4PJ2A

Crystal structure of aeromonas hydrophila plii in complex with meretrix lusoria lysozyme
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
121
structure length
120
Chain Sequence
b'GFFKQLTLPSGQVVTVSEGRGEPASTGSYDVRLYSGANPQFPLDQFIDGKVLPRDGSIKELKLLDLNGDKQPELIVVVESAGSGSYLSADAFTLNPQEGLDSFNHVEGLAPEDVIQALKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative exported protein
publication title The structure of the proteinaceous inhibitor PliI from Aeromonas hydrophila in complex with its target lysozyme.
pubmed doi rcsb
source organism Aeromonas hydrophila subsp. hydrophila
molecule tags Hydrolase/hydrolase inhibitor
total genus 20
structure length 120
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16743 PliI Periplasmic lysozyme inhibitor of I-type lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.460 Mainly Beta Beta Barrel Lipocalin Lipocalin 4pj2A00
3OD9A 4PJ2A
chains in the Genus database with same CATH superfamily
2MWHA 3P6CA 5HBSA 3SZIA 1ZNEA 2FTBA 1VYOA 4ZCBA 4NYQA 1ZNDA 1FTPA 4I9SA 3HWDA 2NNEA 3G7XA 5BVTA 1NQNA 4CPIA 1VWGB 3VPJE 5K67A 2A3FX 1LDQA 4M7MA 2WWPA 2X55A 3B2KA 4Y0RA 1S44A 1VWNB 4IB9A 2HNXA 3FIQA 2OZQA 1QABE 2ZSCA 2CZUA 3NADA 2L9CA 1LUQA 1HQPA 4Y59A 1G5WA 2IZHB 2MO5A 2L67A 2NNDA 5L8IA 3CR6A 3WJDA 1GT3A 4ON1A 5B5GA 1ZNGA 5C0NA 1I9HA 4LQZA 1PM1X 1GKAA 1OBPA 4ORSA 5F2BA 4UU2A 1IJ8A 4TLJA 3D97A 3MX7A 5D8JA 4YBPA 1HBPA 1SWGA 1QQSA 2GJ5A 2MM3A 3B2IA 5LJKA 5AEOA 5HTEA 3TGBA 2BC3A 2MF6A 4QYNA 2OYBO 3BY0A 4MISA 3WJFA 1VWRB 1PEEA 3Q34A 1GKAB 1NP1A 1VWCB 3C78X 2A2GA 2JW1A 4GDAA 4KC7A 4KH8A 4MEEA 4CDFA 5KICA 2N93A 2Q2PA 3QQ2A 1YWBA 2JN3A 4I60A 2XKLA 1A3YA 1KT6A 1L6MA 1ICMA 1VWJB 4NNSA 1AVGI 4QYPA 4YDAA 4ZJ0A 2X8TA 3EW2A 1E00A 4Z2VA 4Z27A 1LIBA 3FEPA 3UEVA 4O3WA 1KQXA 1MVGA 2C1QA 3PP6A 4YKOA 1JMXA 4MVKA 2AF5A 1RSTB 1ACDA 1BSOA 1BSQA 1RBPA 4YFPA 3ZQ3A 5EEDA 1CBRA 1MOYA 1GGLA 1GX8A 1N0SA 4YBUA 1E06A 3I17A 1SWKA 1SRFA 1OEEA 4GRJA 3V8UA 1BLRA 3OD9A 4BJ8A 1VWPB 2X56A 1AQBA 3WZPA 4QAEA 1DV9A 3RBYA 1HQQA 2HZQA 1W4TA 1ERXA 1LCVA 4GETA 5B11O 2Q4NA 2FWVA 2R73A 4QQ1A 2GTLO 1I78A 2F09A 4QRLA 3T6FA 2BHVA 3GE2A 4DCBA 4BX6A 4N7CA 3K3LA 