4PJ0U

Structure of t.elongatus photosystem ii, rows of dimers crystal packing
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
96
structure length
96
Chain Sequence
LVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
pubmed doi rcsb
molecule tags Oxidoreductase, electron transport
molecule keywords Photosystem Q(B) protein 1
total genus 28
structure length 96
sequence length 96
chains with identical sequence u
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 4pj0U01
5H2FU 4UB6U 3A0BU 2AXTU 1S5LU 5GTIU 5B5EU 5GTHU 5B66U 4IL6U 5TISU 4UB8U 3WU2U 5E79U 5KAFU 2DUYA 3A0HU 5KAIU 4PJ0U 3KZIU
chains in the Genus database with same CATH superfamily
1X6IA 1X9XA 2AGOA 2W54A 1SKRA 1RYUA 3PSFA 3PMLA 1T7PA 1ZETA 2Y0SC 4BGDA 4RQNA 4DQSA 2XY5A 5K4LA 4YP3A 5DG7A 1S9FA 2ZIVA 3OTQA 2MSNA 2G5IB 1SKSA 1ZQCA 5CA7A 2EQYA 4NXZA 3H0RB 3LWMA 1MC8A 2HVIA 3LYSA 3TI0A 7ICOA 4M47A 2BGWA 2V4RA 1S8OA 4QWDA 3PR5B 1PVPA 7ICLA 2ZIXB 2OEHA 2E8PA 1SB3C 3QU9A 1L3SA 4NLKA 1T8EA 1SV0C 1BVSA 2CRXA 1L8LA 3MFIA 4EBCA 1SL1A 4F2RA 5ALNA 2J6UA 2F76X 3ZD8A 3B9JA 9ICGA 4DQIA 3WKDA 4LZGA 4I2BA 2KZMA 2WB1F 3GFKB 9ICPA 1F0MA 4C8LA 2KFNA 3N7PD 2R8GA 3K1ZA 2UVRA 5B5EU 4QZEA 2I5HA 4I2EA 4ED6A 2XY7A 5KFOA 1U9LA 2BCSA 3QU7A 2NRXA 2DKXA 3UM9A 1LKYB 2YB4A 1ZQOA 7ICUA 3ISDA 3KD3A 5KFYA 3PX6A 7ICNA 2YN4A 1N62A 3EWAA 1A0PA 4UB5A 2KSOB 4IR9A 2RQ5A 3EPIA 1H38A 4TQRA 5KL8B 3Q8KA 2YX8A 2G09A 3CYMA 1A76A 2WF9A 1YT3A 4JK1A 5D46A 8ICTA 1PUZA 1ZQIA 4EZ6A 3IV6A 2JZBB 4YQWA 5DKWA 1OXJA 2OWOA 1QQ6A 2KE7A 2ASDA 4NM2A 3UPQA 5KFHA 2F1JA 3M8SA 3I28A 2NRWA 3HT3A 2E1EA 2WF6A 1ZQDA 1QH9A 4OO1J 5EE0A 1UT8A 2PMZF 3RJEA 5DBAA 2YQEA 3SEIA 2PFNA 1MSWD 2JEJA 4P0PB 2H3FA 4EX6A 3RJGA 8ICFA 4PHAA 5ALVA 3FM9A 5DG9A 3PW4A 1A6SA 3V6HA 4RU9A 1K1SA 4UB1A 1TAQA 3LDAA 2VJ4A 2DUYA 5AKLA 2FMQA 1FEZA 4KLIA 3N28A 4C8NA 4KLHA 4P0QA 4DL7A 4IQUA 3Q8PB 2MU2A 1ZQMA 3C1YA 3CP8A 4EEYA 5KFZA 4HAIA 1P7DA 5J0RA 2VA2A 1DXSA 8ICCA 5J0XA 4A8EA 3JPRA 2C28A 2IOFK 3E2EA 5ALYA 1PK3A 4GIBA 2P6RA 2HOIA 5CB1A 5KFQA 1S0MA 2F2AB 3PW5A 4MF8A 2DQNB 2XO7A 4AYBC 5AHXA 3KHGA 2WFAA 1JUDA 4F8RA 1F5SA 3KZIU 3M9NB 4EYHB 2R8JA 2QB0A 4M9HA 4YR3A 4F5QA 2FPLA 5ALSA 4DL5A 2W9BA 2QARB 4QZDA 2FMSA 8ICUA 1ZD5A 5KG0A 8ICXA 4QZCA 4R63A 3OSNA 2OM6A 4LZDA 4ED7A 4NM1A 3J81j 5KG6A 4DFDA 1BGXT 5T14A 5KFCA 4Z6FA 5B66U 1DK3A 3C5GA 4GXJA 3F5EA 2ASLA 4TUSA 3KHLA 1ZQXA 3DDHA 5G5GA 5DBBA 1DGJA 1Q8KA 2HBKA 5AI4A 5KFPA 5L1IA 2DFLA 4EENA 5J8YA 4Z6EA 3RB4A 1TK8A 1BPXA 2YMLA 1PVQA 1Z4NA 3L4PA 5ALRA 4UASA 2AQ0A 3EW9A 2A1JA 1COOA 2W11A 3WKCA 4I2DA 2W9BB 4KX5A 5EE3A 3V7JA 5J2AA 1UCVA 3OGUA 1RYRA 3MFHA 1SGGA 1ZQPA 4DOAA 3QXGA 2B21A 3H8MA 1X9WA 5HR7A 3NUQA 4MFAA 1LVHA 5ALGA 2P6UA 1HUOA 2HDOA 2IOFA 3M6ZA 8ICHA 5DB6A 1MQ2A 4DQPA 2Y0SF 5TZVA 5AI0A 5GTHU 4CF5A 5JUMA 5F3XB 3MGHA 1KLNA 4BDPA 3MR6A 2F8KA 5ALDA 2HSZA 3PNCA 1ZQFA 5KFMA 3A0BU 1T94A 2C22A 4UBBA 1ZQZA 5L9XA 5KT3A 2M0NA 2EH9A 2QLTA 2IA6A 4YMOA 2RHFA 1TKDA 3M1YA 7ICIA 2ZJAA 3C2LA 1ZQQA 2BZFA 3C2KA 3ONNA 5KFEA 3NVZA 8ICMA 1MN8A 1HUZA 1SXDA 4RPXA 2HBLA 3E0FA 2Y1JA 3AN1A 4ECWA 4DQQA 3AQFA 4OJ5A 3BQTA 2JH7A 2W9AA 1CRXA 4R64A 7ICQA 3RAQA 1ZQBA 3M9MB 2GLEA 2E1FA 3TFSA 1DGSA 4PJ0U 3C5FA 4J9SA 3AUOA 3UQ2A 1WCNA 4RUAA 1BPZA 2ZJ8A 1UHUA 2B6GA 2EAMA 2RLTA 2W9CB 1ZQTA 1QQ7A 3C2MA 4JWMA 1Z4OA 4FS1A 3GIMA 4UB4A 5DB7A 3DV9A 4DO9A 2MA1A 4PGYA 3V72A 4O3SA 5ALEA 2E8NA 2DWQA 3RR7A 3IP4B 2MRLA 2RDJA 4IS7A 4B9TA 3LVVA 1L7PA 3JPOA 4XUSA 2WAQF 4USAA 5HP4A 5IINA 1WUDA 2HBMA 1L3VA 9ICKA 5KT2A 4DL2A 1SXEA 2P35A 2AJQA 1ZQRA 1O08A 1QSLA 2MAXA 1PZNA 3HPOA 1BPYA 5EWGA 4RNOA 1ZRMA 1K1QA 2LPEA 4FE3A 1NJYA 2D3DA 3H7IA 4IQTA 1ZRNA 3ICXA 3NGDA 4YD1A 1L5UA 5EOZA 2Z7JA 4KLDA 5DGAA 7ICJA 9ICLA 2K60A 5J8YC 