4PJ0U

Structure of t.elongatus photosystem ii, rows of dimers crystal packing
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
96
structure length
96
Chain Sequence
LVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
pubmed doi rcsb
molecule tags Oxidoreductase, electron transport
molecule keywords Photosystem Q(B) protein 1
total genus 28
structure length 96
sequence length 96
chains with identical sequence u
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 4pj0U01
3A0HU 5E79U 5B5EU 2DUYA 4UB6U 3A0BU 5GTHU 5TISU 5H2FU 3KZIU 3WU2U 5B66U 5GTIU 4UB8U 5KAFU 2AXTU 5KAIU 1S5LU 4IL6U 4PJ0U
chains in the Genus database with same CATH superfamily
2VA3A 1NK6A 1XWLA 5L1KA 3M9NB 1WYGA 5IIIA 2HHUA 4QZGA 3SR6A 4Z6CA 3HJEA 2ZXIA 1QQ7A 2PFNA 1COKA 3RB0A 5DG8A 3WK5A 1DK3A 3N28A 5HNKA 3G6VA 1CUKA 8ICBA 4LVSA 5AIBA 5J2BA 1YZ6A 4TUSA 8ICHA 3PSTA 4UAVA 5CRXA 3EUB2 4RQ1A 2W3SA 1K1QA 5HMLA 5ALGA 2XGQA 4F50A 5DB9A 4C7YA 2XCPA 1ZQNA 1QTMA 2CPRA 4OJOA 1BPEA 4PHDA 3AUOA 1QQ6A 4DCCA 1L8LA 4EBEA 1T3NA 1JALA 4QZCA 3RJHA 1L6NA 1S77D 1ED1A 5H2FU 1WCLA 4FZLA 3Q8SB 2FMPA 2BCVA 4I28A 2ZIXB 2G5IB 3LDAA 2KE7A 4KTQA 2IMWP 5AK6A 4B9LA 3HILA 1DK2A 2J6SA 3G6YA 3K1RB 1NK8A 1MN8A 3B0YA 3PVXA 4F71A 3SV4A 2E3TA 3UMCA 2W54A 4GC6A 2B0CA 2ZG6A 4UATA 5FP0A 5KL1B 3MR2A 2AH5A 3L3FX 2EANA 5DLFA 3MR5A 3E58A 4M2YA 4XQ8A 3N7RC 5ALDA 2XIDA 2ASJA 3LK9A 2XY5A 1Z4NA 4Q45A 5AKJA 1RYUA 2M9NA 3NVWA 4ED1A 2ZUCA 1XO1A 3QEAZ 4KLDA 3NUQA 3SENA 2H3ZA 4KLIA 1Y88A 1X9SA 1D9FA 4EBCA 3AM9A 5EWGA 3OJSA 4ECVA 2LHTA 5D49A 5KFQA 1NJWA 4O0IA 3V7LA 2C2RA 3WKCA 1RXWA 3PO5A 4KLEA 5ALJA 1Z19A 5J8YC 1X9MA 4O5EA 2KKPA 4OJLA 4QZDA 1ZQTA 4P2HA 1OUQA 5J0UA 4I2BA 5ALXA 4F3OA 5HR7A 8ICEA 5KTQA 2KN7A 1KSPA 2D3DA 1MA7A 4JWNA 3RBDA 2HHSA 5KG7A 3EWAA 1XC9A 3ED5A 9ICPA 3MDCA 4M9HA 5AKIA 2FPLA 2LKYA 2QB0B 3T5HA 2BCQA 1TFRA 2EZYA 4Z6FA 4E0DA 1ZJNA 4PZOA 2XCAA 2KJ8A 1SV0A 4KN4A 3L4PA 4F4ZA 4EZ9A 4I29A 1XSLA 2KZMA 2VJ5A 2M0NA 5G5GA 1K5OA 4I2GA 5AKHA 2F44A 1ZQMA 9ICJA 4GIBA 3IG8A 3QU7A 2W9MA 5EOZA 3M1YA 4J9QA 2BCUA 3GIIA 9ICXA 4DSIA 2ISOA 3SYZA 2V9WA 2W11A 2AU0A 2ZUDA 2UVRA 1DOQA 3PW2A 2BQRA 3QEBZ 2A3VA 2G0AA 4F4XA 4UB3A 4DWIA 1T3QA 3KD3A 5B5EU 2B21A 1XO0A 3DV9A 4JB3A 1T7PA 4BXOA 4U6PA 5DB6A 4J9RA 4CF4A 4QWDA 3QU5A 3M8SA 3T5LA 5JUMA 4KLMA 5DB8A 2WFAA 1T8EA 4KLUA 3ZD8A 1ZQPA 2BHNA 5DBAA 1QSSA 1MC8A 2JMGA 3BZKA 5KFGA 4MHVA 2G06A 4UB8U 1L3SA 4RT2A 3MC1A 4J9KA 1RPLA 5ALUA 4C4RA 5KFBA 4MEXA 4ELUA 1J2MA 8ICMA 2BPGA 4M9LA 4QZ8A 4ED0A 1UA1A 4GC7A 1KKXA 2LM1A 1TKDA 1L7PA 2QARB 2FLNA 2YMQA 2K4EA 5IILA 5C0YA 1ZQXA 5ALEA 4QZBA 1TK5A 2FDRA 3TKAA 1L7MA 2LI6A 4ECRA 5KFYA 4P0PA 5BOLA 1KLNA 2IA6A 3ETRA 4DEZA 5DQHA 3WK6A 5JRTA 1S10A 4R8UB 3BZCA 4M47A 2BPFA 3H0LB 4R64A 1ZQBA 4J9PA 3C2MA 3O0FA 3WK9A 5T14A 4DOCA 2YQEA 2WF7A 2CN1A 4M0AA 1SZPA 4YFKA 3KFUF 2ZIVB 4NLNA 1YT3A 3ETLA 4EBDA 5KNIA 4RQ7A 2W04A 9ICBA 4NM2A 5TISU 3QUQA 5J0PA 2R8HA 3MR3A 2GH1A 2KG5A 5KFWA 9ICGA 1Z1BA 8ICKA 4PH5A 5EE1A 3I1YA 3HT3A 5J2GA 1JI7A 3EPIA 1L5UA 4RQ3A 3PO4A 1ZQLA 3GV8B 2HOIA 4IRCA 1F0MA 4YR2A 2WHEA 4IS7A 4QZHA 4NL9C 2BQUA 2NO4A 4C0ZA 5J0OA 4NL9A 1A6SA 5A0LA 5KG1A 4RZRA 4RPXA 3T5KA 4YMNA 2EH9A 4DF4A 1RYRA 2ZTCA 2WF6A 4QZ9A 2NRTA 2KOBA 4FZNA 1C7YA 3V6HA 2YN4A 4RUAA 4UAYA 4NM1A 4DSKA 8ICWA 4QW9A 4YXJA 2A1JB 3R9KA 3KZXA 1X6IA 1FFUA 3IDWA 1WWUA 2HDOA 4GXIA 3C28A 5AK5A 2ODGA 4I2EA 4IR9A 2AJQA 4ECYA 1RQLA 1NKCA 5IIOA 1S76D 3RJKA 4I2DA 2LM4A 2VIXA 2V4RA 3IM1A 3QNMA 4QZIA 7ICOA 3RAXA 1U49A 8ICTA 2LBOA 2A19A 2K89A 3LWMA 5J0XA 2RHFA 3NVZA 1GO3F 1VLBA 3N97B 1LV5A 2JHDA 9ICLA 3PX4A 1V85A 3KOOA 9ICWA 8ICOA 2D8CA 1D8LA 5DDYA 2ATLA 5KFTA 8ICXA 7ICLA 3HPOA 4PPXA 1C20A 5DG9A 2XICA 1ECWA 4ECSA 4AP9A 3Q8PB 4PJ0U 2YMPA 