3KFFA 1KT5A 1KQWA 1LCZA 1VPRA 1X8QA 1BRQA 1UYOX 1JMZA 1PMPA 2AT8X 3F9DA 4RUUA 4XMGA 4GKCA 3BRNA 3CBCA 4LKTA 1N43A 2RTQB 4R0BA 4O4OA 1VWQB 5AJCA 3VGWA 1KL5A 3RDQA 4ZR2A 2GTLM 2IZJA 2X8SA 3DTQA 3EMMA 3U9PC 4BX6B 1KZWA 2AL0X 2BSZA 4ZHDA 1SRIA 1D3SA 1FDQA 2UYWA 1EUOA 2JU3A 5CHKA 4IAWA 4PSQA 4O4SA 4IRWA 4TNNA 3VG6A 3C77X 2RTNB 1BRPA 1IIUA 4JHQA 1QG5A 1SWOA 2FHLA 1OEKA 2OFMX 2RTAA 5AQ6A 5BVSA 3UEUA 1OSPO 3B2JA 3EM0A 5LKEA 3CWKA 1MEPA 1LF7A 1O1VA 1STPA 4EFGA 5CYBA 4JNJA 3SLOA 3CKFA 3TZSA 1SWBA 5HAEA 2AT0X 4IMOA 4UU3A 3RE5A 5B27A 4NYRA 1EW3A 1ALBA 1JBHA 3NP1A 2IZDB 4YFQA 4ZHCA 1KL4A 1PTSA 3WZOA 4AZQA 4OS3A 3LV4A 5H9KA 4YGHA 5H8TA 3DSZA 5FAZA 1VWFB 2QO4A 1HY2A 3RWXA 4ZGUA 4Y0QA 2QO6A 4GJVA 5AJBA 5IRUA 3T2XA 4AW8A 4ZHHA 4IABA 2RTBB 3FENA 4MVEA 1CJ5A 1NBXA 3CQRA 4L3RA 2W2FA 5B10O 2A5BA 1Y9TA 4ZH6A 3ZW1A 3EYCA 4EEJA 3AKNA 1NGLA 4FBOA 4AZPA 1G85A 2CM4A 5B2AO 1I4UA 5KIDA 5LJEA 4CDCA 4EXZA 1IW2A 3P6FA 4BCSA 1NC9A 5IRWA 3D4RA 4I6SA 3S26A 2FGSA 2RTEB 4M6SA 4ARHA 1SWTA 3PH5A 1G74A 3P6HA 3ZW1B 3L4RA 4PJ2A 1YP7A 1YUPA 2JU7A 2KTDA 2ZAIA 4CV7A 3S5VA 1OEJA 4ORYA 1KT3A 3AEHA 2HLVA 4Z2OA 1OBUA 2KTSA 1U0XA 1WBIA 2GTLN 2P8GA 2RTHB 3PK2A 4C5PA 5JR8A 3KFGA 3BX7A 4OELA 4CPEA 3S5XA 3RY1A 2HZRA 4HPAA 5H9AA 5DG4A 4I95A 2FS7A 3BDRA 3FELA 3Q6LA 4O49A 1B8EA 5B3MO 4QGVA 5CE4A 1BM5A 1N9MA 1PBOA 5EDBA 1PBYA 4D6BA 4U8UO 1AELA 2RTJA 4ALBA 1N9YA 4LZUA 3AUMO 1YWDA 1BJ7A 4BX5A 2GH7A 2GC9A 1RLBE 1IKEA 3MG5A 1SLGB 2WPUA 5L8OA 1EPAA 3D9WA 5B5FA 3WBGA 5FENA 2C1SA 4BOEA 1TVQA 1VWAB 1KOIA 1KXOA 1ERBA 3HPEA 4ORWA 4IB7A 4OMWA 3X00A 3BU1A 2G78A 2WSJA 4BX5B 2ANSA 3O22A 4U8UM 1SWSA 1SWNA 2Y3FA 1SRJA 1ZNKA 1EIOA 1KT4A 1S7DA 1RAVA 3NPOA 4NV7A 4DQ3A 3UEXA 1P6PA 5F7GA 3CMPA 4WFUA 2G7BA 1FJ1E 1VWIB 3T6LA 3RE6A 3EBWA 1QWDA 1UYNX 3P6EA 3ZUOA 3RDSA 2DM5A 2WQ9A 1TOUA 3KFHA 4EKVA 1LPJA 4GJSA 4KT5A 1SREA 5HTDA 1SWJA 2CBRA 2X34A 2ACPX 2K23A 4FBVA 1UREA 3T2WA 1A57A 2F73A 5BVQA 2BLGA 4ORXA 2AMMX 3RDMA 1LKEA 3ZI8A 3CBSA 2LBVA 4EDEA 2OVDA 1IFBA 2QOSC 2PI3O 2YMSA 2JOZA 3JQOA 3RZYA 5HZ6A 4CK4A 1U17A 1FENA 2R56A 3PECA 4IB8A 4O3ZA 3WZNA 4A60A 1VWBB 2RTIB 5HWZA 4IAXA 1RSUB 3JSQA 4GZVA 2CBSA 4O4UA 1VWOB 2OY8A 1LFOA 1T0VA 2DJFA 