4KLOA 1XSNA 2JEFA 2IMWP 4C0ZA 1S77D 1JRPA 2HW3A 4K4GA 4U7CA 4I27A 9ICNA 1N5XA 2IHNA 5DB9A 3Q8LA 4FBUA 1ZD2P 4DL6A 4ELUA 2BQRA 2XCPA 3T3FA 9ICRA 3GILA 5J0PA 4DSEA 1Z00A 3H8JA 2ZUDA 1VJ5A 4QZ8A 4PGQA 3BQ1A 1NKEA 1ZXIA 3RJFA 1XNSA 2BDPA 9ICFA 1CUKA 3RH6A 3PO4A 1QTMA 3RB6A 5J0TA 9ICJA 4IQVA 3SAHA 4OD0A 5J2IA 4QZIA 3ETLA 4RQ4A 1HIWA 3N7SC 3HP6A 4ED8A 3QE9Y 1U4BA 4YXMA 3FDSA 4O5EA 4ED2A 3ZDCA 5AI8A 4JB3A 1KW4A 1L3TA 1SIJA 2ODGA 1X6JA 4GLXA 1S0NA 3RR8A 2N1RA 4DFJA 8ICZA 4C4SA 3QU5A 2JV3A 3ZDAA 1A77A 5KT7A 5DG8A 1RM6C 1SZHA 3QUTA 1RQLA 5ALXA 4JWNA 2C2EA 1ZQNA 5KNIA 5J2BA 5DLGA 3ORYA 4Z6DA 2EAPA 2NO4A 7ICHA 2GO7A 4MHVA 4RQ2A 1NK4A 5IIOA 2PMZC 4NY8A 5TISU 3F2CA 3V6KA 2HI0A 4PHEA 5AK5A 3MGVA 4I2HA 4O5KA 8ICNA 1S76D 5F9LA 3TARA 4BWJA 4M04A 8ICWA 2WF5A 1ZQUA 3H0MB 2H3IA 5KFSA 4O5CA 3Q8QB 4IC9A 2VA3A 4RQ8A 3D2QA 2Q4TA 5J2JA 3WK5A 4PL1A 4J9OA 2QKQA 5KG4A 1HEKA 1NKBA 3NVYA 4BXOA 3PR4A 4QZ9A 1IM4A 5AKYA 3JPPA 5HMMA 5KFDA 3KBBA 2ES6A 4QZFA 2MUTA 9ICXA 3RF9A 2FDRA 3K1RB 4F2SA 1ZQWA 1JXEA 2WAQC 1D9FA 8ICPA 4C8MA 3WK7A 2LM1A 4AYBF 3FAHA 3MBYA 2F77X 5KFWA 3PSTA 4XRHA 3IHQB 1JIHA 4C7ZA 4QWEA 4M9LA 1B43A 4RQ5A 3B0YA 1NJXA 4B9VA 1JX4A 4QW8A 1XS9D 2W8KA 1KTQA 5A0LA 3H4DA 1NJZA 5J2KA 1SV4A 3H40A 2LM4A 1PK1A 3JPTA 4RQ6A 7ICVA 3CRXA 2BPCA 4CF4A 4RQ7A 2OH2A 3GV8B 9ICCA 4ECQA 3AU2A 2W03A 3OHAA 4FZNA 1RZTA 2B0CA 5AM1A 4GXKA 1ZD3A 8ICSA 5KL1B 2WF8A 4QWCA 2XI9A 1FFUA 1AQ6A 1ZJNA 3QZ8A 1RXWA 3RBEA 4J9KA 2HOQA 3L3FX 3MDAA 2LHTA 4NLBA 4Q8FA 9ICMA 1PK1B 4BWMA 4RZRA 1MA7A 1QQ5A 3WKEA 4NLCA 1GO3F 4RT3A 4Y2VA 3KFUF 3RJIA 2XC9A 3A0HU 2OHFA 4P4OA 4B9MA 3IDWA 1V97A 4RPYA 2ZJ5A 2FPMA 5AM0A 4CF3A 1YZ6A 1TAUA 1KFTA 2LYBA 4EYIB 4BUGA 2A19A 5AKGA 2HHWA 5AIBA 5J2EA 4RNMA 1QLNA 1KEJA 1KFDA 4UB6U 4EZ9A 2JHDA 5IIMA 4QW9A 2V4QA 1S5LU 3KKAA 2K8CB 3PW0A 1LKYA 4YFKA 4DLEA 3QYPA 1L7MA 3F53A 1C20A 2D8CA 3RH4A 7ICEA 2ZTCA 2KZ3A 4KLLA 5KT6A 4I2CA 4F71A 3NVVA 4KLGA 5IIJA 2AU0A 1K5OA 1QSYA 3GV7B 2XIDA 4Y2JA 2AGPA 4F4KA 3HRDD 1TFRA 2NRZA 3M7DA 2ZG6A 3M9OB 1BNPA 2DL0A 4O9MA 8ICLA 4Y2PA 9ICAA 2Y9TA 3D2SA 3ISBA 4KLTA 5DB8A 4KTQA 3M8RA 5JTIA 4P0QB 3LWLA 1XSPA 3MR5A 1N61A 3QU4A 3S6JA 4C7YA 4FFDA 4US9A 1XC9A 2VANA 8ICYA 4RNNA 3O0FA 4JMUA 5L1JA 2Y9UA 5KFVA 5KT4A 3PSPA 9ICHA 4DLGA 4RPZA 2NYVA 4EBEA 3JPNA 3IRUA 3UQ0A 4DSLA 5ALQA 3GU3A 3JPSA 2AXTU 3UXOA 4F5PA 3RAXA 1L8OA 8ICIA 2DF4B 4J9MA 4G3IA 3MR3A 9ICSA 1V85A 1X9SA 3RRHA 5ALUA 5D49A 5DQHA 2CN1A 4JV1A 4MFCA 1KFSA 1CI4A 3SV3A 2F1HA 2VIXA 1S97A 2J6TA 5KFRA 4WJ3B 2KJ8A 4YN4A 3TQ1A 1NK8A 3HX0A 4U6PA 2FPKA 5J2HA 2OYYA 4Y2SA 1N60A 4PH5A 2YMPA 3SYZA 3RH5A 5DQIA 5KT5A 1D8YA 2GOLA 3SAFA 5J0SA 1ZQEA 1VDVA 1JMSA 2PFPA 4QZAA 1L7OA 2IHMA 1DOQA 5KFUA 3ED5A 4YVZA 5AK3A 1X2IA 1X66A 1ZD4A 3ALRA 4PHPA 3KKAC 1NK7A 5AM2A 4DFMA 2FLNA 1SWVA 4R8UA 4ELVA 1NK9A 3NS1A 4F5RA 5DGBA 4KMUA 1S10A 5AI5A 3UMGA 2NO5A 1B0XA 4R8UB 5G5HA 4EX7A 2NRTA 1RG6A 4DS5A 5EE9A 4IL6U 4UQGA 4YG2A 5J2GA 3WKBA 2KTQA 3Q8MA 2OCEA 2PI4A 5HNKA 1BPBA 4PZNA 3F5AA 2K8BB 4MEXA 1RPLA 2OXOA 4ECZA 2W04A 1X42A 4O3NA 4CRXA 4QZHA 3IG5A 4ED0A 5AKJA 1UA0A 1ZQSA 3AEVA 5HR6A 2ALZA 5AKKA 1ZYQA 4PHDA 9ICOA 1NK5A 1OW5A 3E58A 2K4HA 1XO0A 4BX9C 1FIQA 1KDHA 1T3NA 3UMBA 2QARA 3NASA 3RRGA 3QUBA 4F4XA 1XU4A 1KRPA 5ALTA 2QB0B 5AKXA 4YR2A 3FC4A 4J9NA 1KBUA 1ZOLA 2IOHA 2BDUA 4IRKA 1N2XA 3HWTA 4M9GA 1D8LA 2HMXA 2Q0ZX 2JR5A 5ALOA 2W55A 3AMZA 1IV8A 4YXJA 2KG5A 8ICJA 3BS5A 1B22A 3VCBA 3BZCA 2EZXA 4IRCA 4XA5A 2BQUA 1T3QA 1ECWA 4Q8EA 4Q44A 4P4MA 2G5HB 2RDIA 3QEBZ 2F44A 3FYHA 4JV0A 3QUCA 4FS2A 3ZDBA 2ISOA 2BQ3A 5AKIA 4NWIA 1IG6A 8ICBA 4ZH4A 3T5KA 4IQWA 5AK4A 4F93B 1UT5A 2UVUA 2HHXA 2ZUBA 2W9CA 3ZI4A 4MF2A 3NVWA 3PX4A 4C8OA 3PSIA 2ZIWA 5IIKA 2I1QA 4KN4A 2P66A 2W3RA 4NLZA 1Z1BA 3V6JA 