2MUTB 2F77X 5J2DA 2F3NA 2LYHA 5D46A 2JEIA 4CDGA 3QUBA 1HJPA 3V6KA 3AQFA 1T94A 2IHMA 2H3FA 1J2NA 4R66A 2C2EA 1L8OA 4NLCA 4OCZA 2W03A 4MFFA 9ICSA 3WKEA 4K4IA 1JRPA 1Z00A 3F5AA 1LB2B 3GV7B 4F4YA 3SEIA 1T4GA 4WJ3B 2VJ4A 4I2JA 2OWOA 2MU2A 3KHGA 4O5CA 4C8MA 5BPCA 3H0RB 3MFHA 3F5EA 4ED6A 2DPJA 1N61A 1SKWA 2W9BA 4DQRA 3C2KA 3C5GA 1NKEA 1UHUA 3LVWA 2YB1A 2OCEA 4YR3A 2KSOA 4LJXA 4C7ZA 5AM2A 4KN7A 2ZXHA 3U26A 5KFUA 5AM3A 4UW9A 3UQ0A 1S0OA 1D9DA 1S9FA 4NWIA 4I2CA 2R8GA 4YG2A 2DFLA 1JIHA 3AMZA 3N4MB 2DKXA 5DB7A 1UA0A 2G09A 3MR6A 4Q8EA 2O6KA 4EZ6A 3ALRA 2DBYA 1B0XA 1JMSA 2F76X 2XVTA 5ALZA 3BQ2A 1XSPA 4FBTA 4UBCA 1N62A 3I76A 4ELVA 4JMUA 2XGPA 3QE9Y 1HUOA 1ZOLA 4DLGA 2HVIA 5CR0A 3MGHA 4NV0A 2EAOA 3L5KA 2FPMA 2WAQF 4TUQA 3UXPA 2KJ9A 7ICGA 5AKYA 2R18A 5E79U 4CNQA 4FFDA 1KFTA 4QWEA 1KFDA 1NZPA 3RJIA 2I5HA 1SL1A 2HHVA 2BDPA 2E8OA 2QB0A 1EXNA 4QZEA 5J2AA 4DL2A 4UAWA 2NRZA 4CF5A 4IQVA 2WF5A 4F2RA 4PGQA 4FBUA 1VJ5A 3TQ1A 2W9AA 5AKLA 2J6TA 2GO7A 3IHQB 2MA1A 4EYHB 4LZGA 2F2AB 3T79A 1TV9A 1ZQHA 4O3RA 3CNHA 3SAFA 5IIJA 5J2HA 1Z1VA 2KP7A 4NY8A 4QWBA 2W7OA 1BPXA 3IP4B 3QX7A 1PVPA 4YMMA 3KZIU 2W7PA 5DGBA 3UXOA 4F92B 9ICOA 2XO7A 4PHAA 4C8NA 2AQ0A 4B9NA 1OW5A 2JEJA 5KT7A 3C5FA 7ICQA 2UVUA 3TAQA 8ICYA 1D8BA 2C22A 5ALWA 3IRUA 1KRPA 4C4TA 3CRXA 3GIKA 4OD0A 3EW9A 4C8KA 2V4QA 2BZFA 5KFMA 5J0TA 2RLTA 2P6RA 2ZIUB 9ICAA 2E1FA 2FE9A 5KFXA 5AM0A 5EE9A 4Y2YA 5AKXA 2ZJAA 1HIWA 5KFZA 2BGWA 3ORYA 2WB1C 4UBBA 7ICIA 5J2KA 3OHBA 3E0FA 2HBLA 2D6FC 1JXEA 3WK7A 4YP3A 3WU2U 1HEKA 3GZFA 1U4BA 3RR7A 4CE6A 2IHNA 3PX6A 2LYBA 1TK0A 4F4KA 5DBBA 5KG6A 5KT2A 1BPYA 3PMLA 2KIVA 2MSNA 2EZZA 3J81j 1RZTA 4O9MA 3DEEA 4JWMA 4EX7A 4J9LA 3ZDDA 2VA2A 3EYZA 1F5SA 1SGGA 1BPZA 2VKQA 2RP5A 4P0QB 2MUTA 1A76A 4ED2A 5KG5A 4DL5A 3JPTA 3H8WA 2KHVA 4DL7A 1UCVA 3ZDCA 4F5OA 2EDUA 4J9NA 4KLGA 3A0BU 4EEYA 1S8OA 2DKZA 2AXTU 2ZJ5A 9ICQA 5KL8B 2CRXA 2OEHA 8ICIA 3QZ7A 2PI4A 1TAMA 4TQSA 3M7DA 5CA7A 1SWWA 1TVAA 4EEKA 1N48A 4KLSA 3UXNA 2UVWA 7ICRA 4ED3A 4DFPA 4RU9A 3ISBA 1XNSA 4B9UA 4IQTA 2IOFA 3NRWA 4DFKA 2F8LA 1KW4A 9ICRA 2JRZA 4DQIA 4DFJA 4RT3A 5KAFU 2XY7A 2E5SA 2G07A 4OO1J 4KITB 4UB6U 2YMMA 3PR4A 4J9MA 2R8IA 3NGDA 4UB4A 1XU4A 2G5HB 5AI5A 5KFFA 3PSIA 7ICHA 1QLNA 1UQVA 1MSWD 2C2DA 3KTQA 5J2IA 3RH4A 3TANA 4QWAA 4XA5A 2LYAA 5KFVA 1ZQRA 2RRDA 1X40A 3C1YA 4O3OA 4B9MA 4UQGA 3WK8A 3LVVA 2ESEA 3KKAC 5KFDA 4DFDA 4PZNA 4BGDA 4BDPA 2Y1IA 3TFRA 9ICEA 2KIWA 1LKYB 3MDAA 3K75D 4UB5A 4Q8FA 4Y2PA 4F5RA 2HBJA 5AI6A 2PFPA 4BX9C 4NLBA 1SV4A 3JPSA 4I2FA 4RQ6A 2KK0A 4BWJA 4DSLA 5HHIA 4QZFA 4Q43A 1V9PA 1BVSA 3T3FA 5AK3A 1LKYA 1BGXT 3F2BA 7ICNA 4UAUA 4DQQA 1Z3EB 3AU6A 2F1JA 5KAIU 4MF2A 1UPHA 2NRXA 4KLTA 2E8PA 3PY8A 5KFLA 3PZPA 4R8UA 2ISPA 2OYYA 3QUCA 1IIPA 3BQ7A 8ICAA 3FC4A 1SZHA 4DS5A 4O3PA 3UM9A 4P4PA 1ZQVA 2NRVA 3RR8A 2H5XA 2KSOB 2KKVA 3FAHA 5L1MA 3NRZA 5KFAA 1ZQYA 3WKDA 4US9A 4AYBF 4F5PA 3NS1A 5IINA 1PVRA 1QQ5A 4FZMA 1ZQKA 5AK4A 1S0NA 5HMMA 1ZRMA 2GOLA 1KN5A 4QZAA 1X2IA 4DSFA 4ED7A 3Q8KA 5DKWA 1N60A 3RTVA 4PGXA 1CRXA 1X6JA 3NVVA 3BDPA 2FI1A 5KFJA 7ICVA 3GQCA 3GU3A 2BCRA 2NRWA 2NV3A 1SIJA 3PSFA 5AI0A 5ALOA 4I2AA 3BS5A 5KG4A 2F1HA 2I1QA 3RFAA 1ZQZA 2HBMA 2N1RA 4PGYA 4OJ5A 3IV6A 3H4DA 2ALZA 3PMNA 4CGZA 3H8JA 5AICA 5J0YA 1NJZA 2MRLA 1XSNA 3HKZC 2W8KA 4RQNA 3B9JA 5ALFA 5AI9A 4I2HA 2OXOA 5CP2A 9ICVA 2W43A 1X66A 3HWTA 4RQ0A 3K1ZA 7ICMA 9ICHA 9ICFA 1IG6A 3JPQA 2VA8A 4DL4A 4QWCA 1N63A 1NOMA 1DGJA 5K4LA 3BS5B 3TAPA 4I27A 1FFVA 1QH9A 2K4HA 1KTQA 3BQ1A 2H3VA 4Z6EA 5ALVA 2ASDA 5DDMA 2AGOA 3PX0A 1SV0C 2EQYA 2AQ4A 3IN5A 4RPYA 3V72A 3ONNA 1N56A 3THVA 3C23A 1FEZA 2QKQA 4M9JA 2HMXA 1ZQQA 4P0PB 4GXKA 4G9BA 2ASLA 1V38A 1WWVA 5ALMA 4YD2A 3ICXA 2KMDA 3MFIA 2YB4A 4RQ2A 3E2EA 3TARA 8ICFA 4F93B 3PW4A 4JK1A 