4PJ0U

Structure of t.elongatus photosystem ii, rows of dimers crystal packing
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
96
structure length
96
Chain Sequence
LVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein 1
publication title Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
pubmed doi rcsb
molecule tags Oxidoreductase, electron transport
total genus 28
structure length 96
sequence length 96
chains with identical sequence u
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 4pj0U01
3WU2U 5B5EU 5KAIU 2AXTU 4UB6U 5GTIU 4PJ0U 4IL6U 2DUYA 5B66U 3A0HU 5GTHU 5H2FU 1S5LU 5KAFU 3KZIU 5E79U 5TISU 3A0BU 4UB8U
chains in the Genus database with same CATH superfamily
1YT3A 2PMZF 1V97A 4UAWA 1S0MA 5KFRA 2HHTA 2OH2A 3K75D 2AXTU 5AM5A 4P2HA 4DL3A 2BPFA 3ISBA 3BS7A 2WF5A 3WK4A 3JPSA 4AYBF 3OHAA 3V6KA 2GOLA 3TKAA 5AKEA 1ZQTA 5DDMA 1WG8A 2KZ3A 4QW8A 4KX5A 3PO5A 2ISPA 3PR5B 2GH1A 1X2IA 1XSPA 2QB0B 3MFHA 4JWMA 2F8LA 2YMQA 1J97A 3N7RC 4Y2JA 2FPKA 2YY6A 2W7PA 3AU6A 2O6KA 1N62A 1COKA 2ESEA 3THVA 4F72A 2Y1IA 5AKZA 4O3MA 8ICTA 1B0XA 3QU2A 5EE3A 3BS5A 1HEKA 3L5KA 1RQLA 4US8A 1BPYA 5KT4A 2Z7JA 4RQ2A 5AK5A 2V4RA 1ZRNA 3PO4A 4Y2PA 4G9BA 5AM3A 2XICA 1QLNA 1LKYA 5AI8A 4JV2A 4CF5A 2E8OA 4RNMA 3WK5A 4FE3A 1KL9A 1RM6C 3M7DA 4AYBC 5DDYA 4PL2A 2G0AA 1X6IA 3GIJA 1COOA 4ELVA 2YB4A 4EZ6A 2WF9A 1ZRMA 2K89A 2YMLA 4NXZA 1MN8A 1JIHA 3RRHA 4KLIA 5KG0A 2FI1A 4GFJA 5J2DA 4CGZA 5KAIU 1NKEA 4TUSA 1ZOLA 1ZQZA 3RBEA 5AKXA 4LZGA 8ICUA 2H3VA 1FEZA 2YMMA 2KFZA 4F4XA 4ECWA 2KIVA 2XY6A 9ICAA 2W9MA 4Y2XA 2BKEA 7ICGA 2BCQA 4UAUA 5CWRA 3NTUA 3ZDCA 2IBKA 2FE9A 5AIAA 5FP0A 4B9SA 1QQ5A 3PW4A 1A0PA 3NRZA 2DBYA 4I2EA 1SV0A 4YMNA 3KKAC 3IN5A 7ICLA 3T3FA 4UB8U 3BQ0A 3M1YA 1QSLA 2LYHA 3ICXA 1TAQA 1WCLA 5ALKA 2Y0SF 3RB3A 2MU2A 3M9OB 4Z6FA 2JV3A 4RQ1A 2KG5A 4QZEA 1ECWA 5KFTA 3JPQA 2W9CA 5ALJA 2WB1C 2EDUA 5K4LA 3ZDEA 2F8KA 4C7ZA 1RYUA 3RJGA 1ZQAA 2ZG6A 2ODGA 3AM9A 4UW9A 2FMSA 3Q8LA 4B9NA 2KMDA 1BPZA 2R8IA 3NS1A 3QU5A 1T4GA 1DK3A 3V7JA 5AICA 2JRZA 2OCEA 4I29A 1ZQLA 1KW4A 4DLEA 3PSTA 4KLDA 1RDFA 1Z1BA 1RPLA 5ALEA 1WWUA 5IIMA 4JB3A 5ALSA 3GU3A 4O9MA 3VCBA 1Q8KA 2W11A 4NLZA 4DS5A 2FPLA 1UHUA 5AI6A 5ALYA 4P4MA 2LMRA 4I2HA 4OJ5A 1ZYQA 4DOBA 1L3VA 2FJ6A 3UMCA 8ICCA 1JN3A 3L4PA 3T5KA 3RJKA 3JPPA 5IILA 1TK5A 1K1QA 1ZQ1C 8ICPA 4NL9A 4IL6U 2PFNA 1FFVA 3BZKA 2OYYA 3BS5B 2KD1A 2WF6A 5DBCA 1KFSA 4G3IA 4Q8EA 1MQ2A 2EZXA 4JMUA 3PW2A 3FAHA 3M8RA 3RF9A 4IS7A 2DPJA 1M6YA 4KLEA 4DWIA 5J2GA 5DB7A 5DB9A 3OSNA 1KDHA 5AIBA 3PX4A 3B9JA 1ZQSA 4C8KA 1A6SA 3UQ2A 4R64A 1NKBA 4MFAA 2ZIWA 4Y2QA 5KT6A 4ECZA 5ALXA 4UB3A 1T7PA 3ZDDA 4XRHA 1CUKA 3C28A 8ICHA 4BJQA 1SGGA 1XO0A 1L7OA 4NV0A 2AHOB 3V72A 3C23A 1D8LA 4QZDA 4UB4A 2NRXA 2BR0A 1BPEA 5ALFA 3PV8A 5KFXA 5KFSA 4EELA 5HMLA 3HKZC 4TQRA 2KTQA 1BPBA 1ZQVA 4C8MA 5KFEA 4I2DA 1VDVA 2ZJ8A 2A1AA 4PJ0U 5CA7A 8ICVA 3WKDA 3C2LA 2W3RA 3E2EA 4YP3A 5ALIA 7ICQA 3IV6A 5ALWA 4QZ8A 3M6KA 2G07A 2LBOA 2CN1A 3MBYA 2W9AA 1Z1VA 2DKXA 2M0NA 3J81j 3CRXA 2UVUA 5KFJA 2W54A 5CP2A 4DFKA 4DL2A 3WKCA 3UM9A 3ED5A 4RPZA 5DLFA 2HDOA 1K5OA 4QIWF 5AKGA 1DRGA 4ED1A 1DGJA 2EQYA 2F1JA 5TZVA 4ZH4A 2RDIA 3UPQA 3RH5A 4MF2A 4B9TA 1SZHA 2IOFA 1N60A 4J9KA 1KBUA 2WHEA 2EAOA 2C22A 1DGSA 3T5JA 5EE9A 3IHQB 1BVSA 5DG7A 1SL0A 2OM6A 3QUTA 1OUQA 2J6TA 8ICQA 9ICXA 3C2KA 8ICBA 1T94A 4M9HA 4K4IA 4YQWA 2IOHA 3OPXA 4DL4A 2XVTA 2R8KA 2HW3A 3VC8A 4RQ0A 4DSKA 4O5KA 5AHXA 1MSWD 3ETRA 3KFUF 3BQ2A 2ASLA 2ZTCA 1BGXT 3QX7A 4WJ3B 3MC1A 2DF4B 3C1ZA 3EPGA 2RLTA 3H8SA 2QB1A 3D2NA 2WAQF 4FBUA 2A3VA 2BCUA 4FZMA 1L7NA 1S8OA 2ASDA 1ZD5A 4RNNA 3EYZA 2E8NA 3ORYA 3QU4A 5KG5A 2ISOA 3I76A 4ED3A 3DV9A 3QUBA 2IHNA 3RFAA 2DGZA 3S6JA 2KIWA 2BDUA 4J03A 2KZMA 4R65A 2K60A 3LDAA 1Z3EB 