2HBJA 4UARA 2A1AA 2KKPA 4UBCA 5CP2A 4M0AA 1N56A 3D6JA 5L1KA 5J2DA 2RRDA 4ECUA 1WCLA 1NNLA 1ZQVA 1O03A 4O3RA 4O3OA 3CW2C 1NK0A 1RXVA 4O0IA 3KHRA 5J2FA 3TADA 4R66A 2JXJA 3WKAA 2BCRA 2E5SA 8ICOA 2BR0A 4ECRA 4QIWF 2K8AA 7ICPA 3WU2U 2KHVA 5KFFA 1L6NA 3GZFA 1CEZA 2JMGA 1UQVA 2ZIWB 4CE6A 2F1IA 9ICTA 5CEHA 5J0WA 4PZOA 5J2CA 2FMPA 3RJHA 5HMLA 3QUQA 4UATA 1Q3UA 4PL2A 4YCXA 3SENA 4Z6CA 4DWIA 9ICQA 2KOBA 5ALLA 4Y2QA 3K75D 1Y88A 3NRZA 1Z19A 4CNQA 3V7KA 4Y2TA 4US8A 4C4RA 1BPDA 4F3OA 2EZYA 4B9LA 7ICTA 5J0UA 3QX7A 1Z3EB 1C7YA 2BCVA 8ICGA 2BCUA 2YTUA 2KFZA 1J97A 4NL9A 3GDXA 1RQNA 3UXPA 4ECXA 4GXIA 5AM4A 1XWLA 2W3SA 5KFIA 5HHHA 2LYHA 1ZQ1C 1SWWA 4P4PA 1Q46A 1N63A 4MFFA 4P0PA 5KG1A 2K89A 3B0XA 2KHQA 1WWUA 1ZQGA 4KLSA 2KVCA 2ISPA 2XICA 1EXNA 5IILA 2I9GA 3QNMA 1D9DA 1OUQA 2K4IA 4P2HA 2F8LA 4UAVA 1NOMA 4EBDA 2KIVA 2VA8A 2PFQA 2R8KA 3OPXA 4M9NA 3DEEA 3T5JA 3SMVA 4BJQA 2D6FC 5CJ7A 3ZDEA 3H8SA 5AICA 1KSPA 3RB3A 2KICA 4M9JA 4F91B 4FBTA 2H3VA 3SV4A 4KLMA 2JH1A 2KJ5A 3SD7A 3VC8A 2E3TA 4J9LA 5E79U 5AKZA 1ZJMA 1ZQHA 1KKXA 5KFLA 2HCFA 2R18A 3EZ5A 2LMRA 3MABA 2IBKA 3G6XA 1KN5A 4F5OA 4E0DA 4GFJA 2W43A 2VJ5A 4DSKA 4LVSA 3H8WA 2LKYA 1WG8A 1U48A 1M6YA 3TAPA 3I76A 4UB3A 2BHNA 1LV5A 5DQGA 4B9SA 3RB0A 4DFKA 2KMDA 2KZZA 4DFPA 4M6WA 1NK6A 4RUCA 1N5WA 4ELTA 4TUPA 2HHTA 3TACB 5DDYA 3NTUA 1TE2A 2KEYA 4I2IA 1TK5A 5AIAA 4I2AA 1BNOA 3HILA 2E8OA 5ALHA 5KFNA 3GQCA 5EE1A 1QSSA 3C29A 8ICQA 1Q3VA 2KV2A 2AGQA 2XY6A 1V9PA 1F44A 5KAIU 1B4FA 3UXNA 3R9KA 1FFVA 1PVRA 4DF4A 4EEKA 5KG2A 3Q8RB 2KN7A 5ALFA 2KK0A 2RP5A 4UW9A 3T5LA 2AQ4A 5AKHA 4AP9A 4DOCA 5ALJA 4FO6A 2WB1C 4M6WB 5CR0A 2ATLA 5FP0A 4B9NA 3UMCA 1WWVA 3ISCA 4JUZA 2HOFA 2PI5A 5AI9A 2HHUA 5ALIA 3K4GA 2GWSA 2H5XA 4PPXA 2ZXHA 4DSJA 1S0OA 3BS7A 1IXRA 2L5YA 4I2JA 3EPGA 8ICRA 5J29A 2FLPA 1YZ7A 4ED3A 2DKZA 3RJKA 2R8HA 5AM3A 4DSIA 3PMNA 4ZOHC 1U47A 4G9BA 2WF7A 2ESEA 2VKQA 1NKCA 5CWRA 1ZQYA 4NL9C 3PO5A 1BPEA 3HJEA 3C21A 5KAFU 5DDMA 1U45A 8ICAA 4J03A 3TANA 3MR2A 4UAZA 1IIPA 1AROP 2DBYA 1Z00B 3SZ2A 4QWBA 1ZQAA 2BPGA 4ECVA 4QZGA 1T4GA 1TK0A 5JRTA 2EAOA 1QCKA 5KG3A 5BOMA 4O3PA 1N48A 1JI7A 3BQ0A 2WHEA 4TURA 4C8KA 4DQRA 5AI6A 4QIWC 2BCQA 4EELA 1URJA 1X40A 5J0YA 3PY8A 1J2MA 2JRZA 3WK8A 3M6KA 3PW2A 3BZKA 4Y2RA 1JN3A 4YR0A 2NV3A 2YMQA 2EDUA 4MEYA 4DS4A 2HHVA 3H0LB 4I28A 3N97B 7ICFA 3NRWA 5H2FU 4ECYA 1SL2A 3HKZC 1COKA 3OHBA 3MGIA 4NV0A 1L3UA 4F4YA 4FZLA 3MDCA 4PGXA 3QEAZ 5KG7A 3L5KA 5ALPA 3PX0A 2Y1IA 2YB1A 4DEZA 5J0QA 4RQ1A 4B6JA 3IG8A 3OSPA 4B9UA 4TUQA 2CPRA 2HHSA 3WK9A 1JXLA 1UA1A 4YD2A 4F92B 4J9QA 3PVXA 2E8MA 4KLEA 5KFAA 4KX3A 1Z1VA 4Y2XA 2K4PA 4ACOA 3N4MB 4Q43A 4Y2UA 9ICBA 2FE9A 5J0OA 3ZDDA 1ZQKA 4M2YA 1ZQLA 1TAMA 2KIWA 3RTVA 4K4HA 1RDFA 2ZTDA 2EZZA 4F72A 5DBCA 4KMOB 4OCZA 3F2DA 3LK9A 3ETRA 5ALKA 3QZ7A 3BQ2A 4UAUA 3KOOA 4ECTA 4UAYA 7ICGA 1RYSA 4DL4A 5C5JA 4CDGA 3H4BA 4KN7A 3TFRA 4F50A 3KTQA 1HJPA 4Y2YA 3TKAA 1UPHA 3PZPA 2J6SA 5BOLA 3PW7A 2JEIA 9ICEA 3OJUA 1KL9A 1SL0A 4JV2A 8ICEA 3C23A 7ICSA 3GIJA 9ICIA 5KTQA 2A3VA 3EYZA 4IRDA 5AK6A 3V7LA 3C28A 4X5VA 2FJ6A 4GC7A 1SZPA 1SKWA 3TADC 3F2BA 2H3ZA 5DLFA 5KFXA 2PFOA 4R65A 4ECSA 4LJXA 4K4IA 2ZIUA 1TV9A 1FO4A 3Q8SB 2W7PA 2UVVA 2CXYA 4O3MA 5CRXA 2EANA 4OJPA 4RQ0A 5L1LA 2V9WA 4IR1A 4HYKA 2NRVA 3WK4A 5BPCA 9ICVA 2LYAA 4NLNA 1XO1A 3U26A 4RQ3A 4YMNA 2DPIA 4ICAA 2XGQA 4J9PA 2DPJA 3SR6A 3SQIA 3AQEA 4CGZA 2KKVA 4QNLA 4F5NA 2KNJA 3C1ZA 5KFBA 3AM9A 7ICMA 2MUTB 8ICKA 4I2FA 3JPQA 4C4TA 4OJLA 2JEGA 4DOBA 7ICRA 2ZIVB 3BJYA 3PV8A 3T5HA 5ALWA 3SAGA 3THVA 3BQ7A 2YMMA 4XQ8A 3AU6A 1ED1A 2KD1A 8ICVA 1MQ3A 3MC1A 3GIIA 1NJWA 1ZQJA 3KZXA 3IM1A 2R8IA 2ZTEA 4DF8A 3IN5A 1NZPA 3RFAA 3RBDA 9ICWA 2BPFA 2C2DA 2AH5A 4UB8U 3HKZF 4NJ8A 4O3QA 2LI6A 2AHOB 1LB2B 5ALMA 5JU5A 1J2NA 4C80A 3AL0B 