4KMOB 2WF9A 5KT4A 4RNOA 1QSYA 3SAGA 2KV2A 1DRGA 1ZD4A 4RPZA 3JPPA 4EX6A 3KHRA 3NTUA 3RJJA 4X5VA 1ZJMA 2BR0A 2C28A 1IXRA 1Z00B 3M8RA 2JV3A 3PV8A 2H3QA 4DLEA 4Q44A 1A77A 2XY6A 5J29A 2ZIXA 1NJXA 2JH1A 2YY6A 3H8MA 1SL2A 1H38A 3QXGA 5BOMA 2H3IA 4P4OA 5KFKA 5J0QA 2FMQA 3D2NA 4DSEA 3H4BA 3RBEA 1Z4OA 3T5JA 5KFPA 1ZQIA 4JV1A 4YCXA 4AYBC 2KZZA 3WK4A 3WKBA 5G5HA 4C8OA 1RQNA 4UB2A 1S5LU 4J9SA 1ZQCA 1ZQEA 5DLGA 5IIKA 1RDFA 4HYKA 1JROA 8ICLA 5CWRA 4HAIA 2EAPA 1ZQWA 4MFAA 3ZDBA 4ECTA 2L5YA 1QCKA 1COOA 4PHEA 4OJ6A 2AGQA 4ZH4A 3RB6A 5KFEA 2RQ5A 3MGVA 4US8A 2DGZA 1ZETA 9ICTA 1NK0A 5ALSA 3F2DA 2NO5A 2E8NA 4G3IA 4NJ8A 5TZVA 3OSPA 9ICCA 3KBBA 3KHLA 1M6YA 3QUTA 4XUSA 3RRGA 1DGSA 3AU2A 3Q8LA 3B0XA 2K8BB 2Y9UA 4JV0A 3MABA 3QYPA 2W9CB 1NI3A 1FIQA 2HI0A 1ZQDA 3SAHA 3PR5B 3EPGA 1K1SA 4Y2JA 3EZ5A 1LVHA 5ALTA 1KEJA 1PVQA 5CHGA 2DF4B 1AROP 2I6XA 4ACOA 3RB4A 2K60A 4ELTA 3F53A 5J2FA 1KFSA 4DSJA 1IM4A 5KG2A 1SL0A 2PI5A 4F72A 2KVCA 5EWFA 5ALNA 4RQ8A 3FM9A 1DXSA 3PSPA 9ICUA 4Z6DA 2W9CA 3JPNA 5AI8A 1B22A 5DBCA 2ZIWA 2QLTA 5HR6A 5JU5A 5AHXA 4F5QA 8ICJA 4ECZA 4DS4A 2W9BB 3GILA 1L3VA 4PL2A 2BPCA 4YVZA 1SXDA 4F91B 3SZ2A 2DPIA 4O3MA 2HHXA 2HSZA 2Q4TA 3H7IA 3PW7A 2ZUBA 1B4FA 8ICCA 2KZ3A 3RJFA 2EZXA 1X9XA 3DDHA 5CJ7A 2JR5A 1IV8A 1L7NA 2IOFK 3ZDAA 5ALKA 5KG0A 5HHHA 1O03A 2ZTDA 3NVYA 2Y1JA 3TACB 4K4GA 3GIJA 1TK8A 2ES6A 3JPOA 2JEFA 3KKAA 3MBYA 1ZQUA 1N2XA 2DL0A 2VANA 4Y2XA 1BPBA 4FO6A 1ZD2P 4DQPA 8ICGA 2LMRA 5AI4A 4YMOA 4CF3A 1MQ3A 9ICIA 8ICRA 1WG8A 3H8SA 1CEZA 4IRDA 3UMBA 3TFSA 2OH2A 4M9GA 2HVHA 2F1IA 1U47A 2WAQC 4P4MA 5ALIA 5DQGA 5AIAA 4UAZA 1NZBA 4QJFB 2JEGA 3OTQA 3GDXA 2AHOB 1QSLA 2P35A 1NJYA 3HP6A 4Y2VA 4BJQA 3C1ZA 1N5WA 2NYVA 5KFHA 4QIWF 4O3QA 2CXYA 2KVSA 2P66A 2LPEA 3SI8A 3CP8A 2KTQA 2K4PA 4K4HA 5EE0A 5ALPA 4C8LA 1KQQA 4IR1A 2YMLA 4EYIB 5D4BA 4XRHA 2K8CB 2QB1A 4KLQA 4UASA 2WB1F 4CRXA 2MAXA 4KX3A 2RDIA 2FLLA 1SWVA 1SB3C 2IOHA 4C80A 3VC8A 4DOBA 2I9GA 4PL1A 3M9MB 2PMZF 1S97A 4O5KA 4Y2QA 4BUGA 4M04A 5F9LA 1ZQGA 4IRKA 4F5NA 9ICNA 2W3RA 1JN3A 5KT6A 1SKRA 4B9TA 2GLEA 5DG7A 4CCHA 4DOAA 2IBKA 4ED8A 4U7CA 7ICSA 9ICMA 2PMZC 1N5XA 4RNMA 1RYSA 4O3NA 4LZDA 8ICPA 1ZXIA 4NLGA 5KFNA 1ZQJA 2KHQA 1ZYQA 4P0QA 2HW3A 4UB1A 3OSNA 3GV5B 4DL6A 4KLFA 2KFNA 1BPDA 1WCNA 2JH7A 1CI4A 3C2LA 4TURA 5AKEA 3SMVA 4NXZA 3Q8MA 3S6JA 5KT5A 2DWQA 4IQWA 3BQTA 1U9LA 2Y9TA 5ALQA 5KFCA 1A0PA 4RQ4A 3C29A 3LYSA 5KFIA 5EE3A 7ICUA 3ISCA 4QIWC 5L1LA 3M6ZA 3ISDA 3LWLA 1TAQA 4QNLA 8ICVA 1L3TA 2Z7JA 2W8LA 4M6WB 3Q8QB 4FS1A 2HHQA 4MFCA 4IL6U 3G6XA 1ZQOA 1ZQAA 4JV2A 3GFKB 5CEHA 1TAUA 2Y0SF 2PXIA 5CB1A 4ECQA 1NKBA 1ZQFA 3PNCA 3QU4A 4KLHA 4GFJA 4R63A 2JZBB 3NASA 1BNOA 5J0WA 2HHWA 3QU9A 2ZIUA 3CW2C 2J6UA 2R8KA 4DF8A 4ICAA 1VDVA 5C5JA 3RB3A 4BXOB 3ZDEA 4ECWA 4DFMA 3CYMA 5J8YA 2HHTA 5B66U 2YX8A 4I2IA 2WTFA 3V7JA 4IQUA 2G08A 1NK7A 4C4SA 4M9NA 2BKEA 3HW8A 2R8JA 2XI9A 3Q8RB 1F44A 2PFOA 3V7KA 1RM6C 2WF8A 5ALRA 4GLXA 1UT5A 1JUDA 5ALLA 3H0MB 2P6UA 4YR0A 3I28A 1X9WA 3RH5A 4NLZA 4EELA 4ZOHC 4PHPA 1V97A 2DUYA 2HOQA 2F8KA 3OJUA 2E8MA 4B9VA 3RRHA 3D6JA 3TADC 2FMSA 3TADA 1O08A 3KHHA 1ZQ1C 1S0VA 1WUDA 5KG3A 2K8AA 3VCBA 4F2SA 2ZIWB 5KFRA 1ZRNA 2HBKA 3JPRA 3FDSA 2KICA 1RXVA 3A0HU 3ZI4A 2BDUA 2YTUA 5F9NA 4RQ5A 4IC9A 2FPKA 3HX0A 1YZ7A 2JXJA 3SD7A 1Q46A 5AKGA 1X42A 5DGAA 1OXJA 3H40A 1P7DA 3BS7A 5HP4A 2KEYA 1BNPA 3ZD9A 4TUPA 1HUZA 7ICKA 5L9XA 4QW8A 1NK5A 2E1EA 1Q8KA 1L7OA 8ICUA 1PK1B 1KL9A 1PK3A 3D2QA 4F8RA 5DQIA 2JZBA 1JX4A 4F4WA 1Q3VA 2A1JA 2Y0SC 2EAMA 7ICEA 3UQ2A 1Q3UA 4YQWA 3SQIA 4ECUA 4O3SA 2OHFA 3GIMA 1AQ6A 4Y2SA 4DQSA 8ICSA 7ICJA 4BWMA 5L1JA 1URJA 2KJ5A 4Y2UA 5AKZA 2ZJ8A 3QU2A 3RJEA 2JGAA 3HKZF 3D2SA 1JXLA 1B43A 7ICTA 1ZD5A 4KX5A 5EWEA 2OM6A 4DL3A 2PKEA 1NNLA 1NK4A 5AM1A 4KLOA 1KDHA 