9ICPA 4UARA 8ICRA 3ZD8A 1BNPA 4USAA 3H8MA 3GIMA 5JTIA 3F5AA 2VA3A 4KLJA 4F2SA 2P6RA 2G09A 5AKIA 8ICFA 2J6UA 3V7LA 4ICAA 3CYMA 4DOAA 2ZIWB 3BQ7A 4CE6A 4YD1A 4ECQA 4QWDA 1F44A 4DOCA 3SQIA 1N61A 5G5GA 3LK9A 1UT5A 3TAQA 4BDPA 5KFNA 2RRDA 2DFLA 1UCVA 1Z19A 3AQFA 1QH9A 5KFFA 1MA7A 3C5GA 4NJ8A 2HBLA 2K4IA 4NLNA 4QWEA 5KFBA 4DSJA 5CB1A 4PHEA 4O5EA 4RQ3A 3RJFA 2BCSA 4EBEA 4I2IA 1X40A 2JR5A 1QQ7A 4ECXA 1PVQA 3WKBA 1L7MA 4DQSA 4C80A 5KFOA 3MR3A 2BQRA 3HJEA 3AU2A 4TUPA 4UAVA 1JRPA 1KRPA 3PSFA 2A19A 1ZQKA 4ECTA 3SAGA 1L3SA 4YXMA 5ALPA 8ICMA 3MDAA 1F5SA 1Y88A 2AGQA 3PX0A 3F2BA 1ZQUA 1ZQOA 2QKQA 4KX3A 5J2HA 7ICFA 4RQNA 2DKZA 3FYHA 1ED1A 2E1FA 5HNKA 2KJ5A 3G6VA 1B22A 2K8AA 1JXLA 4PL1A 4YR2A 2UVWA 4GXIA 3PW5A 4O5CA 8ICYA 3Q8SB 4ED0A 2ZIXB 3I1YA 3LYSA 4GIBA 2RHFA 2JMGA 5IINA 1TK8A 9ICEA 4UATA 4R8UA 4B6JA 5CEHA 1JMSA 4UB2A 4YCXA 3ISDA 2KJ8A 2GWSA 1BNOA 8ICGA 4F92B 2OXOA 4QWAA 3L3FX 2KP7A 2H5XA 4RT3A 1ZQCA 4DF4A 5J2EA 2ZUCA 3QUCA 3QZ7A 2I9GA 1IV8A 1XNSA 2ZIVA 4I2GA 4O3PA 1KLNA 2HVIA 1SZPA 1HJPA 5KG7A 5KT3A 5DBAA 2HHSA 1KFDA 1SKWA 3RAXA 1SL1A 4F4ZA 2F44A 5KTQA 5DQHA 5D49A 4QWCA 4P0QA 3AUOA 1UQVA 2Y1JA 3H8WA 3UXNA 1L6NA 4ECUA 2PXIA 4NL9C 4F5NA 2HVHA 3PW7A 4PPXA 4IC9A 4M04A 9ICWA 4C4TA 5J8YA 4BGDA 2B21A 5AI4A 5KFDA 2KSOB 2RDJA 5AK6A 3Q8KA 3KHGA 5DGBA 5EOZA 2F2AB 4CF3A 2WB1F 4YFKA 4Y2YA 4F2RA 4PGQA 1TAUA 1ZD3A 4U7CA 5KFZA 5AK3A 5AKLA 2I6XA 3AEVA 4Q43A 4CRXA 5JUMA 4YR3A 1RYRA 1KSPA 3RAQA 2KK0A 1Q3VA 2KV2A 4EZ9A 5GTHU 8ICOA 1NK0A 1N2XA 5KG6A 5KFQA 2QARB 2GLEA 1RXVA 5CJ7A 3MR6A 5E79U 4FBTA 4RQ8A 5AM2A 4KLHA 2D8CA 2BHNA 3MGVA 3TFSA 3MGIA 2JGAA 2WF7A 1NK9A 4F4WA 1B43A 5KT7A 1OW5A 2W04A 4QZBA 5DG9A 3CW2C 4KLFA 2ZTEA 4FS1A 2R8JA 5L1MA 2YQEA 3N28A 4QW9A 4EYHB 1K1SA 1CRXA 2UVRA 4NLKA 4IQTA 1J2MA 1U47A 1YZ7A 4QNLA 2XI9A 3PMNA 4DO9A 3T79A 1PVPA 3ZDBA 4TQSA 2XY5A 2KHVA 4DQPA 1T8EA 3NVYA 1TAMA 5ALMA 4DSIA 9ICCA 3C5FA 3UXOA 2W55A 1FO4A 3T5HA 2HBMA 4DEZA 4UB1A 4R8UB 4TURA 5KFVA 2Q0ZX 4JK1A 2AU0A 2FPMA 2HHWA 5ALNA 2KKVA 1CEZA 4XA5A 4PZNA 2F77X 1SKRA 2VIXA 5DBBA 5ALQA 4B9MA 4RQ7A 2I1QA 2E5SA 3N7SC 5AM1A 1O03A 1PK3A 5BOLA 2ZIVB 3F53A 3V7KA 4FO6A 1KEJA 2XO7A 1V38A 3OHBA 3HKZF 2XGPA 3NVVA 2J6SA 2KVSA 1ZQQA 2E8PA 1IM4A 9ICIA 2NV3A 3PSIA 3T5LA 5AM0A 1XC9A 4KN7A 4LJXA 4IQUA 3GILA 2W3SA 4KTQA 3K4GA 1ZQRA 3SAHA 3F2DA 4F5PA 4P0QB 5KFMA 4J9SA 5L1LA 9ICTA 4EENA 2BDPA 5DB6A 2LPEA 1ZQFA 4RQ4A 4ED7A 4F71A 4NY8A 1NOMA 1KFTA 4JWNA 5IIIA 1D8BA 4O3OA 2WFAA 5TISU 2DPIA 2VJ4A 2PFOA 4MEXA 4BX9C 5KFYA 2NRZA 1U45A 5ALVA 4J9QA 9ICJA 2RQ5A 1HUZA 1TVAA 3K1RB 2W8LA 5DB8A 2K8CB 4RU9A 1UPHA 3H40A 8ICIA 2PFQA 1D9FA 1KQQA 1Z4NA 5EWFA 1L5UA 2H3FA 3TI0A 1FFUA 1S0VA 2B6GA 9ICBA 3M6ZA 7ICOA 5HP4A 1NK6A 3SZ2A 1HUOA 2RP5A 7ICKA 1O08A 3D2SA 3C21A 2K4PA 1L3TA 3M9MB 2HHVA 5JU5A 1L8LA 1LV5A 2YN4A 4MHVA 1SIJA 4IRKA 3C2MA 2BQUA 3M9NB 4Z6CA 5J0XA 3PMLA 4CCHA 4RT2A 3A0HU 1PK1B 3DDHA 3KHHA 1S5LU 3QEAZ 4DS4A 2HI0A 2DWQA 5AKYA 2G5IB 3N97B 4R63A 3KBBA 5ALLA 1N48A 2XCPA 4M6WB 4KMOB 4NM1A 1ZQJA 1RQNA 1WUDA 4M2YA 2ZIXA 5KG3A 1QTMA 4PGXA 1ZQDA 2DL0A 3G6YA 5EWEA 4ECSA 4O3QA 9ICVA 2KJ9A 1VJ5A 4ECYA 4ED8A 4TUQA 2Q4TA 1S77D 3FC4A 4B9LA 1NJWA 4ECVA 5DLGA 7ICSA 2JEGA 2A1JA 2KE7A 3ETLA 3QU9A 4DQIA 5D4BA 3TADA 3OTQA 5H2FU 4FFDA 4DSFA 3OJUA 3EWAA 1X42A 3AN1A 1ZQHA 4UASA 9ICHA 2IA6A 7ICIA 4UAYA 2W9BA 3RB4A 4MEYA 7ICNA 4M9GA 2E8MA 1YZ6A 2KKPA 3KZIU 2GO7A 5J2CA 3LVVA 8ICNA 4O0IA 2JEJA 1ZQXA 1C20A 3RB0A 3BDPA 5KFWA 2YB1A 2AH5A 1UA1A 4EEKA 1QQ6A 2FLPA 3IP4B 1LVHA 4EX7A 1ZQYA 4JUZA 2HHXA 2KSOA 4UAZA 5DQIA 4MFFA 1A76A 4KMUA 4I2BA 4DF8A 5KAFU 1QSSA 4F5QA 4IQWA 5KFUA 2PKEA 5J8YC 4OJLA 1IXRA 4EBDA 3PR4A 3PSPA 5JRTA 4UBBA 4J9MA 2DUYA 1NJZA 5J29A 3QXGA 4I27A 1ZQGA 4IR1A 1XSLA 4KLUA 4RPYA 4PGYA 