1VLBA 2XCAA 2GH1A 4Q45A 3KHHA 5AM5A 3ZD9A 2JGAA 2PXIA 2KP7A 5C0YA 1DK2A 1D8BA 3D2NA 2KSOA 5KFTA 2ASJA 4QZBA 4QWAA 1S0VA 1JROA 5KFKA 1SV0A 5ALZA 2HHQA 5D4BA 4KLQA 4ED1A 3LVWA 1NZBA 4GC6A 4DL3A 2W8LA 3TAQA 4J9RA 2W7OA 5HHIA 5AKEA 4F4WA 1WYGA 2G08A 3CNHA 3SI8A 1KQQA 4F4ZA 4RQMA 4KLUA 5KFGA 1U49A 1NI3A 2ZIUB 3GIKA 3I1YA 3QU2A 4OJ6A 2XGPA 2XVTA 2WTFA 2JZBA 1TVAA 3HW8A 2A1JB 2O6KA 9ICUA 5GTIU 2ZXIA 2DGZA 2FLLA 4DCCA 3G6VA 2QB1A 4KLFA 2W9MA 2YY6A 1V38A 1DRGA 2HVHA 7ICKA 2BKEA 2K4EA 2LBOA 5CHGA 1X9MA 4UAWA 5IIIA 2UVWA 2H3QA 4NLGA 4BXOB 4KLJA 3GV5B 2ZIXA 3BS5B 5EWEA 2F3NA 3T79A 3OJSA 2I6XA 4QJFB 1JALA 2M9NA 3N7RC 4FZMA 2C2RA 2KJ9A 3BDPA 5L1MA 2ZUCA 2PKEA 3WK6A 3RJJA 2G07A 4TQSA 4I29A 2KVSA 3EUB2 4YMMA 4DSFA 5F9NA 5EWFA 5KFJA 5KG5A 2G06A 1XSLA 4CCHA 4OJOA 4KITB 1L7NA 2G0AA 2FI1A 4UB2A 4RT2A 3G6YA 4I2GA
chains in the Genus database with same CATH topology
5H2FU 4UB6U 3A0BU 2AXTU 1S5LU 5GTIU 5B5EU 5GTHU 5B66U 4IL6U 5TISU 4UB8U 3WU2U 5E79U 5KAFU 2DUYA 3A0HU 5KAIU 4PJ0U 3KZIU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H2F U;  4UB6 U;  3A0B U;  2AXT U;  1S5L U;  5GTI U;  5B5E U;  5GTH U;  5B66 U;  4IL6 U;  5TIS U;  4UB8 U;  3WU2 U;  5E79 U;  5KAF U;  2DUY A;  3A0H U;  5KAI U;  4PJ0 U;  3KZI U; 
#chains in the Genus database with same CATH topology
 1X6I A;  1X9X A;  2AGO A;  2W54 A;  1SKR A;  1RYU A;  3PSF A;  3PML A;  1T7P A;  1ZET A;  2Y0S C;  4BGD A;  4RQN A;  4DQS A;  2XY5 A;  5K4L A;  4YP3 A;  5DG7 A;  1S9F A;  2ZIV A;  3OTQ A;  2MSN A;  2G5I B;  1SKS A;  1ZQC A;  5CA7 A;  2EQY A;  4NXZ A;  3H0R B;  3LWM A;  1MC8 A;  2HVI A;  3LYS A;  3TI0 A;  7ICO A;  4M47 A;  2BGW A;  2V4R A;  1S8O A;  4QWD A;  3PR5 B;  1PVP A;  7ICL A;  2ZIX B;  2OEH A;  2E8P A;  1SB3 C;  3QU9 A;  1L3S A;  4NLK A;  1T8E A;  1SV0 C;  1BVS A;  2CRX A;  1L8L A;  3MFI A;  4EBC A;  1SL1 A;  4F2R A;  5ALN A;  2J6U A;  2F76 X;  3ZD8 A;  3B9J A;  9ICG A;  4DQI A;  3WKD A;  4LZG A;  4I2B A;  2KZM A;  2WB1 F;  3GFK B;  9ICP A;  1F0M A;  4C8L A;  2KFN A;  3N7P D;  2R8G A;  3K1Z A;  2UVR A;  5B5E U;  4QZE A;  2I5H A;  4I2E A;  4ED6 A;  2XY7 A;  5KFO A;  1U9L A;  2BCS A;  3QU7 A;  2NRX A;  2DKX A;  3UM9 A;  1LKY B;  2YB4 A;  1ZQO A;  7ICU A;  3ISD A;  3KD3 A;  5KFY A;  3PX6 A;  7ICN A;  2YN4 A;  1N62 A;  3EWA A;  1A0P A;  4UB5 A;  2KSO B;  4IR9 A;  2RQ5 A;  3EPI A;  1H38 A;  4TQR A;  5KL8 B;  3Q8K A;  2YX8 A;  2G09 A;  3CYM A;  1A76 A;  2WF9 A;  1YT3 A;  4JK1 A;  5D46 A;  8ICT A;  1PUZ A;  1ZQI A;  4EZ6 A;  3IV6 A;  2JZB B;  4YQW A;  5DKW A;  1OXJ A;  2OWO A;  1QQ6 A;  2KE7 A;  2ASD A;  4NM2 A;  3UPQ A;  5KFH A;  2F1J A;  3M8S A;  3I28 A;  2NRW A;  3HT3 A;  2E1E A;  2WF6 A;  1ZQD A;  1QH9 A;  4OO1 J;  5EE0 A;  1UT8 A;  2PMZ F;  3RJE A;  5DBA A;  2YQE A;  3SEI A;  2PFN A;  1MSW D;  2JEJ A;  4P0P B;  2H3F A;  4EX6 A;  3RJG A;  8ICF A;  4PHA A;  5ALV A;  3FM9 A;  5DG9 A;  3PW4 A;  1A6S A;  3V6H A;  4RU9 A;  1K1S A;  4UB1 A;  1TAQ A;  3LDA A;  2VJ4 A;  2DUY A;  5AKL A;  2FMQ A;  1FEZ A;  4KLI A;  3N28 A;  4C8N A;  4KLH A;  4P0Q A;  4DL7 A;  4IQU A;  3Q8P B;  2MU2 A;  1ZQM A;  3C1Y A;  3CP8 A;  4EEY A;  5KFZ A;  4HAI A;  1P7D A;  5J0R A;  2VA2 A;  1DXS A;  8ICC A;  5J0X A;  4A8E A;  3JPR A;  2C28 A;  2IOF K;  3E2E A;  5ALY A;  1PK3 A;  4GIB A;  2P6R A;  2HOI A;  5CB1 A;  5KFQ A;  1S0M A;  2F2A B;  3PW5 A;  4MF8 A;  2DQN B;  2XO7 A;  4AYB C;  5AHX A;  3KHG A;  2WFA A;  1JUD A;  4F8R A;  1F5S A;  3KZI U;  3M9N B;  4EYH B;  2R8J A;  2QB0 A;  4M9H A;  4YR3 A;  4F5Q A;  2FPL A;  5ALS A;  4DL5 A;  2W9B A;  2QAR B;  4QZD A;  2FMS A;  8ICU A;  1ZD5 A;  5KG0 A;  8ICX A;  4QZC A;  4R63 A;  3OSN A;  2OM6 A;  4LZD A;  4ED7 A;  4NM1 A;  