4KMUA 1PUZA 5J0SA 2K4IA 2KFZA 5KT3A 4UARA 4NLKA 3AN1A 3HRDD 1SKSA 3QZ8A 4OJPA 3F2CA 1J97A 2ZIVA 5KFOA 2BCSA 4J03A 4YD1A 2XC9A 5L1IA 2UVVA 2DQNB 8ICNA 2FJ6A 1NK9A 4Y2TA 5J2EA 4KLJA 7ICFA 5IIMA 2ZTEA 4J9OA 5GTHU 3N7SC 2BQ3A 5GTIU 4EENA 4FE3A 5AM4A 4RNNA 3RH6A 3BJYA 1FO4A 1U45A 1TE2A 4Y2RA 4FS2A 3M9OB 1XS9D 3AL0B 1RG6A 4MF8A 5ALYA 3IG5A 2B6GA 3UMGA 2PFQA 2GWSA 2QARA 2KNJA 5F3XB 1S0MA 3RAQA 1L3UA 1U48A 5KFSA 3N7PD 4YXMA 4R65A 1ZD3A 2RDJA 1MQ2A 3PW0A 3AEVA 4DO9A 3PW5A 1KBUA 4JUZA 4RUCA 2A1AA 4MEYA 1ZQSA 3BQ0A 4GXJA 4M6WA 1SXEA 3RJGA 1D8YA 1UT8A 2Q0ZX 1PK1A 3OHAA 3OGUA 3TI0A 2HOFA 4RQMA 3K4GA 3AQEA 3OPXA 7ICPA 2AGPA 2HCFA 4B9SA 5AKKA 3UPQA 3SV3A 3RF9A 5ALHA 3C21A 5J0RA 2KD1A 9ICKA 4KLLA 5J2CA 5JTIA 5J2JA 4A8EA 4B6JA 4USAA 2W55A 2FLPA 4TQRA 3V6JA 5AM5A 3FYHA 4ECXA 8ICZA 3M6KA 1PZNA 3MGIA 4YN4A 3WKAA 8ICQA
chains in the Genus database with same CATH topology
3A0HU 5E79U 5B5EU 2DUYA 4UB6U 3A0BU 5GTHU 5TISU 5H2FU 3KZIU 3WU2U 5B66U 5GTIU 4UB8U 5KAFU 2AXTU 5KAIU 1S5LU 4IL6U 4PJ0U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H U;  5E79 U;  5B5E U;  2DUY A;  4UB6 U;  3A0B U;  5GTH U;  5TIS U;  5H2F U;  3KZI U;  3WU2 U;  5B66 U;  5GTI U;  4UB8 U;  5KAF U;  2AXT U;  5KAI U;  1S5L U;  4IL6 U;  4PJ0 U; 
#chains in the Genus database with same CATH topology
 2VA3 A;  1NK6 A;  1XWL A;  5L1K A;  3M9N B;  1WYG A;  5III A;  2HHU A;  4QZG A;  3SR6 A;  4Z6C A;  3HJE A;  2ZXI A;  1QQ7 A;  2PFN A;  1COK A;  3RB0 A;  5DG8 A;  3WK5 A;  1DK3 A;  3N28 A;  5HNK A;  3G6V A;  1CUK A;  8ICB A;  4LVS A;  5AIB A;  5J2B A;  1YZ6 A;  4TUS A;  8ICH A;  3PST A;  4UAV A;  5CRX A;  3EUB 2;  4RQ1 A;  2W3S A;  1K1Q A;  5HML A;  5ALG A;  2XGQ A;  4F50 A;  5DB9 A;  4C7Y A;  2XCP A;  1ZQN A;  1QTM A;  2CPR A;  4OJO A;  1BPE A;  4PHD A;  3AUO A;  1QQ6 A;  4DCC A;  1L8L A;  4EBE A;  1T3N A;  1JAL A;  4QZC A;  3RJH A;  1L6N A;  1S77 D;  1ED1 A;  5H2F U;  1WCL A;  4FZL A;  3Q8S B;  2FMP A;  2BCV A;  4I28 A;  2ZIX B;  2G5I B;  3LDA A;  2KE7 A;  4KTQ A;  2IMW P;  5AK6 A;  4B9L A;  3HIL A;  1DK2 A;  2J6S A;  3G6Y A;  3K1R B;  1NK8 A;  1MN8 A;  3B0Y A;  3PVX A;  4F71 A;  3SV4 A;  2E3T A;  3UMC A;  2W54 A;  4GC6 A;  2B0C A;  2ZG6 A;  4UAT A;  5FP0 A;  5KL1 B;  3MR2 A;  2AH5 A;  3L3F X;  2EAN A;  5DLF A;  3MR5 A;  3E58 A;  4M2Y A;  4XQ8 A;  3N7R C;  5ALD A;  2XID A;  2ASJ A;  3LK9 A;  2XY5 A;  1Z4N A;  4Q45 A;  5AKJ A;  1RYU A;  2M9N A;  3NVW A;  4ED1 A;  2ZUC A;  1XO1 A;  3QEA Z;  4KLD A;  3NUQ A;  3SEN A;  2H3Z A;  4KLI A;  1Y88 A;  1X9S A;  1D9F A;  4EBC A;  3AM9 A;  5EWG A;  3OJS A;  4ECV A;  2LHT A;  5D49 A;  5KFQ A;  1NJW A;  4O0I A;  3V7L A;  2C2R A;  3WKC A;  1RXW A;  3PO5 A;  4KLE A;  5ALJ A;  1Z19 A;  5J8Y C;  1X9M A;  4O5E A;  2KKP A;  4OJL A;  4QZD A;  1ZQT A;  4P2H A;  1OUQ A;  5J0U A;  4I2B A;  5ALX A;  4F3O A;  5HR7 A;  8ICE A;  5KTQ A;  2KN7 A;  1KSP A;  2D3D A;  1MA7 A;  4JWN A;  3RBD A;  2HHS A;  5KG7 A;  3EWA A;  1XC9 A;  3ED5 A;  9ICP A;  3MDC A;  4M9H A;  5AKI A;  2FPL A;  2LKY A;  2QB0 B;  3T5H A;  2BCQ A;  1TFR A;  2EZY A;  4Z6F A;  4E0D A;  1ZJN A;  4PZO A;  2XCA A;  2KJ8 A;  1SV0 A;  4KN4 A;  3L4P A;  4F4Z A;  4EZ9 A;  4I29 A;  1XSL A;  2KZM A;  2VJ5 A;  2M0N A;  5G5G A;  1K5O A;  4I2G A;  5AKH A;  2F44 A;  1ZQM A;  9ICJ A;  4GIB A;  3IG8 A;  3QU7 A;  2W9M A;  5EOZ A;  3M1Y A;  4J9Q A;  2BCU A;  3GII A;  9ICX A;  4DSI A;  2ISO A;  3SYZ A;  2V9W A;  2W11 A;  2AU0 A;  2ZUD A;  2UVR A;  1DOQ A;  3PW2 A;  2BQR A;  3QEB Z;  2A3V A;  2G0A A;  4F4X A;  4UB3 A;  4DWI A;  1T3Q A;  3KD3 A;  5B5E U;  2B21 A;  1XO0 A;  3DV9 A;  4JB3 A;  1T7P A;  4BXO A;  4U6P A;  5DB6 A;  4J9R A;  4CF4 A;  4QWD A;  3QU5 A;  3M8S A;  