4Z6EA 1LB2B 4EX6A 3E58A 4CNQA 2NYVA 2XY7A 1ZQWA 3EW9A 1RG6A 3RJHA 3WU2U 1SXEA 5F9LA 3GIIA 5F3XB 9ICSA 4PHDA 3H8JA 3SV3A 3MABA 1JALA 2OHFA 2P35A 4JV1A 4C4RA 2EANA 2QARA 1NJXA 2ZXHA 2K4HA 4EBCA 4US9A 3RR8A 3MFIA 3GDXA 4C8OA 3AMZA 4P0PA 4YMMA 4UBCA 2LKYA 3KHLA 3R9KA 1BPXA 4ELUA 5J0UA 2VJ5A 2BPGA 3SENA 5J2JA 2B0CA 1D8YA 3SEIA 1SV0C 1SWVA 4NLBA 2KZZA 3PNCA 1DXSA 2G5HB 2HHQA 2HOFA 5CRXA 1X66A 9ICUA 2QLTA 3UQ0A 2I5HA 3FDSA 2L5YA 1U9LA 5ALOA 3UMGA 2AQ4A 1VLBA 4QJFB 1N5XA 1ZJNA 1NKCA 5T14A 4RQ5A 5DG8A 1CI4A 2V4QA 3JPOA 4Q44A 2MRLA 1RZTA 1ZJMA 2MUTA 5DGAA 2PI4A 4JV0A 1BPDA 3WKAA 4DLGA 4KLOA 4U6PA 4YMOA 2K8BB 5KFHA 4HYKA 1X6JA 3IG5A 5KL8B 3BQ1A 3SV4A 3EZ5A 2JH7A 5AM4A 2Y9TA 3H0LB 5A0LA 5ALZA 9ICGA 4QZIA 4Y2RA 5EWGA 3TANA 2AQ0A 2ZTDA 2A1JB 5J0OA 4GC7A 5KFAA 4F91B 1UA0A 1NK7A 2XIDA 5BPCA 2C2DA 4FS2A 4QZCA 2PI5A 1JROA 4RQ6A 5J2FA 2ATLA 2FMQA 3H0RB 2JEFA 2KICA 1D9DA 3PZPA 5DQGA 8ICJA 8ICZA 3UMBA 3TACB 5J2AA 9ICFA 2IHMA 4PHAA 2W9BB 1ZQEA 2AJQA 1QCKA 1V85A 3H4BA 7ICMA 3QNMA 2ALZA 4GXKA 3A0BU 5J0SA 4J9RA 3CNHA 2JHDA 3GIKA 1N56A 9ICLA 2MSNA 3ZI4A 3QEBZ 5J0WA 4XQ8A 1URJA 2OEHA 4ELTA 4O3RA 2PMZC 2WF8A 4F5RA 4KLTA 2EZZA 2VKQA 4NWIA 2NO4A 3C29A 4RUCA 1T3NA 1DOQA 2HBKA 1Z00A 2C2EA 2DQNB 2HCFA 2LM4A 3JPNA 2BGWA 8ICSA 3KD3A 1QSYA 1L8OA 5AI5A 1ZD4A 2JEIA 3PW0A 4F50A 3TFRA 4YR0A 4F93B 3TQ1A 3HILA 2JZBA 4BXOA 2UVVA 2YMPA 2ZJAA 2XGQA 1T3QA 4Y2UA 2HOIA 4OCZA 5CR0A 2JXJA 7ICPA 5L1KA 2ZIUB 1Q46A 4F3OA 3PX6A 1TK0A 2IMWP 2ZXIA 2H3IA 1SV4A 4FZNA 4P4PA 4I2FA 3Q8MA 2D3DA 1HIWA 4C8NA 5KG4A 4M9JA 3E0FA 1PK1A 3BZCA 2P66A 2LI6A 5AK4A 5BOMA 3SYZA 2YTUA 4P0PB 2EAMA 4NM2A 1JUDA 2CXYA 4ZOHC 4Y2SA 5KNIA 2ZUDA 8ICLA 2HBJA 4YG2A 4OJ6A 4PHPA 2VA2A 7ICHA 4M6WA 5C5JA 4YXJA 4J9OA 3OGUA 4DQRA 4QZGA 2R18A 3GFKB 3ZDAA 3HWTA 1X9SA 4BUGA 1ZQMA 4KLQA 1ZQPA 4GLXA 4X5VA 1S9FA 3RJJA 4IR9A 1NK4A 3NUQA 1V9PA 1RXWA 4M9LA 3EUB2 5HHIA 4RNOA 4ECRA 3LWMA 4I2JA 3RBDA 3N7PD 1XU4A 1XSNA 5ALDA 4M9NA 3SAFA 4NLCA 3SMVA 2MUTB 5ALHA 4J9NA 4KN4A 3I28A 4J9LA 4KLGA 5IIJA 3GZFA 3HPOA 3NASA 2R8GA 1XO1A 7ICRA 5ALUA 2KHQA 2E3TA 3TAPA 3KZXA 1PVRA 3M8SA 4Q8FA 4IRDA 2E1EA 3QZ8A 3QYPA 5B5EU 1AROP 3HX0A 3TADC 3OSPA 1MQ3A 3HW8A 1WWVA 4DFJA 2ZJ5A 4UB6U 3ALRA 2FMPA 3HT3A 4MF8A 3EPIA 2V9WA 1ZQNA 1TE2A 3WK8A 1C7YA 2K4EA 4PH5A 2FLLA 4DQQA 2Y0SC 4C0ZA 3BQTA 1S97A 5J0YA 2LYAA 2W03A 3V6HA 3FM9A 4BWMA 5CHGA 3H7IA 5J2BA 5ALGA 3DEEA 4NLGA 2BCRA 9ICNA 5HR7A 2AGPA 1SL2A 2XCAA 4ED2A 2NO5A 1Q3UA 5J0PA 4OJOA 4EEYA 3SR6A 3JPRA 1NI3A 4EYIB 5L1IA 4KITB 1U48A 2BZFA 3AQEA 1A77A 2EH9A 2D6FC 2F3NA 1LKYB 1ZQIA 4E0DA 5J2IA 4A8EA 4F4YA 1Z00B 2W43A 4DL6A 4YVZA 1X9WA 4I2AA 3WKEA 3UXPA 4F4KA 4DFMA 5IIKA 3RH6A 4MFCA 3U26A 1H38A 2KFNA 2JZBB 1SWWA 3G6XA 4BXOB 3F2CA 2BQ3A 8ICAA 4C8LA 4RZRA 4RUAA 2VANA 2KOBA 5AKHA 5AI9A 2XC9A 3HRDD 5AKJA 3Q8RB 4K4HA 3WK9A 4QZAA 3NRWA 9ICRA 4ED6A 4RQMA 4QWBA 3RH4A 3KKAA 2ASJA 5AI0A 1KTQA 2EZYA 2W8KA 3WK7A 5KFLA 3LWLA 4Q45A 4B9VA 3LVWA 4DFPA 9ICQA 1N63A 1J2NA 2G08A 1FIQA 1NK8A 1MC8A 5HHHA 5KL1B 4BWJA 4C7YA 4M47A 4F5OA 1Z4OA 1U49A 2LM1A 2LYBA 3QUQA 2HHUA 5D46A 3KHRA 4YD2A 3IM1A 5IIOA 7ICVA 3SD7A 1X9XA 5ALRA 4P4OA 2FDRA 3V6JA 4CF4A 4RPXA 3MDCA 1NJYA 4QZFA 3GV7B 3RJEA 4AP9A 2W9CB 3JPTA 4FZLA 3NGDA 1SKSA 5ALTA 8ICWA 2P6UA 1ZQBA 2PFPA 1DK2A 1S10A 5KG2A 3IDWA 5J0QA 3SI8A 3QE9Y 2Y9UA 3IG8A 4OJPA 1GO3F 1U4BA 1NZPA 3NVWA 1TFRA 1PUZA 1P7DA 2KNJA 2ZUBA 5G5HA 4UB5A 2M9NA 2WTFA 3D6JA 2HOQA 4KLLA 2HSZA 1TKDA 1ZD2P 2IOFK 2QB0A 2VA8A 5KT2A 1SXDA 4ACOA 4O3SA 2F1HA 3GV5B 1IG6A 8ICKA 4CDGA 1JXEA 5DKWA 3IRUA 4B9UA 9ICKA 5HMMA 4R66A 4KLMA 3RTVA 7ICTA 3GV8B 5KFKA 4O3NA 2N1RA 7ICEA 5J0RA 2ES6A 2H3QA 1XS9D 5EE1A 4QIWC 4QZHA 2C28A 1L3UA 4Y2VA 2F1IA 5KG1A 2LHTA 3PY8A 4IQVA 3MR5A 2EAPA 4Z6DA 5J2KA 