3J81 j;  5KG6 A;  4DFD A;  1BGX T;  5T14 A;  5KFC A;  4Z6F A;  5B66 U;  1DK3 A;  3C5G A;  4GXJ A;  3F5E A;  2ASL A;  4TUS A;  3KHL A;  1ZQX A;  3DDH A;  5G5G A;  5DBB A;  1DGJ A;  1Q8K A;  2HBK A;  5AI4 A;  5KFP A;  5L1I A;  2DFL A;  4EEN A;  5J8Y A;  4Z6E A;  3RB4 A;  1TK8 A;  1BPX A;  2YML A;  1PVQ A;  1Z4N A;  3L4P A;  5ALR A;  4UAS A;  2AQ0 A;  3EW9 A;  2A1J A;  1COO A;  2W11 A;  3WKC A;  4I2D A;  2W9B B;  4KX5 A;  5EE3 A;  3V7J A;  5J2A A;  1UCV A;  3OGU A;  1RYR A;  3MFH A;  1SGG A;  1ZQP A;  4DOA A;  3QXG A;  2B21 A;  3H8M A;  1X9W A;  5HR7 A;  3NUQ A;  4MFA A;  1LVH A;  5ALG A;  2P6U A;  1HUO A;  2HDO A;  2IOF A;  3M6Z A;  8ICH A;  5DB6 A;  1MQ2 A;  4DQP A;  2Y0S F;  5TZV A;  5AI0 A;  5GTH U;  4CF5 A;  5JUM A;  5F3X B;  3MGH A;  1KLN A;  4BDP A;  3MR6 A;  2F8K A;  5ALD A;  2HSZ A;  3PNC A;  1ZQF A;  5KFM A;  3A0B U;  1T94 A;  2C22 A;  4UBB A;  1ZQZ A;  5L9X A;  5KT3 A;  2M0N A;  2EH9 A;  2QLT A;  2IA6 A;  4YMO A;  2RHF A;  1TKD A;  3M1Y A;  7ICI A;  2ZJA A;  3C2L A;  1ZQQ A;  2BZF A;  3C2K A;  3ONN A;  5KFE A;  3NVZ A;  8ICM A;  1MN8 A;  1HUZ A;  1SXD A;  4RPX A;  2HBL A;  3E0F A;  2Y1J A;  3AN1 A;  4ECW A;  4DQQ A;  3AQF A;  4OJ5 A;  3BQT A;  2JH7 A;  2W9A A;  1CRX A;  4R64 A;  7ICQ A;  3RAQ A;  1ZQB A;  3M9M B;  2GLE A;  2E1F A;  3TFS A;  1DGS A;  4PJ0 U;  3C5F A;  4J9S A;  3AUO A;  3UQ2 A;  1WCN A;  4RUA A;  1BPZ A;  2ZJ8 A;  1UHU A;  2B6G A;  2EAM A;  2RLT A;  2W9C B;  1ZQT A;  1QQ7 A;  3C2M A;  4JWM A;  1Z4O A;  4FS1 A;  3GIM A;  4UB4 A;  5DB7 A;  3DV9 A;  4DO9 A;  2MA1 A;  4PGY A;  3V72 A;  4O3S A;  5ALE A;  2E8N A;  2DWQ A;  3RR7 A;  3IP4 B;  2MRL A;  2RDJ A;  4IS7 A;  4B9T A;  3LVV A;  1L7P A;  3JPO A;  4XUS A;  2WAQ F;  4USA A;  5HP4 A;  5IIN A;  1WUD A;  2HBM A;  1L3V A;  9ICK A;  5KT2 A;  4DL2 A;  1SXE A;  2P35 A;  2AJQ A;  1ZQR A;  1O08 A;  1QSL A;  2MAX A;  1PZN A;  3HPO A;  1BPY A;  5EWG A;  4RNO A;  1ZRM A;  1K1Q A;  2LPE A;  4FE3 A;  1NJY A;  2D3D A;  3H7I A;  4IQT A;  1ZRN A;  3ICX A;  3NGD A;  4YD1 A;  1L5U A;  5EOZ A;  2Z7J A;  4KLD A;  5DGA A;  7ICJ A;  9ICL A;  2K60 A;  5J8Y C;  4KLO A;  1XSN A;  2JEF A;  2IMW P;  4C0Z A;  1S77 D;  1JRP A;  2HW3 A;  4K4G A;  4U7C A;  4I27 A;  9ICN A;  1N5X A;  2IHN A;  5DB9 A;  3Q8L A;  4FBU A;  1ZD2 P;  4DL6 A;  4ELU A;  2BQR A;  2XCP A;  3T3F A;  9ICR A;  3GIL A;  5J0P A;  4DSE A;  1Z00 A;  3H8J A;  2ZUD A;  1VJ5 A;  4QZ8 A;  4PGQ A;  3BQ1 A;  1NKE A;  1ZXI A;  3RJF A;  1XNS A;  2BDP A;  9ICF A;  1CUK A;  3RH6 A;  3PO4 A;  1QTM A;  3RB6 A;  5J0T A;  9ICJ A;  4IQV A;  3SAH A;  4OD0 A;  5J2I A;  4QZI A;  3ETL A;  4RQ4 A;  1HIW A;  3N7S C;  3HP6 A;  4ED8 A;  3QE9 Y;  1U4B A;  4YXM A;  3FDS A;  4O5E A;  4ED2 A;  3ZDC A;  5AI8 A;  4JB3 A;  1KW4 A;  1L3T A;  1SIJ A;  2ODG A;  1X6J A;  4GLX A;  1S0N A;  3RR8 A;  2N1R A;  4DFJ A;  8ICZ A;  4C4S A;  3QU5 A;  2JV3 A;  3ZDA A;  1A77 A;  5KT7 A;  5DG8 A;  1RM6 C;  1SZH A;  3QUT A;  1RQL A;  5ALX A;  4JWN A;  2C2E A;  1ZQN A;  5KNI A;  5J2B A;  5DLG A;  3ORY A;  4Z6D A;  2EAP A;  2NO4 A;  7ICH A;  2GO7 A;  4MHV A;  4RQ2 A;  1NK4 A;  5IIO A;  2PMZ C;  4NY8 A;  5TIS U;  3F2C A;  3V6K A;  2HI0 A;  4PHE A;  5AK5 A;  3MGV A;  4I2H A;  4O5K A;  8ICN A;  1S76 D;  5F9L A;  3TAR A;  4BWJ A;  4M04 A;  8ICW A;  2WF5 A;  1ZQU A;  3H0M B;  2H3I A;  5KFS A;  4O5C A;  3Q8Q B;  4IC9 A;  2VA3 A;  4RQ8 A;  3D2Q A;  2Q4T A;  5J2J A;  3WK5 A;  4PL1 A;  4J9O A;  2QKQ A;  5KG4 A;  1HEK A;  1NKB A;  3NVY A;  4BXO A;  3PR4 A;  4QZ9 A;  1IM4 A;  5AKY A;  3JPP A;  5HMM A;  5KFD A;  3KBB A;  2ES6 A;  4QZF A;  2MUT A;  9ICX A;  3RF9 A;  2FDR A;  3K1R B;  4F2S A;  1ZQW A;  1JXE A;  2WAQ C;  1D9F A;  8ICP A;  4C8M A;  3WK7 A;  2LM1 A;  4AYB F;  3FAH A;  3MBY A;  2F77 X;  5KFW A;  3PST A;  4XRH A;  3IHQ B;  1JIH A;  4C7Z A;  4QWE A;  4M9L A;  1B43 A;  4RQ5 A;  3B0Y A;  1NJX A;  4B9V A;  1JX4 A;  4QW8 A;  1XS9 D;  2W8K A;  1KTQ A;  5A0L A;  3H4D A;  1NJZ A;  5J2K A;  1SV4 A;  3H40 A;  2LM4 A;  1PK1 A;  3JPT A;  4RQ6 A;  7ICV A;  3CRX A;  2BPC A;  4CF4 A;  4RQ7 A;  2OH2 A;  3GV8 B;  9ICC A;  4ECQ A;  3AU2 A;  2W03 A;  3OHA A;  4FZN A;  1RZT A;  2B0C A;  5AM1 A;  4GXK A;  1ZD3 A;  8ICS A;  5KL1 B;  2WF8 A;  4QWC A;  2XI9 A;  1FFU A;  1AQ6 A;  1ZJN A;  3QZ8 A;  1RXW A;  3RBE A;  4J9K A;  2HOQ A;  3L3F X;  3MDA A;  2LHT A;  4NLB A;  4Q8F A;  9ICM A;  1PK1 B;  4BWM A;  4RZR A;  1MA7 A;  1QQ5 A;  3WKE A;  4NLC A;  1GO3 F;  4RT3 A;  4Y2V A;  3KFU F;  3RJI A;  2XC9 A;  3A0H U;  2OHF A;  4P4O A;  4B9M A;  3IDW A;  1V97 A;  4RPY A;  2ZJ5 A;  2FPM A;  5AM0 A;  4CF3 A;  1YZ6 A;  1TAU A;  1KFT A;  2LYB A;  4EYI B;  4BUG A;  2A19 A;  5AKG A;  2HHW A;  5AIB A;  5J2E A;  4RNM A;  1QLN A;  1KEJ A;  1KFD A;  4UB6 U;  4EZ9 A;  2JHD A;  5IIM A;  4QW9 A;  2V4Q A;  1S5L U;  3KKA A;  2K8C B;  3PW0 A;  1LKY A;  4YFK A;  4DLE A;  3QYP A;  1L7M A;  3F53 A;  1C20 A;  2D8C A;  3RH4 A;  7ICE A;  2ZTC A;  2KZ3 A;  4KLL A;  5KT6 A;  4I2C A;  4F71 A;  3NVV A;  4KLG A;  5IIJ A;  2AU0 A;  1K5O A;  1QSY A;  3GV7 B;  2XID A;  4Y2J A;  2AGP A;  4F4K A;  3HRD D;  1TFR A;  2NRZ A;  3M7D A;  2ZG6 A;  3M9O B;  1BNP A;  2DL0 A;  4O9M A;  8ICL A;  4Y2P A;  9ICA A;  2Y9T A;  3D2S A;  3ISB A;  4KLT A;  5DB8 A;  4KTQ A;  3M8R A;  5JTI A;  4P0Q B;  3LWL A;  1XSP A;  3MR5 A;  1N61 A;  3QU4 A;  3S6J A;  4C7Y A;  4FFD A;  4US9 A;  1XC9 A;  2VAN A;  8ICY A;  4RNN A;  3O0F A;  4JMU A;  5L1J A;  2Y9U A;  5KFV A;  5KT4 A;  3PSP A;  9ICH A;  4DLG A;  4RPZ A;  2NYV A;  4EBE A;  3JPN A;  3IRU A;  3UQ0 A;  4DSL A;  5ALQ A;  3GU3 A;  3JPS A;  2AXT U;  3UXO A;  4F5P A;  3RAX A;  1L8O A;  8ICI A;  2DF4 B;  4J9M A;  4G3I A;  3MR3 A;  9ICS A;  1V85 A;  1X9S A;  3RRH A;  5ALU A;  5D49 A;  5DQH A;  2CN1 A;  4JV1 A;  4MFC A;  1KFS A;  1CI4 A;  3SV3 A;  2F1H A;  2VIX A;  1S97 A;  2J6T A;  5KFR A;  4WJ3 B;  2KJ8 A;  4YN4 A;  3TQ1 A;  1NK8 A;  3HX0 A;  4U6P A;  2FPK A;  5J2H A;  2OYY A;  4Y2S A;  1N60 A;  4PH5 A;  2YMP A;  3SYZ A;  3RH5 A;  5DQI A;  5KT5 A;  1D8Y A;  2GOL A;  3SAF A;  5J0S A;  1ZQE A;  1VDV A;  1JMS A;  2PFP A;  4QZA A;  1L7O A;  2IHM A;  1DOQ A;  5KFU A;  3ED5 A;  4YVZ A;  5AK3 A;  1X2I A;  1X66 A;  1ZD4 A;  3ALR A;  4PHP A;  3KKA C;  1NK7 A;  5AM2 A;  4DFM A;  2FLN A;  1SWV A;  4R8U A;  4ELV A;  1NK9 A;  3NS1 A;  4F5R A;  5DGB A;  4KMU A;  1S10 A;  5AI5 A;  3UMG A;  2NO5 A;  1B0X A;  4R8U B;  5G5H A;  4EX7 A;  2NRT A;  1RG6 A;  4DS5 A;  5EE9 A;  4IL6 U;  4UQG A;  4YG2 A;  5J2G A;  3WKB A;  2KTQ A;  3Q8M A;  2OCE A;  2PI4 A;  5HNK A;  1BPB A;  4PZN A;  3F5A A;  2K8B B;  4MEX A;  1RPL A;  2OXO A;  4ECZ A;  2W04 A;  1X42 A;  4O3N A;  4CRX A;  4QZH A;  3IG5 A;  4ED0 A;  5AKJ A;  1UA0 A;  1ZQS A;  3AEV A;  5HR6 A;  2ALZ A;  5AKK A;  1ZYQ A;  4PHD A;  9ICO A;  1NK5 A;  1OW5 A;  3E58 A;  2K4H A;  1XO0 A;  4BX9 C;  1FIQ A;  1KDH A;  1T3N A;  3UMB A;  2QAR A;  3NAS A;  3RRG A;  3QUB A;  4F4X A;  1XU4 A;  1KRP A;  5ALT A;  2QB0 B;  5AKX A;  4YR2 A;  3FC4 A;  4J9N A;  1KBU A;  1ZOL A;  2IOH A;  2BDU A;  4IRK A;  1N2X A;  3HWT A;  4M9G A;  1D8L A;  2HMX A;  2Q0Z X;  2JR5 A;  5ALO A;  2W55 A;  3AMZ A;  1IV8 A;  4YXJ A;  2KG5 A;  8ICJ A;  3BS5 A;  1B22 A;  3VCB A;  3BZC A;  2EZX A;  4IRC A;  4XA5 A;  2BQU A;  1T3Q A;  1ECW A;  4Q8E A;  4Q44 A;  4P4M A;  2G5H B;  2RDI A;  3QEB Z;  2F44 A;  3FYH A;  4JV0 A;  3QUC A;  4FS2 A;  3ZDB A;  2ISO A;  