3T5L A;  5JUM A;  4KLM A;  5DB8 A;  2WFA A;  1T8E A;  4KLU A;  3ZD8 A;  1ZQP A;  2BHN A;  5DBA A;  1QSS A;  1MC8 A;  2JMG A;  3BZK A;  5KFG A;  4MHV A;  2G06 A;  4UB8 U;  1L3S A;  4RT2 A;  3MC1 A;  4J9K A;  1RPL A;  5ALU A;  4C4R A;  5KFB A;  4MEX A;  4ELU A;  1J2M A;  8ICM A;  2BPG A;  4M9L A;  4QZ8 A;  4ED0 A;  1UA1 A;  4GC7 A;  1KKX A;  2LM1 A;  1TKD A;  1L7P A;  2QAR B;  2FLN A;  2YMQ A;  2K4E A;  5IIL A;  5C0Y A;  1ZQX A;  5ALE A;  4QZB A;  1TK5 A;  2FDR A;  3TKA A;  1L7M A;  2LI6 A;  4ECR A;  5KFY A;  4P0P A;  5BOL A;  1KLN A;  2IA6 A;  3ETR A;  4DEZ A;  5DQH A;  3WK6 A;  5JRT A;  1S10 A;  4R8U B;  3BZC A;  4M47 A;  2BPF A;  3H0L B;  4R64 A;  1ZQB A;  4J9P A;  3C2M A;  3O0F A;  3WK9 A;  5T14 A;  4DOC A;  2YQE A;  2WF7 A;  2CN1 A;  4M0A A;  1SZP A;  4YFK A;  3KFU F;  2ZIV B;  4NLN A;  1YT3 A;  3ETL A;  4EBD A;  5KNI A;  4RQ7 A;  2W04 A;  9ICB A;  4NM2 A;  5TIS U;  3QUQ A;  5J0P A;  2R8H A;  3MR3 A;  2GH1 A;  2KG5 A;  5KFW A;  9ICG A;  1Z1B A;  8ICK A;  4PH5 A;  5EE1 A;  3I1Y A;  3HT3 A;  5J2G A;  1JI7 A;  3EPI A;  1L5U A;  4RQ3 A;  3PO4 A;  1ZQL A;  3GV8 B;  2HOI A;  4IRC A;  1F0M A;  4YR2 A;  2WHE A;  4IS7 A;  4QZH A;  4NL9 C;  2BQU A;  2NO4 A;  4C0Z A;  5J0O A;  4NL9 A;  1A6S A;  5A0L A;  5KG1 A;  4RZR A;  4RPX A;  3T5K A;  4YMN A;  2EH9 A;  4DF4 A;  1RYR A;  2ZTC A;  2WF6 A;  4QZ9 A;  2NRT A;  2KOB A;  4FZN A;  1C7Y A;  3V6H A;  2YN4 A;  4RUA A;  4UAY A;  4NM1 A;  4DSK A;  8ICW A;  4QW9 A;  4YXJ A;  2A1J B;  3R9K A;  3KZX A;  1X6I A;  1FFU A;  3IDW A;  1WWU A;  2HDO A;  4GXI A;  3C28 A;  5AK5 A;  2ODG A;  4I2E A;  4IR9 A;  2AJQ A;  4ECY A;  1RQL A;  1NKC A;  5IIO A;  1S76 D;  3RJK A;  4I2D A;  2LM4 A;  2VIX A;  2V4R A;  3IM1 A;  3QNM A;  4QZI A;  7ICO A;  3RAX A;  1U49 A;  8ICT A;  2LBO A;  2A19 A;  2K89 A;  3LWM A;  5J0X A;  2RHF A;  3NVZ A;  1GO3 F;  1VLB A;  3N97 B;  1LV5 A;  2JHD A;  9ICL A;  3PX4 A;  1V85 A;  3KOO A;  9ICW A;  8ICO A;  2D8C A;  1D8L A;  5DDY A;  2ATL A;  5KFT A;  8ICX A;  7ICL A;  3HPO A;  4PPX A;  1C20 A;  5DG9 A;  2XIC A;  1ECW A;  4ECS A;  4AP9 A;  3Q8P B;  4PJ0 U;  2YMP A;  2MUT B;  2F77 X;  5J2D A;  2F3N A;  2LYH A;  5D46 A;  2JEI A;  4CDG A;  3QUB A;  1HJP A;  3V6K A;  3AQF A;  1T94 A;  2IHM A;  2H3F A;  1J2N A;  4R66 A;  2C2E A;  1L8O A;  4NLC A;  4OCZ A;  2W03 A;  4MFF A;  9ICS A;  3WKE A;  4K4I A;  1JRP A;  1Z00 A;  3F5A A;  1LB2 B;  3GV7 B;  4F4Y A;  3SEI A;  1T4G A;  4WJ3 B;  2VJ4 A;  4I2J A;  2OWO A;  2MU2 A;  3KHG A;  4O5C A;  4C8M A;  5BPC A;  3H0R B;  3MFH A;  3F5E A;  4ED6 A;  2DPJ A;  1N61 A;  1SKW A;  2W9B A;  4DQR A;  3C2K A;  3C5G A;  1NKE A;  1UHU A;  3LVW A;  2YB1 A;  2OCE A;  4YR3 A;  2KSO A;  4LJX A;  4C7Z A;  5AM2 A;  4KN7 A;  2ZXH A;  3U26 A;  5KFU A;  5AM3 A;  4UW9 A;  3UQ0 A;  1S0O A;  1D9D A;  1S9F A;  4NWI A;  4I2C A;  2R8G A;  4YG2 A;  2DFL A;  1JIH A;  3AMZ A;  3N4M B;  2DKX A;  5DB7 A;  1UA0 A;  2G09 A;  3MR6 A;  4Q8E A;  2O6K A;  4EZ6 A;  3ALR A;  2DBY A;  1B0X A;  1JMS A;  2F76 X;  2XVT A;  5ALZ A;  3BQ2 A;  1XSP A;  4FBT A;  4UBC A;  1N62 A;  3I76 A;  4ELV A;  4JMU A;  2XGP A;  3QE9 Y;  1HUO A;  1ZOL A;  4DLG A;  2HVI A;  5CR0 A;  3MGH A;  4NV0 A;  2EAO A;  3L5K A;  2FPM A;  2WAQ F;  4TUQ A;  3UXP A;  2KJ9 A;  7ICG A;  5AKY A;  2R18 A;  5E79 U;  4CNQ A;  4FFD A;  1KFT A;  4QWE A;  1KFD A;  1NZP A;  3RJI A;  2I5H A;  1SL1 A;  2HHV A;  2BDP A;  2E8O A;  2QB0 A;  1EXN A;  4QZE A;  5J2A A;  4DL2 A;  4UAW A;  2NRZ A;  4CF5 A;  4IQV A;  2WF5 A;  4F2R A;  4PGQ A;  4FBU A;  1VJ5 A;  3TQ1 A;  2W9A A;  5AKL A;  2J6T A;  2GO7 A;  3IHQ B;  2MA1 A;  4EYH B;  4LZG A;  2F2A B;  3T79 A;  1TV9 A;  1ZQH A;  4O3R A;  3CNH A;  3SAF