1NK5A 4DCCA 1S0OA 5HR6A 2KEYA 5L9XA 2BPCA 5F9NA 3Q8QB 2FLNA 2G06A 5AKKA 3RRGA 4J9PA 1UT8A 4XUSA 3H0MB 1S0NA 1AQ6A 1F0MA 3WK6A 4DL5A 1KN5A 1KKXA 3B0YA 1NZBA 7ICUA 2MA1A 3Q8PB 3RJIA 4DSEA 2AGOA 4K4GA 1ZXIA 3AL0B 4LZDA 3NVZA 2YX8A 3GQCA 1S76D 1NNLA 2NRTA 1WCNA 1EXNA 3D2QA 5KFPA 3N4MB 1B4FA 3H4DA 4M0AA 3ZD9A 1X9MA 7ICJA 3KOOA 4HAIA 3B0XA 5J0TA 2OWOA 3RB6A 2NRWA 2ZIUA 5L1JA 2C2RA 2W7OA 2JH1A 2F76X 4OD0A 2NRVA 1ZETA 3MR2A 5GTIU 5EE0A 2MAXA 5KT5A 3KTQA 4UQGA 5C0YA 4I2CA 2HMXA 3MGHA 1PZNA 4LVSA 4F8RA 9ICOA 1JI7A 1IIPA 4GXJA 4DL7A 5KFGA 2WAQC 2CPRA 3F5EA 2KVCA 4GC6A 8ICXA 1WYGA 4DFDA 4YN4A 1TV9A 3BJYA 2CRXA 3C1YA 3O0FA 8ICEA 1JX4A 4I28A 4KLSA 1OXJA 1SB3C 2BCVA 2H3ZA 4IRCA 4Y2TA 4PZOA 5KFIA 3CP8A 1L7PA 1XWLA 3ONNA 2KN7A 9ICMA 3PVXA 3OJSA 3TARA 1RYSA 5B66U 4C4SA 1N5WA 5KFCA 4OO1J 3K1ZA 3HP6A 4DSLA 3QU7A 3ISCA 3RR7A 2R8HA 4QZ9A
chains in the Genus database with same CATH topology
3WU2U 5B5EU 5KAIU 2AXTU 4UB6U 5GTIU 4PJ0U 4IL6U 2DUYA 5B66U 3A0HU 5GTHU 5H2FU 1S5LU 5KAFU 3KZIU 5E79U 5TISU 3A0BU 4UB8U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU2 U;  5B5E U;  5KAI U;  2AXT U;  4UB6 U;  5GTI U;  4PJ0 U;  4IL6 U;  2DUY A;  5B66 U;  3A0H U;  5GTH U;  5H2F U;  1S5L U;  5KAF U;  3KZI U;  5E79 U;  5TIS U;  3A0B U;  4UB8 U; 
#chains in the Genus database with same CATH topology
 1YT3 A;  2PMZ F;  1V97 A;  4UAW A;  1S0M A;  5KFR A;  2HHT A;  2OH2 A;  3K75 D;  2AXT U;  5AM5 A;  4P2H A;  4DL3 A;  2BPF A;  3ISB A;  3BS7 A;  2WF5 A;  3WK4 A;  3JPS A;  4AYB F;  3OHA A;  3V6K A;  2GOL A;  3TKA A;  5AKE A;  1ZQT A;  5DDM A;  1WG8 A;  2KZ3 A;  4QW8 A;  4KX5 A;  3PO5 A;  2ISP A;  3PR5 B;  2GH1 A;  1X2I A;  1XSP A;  2QB0 B;  3MFH A;  4JWM A;  2F8L A;  2YMQ A;  1J97 A;  3N7R C;  4Y2J A;  2FPK A;  2YY6 A;  2W7P A;  3AU6 A;  2O6K A;  1N62 A;  1COK A;  2ESE A;  3THV A;  4F72 A;  2Y1I A;  5AKZ A;  4O3M A;  8ICT A;  1B0X A;  3QU2 A;  5EE3 A;  3BS5 A;  1HEK A;  3L5K A;  1RQL A;  4US8 A;  1BPY A;  5KT4 A;  2Z7J A;  4RQ2 A;  5AK5 A;  2V4R A;  1ZRN A;  3PO4 A;  4Y2P A;  4G9B A;  5AM3 A;  2XIC A;  1QLN A;  1LKY A;  5AI8 A;  4JV2 A;  4CF5 A;  2E8O A;  4RNM A;  3WK5 A;  4FE3 A;  1KL9 A;  1RM6 C;  3M7D A;  4AYB C;  5DDY A;  4PL2 A;  2G0A A;  1X6I A;  3GIJ A;  1COO A;  4ELV A;  2YB4 A;  4EZ6 A;  2WF9 A;  1ZRM A;  2K89 A;  2YML A;  4NXZ A;  1MN8 A;  1JIH A;  3RRH A;  4KLI A;  5KG0 A;  2FI1 A;  4GFJ A;  5J2D A;  4CGZ A;  5KAI U;  1NKE A;  4TUS A;  1ZOL A;  1ZQZ A;  3RBE A;  5AKX A;  4LZG A;  8ICU A;  2H3V A;  1FEZ A;  2YMM A;  2KFZ A;  4F4X A;  4ECW A;  2KIV A;  2XY6 A;  9ICA A;  2W9M A;  4Y2X A;  2BKE A;  7ICG A;  2BCQ A;  4UAU A;  5CWR A;  3NTU A;  3ZDC A;  2IBK A;  2FE9 A;  5AIA A;  5FP0 A;  4B9S A;  1QQ5 A;  3PW4 A;  1A0P A;  3NRZ A;  2DBY A;  4I2E A;  1SV0 A;  4YMN A;  3KKA C;  3IN5 A;  7ICL A;  3T3F A;  4UB8 U;  3BQ0 A;  3M1Y A;  1QSL A;  2LYH A;  3ICX A;  1TAQ A;  1WCL A;  5ALK A;  2Y0S F;  3RB3 A;  2MU2 A;  3M9O B;  4Z6F A;  2JV3 A;  4RQ1 A;  2KG5 A;  4QZE A;  1ECW A;  5KFT A;  3JPQ A;  2W9C A;  5ALJ A;  2WB1 C;  2EDU A;  5K4L A;  3ZDE A;  2F8K A;  4C7Z A;  1RYU A;  3RJG A;  1ZQA A;  2ZG6 A;  2ODG A;  3AM9 A;  4UW9 A;  2FMS A;  3Q8L A;  4B9N A;  2KMD A;  1BPZ A;  2R8I A;  3NS1 A;  3QU5 A;  1T4G A;  1DK3 A;  3V7J A;  5AIC A;  2JRZ A;  2OCE A;  4I29 A;  1ZQL A;  1KW4 A;  4DLE A;  3PST A;  4KLD A;  1RDF A;  1Z1B A;  1RPL A;  5ALE A;  1WWU A;  5IIM A;  4JB3 A;  5ALS A;  3GU3 A;  4O9M A;  3VCB A;  1Q8K A;  2W11 A;  4NLZ A;  4DS5 A;  2FPL A;  1UHU A;  5AI6 A;  5ALY A;  4P4M A;  2LMR A;  4I2H A;  4OJ5 A;  1ZYQ A;  4DOB A;  1L3V A;  2FJ6 A;  3UMC A;  8ICC A;  1JN3 A;  3L4P A;  3T5K A;  3RJK A;  3JPP A;  5IIL A;  1TK5 A;  