2BQ3 A;  5AKI A;  4NWI A;  1IG6 A;  8ICB A;  4ZH4 A;  3T5K A;  4IQW A;  5AK4 A;  4F93 B;  1UT5 A;  2UVU A;  2HHX A;  2ZUB A;  2W9C A;  3ZI4 A;  4MF2 A;  3NVW A;  3PX4 A;  4C8O A;  3PSI A;  2ZIW A;  5IIK A;  2I1Q A;  4KN4 A;  2P66 A;  2W3R A;  4NLZ A;  1Z1B A;  3V6J A;  2HBJ A;  4UAR A;  2A1A A;  2KKP A;  4UBC A;  5CP2 A;  4M0A A;  1N56 A;  3D6J A;  5L1K A;  5J2D A;  2RRD A;  4ECU A;  1WCL A;  1NNL A;  1ZQV A;  1O03 A;  4O3R A;  4O3O A;  3CW2 C;  1NK0 A;  1RXV A;  4O0I A;  3KHR A;  5J2F A;  3TAD A;  4R66 A;  2JXJ A;  3WKA A;  2BCR A;  2E5S A;  8ICO A;  2BR0 A;  4ECR A;  4QIW F;  2K8A A;  7ICP A;  3WU2 U;  2KHV A;  5KFF A;  1L6N A;  3GZF A;  1CEZ A;  2JMG A;  1UQV A;  2ZIW B;  4CE6 A;  2F1I A;  9ICT A;  5CEH A;  5J0W A;  4PZO A;  5J2C A;  2FMP A;  3RJH A;  5HML A;  3QUQ A;  4UAT A;  1Q3U A;  4PL2 A;  4YCX A;  3SEN A;  4Z6C A;  4DWI A;  9ICQ A;  2KOB A;  5ALL A;  4Y2Q A;  3K75 D;  1Y88 A;  3NRZ A;  1Z19 A;  4CNQ A;  3V7K A;  4Y2T A;  4US8 A;  4C4R A;  1BPD A;  4F3O A;  2EZY A;  4B9L A;  7ICT A;  5J0U A;  3QX7 A;  1Z3E B;  1C7Y A;  2BCV A;  8ICG A;  2BCU A;  2YTU A;  2KFZ A;  1J97 A;  4NL9 A;  3GDX A;  1RQN A;  3UXP A;  4ECX A;  4GXI A;  5AM4 A;  1XWL A;  2W3S A;  5KFI A;  5HHH A;  2LYH A;  1ZQ1 C;  1SWW A;  4P4P A;  1Q46 A;  1N63 A;  4MFF A;  4P0P A;  5KG1 A;  2K89 A;  3B0X A;  2KHQ A;  1WWU A;  1ZQG A;  4KLS A;  2KVC A;  2ISP A;  2XIC A;  1EXN A;  5IIL A;  2I9G A;  3QNM A;  1D9D A;  1OUQ A;  2K4I A;  4P2H A;  2F8L A;  4UAV A;  1NOM A;  4EBD A;  2KIV A;  2VA8 A;  2PFQ A;  2R8K A;  3OPX A;  4M9N A;  3DEE A;  3T5J A;  3SMV A;  4BJQ A;  2D6F C;  5CJ7 A;  3ZDE A;  3H8S A;  5AIC A;  1KSP A;  3RB3 A;  2KIC A;  4M9J A;  4F91 B;  4FBT A;  2H3V A;  3SV4 A;  4KLM A;  2JH1 A;  2KJ5 A;  3SD7 A;  3VC8 A;  2E3T A;  4J9L A;  5E79 U;  5AKZ A;  1ZJM A;  1ZQH A;  1KKX A;  5KFL A;  2HCF A;  2R18 A;  3EZ5 A;  2LMR A;  3MAB A;  2IBK A;  3G6X A;  1KN5 A;  4F5O A;  4E0D A;  4GFJ A;  2W43 A;  2VJ5 A;  4DSK A;  4LVS A;  3H8W A;  2LKY A;  1WG8 A;  1U48 A;  1M6Y A;  3TAP A;  3I76 A;  4UB3 A;  2BHN A;  1LV5 A;  5DQG A;  4B9S A;  3RB0 A;  4DFK A;  2KMD A;  2KZZ A;  4DFP A;  4M6W A;  1NK6 A;  4RUC A;  1N5W A;  4ELT A;  4TUP A;  2HHT A;  3TAC B;  5DDY A;  3NTU A;  1TE2 A;  2KEY A;  4I2I A;  1TK5 A;  5AIA A;  4I2A A;  1BNO A;  3HIL A;  2E8O A;  5ALH A;  5KFN A;  3GQC A;  5EE1 A;  1QSS A;  3C29 A;  8ICQ A;  1Q3V A;  2KV2 A;  2AGQ A;  2XY6 A;  1V9P A;  1F44 A;  5KAI U;  1B4F A;  3UXN A;  3R9K A;  1FFV A;  1PVR A;  4DF4 A;  4EEK A;  5KG2 A;  3Q8R B;  2KN7 A;  5ALF A;  2KK0 A;  2RP5 A;  4UW9 A;  3T5L A;  2AQ4 A;  5AKH A;  4AP9 A;  4DOC A;  5ALJ A;  4FO6 A;  2WB1 C;  4M6W B;  5CR0 A;  2ATL A;  5FP0 A;  4B9N A;  3UMC A;  1WWV A;  3ISC A;  4JUZ A;  2HOF A;  2PI5 A;  5AI9 A;  2HHU A;  5ALI A;  3K4G A;  2GWS A;  2H5X A;  4PPX A;  2ZXH A;  4DSJ A;  1S0O A;  3BS7 A;  1IXR A;  2L5Y A;  4I2J A;  3EPG A;  8ICR A;  5J29 A;  2FLP A;  1YZ7 A;  4ED3 A;  2DKZ A;  3RJK A;  2R8H A;  5AM3 A;  4DSI A;  3PMN A;  4ZOH C;  1U47 A;  4G9B A;  2WF7 A;  2ESE A;  2VKQ A;  1NKC A;  5CWR A;  1ZQY A;  4NL9 C;  3PO5 A;  1BPE A;  3HJE A;  3C21 A;  5KAF U;  5DDM A;  1U45 A;  8ICA A;  4J03 A;  3TAN A;  3MR2 A;  4UAZ A;  1IIP A;  1ARO P;  2DBY A;  1Z00 B;  3SZ2 A;  4QWB A;  1ZQA A;  2BPG A;  4ECV A;  4QZG A;  1T4G A;  1TK0 A;  5JRT A;  2EAO A;  1QCK A;  5KG3 A;  5BOM A;  4O3P A;  1N48 A;  1JI7 A;  3BQ0 A;  2WHE A;  4TUR A;  4C8K A;  4DQR A;  5AI6 A;  4QIW C;  2BCQ A;  4EEL A;  1URJ A;  1X40 A;  5J0Y A;  3PY8 A;  1J2M A;  2JRZ A;  3WK8 A;  3M6K A;  3PW2 A;  3BZK A;  4Y2R A;  1JN3 A;  4YR0 A;  2NV3 A;  2YMQ A;  2EDU A;  4MEY A;  4DS4 A;  2HHV A;  3H0L