A;  5IIJ A;  5J2H A;  1Z1V A;  2KP7 A;  4NY8 A;  4QWB A;  2W7O A;  1BPX A;  3IP4 B;  3QX7 A;  1PVP A;  4YMM A;  3KZI U;  2W7P A;  5DGB A;  3UXO A;  4F92 B;  9ICO A;  2XO7 A;  4PHA A;  4C8N A;  2AQ0 A;  4B9N A;  1OW5 A;  2JEJ A;  5KT7 A;  3C5F A;  7ICQ A;  2UVU A;  3TAQ A;  8ICY A;  1D8B A;  2C22 A;  5ALW A;  3IRU A;  1KRP A;  4C4T A;  3CRX A;  3GIK A;  4OD0 A;  3EW9 A;  4C8K A;  2V4Q A;  2BZF A;  5KFM A;  5J0T A;  2RLT A;  2P6R A;  2ZIU B;  9ICA A;  2E1F A;  2FE9 A;  5KFX A;  5AM0 A;  5EE9 A;  4Y2Y A;  5AKX A;  2ZJA A;  1HIW A;  5KFZ A;  2BGW A;  3ORY A;  2WB1 C;  4UBB A;  7ICI A;  5J2K A;  3OHB A;  3E0F A;  2HBL A;  2D6F C;  1JXE A;  3WK7 A;  4YP3 A;  3WU2 U;  1HEK A;  3GZF A;  1U4B A;  3RR7 A;  4CE6 A;  2IHN A;  3PX6 A;  2LYB A;  1TK0 A;  4F4K A;  5DBB A;  5KG6 A;  5KT2 A;  1BPY A;  3PML A;  2KIV A;  2MSN A;  2EZZ A;  3J81 j;  1RZT A;  4O9M A;  3DEE A;  4JWM A;  4EX7 A;  4J9L A;  3ZDD A;  2VA2 A;  3EYZ A;  1F5S A;  1SGG A;  1BPZ A;  2VKQ A;  2RP5 A;  4P0Q B;  2MUT A;  1A76 A;  4ED2 A;  5KG5 A;  4DL5 A;  3JPT A;  3H8W A;  2KHV A;  4DL7 A;  1UCV A;  3ZDC A;  4F5O A;  2EDU A;  4J9N A;  4KLG A;  3A0B U;  4EEY A;  1S8O A;  2DKZ A;  2AXT U;  2ZJ5 A;  9ICQ A;  5KL8 B;  2CRX A;  2OEH A;  8ICI A;  3QZ7 A;  2PI4 A;  1TAM A;  4TQS A;  3M7D A;  5CA7 A;  1SWW A;  1TVA A;  4EEK A;  1N48 A;  4KLS A;  3UXN A;  2UVW A;  7ICR A;  4ED3 A;  4DFP A;  4RU9 A;  3ISB A;  1XNS A;  4B9U A;  4IQT A;  2IOF A;  3NRW A;  4DFK A;  2F8L A;  1KW4 A;  9ICR A;  2JRZ A;  4DQI A;  4DFJ A;  4RT3 A;  5KAF U;  2XY7 A;  2E5S A;  2G07 A;  4OO1 J;  4KIT B;  4UB6 U;  2YMM A;  3PR4 A;  4J9M A;  2R8I A;  3NGD A;  4UB4 A;  1XU4 A;  2G5H B;  5AI5 A;  5KFF A;  3PSI A;  7ICH A;  1QLN A;  1UQV A;  1MSW D;  2C2D A;  3KTQ A;  5J2I A;  3RH4 A;  3TAN A;  4QWA A;  4XA5 A;  2LYA A;  5KFV A;  1ZQR A;  2RRD A;  1X40 A;  3C1Y A;  4O3O A;  4B9M A;  4UQG A;  3WK8 A;  3LVV A;  2ESE A;  3KKA C;  5KFD A;  4DFD A;  4PZN A;  4BGD A;  4BDP A;  2Y1I A;  3TFR A;  9ICE A;  2KIW A;  1LKY B;  3MDA A;  3K75 D;  4UB5 A;  4Q8F A;  4Y2P A;  4F5R A;  2HBJ A;  5AI6 A;  2PFP A;  4BX9 C;  4NLB A;  1SV4 A;  3JPS A;  4I2F A;  4RQ6 A;  2KK0 A;  4BWJ A;  4DSL A;  5HHI A;  4QZF A;  4Q43 A;  1V9P A;  1BVS A;  3T3F A;  5AK3 A;  1LKY A;  1BGX T;  3F2B A;  7ICN A;  4UAU A;  4DQQ A;  1Z3E B;  3AU6 A;  2F1J A;  5KAI U;  4MF2 A;  1UPH A;  2NRX A;  4KLT A;  2E8P A;  3PY8 A;  5KFL A;  3PZP A;  4R8U A;  2ISP A;  2OYY A;  3QUC A;  1IIP A;  3BQ7 A;  8ICA A;  3FC4 A;  1SZH A;  4DS5 A;  4O3P A;  3UM9 A;  4P4P A;  1ZQV A;  2NRV A;  3RR8 A;  2H5X A;  2KSO B;  2KKV A;  3FAH A;  5L1M A;  3NRZ A;  5KFA A;  1ZQY A;  3WKD A;  4US9 A;  4AYB F;  4F5P A;  3NS1 A;  5IIN A;  1PVR A;  1QQ5 A;  4FZM A;  1ZQK A;  5AK4 A;  1S0N A;  5HMM A;  1ZRM A;  2GOL A;  1KN5 A;  4QZA A;  1X2I A;  4DSF A;  4ED7 A;  3Q8K A;  5DKW A;  1N60 A;  3RTV A;  4PGX A;  1CRX A;  1X6J A;  3NVV A;  3BDP A;  2FI1 A;  5KFJ A;  7ICV A;  3GQC A;  3GU3 A;  2BCR A;  2NRW A;  2NV3 A;  1SIJ A;  3PSF A;  5AI0 A;  5ALO A;  4I2A A;  3BS5 A;  5KG4 A;  2F1H A;  2I1Q A;  3RFA A;  1ZQZ A;  2HBM A;  2N1R A;  4PGY A;  4OJ5 A;  3IV6 A;  3H4D A;  2ALZ A;  3PMN A;  4CGZ A;  3H8J A;  5AIC A;  5J0Y A;  1NJZ A;  2MRL A;  1XSN A;  3HKZ C;  2W8K A;  4RQN A;  3B9J A;  5ALF A;  5AI9 A;  4I2H A;  2OXO A;  5CP2 A;  9ICV A;  2W43 A;  1X66 A;  3HWT A;  4RQ0 A;  3K1Z A;  7ICM A;  9ICH A;  9ICF A;  1IG6 A;  3JPQ A;  2VA8 A;  4DL4 A;  4QWC A;  1N63 A;  1NOM A;  1DGJ A;  5K4L A;  3BS5 B;  3TAP A;  4I27 A;  1FFV A;  1QH9 A;  2K4H A;  1KTQ A;  3BQ1 A;  2H3V A;  4Z6E A;  5ALV A;  2ASD A;  5DDM A;  2AGO A;  3PX0 A;  1SV0 C;  2EQY A;  2AQ4 A;  3IN5 A;  