1K1Q A;  1ZQ1 C;  8ICP A;  4NL9 A;  4IL6 U;  2PFN A;  1FFV A;  3BZK A;  2OYY A;  3BS5 B;  2KD1 A;  2WF6 A;  5DBC A;  1KFS A;  4G3I A;  4Q8E A;  1MQ2 A;  2EZX A;  4JMU A;  3PW2 A;  3FAH A;  3M8R A;  3RF9 A;  4IS7 A;  2DPJ A;  1M6Y A;  4KLE A;  4DWI A;  5J2G A;  5DB7 A;  5DB9 A;  3OSN A;  1KDH A;  5AIB A;  3PX4 A;  3B9J A;  1ZQS A;  4C8K A;  1A6S A;  3UQ2 A;  4R64 A;  1NKB A;  4MFA A;  2ZIW A;  4Y2Q A;  5KT6 A;  4ECZ A;  5ALX A;  4UB3 A;  1T7P A;  3ZDD A;  4XRH A;  1CUK A;  3C28 A;  8ICH A;  4BJQ A;  1SGG A;  1XO0 A;  1L7O A;  4NV0 A;  2AHO B;  3V72 A;  3C23 A;  1D8L A;  4QZD A;  4UB4 A;  2NRX A;  2BR0 A;  1BPE A;  5ALF A;  3PV8 A;  5KFX A;  5KFS A;  4EEL A;  5HML A;  3HKZ C;  4TQR A;  2KTQ A;  1BPB A;  1ZQV A;  4C8M A;  5KFE A;  4I2D A;  1VDV A;  2ZJ8 A;  2A1A A;  4PJ0 U;  5CA7 A;  8ICV A;  3WKD A;  3C2L A;  2W3R A;  3E2E A;  4YP3 A;  5ALI A;  7ICQ A;  3IV6 A;  5ALW A;  4QZ8 A;  3M6K A;  2G07 A;  2LBO A;  2CN1 A;  3MBY A;  2W9A A;  1Z1V A;  2DKX A;  2M0N A;  3J81 j;  3CRX A;  2UVU A;  5KFJ A;  2W54 A;  5CP2 A;  4DFK A;  4DL2 A;  3WKC A;  3UM9 A;  3ED5 A;  4RPZ A;  5DLF A;  2HDO A;  1K5O A;  4QIW F;  5AKG A;  1DRG A;  4ED1 A;  1DGJ A;  2EQY A;  2F1J A;  5TZV A;  4ZH4 A;  2RDI A;  3UPQ A;  3RH5 A;  4MF2 A;  4B9T A;  1SZH A;  2IOF A;  1N60 A;  4J9K A;  1KBU A;  2WHE A;  2EAO A;  2C22 A;  1DGS A;  3T5J A;  5EE9 A;  3IHQ B;  1BVS A;  5DG7 A;  1SL0 A;  2OM6 A;  3QUT A;  1OUQ A;  2J6T A;  8ICQ A;  9ICX A;  3C2K A;  8ICB A;  1T94 A;  4M9H A;  4K4I A;  4YQW A;  2IOH A;  3OPX A;  4DL4 A;  2XVT A;  2R8K A;  2HW3 A;  3VC8 A;  4RQ0 A;  4DSK A;  4O5K A;  5AHX A;  1MSW D;  3ETR A;  3KFU F;  3BQ2 A;  2ASL A;  2ZTC A;  1BGX T;  3QX7 A;  4WJ3 B;  3MC1 A;  2DF4 B;  3C1Z A;  3EPG A;  2RLT A;  3H8S A;  2QB1 A;  3D2N A;  2WAQ F;  4FBU A;  2A3V A;  2BCU A;  4FZM A;  1L7N A;  1S8O A;  2ASD A;  1ZD5 A;  4RNN A;  3EYZ A;  2E8N A;  3ORY A;  3QU4 A;  5KG5 A;  2ISO A;  3I76 A;  4ED3 A;  3DV9 A;  3QUB A;  2IHN A;  3RFA A;  2DGZ A;  3S6J A;  2KIW A;  2BDU A;  4J03 A;  2KZM A;  4R65 A;  2K60 A;  3LDA A;  1Z3E B;  9ICP A;  4UAR A;  8ICR A;  3ZD8 A;  1BNP A;  4USA A;  3H8M A;  3GIM A;  5JTI A;  3F5A A;  2VA3 A;  4KLJ A;  4F2S A;  2P6R A;  2G09 A;  5AKI A;  8ICF A;  2J6U A;  3V7L A;  4ICA A;  3CYM A;  4DOA A;  2ZIW B;  3BQ7 A;  4CE6 A;  4YD1 A;  4ECQ A;  4QWD A;  1F44 A;  4DOC A;  3SQI A;  1N61 A;  5G5G A;  3LK9 A;  1UT5 A;  3TAQ A;  4BDP A;  5KFN A;  2RRD A;  2DFL A;  1UCV A;  1Z19 A;  3AQF A;  1QH9 A;  5KFF A;  1MA7 A;  3C5G A;  4NJ8 A;  2HBL A;  2K4I A;  4NLN A;  4QWE A;  5KFB A;  4DSJ A;  5CB1 A;  4PHE A;  4O5E A;  4RQ3 A;  3RJF A;  2BCS A;  4EBE A;  4I2I A;  1X40 A;  2JR5 A;  1QQ7 A;  4ECX A;  1PVQ A;  3WKB A;  1L7M A;  4DQS A;  4C80 A;  5KFO A;  3MR3 A;  2BQR A;  3HJE A;  3AU2 A;  4TUP A;  4UAV A;  1JRP A;  1KRP A;  3PSF A;  2A19 A;  1ZQK A;  4ECT A;  3SAG A;  1L3S A;  4YXM A;  5ALP A;  8ICM A;  3MDA A;  1F5S A;  1Y88 A;  2AGQ A;  3PX0 A;  3F2B A;  1ZQU A;  1ZQO A;  2QKQ A;  4KX3 A;  5J2H A;  7ICF A;  4RQN A;  2DKZ A;  3FYH A;  1ED1 A;  2E1F A;  5HNK A;  2KJ5 A;  3G6V A;  1B22 A;  2K8A A;  1JXL A;  4PL1 A;  4YR2 A;  2UVW A;  4GXI A;  3PW5 A;  4O5C A;  8ICY A;  3Q8S B;  4ED0 A;  2ZIX B;  3I1Y A;  3LYS A;  4GIB A;  2RHF A;  2JMG A;  5IIN A;  1TK8 A;  9ICE A;  4UAT A;  4R8U A;  4B6J A;  5CEH A;  1JMS A;  4UB2 A;  4YCX A;  3ISD A;  2KJ8 A;  2GWS A;  1BNO A;  8ICG A;  4F92 B;  2OXO A;  4QWA A;  3L3F X;  2KP7 A;  2H5X A;  4RT3 A;  1ZQC A;  4DF4 A;  5J2E A;  2ZUC A;  3QUC A;  3QZ7 A;  2I9G A;  1IV8 A;  1XNS A;  2ZIV A;  4I2G A;  4O3P A;  1KLN A;  2HVI A;  1SZP A;  1HJP A;  5KG7 A;  5KT3 A;  5DBA A;  2HHS A;  1KFD A;  