B;  4I28 A;  3N97 B;  7ICF A;  3NRW A;  5H2F U;  4ECY A;  1SL2 A;  3HKZ C;  1COK A;  3OHB A;  3MGI A;  4NV0 A;  1L3U A;  4F4Y A;  4FZL A;  3MDC A;  4PGX A;  3QEA Z;  5KG7 A;  3L5K A;  5ALP A;  3PX0 A;  2Y1I A;  2YB1 A;  4DEZ A;  5J0Q A;  4RQ1 A;  4B6J A;  3IG8 A;  3OSP A;  4B9U A;  4TUQ A;  2CPR A;  2HHS A;  3WK9 A;  1JXL A;  1UA1 A;  4YD2 A;  4F92 B;  4J9Q A;  3PVX A;  2E8M A;  4KLE A;  5KFA A;  4KX3 A;  1Z1V A;  4Y2X A;  2K4P A;  4ACO A;  3N4M B;  4Q43 A;  4Y2U A;  9ICB A;  2FE9 A;  5J0O A;  3ZDD A;  1ZQK A;  4M2Y A;  1ZQL A;  1TAM A;  2KIW A;  3RTV A;  4K4H A;  1RDF A;  2ZTD A;  2EZZ A;  4F72 A;  5DBC A;  4KMO B;  4OCZ A;  3F2D A;  3LK9 A;  3ETR A;  5ALK A;  3QZ7 A;  3BQ2 A;  4UAU A;  3KOO A;  4ECT A;  4UAY A;  7ICG A;  1RYS A;  4DL4 A;  5C5J A;  4CDG A;  3H4B A;  4KN7 A;  3TFR A;  4F50 A;  3KTQ A;  1HJP A;  4Y2Y A;  3TKA A;  1UPH A;  3PZP A;  2J6S A;  5BOL A;  3PW7 A;  2JEI A;  9ICE A;  3OJU A;  1KL9 A;  1SL0 A;  4JV2 A;  8ICE A;  3C23 A;  7ICS A;  3GIJ A;  9ICI A;  5KTQ A;  2A3V A;  3EYZ A;  4IRD A;  5AK6 A;  3V7L A;  3C28 A;  4X5V A;  2FJ6 A;  4GC7 A;  1SZP A;  1SKW A;  3TAD C;  3F2B A;  2H3Z A;  5DLF A;  5KFX A;  2PFO A;  4R65 A;  4ECS A;  4LJX A;  4K4I A;  2ZIU A;  1TV9 A;  1FO4 A;  3Q8S B;  2W7P A;  2UVV A;  2CXY A;  4O3M A;  5CRX A;  2EAN A;  4OJP A;  4RQ0 A;  5L1L A;  2V9W A;  4IR1 A;  4HYK A;  2NRV A;  3WK4 A;  5BPC A;  9ICV A;  2LYA A;  4NLN A;  1XO1 A;  3U26 A;  4RQ3 A;  4YMN A;  2DPI A;  4ICA A;  2XGQ A;  4J9P A;  2DPJ A;  3SR6 A;  3SQI A;  3AQE A;  4CGZ A;  2KKV A;  4QNL A;  4F5N A;  2KNJ A;  3C1Z A;  5KFB A;  3AM9 A;  7ICM A;  2MUT B;  8ICK A;  4I2F A;  3JPQ A;  4C4T A;  4OJL A;  2JEG A;  4DOB A;  7ICR A;  2ZIV B;  3BJY A;  3PV8 A;  3T5H A;  5ALW A;  3SAG A;  3THV A;  3BQ7 A;  2YMM A;  4XQ8 A;  3AU6 A;  1ED1 A;  2KD1 A;  8ICV A;  1MQ3 A;  3MC1 A;  3GII A;  1NJW A;  1ZQJ A;  3KZX A;  3IM1 A;  2R8I A;  2ZTE A;  4DF8 A;  3IN5 A;  1NZP A;  3RFA A;  3RBD A;  9ICW A;  2BPF A;  2C2D A;  2AH5 A;  4UB8 U;  3HKZ F;  4NJ8 A;  4O3Q A;  2LI6 A;  2AHO B;  1LB2 B;  5ALM A;  5JU5 A;  1J2N A;  4C80 A;  3AL0 B;  1VLB A;  2XCA A;  2GH1 A;  4Q45 A;  3KHH A;  5AM5 A;  3ZD9 A;  2JGA A;  2PXI A;  2KP7 A;  5C0Y A;  1DK2 A;  1D8B A;  3D2N A;  2KSO A;  5KFT A;  2ASJ A;  4QZB A;  4QWA A;  1S0V A;  1JRO A;  5KFK A;  1SV0 A;  5ALZ A;  2HHQ A;  5D4B A;  4KLQ A;  4ED1 A;  3LVW A;  1NZB A;  4GC6 A;  4DL3 A;  2W8L A;  3TAQ A;  4J9R A;  2W7O A;  5HHI A;  5AKE A;  4F4W A;  1WYG A;  2G08 A;  3CNH A;  3SI8 A;  1KQQ A;  4F4Z A;  4RQM A;  4KLU A;  5KFG A;  1U49 A;  1NI3 A;  2ZIU B;  3GIK A;  3I1Y A;  3QU2 A;  4OJ6 A;  2XGP A;  2XVT A;  2WTF A;  2JZB A;  1TVA A;  3HW8 A;  2A1J B;  2O6K A;  9ICU A;  5GTI U;  2ZXI A;  2DGZ A;  2FLL A;  4DCC A;  3G6V A;  2QB1 A;  4KLF A;  2W9M A;  2YY6 A;  1V38 A;  1DRG A;  2HVH A;  7ICK A;  2BKE A;  2K4E A;  2LBO A;  5CHG A;  1X9M A;  4UAW A;  5III A;  2UVW A;  2H3Q A;  4NLG A;  4BXO B;  4KLJ A;  3GV5 B;  2ZIX A;  3BS5 B;  5EWE A;  2F3N A;  3T79 A;  3OJS A;  2I6X A;  4QJF B;  1JAL A;  2M9N A;  3N7R C;  4FZM A;  2C2R A;  2KJ9 A;  3BDP A;  5L1M A;  2ZUC A;  2PKE A;  3WK6 A;  3RJJ A;  2G07 A;  4TQS A;  4I29 A;  2KVS A;  3EUB 2;  4YMM A;  4DSF A;  5F9N A;  5EWF A;  5KFJ A;  5KG5 A;  2G06 A;  1XSL A;  4CCH A;  4OJO A;  4KIT B;  1L7N A;  2G0A A;  2FI1 A;  4UB2 A;  4RT2 A;  3G6Y A;  4I2G A; 
#chains in the Genus database with same CATH homology
 5H2F U;  4UB6 U;  3A0B U;  2AXT U;  1S5L U;  5GTI U;  5B5E U;  5GTH U;  5B66 U;  4IL6 U;  5TIS U;  4UB8 U;  3WU2 U;  5E79 U;  5KAF U;  2DUY A;  3A0H U;  5KAI U;  4PJ0 U;  3KZI U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...