4RPY A;  3V72 A;  3ONN A;  1N56 A;  3THV A;  3C23 A;  1FEZ A;  2QKQ A;  4M9J A;  2HMX A;  1ZQQ A;  4P0P B;  4GXK A;  4G9B A;  2ASL A;  1V38 A;  1WWV A;  5ALM A;  4YD2 A;  3ICX A;  2KMD A;  3MFI A;  2YB4 A;  4RQ2 A;  3E2E A;  3TAR A;  8ICF A;  4F93 B;  3PW4 A;  4JK1 A;  4KMO B;  2WF9 A;  5KT4 A;  4RNO A;  1QSY A;  3SAG A;  2KV2 A;  1DRG A;  1ZD4 A;  4RPZ A;  3JPP A;  4EX6 A;  3KHR A;  3NTU A;  3RJJ A;  4X5V A;  1ZJM A;  2BR0 A;  2C28 A;  1IXR A;  1Z00 B;  3M8R A;  2JV3 A;  3PV8 A;  2H3Q A;  4DLE A;  4Q44 A;  1A77 A;  2XY6 A;  5J29 A;  2ZIX A;  1NJX A;  2JH1 A;  2YY6 A;  3H8M A;  1SL2 A;  1H38 A;  3QXG A;  5BOM A;  2H3I A;  4P4O A;  5KFK A;  5J0Q A;  2FMQ A;  3D2N A;  4DSE A;  3H4B A;  3RBE A;  1Z4O A;  3T5J A;  5KFP A;  1ZQI A;  4JV1 A;  4YCX A;  4AYB C;  2KZZ A;  3WK4 A;  3WKB A;  5G5H A;  4C8O A;  1RQN A;  4UB2 A;  1S5L U;  4J9S A;  1ZQC A;  1ZQE A;  5DLG A;  5IIK A;  1RDF A;  4HYK A;  1JRO A;  8ICL A;  5CWR A;  4HAI A;  2EAP A;  1ZQW A;  4MFA A;  3ZDB A;  4ECT A;  2L5Y A;  1QCK A;  1COO A;  4PHE A;  4OJ6 A;  2AGQ A;  4ZH4 A;  3RB6 A;  5KFE A;  2RQ5 A;  3MGV A;  4US8 A;  2DGZ A;  1ZET A;  9ICT A;  1NK0 A;  5ALS A;  3F2D A;  2NO5 A;  2E8N A;  4G3I A;  4NJ8 A;  5TZV A;  3OSP A;  9ICC A;  3KBB A;  3KHL A;  1M6Y A;  3QUT A;  4XUS A;  3RRG A;  1DGS A;  3AU2 A;  3Q8L A;  3B0X A;  2K8B B;  2Y9U A;  4JV0 A;  3MAB A;  3QYP A;  2W9C B;  1NI3 A;  1FIQ A;  2HI0 A;  1ZQD A;  3SAH A;  3PR5 B;  3EPG A;  1K1S A;  4Y2J A;  3EZ5 A;  1LVH A;  5ALT A;  1KEJ A;  1PVQ A;  5CHG A;  2DF4 B;  1ARO P;  2I6X A;  4ACO A;  3RB4 A;  2K60 A;  4ELT A;  3F53 A;  5J2F A;  1KFS A;  4DSJ A;  1IM4 A;  5KG2 A;  1SL0 A;  2PI5 A;  4F72 A;  2KVC A;  5EWF A;  5ALN A;  4RQ8 A;  3FM9 A;  1DXS A;  3PSP A;  9ICU A;  4Z6D A;  2W9C A;  3JPN A;  5AI8 A;  1B22 A;  5DBC A;  2ZIW A;  2QLT A;  5HR6 A;  5JU5 A;  5AHX A;  4F5Q A;  8ICJ A;  4ECZ A;  4DS4 A;  2W9B B;  3GIL A;  1L3V A;  4PL2 A;  2BPC A;  4YVZ A;  1SXD A;  4F91 B;  3SZ2 A;  2DPI A;  4O3M A;  2HHX A;  2HSZ A;  2Q4T A;  3H7I A;  3PW7 A;  2ZUB A;  1B4F A;  8ICC A;  2KZ3 A;  3RJF A;  2EZX A;  1X9X A;  3DDH A;  5CJ7 A;  2JR5 A;  1IV8 A;  1L7N A;  2IOF K;  3ZDA A;  5ALK A;  5KG0 A;  5HHH A;  1O03 A;  2ZTD A;  3NVY A;  2Y1J A;  3TAC B;  4K4G A;  3GIJ A;  1TK8 A;  2ES6 A;  3JPO A;  2JEF A;  3KKA A;  3MBY A;  1ZQU A;  1N2X A;  2DL0 A;  2VAN A;  4Y2X A;  1BPB A;  4FO6 A;  1ZD2 P;  4DQP A;  8ICG A;  2LMR A;  5AI4 A;  4YMO A;  4CF3 A;  1MQ3 A;  9ICI A;  8ICR A;  1WG8 A;  3H8S A;  1CEZ A;  4IRD A;  3UMB A;  3TFS A;  2OH2 A;  4M9G A;  2HVH A;  2F1I A;  1U47 A;  2WAQ C;  4P4M A;  5ALI A;  5DQG A;  5AIA A;  4UAZ A;  1NZB A;  4QJF B;  2JEG A;  3OTQ A;  3GDX A;  2AHO B;  1QSL A;  2P35 A;  1NJY A;  3HP6 A;  4Y2V A;  4BJQ A;  3C1Z A;  1N5W A;  2NYV A;  5KFH A;  4QIW F;  4O3Q A;  2CXY A;  2KVS A;  2P66 A;  2LPE A;  3SI8 A;  3CP8 A;  2KTQ A;  2K4P A;  4K4H A;  5EE0 A;  5ALP A;  4C8L A;  1KQQ A;  4IR1 A;  2YML A;  4EYI B;  5D4B A;  4XRH A;  2K8C B;  2QB1 A;  4KLQ A;  4UAS A;  2WB1 F;  4CRX A;  2MAX A;  4KX3 A;  2RDI A;  2FLL A;  1SWV A;  1SB3 C;  2IOH A;  4C80 A;  3VC8 A;  4DOB A;  2I9G A;  4PL1 A;  3M9M B;  2PMZ F;  1S97 A;  4O5K A;  4Y2Q A;  4BUG A;  4M04 A;  5F9L A;  1ZQG A;  4IRK A;  4F5N A;  9ICN A;  2W3R A;  1JN3 A;  5KT6 A;  1SKR A;  4B9T A;  2GLE A;  5DG7 A;  4CCH A;  4DOA A;  2IBK A;  4ED8 A;  4U7C A;  7ICS A;  9ICM A;  2PMZ C;  1N5X A;  4RNM A;  1RYS A;  4O3N A;  4LZD A;  8ICP A;  1ZXI A;  4NLG A;  5KFN A;  1ZQJ A;  2KHQ A;  1ZYQ A;  4P0Q A;  2HW3 A;  4UB1 A;  3OSN A;  3GV5 B;  4DL6 A;  4KLF A;  2KFN A;  1BPD A;  1WCN A;  2JH7 A;  1CI4 A;  3C2L A;  4TUR A;  5AKE A;  3SMV A;  4NXZ A;  3Q8M A;  3S6J A;  5KT5 A;  2DWQ A;  4IQW A;  3BQT A;  1U9L A;  2Y9T A;  5ALQ A;  5KFC A;  1A0P A;  4RQ4 A;  3C29 A;  3LYS A;  5KFI A;  5EE3 A;  7ICU A;  3ISC A;  4QIW C;  5L1L A;  3M6Z A;  3ISD A;  3LWL A;  1TAQ A;  4QNL A;  8ICV A;  1L3T A;  2Z7J A;  2W8L A;  4M6W B;  3Q8Q B;  4FS1 A;  2HHQ A;  4MFC A;  4IL6 U;  3G6X A;  1ZQO A;  1ZQA A;  4JV2 A;  3GFK B;  5CEH A;  1TAU A;  2Y0S F;  2PXI A;  5CB1 A;  4ECQ A;  1NKB A;  1ZQF A;  3PNC A;  3QU4 A;  4KLH A;  4GFJ A;  4R63 A;  2JZB B;  3NAS A;  1BNO A;  5J0W A;  2HHW A;  3QU9 A;  2ZIU A;  3CW2 C;  2J6U A;  2R8K A;  4DF8 A;  4ICA A;  1VDV A;  5C5J A;  3RB3 A;  4BXO B;  3ZDE A;  4ECW A;  4DFM A;  3CYM A;  5J8Y A;  2HHT A;  5B66 U;  2YX8 A;  4I2I A;  2WTF A;  3V7J A;  4IQU A;  2G08 A;  1NK7 A;  4C4S A;  4M9N A;  2BKE A;  3HW8 A;  2R8J A;  2XI9 A;  3Q8R B;  1F44 A;  2PFO A;  3V7K A;  1RM6 C;  2WF8 A;  5ALR A;  4GLX A;  1UT5 A;  1JUD A;  5ALL A;  3H0M B;  2P6U A;  4YR0 A;  3I28 A;  1X9W A;  3RH5 A;  4NLZ A;  4EEL A;  4ZOH C;  4PHP A;  1V97 A;  2DUY A;  2HOQ A;  2F8K A;  3OJU A;  2E8M A;  4B9V A;  3RRH A;  3D6J A;  3TAD C;  2FMS A;  3TAD A;  1O08 A;  3KHH A;  1ZQ1 C;  1S0V A;  1WUD A;  5KG3 A;  2K8A A;  3VCB A;  4F2S A;  2ZIW B;  5KFR A;  1ZRN A;  2HBK A;  3JPR A;  3FDS A;  2KIC A;  1RXV A;  3A0H U;  3ZI4 A;  2BDU A;  2YTU A;  5F9N A;  4RQ5 A;  4IC9 A;  2FPK A;  3HX0 A;  1YZ7 A;  2JXJ A;  3SD7 A;  1Q46 A;  5AKG A;  1X42 A;  5DGA A;  1OXJ A;  3H40 A;  1P7D A;  3BS7 A;  5HP4 A;  2KEY A;  1BNP A;  3ZD9 A;  4TUP A;  1HUZ A;  7ICK A;  5L9X A;  4QW8 A;  1NK5 A;  2E1E A;  1Q8K A;  1L7O A;  8ICU A;  1PK1 B;  1KL9 A;  1PK3 A;  3D2Q A;  4F8R A;  5DQI A;  2JZB A;  1JX4 A;  4F4W A;  1Q3V A;  2A1J A;  2Y0S C;  2EAM A;  7ICE A;  3UQ2 A;  1Q3U A;  4YQW A;  3SQI A;  4ECU A;  4O3S A;  2OHF A;  3GIM A;  1AQ6 A;  4Y2S A;  4DQS A;  8ICS A;  7ICJ A;  4BWM A;  5L1J A;  1URJ A;  2KJ5 A;  4Y2U A;  5AKZ A;  2ZJ8 A;  3QU2 A;  3RJE A;  2JGA A;  3HKZ F;  3D2S A;  1JXL A;  1B43 A;  7ICT A;  1ZD5 A;  4KX5 A;  5EWE A;  2OM6 A;  4DL3 A;  2PKE A;  1NNL A;  1NK4 A;  5AM1 A;  4KLO A;  1KDH A;  4KMU A;  1PUZ A;  5J0S A;  2K4I A;  2KFZ A;  5KT3 A;  4UAR A;  4NLK A;  3AN1 A;  3HRD D;  1SKS A;  3QZ8 A;  4OJP A;  3F2C A;  1J97 A;  2ZIV A;  5KFO A;  2BCS A;  4J03 A;  4YD1 A;  2XC9 A;  5L1I A;  2UVV A;  2DQN B;  8ICN A;  2FJ6 A;  1NK9 A;  4Y2T A;  5J2E A;  4KLJ A;  7ICF A;  5IIM A;  2ZTE A;  4J9O A;  5GTH U;  3N7S C;  2BQ3 A;  5GTI U;  4EEN A;  4FE3 A;  5AM4 A;  4RNN A;  3RH6 A;  3BJY A;  1FO4 A;  1U45 A;  1TE2 A;  4Y2R A;  4FS2 A;  3M9O B;  1XS9 D;  3AL0 B;  1RG6 A;  4MF8 A;  5ALY A;  3IG5 A;  2B6G A;  3UMG A;  2PFQ A;  2GWS A;  2QAR A;  2KNJ A;  5F3X B;  1S0M A;  3RAQ A;  1L3U A;  1U48 A;  5KFS A;  3N7P D;  4YXM A;  4R65 A;  1ZD3 A;  2RDJ A;  1MQ2 A;  3PW0 A;  3AEV A;  4DO9 A;  3PW5 A;  1KBU A;  4JUZ A;  4RUC A;  2A1A A;  4MEY A;  1ZQS A;  3BQ0 A;  4GXJ A;  4M6W A;  1SXE A;  3RJG A;  1D8Y A;  1UT8 A;  2Q0Z X;  1PK1 A;  3OHA A;  3OGU A;  3TI0 A;  2HOF A;  4RQM A;  3K4G A;  3AQE A;  3OPX A;  7ICP A;  2AGP A;  2HCF A;  4B9S A;  5AKK A;  3UPQ A;  3SV3 A;  3RF9 A;  5ALH A;  3C21 A;  5J0R A;  2KD1 A;  9ICK A;  4KLL A;  5J2C A;  5JTI A;  5J2J A;  4A8E A;  4B6J A;  4USA A;  2W55 A;  2FLP A;  4TQR A;  3V6J A;  5AM5 A;  3FYH A;  4ECX A;  8ICZ A;  3M6K A;  1PZN A;  3MGI A;  4YN4 A;  3WKA A;  8ICQ A; 
#chains in the Genus database with same CATH homology
 3A0H U;  5E79 U;  5B5E U;  2DUY A;  4UB6 U;  3A0B U;  5GTH U;  5TIS U;  5H2F U;  3KZI U;  3WU2 U;  5B66 U;  5GTI U;  4UB8 U;  5KAF U;  2AXT U;  5KAI U;  1S5L U;  4IL6 U;  4PJ0 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...