1SKW A;  3RAX A;  1SL1 A;  4F4Z A;  2F44 A;  5KTQ A;  5DQH A;  5D49 A;  4QWC A;  4P0Q A;  3AUO A;  1UQV A;  2Y1J A;  3H8W A;  3UXN A;  1L6N A;  4ECU A;  2PXI A;  4NL9 C;  4F5N A;  2HVH A;  3PW7 A;  4PPX A;  4IC9 A;  4M04 A;  9ICW A;  4C4T A;  5J8Y A;  4BGD A;  2B21 A;  5AI4 A;  5KFD A;  2KSO B;  2RDJ A;  5AK6 A;  3Q8K A;  3KHG A;  5DGB A;  5EOZ A;  2F2A B;  4CF3 A;  2WB1 F;  4YFK A;  4Y2Y A;  4F2R A;  4PGQ A;  1TAU A;  1ZD3 A;  4U7C A;  5KFZ A;  5AK3 A;  5AKL A;  2I6X A;  3AEV A;  4Q43 A;  4CRX A;  5JUM A;  4YR3 A;  1RYR A;  1KSP A;  3RAQ A;  2KK0 A;  1Q3V A;  2KV2 A;  4EZ9 A;  5GTH U;  8ICO A;  1NK0 A;  1N2X A;  5KG6 A;  5KFQ A;  2QAR B;  2GLE A;  1RXV A;  5CJ7 A;  3MR6 A;  5E79 U;  4FBT A;  4RQ8 A;  5AM2 A;  4KLH A;  2D8C A;  2BHN A;  3MGV A;  3TFS A;  3MGI A;  2JGA A;  2WF7 A;  1NK9 A;  4F4W A;  1B43 A;  5KT7 A;  1OW5 A;  2W04 A;  4QZB A;  5DG9 A;  3CW2 C;  4KLF A;  2ZTE A;  4FS1 A;  2R8J A;  5L1M A;  2YQE A;  3N28 A;  4QW9 A;  4EYH B;  1K1S A;  1CRX A;  2UVR A;  4NLK A;  4IQT A;  1J2M A;  1U47 A;  1YZ7 A;  4QNL A;  2XI9 A;  3PMN A;  4DO9 A;  3T79 A;  1PVP A;  3ZDB A;  4TQS A;  2XY5 A;  2KHV A;  4DQP A;  1T8E A;  3NVY A;  1TAM A;  5ALM A;  4DSI A;  9ICC A;  3C5F A;  3UXO A;  2W55 A;  1FO4 A;  3T5H A;  2HBM A;  4DEZ A;  4UB1 A;  4R8U B;  4TUR A;  5KFV A;  2Q0Z X;  4JK1 A;  2AU0 A;  2FPM A;  2HHW A;  5ALN A;  2KKV A;  1CEZ A;  4XA5 A;  4PZN A;  2F77 X;  1SKR A;  2VIX A;  5DBB A;  5ALQ A;  4B9M A;  4RQ7 A;  2I1Q A;  2E5S A;  3N7S C;  5AM1 A;  1O03 A;  1PK3 A;  5BOL A;  2ZIV B;  3F53 A;  3V7K A;  4FO6 A;  1KEJ A;  2XO7 A;  1V38 A;  3OHB A;  3HKZ F;  2XGP A;  3NVV A;  2J6S A;  2KVS A;  1ZQQ A;  2E8P A;  1IM4 A;  9ICI A;  2NV3 A;  3PSI A;  3T5L A;  5AM0 A;  1XC9 A;  4KN7 A;  4LJX A;  4IQU A;  3GIL A;  2W3S A;  4KTQ A;  3K4G A;  1ZQR A;  3SAH A;  3F2D A;  4F5P A;  4P0Q B;  5KFM A;  4J9S A;  5L1L A;  9ICT A;  4EEN A;  2BDP A;  5DB6 A;  2LPE A;  1ZQF A;  4RQ4 A;  4ED7 A;  4F71 A;  4NY8 A;  1NOM A;  1KFT A;  4JWN A;  5III A;  1D8B A;  4O3O A;  2WFA A;  5TIS U;  2DPI A;  2VJ4 A;  2PFO A;  4MEX A;  4BX9 C;  5KFY A;  2NRZ A;  1U45 A;  5ALV A;  4J9Q A;  9ICJ A;  2RQ5 A;  1HUZ A;  1TVA A;  3K1R B;  2W8L A;  5DB8 A;  2K8C B;  4RU9 A;  1UPH A;  3H40 A;  8ICI A;  2PFQ A;  1D9F A;  1KQQ A;  1Z4N A;  5EWF A;  1L5U A;  2H3F A;  3TI0 A;  1FFU A;  1S0V A;  2B6G A;  9ICB A;  3M6Z A;  7ICO A;  5HP4 A;  1NK6 A;  3SZ2 A;  1HUO A;  2RP5 A;  7ICK A;  1O08 A;  3D2S A;  3C21 A;  2K4P A;  1L3T A;  3M9M B;  2HHV A;  5JU5 A;  1L8L A;  1LV5 A;  2YN4 A;  4MHV A;  1SIJ A;  4IRK A;  3C2M A;  2BQU A;  3M9N B;  4Z6C A;  5J0X A;  3PML A;  4CCH A;  4RT2 A;  3A0H U;  1PK1 B;  3DDH A;  3KHH A;  1S5L U;  3QEA Z;  4DS4 A;  2HI0 A;  2DWQ A;  5AKY A;  2G5I B;  3N97 B;  4R63 A;  3KBB A;  5ALL A;  1N48 A;  2XCP A;  4M6W B;  4KMO B;  4NM1 A;  1ZQJ A;  1RQN A;  1WUD A;  4M2Y A;  2ZIX A;  5KG3 A;  1QTM A;  4PGX A;  1ZQD A;  2DL0 A;  3G6Y A;  5EWE A;  4ECS A;  4O3Q A;  9ICV A;  2KJ9 A;  1VJ5 A;  4ECY A;  4ED8 A;  4TUQ A;  2Q4T A;  1S77 D;  3FC4 A;  4B9L A;  1NJW A;  4ECV A;  5DLG A;  7ICS A;  2JEG A;  2A1J A;  2KE7 A;  3ETL A;  3QU9 A;  4DQI A;  5D4B A;  3TAD A;  3OTQ A;  5H2F U;  4FFD A;  4DSF A;  3OJU A;  3EWA A;  1X42 A;  3AN1 A;  1ZQH A;  4UAS A;  9ICH A;  2IA6 A;  7ICI A;  4UAY A;  2W9B A;  3RB4 A;  4MEY A;  7ICN A;  4M9G A;  2E8M A;  1YZ6 A;  2KKP A;  3KZI U;  2GO7 A;  5J2C A;  3LVV A;  8ICN A;  4O0I A;  2JEJ A;  1ZQX A;  1C20 A;  3RB0 A;  3BDP A;  5KFW A;  2YB1 A;  2AH5 A;  1UA1 A;  4EEK A;  1QQ6 A;  2FLP A;  3IP4 B;  1LVH A;  4EX7 A;  1ZQY A;  4JUZ A;  2HHX A;  2KSO A;  4UAZ A;  5DQI A;  4MFF A;  1A76 A;  4KMU A;  4I2B A;  