK42 4AYDC 5B66O 1Q9GA 2KZ7B 4E1TA 2XTRA 3POUA 1GFNA
chains in the Genus database with same CATH topology
3JCUO 3KZIO 5KAFO 5H2FO 2AXTO 5GTIO 3A0BO 4UB6O 5E79O 5G3AA 5TISO 4UB8O 5G38A 5GTHO 3WU2O 5B5EO 4PJ0O 5G39A 3A0HO 1S5LO 4IL6O 5B66O 5KAIO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCU O;  3KZI O;  5KAF O;  5H2F O;  2AXT O;  5GTI O;  3A0B O;  4UB6 O;  5E79 O;  5G3A A;  5TIS O;  4UB8 O;  5G38 A;  5GTH O;  3WU2 O;  5B5E O;  4PJ0 O;  5G39 A;  3A0H O;  1S5L O;  4IL6 O;  5B66 O;  5KAI O; 
#chains in the Genus database with same CATH topology
 3JCU O;  5FVN A;  4PR7 A;  2R4O A;  2MHL A;  4O3Z A;  3QRC A;  5JDP A;  3VZW X;  3UU2 A;  3DA3 A;  4FZL A;  5PRN A;  7PRN A;  1BH3 A;  4RJX A;  2X27 X;  4G76 A;  4JCH A;  1T16 A;  3RBH A;  4KR4 A;  4O4X A;  3AA0 B;  2N2L A;  2YNK A;  3VE2 A;  4O4U A;  5G3A A;  2FGR A;  5DL6 A;  4PUX A;  3JTY A;  3PGU A;  1YS5 A;  3VY9 X;  4AKR A;  3AA6 A;  3VZT X;  4C00 A;  4FSP A;  2R4L A;  4KRA A;  1OSM A;  4O3X B;  2XE3 A;  4AKM A;  2GE4 A;  3WU2 O;  4F4B A;  2R8A A;  2XE5 A;  3HOE A;  2ZFG A;  3PGR A;  4BUM X;  1S5L O;  4AFK A;  8PRN A;  2IWV A;  2YPV A;  3SZV A;  2QTK A;  3POR A;  3G7G A;  3C5O A;  3VZU X;  3TZG A;  3PQU A;  5G26 A;  3A2S X;  1ZHY A;  1ZHX A;  2KDY A;  2LFU A;  2O4V A;  2LHF A;  1BT9 A;  1MPF A;  2Y0L A;  2ZLD A;  3AA6 B;  3AAE B;  3HW9 A;  3DA4 A;  3KZI O;  4FMS A;  4AYE C;  5IYU A;  3UPG A;  3VE1 A;  3WI4 A;  3WI5 A;  1HXX A;  2R89 A;  2Y2X A;  3BRY A;  4UB6 O;  5DL7 A;  3K19 A;  3POX A;  4JFB A;  4D64 A;  2IWW A;  4B61 A;  5AFU K;  4GCP A;  2FGQ X;  4XNK A;  2W80 C;  3O0E A;  4FOZ A;  2XMX A;  4N58 A;  5TIS O;  4AKR B;  1G90 A;  6PRN A;  2Y7S A;  1PRN A;  3SYS A;  2XE1 A;  3VY8 X;  2KXP A;  5GTH O;  4O49 A;  5ADX K;  1GFO A;  4FRX A;  4LSE A;  2OMF A;  4PJ0 O;  5G39 A;  5T5F A;  4KR8 A;  4N75 A;  1QJ8 A;  1ZHT A;  2F1C X;  1BXW A;  1HXU A;  2X9K A;  3HWB A;  4FRT A;  2XTQ A;  1IZN A;  3AAA B;  3PRN A;  4IL6 O;  2N2M A;  4O3W A;  2XG6 A;  4U9C A;  3T24 A;  3BRZ A;  3V8U A;  2WJQ A;  4K3C A;  3EMN X;  1PHO A;  3AA7 A;  1ORM A;  2MNH A;  3SYB A;  4LSI A;  2W81 C;  3PF1 A;  4LSH A;  3AA7 B;  5DL8 A;  4N59 A;  4D5U A;  1MM4 A;  4FES A;  5EE2 A;  3GP6 A;  3HOL A;  2AXT O;  2KC0 A;  2K4T A;  3LK2 A;  3POQ A;  4FQE A;  4GCQ A;  3DZM A;  4AZL A;  5GV0 A;  1IZN B;  4GCS A;  1HXT A;  3AA1 A;  5E79 O;  2M07 A;  4C4V B;  5D5D A;  2KXP B;  4LSF A;  4D65 A;  5ADX L;  2PRN A;  2WJR A;  4FT6 A;  3LK3 B;  5B5E O;  3QRA A;  4QQ1 A;  1QJP A;  2F1V A;  2R4N A;  4FZM A;  4K3B A;  1T1L A;  2POR A;  4FUV A;  4RL9 A;  3UAQ A;  3AA1 B;  2ERV A;  4FSO A;  2JQY A;  4AYM C;  4RLC A;  3DWN A;  5KAI O;  3FYX A;  4XNL A;  4C69 X;  4GF4 A;  4CTD A;  2J1N A;  3AAE A;  3BS0 A;  1OPF A;  1QJ9 A;  3KVD D;  4RJW A;  1E54 A;  3SY9 A;  1H6S 1;  5KAF O;  5H2F O;  2K0L A;  1Q9F A;  2R4P A;  4GHB A;  1MM5 A;  3A0B O;  3DWO X;  5GTI O;  3NSG A;  2M06 A;  4N74 A;  3NJT A;  3PGS A;  2JMM A;  3LK4 1;  5DL5 A;  4AUI A;  3T20 A;  4Z3T A;  3AAA A;  1GFM A;  4RLB A;  4E1S A;  3AA0 A;  1ZHW A;  2KZ7 A;  2ODJ A;  2R88 A;  2Y0H A;  1THQ A;  4UB8 O;  5G38 A;  1P4T A;  4FZN A;  3SY7 A;  3T0S A;  1GFP A;  2WVP A;  4AYI D;  2Y0K A;  2XE2 A;  3PQS A;  3A0H O;  3LK3 A;  3LK2 B;  2J4U P;  4O3Y A;  1GFQ A;  4G75 A;  1ZHZ A;  3SZD A;  4C4V A;  5AFU L;  2F1T A;  4AYN A;  3LK4 2;  4AYD C;  5B66 O;  1Q9G A;  2KZ7 B;  4E1T A;  2XTR A;  3POU A;  1GFN A; 
#chains in the Genus database with same CATH homology
 3JCU O;  3KZI O;  5KAF O;  5H2F O;  2AXT O;  5GTI O;  3A0B O;  4UB6 O;  5E79 O;  5G3A A;  5TIS O;  4UB8 O;  5G38 A;  5GTH O;  3WU2 O;  5B5E O;  4PJ0 O;  5G39 A;  3A0H O;  1S5L O;  4IL6 O;  5B66 O;  5KAI O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...