4DF8 A;  5KAF U;  1QSS A;  4F5Q A;  4IQW A;  5KFU A;  2PKE A;  5J8Y C;  4OJL A;  1IXR A;  4EBD A;  3PR4 A;  3PSP A;  5JRT A;  4UBB A;  4J9M A;  2DUY A;  1NJZ A;  5J29 A;  3QXG A;  4I27 A;  1ZQG A;  4IR1 A;  1XSL A;  4KLU A;  4RPY A;  4PGY A;  4Z6E A;  1LB2 B;  4EX6 A;  3E58 A;  4CNQ A;  2NYV A;  2XY7 A;  1ZQW A;  3EW9 A;  1RG6 A;  3RJH A;  3WU2 U;  1SXE A;  5F9L A;  3GII A;  5F3X B;  9ICS A;  4PHD A;  3H8J A;  3SV3 A;  3MAB A;  1JAL A;  2OHF A;  2P35 A;  4JV1 A;  4C4R A;  2EAN A;  2QAR A;  1NJX A;  2ZXH A;  2K4H A;  4EBC A;  4US9 A;  3RR8 A;  3MFI A;  3GDX A;  4C8O A;  3AMZ A;  4P0P A;  4YMM A;  4UBC A;  2LKY A;  3KHL A;  3R9K A;  1BPX A;  4ELU A;  5J0U A;  2VJ5 A;  2BPG A;  3SEN A;  5J2J A;  2B0C A;  1D8Y A;  3SEI A;  1SV0 C;  1SWV A;  4NLB A;  2KZZ A;  3PNC A;  1DXS A;  2G5H B;  2HHQ A;  2HOF A;  5CRX A;  1X66 A;  9ICU A;  2QLT A;  3UQ0 A;  2I5H A;  3FDS A;  2L5Y A;  1U9L A;  5ALO A;  3UMG A;  2AQ4 A;  1VLB A;  4QJF B;  1N5X A;  1ZJN A;  1NKC A;  5T14 A;  4RQ5 A;  5DG8 A;  1CI4 A;  2V4Q A;  3JPO A;  4Q44 A;  2MRL A;  1RZT A;  1ZJM A;  2MUT A;  5DGA A;  2PI4 A;  4JV0 A;  1BPD A;  3WKA A;  4DLG A;  4KLO A;  4U6P A;  4YMO A;  2K8B B;  5KFH A;  4HYK A;  1X6J A;  3IG5 A;  5KL8 B;  3BQ1 A;  3SV4 A;  3EZ5 A;  2JH7 A;  5AM4 A;  2Y9T A;  3H0L B;  5A0L A;  5ALZ A;  9ICG A;  4QZI A;  4Y2R A;  5EWG A;  3TAN A;  2AQ0 A;  2ZTD A;  2A1J B;  5J0O A;  4GC7 A;  5KFA A;  4F91 B;  1UA0 A;  1NK7 A;  2XID A;  5BPC A;  2C2D A;  4FS2 A;  4QZC A;  2PI5 A;  1JRO A;  4RQ6 A;  5J2F A;  2ATL A;  2FMQ A;  3H0R B;  2JEF A;  2KIC A;  1D9D A;  3PZP A;  5DQG A;  8ICJ A;  8ICZ A;  3UMB A;  3TAC B;  5J2A A;  9ICF A;  2IHM A;  4PHA A;  2W9B B;  1ZQE A;  2AJQ A;  1QCK A;  1V85 A;  3H4B A;  7ICM A;  3QNM A;  2ALZ A;  4GXK A;  3A0B U;  5J0S A;  4J9R A;  3CNH A;  2JHD A;  3GIK A;  1N56 A;  9ICL A;  2MSN A;  3ZI4 A;  3QEB Z;  5J0W A;  4XQ8 A;  1URJ A;  2OEH A;  4ELT A;  4O3R A;  2PMZ C;  2WF8 A;  4F5R A;  4KLT A;  2EZZ A;  2VKQ A;  4NWI A;  2NO4 A;  3C29 A;  4RUC A;  1T3N A;  1DOQ A;  2HBK A;  1Z00 A;  2C2E A;  2DQN B;  2HCF A;  2LM4 A;  3JPN A;  2BGW A;  8ICS A;  3KD3 A;  1QSY A;  1L8O A;  5AI5 A;  1ZD4 A;  2JEI A;  3PW0 A;  4F50 A;  3TFR A;  4YR0 A;  4F93 B;  3TQ1 A;  3HIL A;  2JZB A;  4BXO A;  2UVV A;  2YMP A;  2ZJA A;  2XGQ A;  1T3Q A;  4Y2U A;  2HOI A;  4OCZ A;  5CR0 A;  2JXJ A;  7ICP A;  5L1K A;  2ZIU B;  1Q46 A;  4F3O A;  3PX6 A;  1TK0 A;  2IMW P;  2ZXI A;  2H3I A;  1SV4 A;  4FZN A;  4P4P A;  4I2F A;  3Q8M A;  2D3D A;  1HIW A;  4C8N A;  5KG4 A;  4M9J A;  3E0F A;  1PK1 A;  3BZC A;  2P66 A;  2LI6 A;  5AK4 A;  5BOM A;  3SYZ A;  2YTU A;  4P0P B;  2EAM A;  4NM2 A;  1JUD A;  2CXY A;  4ZOH C;  4Y2S A;  5KNI A;  2ZUD A;  8ICL A;  2HBJ A;  4YG2 A;  4OJ6 A;  4PHP A;  2VA2 A;  7ICH A;  4M6W A;  5C5J A;  4YXJ A;  4J9O A;  3OGU A;  4DQR A;  4QZG A;  2R18 A;  3GFK B;  3ZDA A;  3HWT A;  1X9S A;  4BUG A;  1ZQM A;  4KLQ A;  1ZQP A;  4GLX A;  4X5V A;  1S9F A;  3RJJ A;  4IR9 A;  1NK4 A;  3NUQ A;  1V9P A;  1RXW A;  4M9L A;  3EUB 2;  5HHI A;  4RNO A;  4ECR A;  3LWM A;  4I2J A;  3RBD A;  3N7P D;  1XU4 A;  1XSN A;  5ALD A;  4M9N A;  3SAF A;  4NLC A;  3SMV A;  2MUT B;  5ALH A;  4J9N A;  4KN4 A;  3I28 A;  4J9L A;  4KLG A;  5IIJ A;  3GZF A;  3HPO A;  3NAS A;  2R8G A;  1XO1 A;  7ICR A;  5ALU A;  2KHQ A;  2E3T A;  3TAP A;  3KZX A;  1PVR A;  3M8S A;  4Q8F A;  4IRD A;  2E1E A;  3QZ8 A;  3QYP A;  5B5E U;  1ARO P;  3HX0 A;  3TAD C;  3OSP A;  1MQ3 A;  3HW8 A;  1WWV A;  4DFJ A;  2ZJ5 A;  4UB6 U;  3ALR A;  2FMP A;  3HT3 A;  4MF8 A;  3EPI A;  2V9W A;  1ZQN A;  1TE2 A;  3WK8 A;  1C7Y A;  2K4E A;  4PH5 A;  2FLL A;  4DQQ A;  2Y0S C;  4C0Z A;  3BQT A;  1S97 A;  5J0Y A;  2LYA A;  2W03 A;  3V6H A;  3FM9 A;  4BWM A;  5CHG A;  3H7I A;  5J2B A;  5ALG A;  3DEE A;  4NLG A;  2BCR A;  9ICN A;  5HR7 A;  2AGP A;  1SL2 A;  2XCA A;  4ED2 A;  2NO5 A;  1Q3U A;  5J0P A;  4OJO A;  4EEY A;  3SR6 A;  3JPR A;  1NI3 A;  4EYI B;  5L1I A;  4KIT B;  1U48 A;  2BZF A;  3AQE A;  1A77 A;  2EH9 A;  2D6F C;  2F3N A;  1LKY B;  1ZQI A;  4E0D A;  5J2I A;  4A8E A;  4F4Y A;  1Z00 B;  2W43 A;  4DL6 A;  4YVZ A;  1X9W A;  4I2A A;  3WKE A;  3UXP A;  4F4K A;  4DFM A;  5IIK A;  3RH6 A;  4MFC A;  3U26 A;  1H38 A;  2KFN A;  2JZB B;  1SWW A;  3G6X A;  4BXO B;  3F2C A;  2BQ3 A;  8ICA A;  4C8L A;  4RZR A;  4RUA A;  2VAN A;  2KOB A;  5AKH A;  5AI9 A;  2XC9 A;  3HRD D;  5AKJ A;  3Q8R B;  4K4H A;  3WK9 A;  4QZA A;  3NRW A;  9ICR A;  4ED6 A;  4RQM A;  4QWB A;  3RH4 A;  3KKA A;  2ASJ A;  5AI0 A;  1KTQ A;  2EZY A;  2W8K A;  3WK7 A;  5KFL A;  3LWL A;  4Q45 A;  4B9V A;  3LVW A;  4DFP A;  9ICQ A;  1N63 A;  1J2N A;  2G08 A;  1FIQ A;  1NK8 A;  1MC8 A;  5HHH A;  5KL1 B;  4BWJ A;  4C7Y A;  4M47 A;  4F5O A;  1Z4O A;  1U49 A;  2LM1 A;  2LYB A;  3QUQ A;  2HHU A;  5D46 A;  3KHR A;  4YD2 A;  3IM1 A;  5IIO A;  7ICV A;  3SD7 A;  1X9X A;  5ALR A;  4P4O A;  2FDR A;  3V6J A;  4CF4 A;  4RPX A;  3MDC A;  1NJY A;  4QZF A;  3GV7 B;  3RJE A;  4AP9 A;  2W9C B;  3JPT A;  4FZL A;  3NGD A;  1SKS A;  5ALT A;  8ICW A;  2P6U A;  1ZQB A;  2PFP A;  1DK2 A;  1S10 A;  5KG2 A;  3IDW A;  5J0Q A;  3SI8 A;  3QE9 Y;  2Y9U A;  3IG8 A;  4OJP A;  1GO3 F;  1U4B A;  1NZP A;  3NVW A;  1TFR A;  1PUZ A;  1P7D A;  2KNJ A;  2ZUB A;  5G5H A;  4UB5 A;  2M9N A;  2WTF A;  3D6J A;  2HOQ A;  4KLL A;  2HSZ A;  1TKD A;  1ZD2 P;  2IOF K;  2QB0 A;  2VA8 A;  5KT2 A;  1SXD A;  4ACO A;  4O3S A;  2F1H A;  3GV5 B;  1IG6 A;  8ICK A;  4CDG A;  1JXE A;  5DKW A;  3IRU A;  4B9U A;  9ICK A;  5HMM A;  4R66 A;  4KLM A;  3RTV A;  7ICT A;  3GV8 B;  5KFK A;  4O3N A;  2N1R A;  7ICE A;  5J0R A;  2ES6 A;  2H3Q A;  1XS9 D;  5EE1 A;  4QIW C;  4QZH A;  2C28 A;  1L3U A;  4Y2V A;  2F1I A;  5KG1 A;  2LHT A;  3PY8 A;  4IQV A;  3MR5 A;  2EAP A;  4Z6D A;  5J2K A;  1NK5 A;  4DCC A;  1S0O A;  5HR6 A;  2KEY A;  5L9X A;  2BPC A;  5F9N A;  3Q8Q B;  2FLN A;  2G06 A;  5AKK A;  3RRG A;  4J9P A;  1UT8 A;  4XUS A;  3H0M B;  1S0N A;  1AQ6 A;  1F0M A;  3WK6 A;  4DL5 A;  1KN5 A;  1KKX A;  3B0Y A;  1NZB A;  7ICU A;  2MA1 A;  3Q8P B;  3RJI A;  4DSE A;  2AGO A;  4K4G A;  1ZXI A;  3AL0 B;  4LZD A;  3NVZ A;  2YX8 A;  3GQC A;  1S76 D;  1NNL A;  2NRT A;  1WCN A;  1EXN A;  3D2Q A;  5KFP A;  3N4M B;  1B4F A;  3H4D A;  4M0A A;  3ZD9 A;  1X9M A;  7ICJ A;  3KOO A;  4HAI A;  3B0X A;  5J0T A;  2OWO A;  3RB6 A;  2NRW A;  2ZIU A;  5L1J A;  2C2R A;  2W7O A;  2JH1 A;  2F76 X;  4OD0 A;  2NRV A;  1ZET A;  3MR2 A;  5GTI U;  5EE0 A;  2MAX A;  5KT5 A;  3KTQ A;  4UQG A;  5C0Y A;  4I2C A;  2HMX A;  3MGH A;  1PZN A;  4LVS A;  4F8R A;  9ICO A;  1JI7 A;  1IIP A;  4GXJ A;  4DL7 A;  5KFG A;  2WAQ C;  2CPR A;  3F5E A;  2KVC A;  4GC6 A;  8ICX A;  1WYG A;  4DFD A;  4YN4 A;  1TV9 A;  3BJY A;  2CRX A;  3C1Y A;  3O0F A;  8ICE A;  1JX4 A;  4I28 A;  4KLS A;  1OXJ A;  1SB3 C;  2BCV A;  2H3Z A;  4IRC A;  4Y2T A;  4PZO A;  5KFI A;  3CP8 A;  1L7P A;  1XWL A;  3ONN A;  2KN7 A;  9ICM A;  3PVX A;  3OJS A;  3TAR A;  1RYS A;  5B66 U;  4C4S A;  1N5W A;  5KFC A;  4OO1 J;  3K1Z A;  3HP6 A;  4DSL A;  3QU7 A;  3ISC A;  3RR7 A;  2R8H A;  4QZ9 A; 
#chains in the Genus database with same CATH homology
 3WU2 U;  5B5E U;  5KAI U;  2AXT U;  4UB6 U;  5GTI U;  4PJ0 U;  4IL6 U;  2DUY A;  5B66 U;  3A0H U;  5GTH U;  5H2F U;  1S5L U;  5KAF U;  3KZI U;  5E79 U;  5TIS U;  3A0B U;  4UB8 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...