3BSZE 2LB6A 3F8AA 5HA0A 2CZTA 4L1NA 1Y0GA 1A18A 3AKMA 4GNYA 2UZ2A 3VG3A 4TQ2A 3RY2A 4YFRA 1JJXA 2FLJA 3NX1A 3TF6A 3HOLA 4B55A 3HWGA 1H91A 3CKGA 4FGIB 4JO6A 3F6ZB 3PQUA 3E3CA 3ELXA 1DZMA 3NBXX 3WZQA 1E2TA 1T8VA 4NW4A 5D4AA 3RDUA 2F01A 3NQ9A 5IO5A 4Z6JA 2AT5X 3FA9A 1TXLA 2MJIA 3NX2A 3QKGA 1TW4A 3ZZVA 5BYPA 4GD9A 1MDCA 2C4IA 1Y55X 1SXWA 4RUNA 3VG5A 3B2HA 2EU7X 2OVEA 4MVIA 3EBKA 4COTA 1YP6A 1I05A 1EQDA 5D47A 4KIIA 2QO5A 3PDFA 3HWFA 4GU8A 2XSTA 3WJEA 3FDCA 1QY2A 1SXXA 4GUZA 4HPCA 2BS6A 4NP1A 4O9SA 4U8UN 4Y0SA 4YKMA 1GM6A 2HYSA 2WR6A 2FR2A 2FHNX 1VWLB 1GX3A 1ZNLA 2RTMA 4GDZA 4CSBA 2NP1A 1UZ2X 1I04A 3STKA 5EPQA 1GT5A 2FRSA 1ZNHA 1JYJA 2AVIA 2IZAA 2Z4HA 3IA8A 4JGLA 4YGGA 2OFRX 1WUBA 3VHIA 1JJJA 1SMPI 3APWA 1SRHA 1S2PA 2RTPB 1JQPA 2YG2A 1K3BA 4GE1A 1DF8A 1MK5A 4IMNA 3TGCA 2G8CO 3NQ3A 5DPQA 4ORRA 3CQNA 2M4LA 2WEXA 5HA1A 4GGTA 5IO6A 2IZCB 1B0OA 1W6FA 2KW1A 3ELZA 1OPBA 3HTYA 3WJCA 4I3BA 3KFIA 1STRB 4YVBA 3APXA 5CSEA 3PH6A 3WYQA 3LHNA 4MVLA 5IO7A 3FW4A 3N91A 4ORUA 1LIDA 3WJBA 1JV4A 4LZVA 2IZLB 4DNEA 2DJGA 2LA7A 1ML7A 4QGXA 1SY3A 3PPTA 3SZHA 1YWCA 2L68A 1X89A 4TJZA 3FA6A 3KQ0A 1I06A 1QFTA 1SY1A 5EDCA 4CDDA 1LCWA 1SWHA 2MHDA 4O4XA 5L8NA 5K06A 2ALLX 1MX7A 1O8VA 1B56A 2AT3X 2POAA 3RKGA 5F1EA 2RA6A 1XKIA 1SWQA 5LJCA 1KZXA 4YCEA 4NLIA 1SWFA 2RTKA 4OS0A 1MUPA 3I0AA 4BBOA 3GAQA 2VFBA 3EW1A 3OE3A 1HMRA 1HMSA 4BX7A 1JJUA 2G79A 1NQMA 3FMZA 2RTGB 4WBKA 2IZGB 1LDOA 2RCQA 2IFBA 2JGSA 3KZAA 3RDOA 1EALA 1XCAA 1HXZA 1VWKB 5HCDC 2QMIA 1ICNA 5K68A 2I5ZO 4GGZA 1SY0A 2K62A 3BU9A 3VU1A 1BEBA 3EC5A 4HPBA 4BX7B 5HZQA 2Q2MA 1LELA 2WQAE 4KCAA 4Y5DA 5LKFA 1W5RA 3FYFA 3WVMA 2Z4IA 2I5VO 1EXSA 5FFHA 4FBRA 5D48A 4I3CA 1HMTA 2RD7C 3P24A 1KT7A 2E4JA 1U18A 2O62A 4YH0A 1X8UA 3VG4A 2Q39A 4DQ4A 5HZ8A 1VWMB 1SWUA 1SXUA 1ADLA 1SLDB 3RSWA 2CM9A 1NDJA 3BX8A 2KT4B 3VHMA 2L5PA 2OL8O 4ID2A 1IKJA 2IZEB 3WJGA 4NNTA 1A2DA 4Y0PA 4BGFA 3P6DA 3FA7A 4GH7A 4LKPA 4D6AA 3FR2A 2OL7A 2WEWA 1DFVA 1HBQA 1SA8A 2RTCB 4YGZA 5FQ8E 4ZH9A 1VYFA 1QY0A 2OFAA 4XMDA 1DZPA 3PEDA 2JMBA 5HCEC 2FT9A 3WYPA 3FW5A 1B4MA 2QCBA 3FR5A 1SLEB 3ZWEA 4WFVA 4ZFXA 5HZ9A 2LBAA 4HWMA 4AZRA 3U03A 2FR3A 4N7DA 5IRAA 1DZKA 5LJHA 4K19A 1X8OA 2IZIA 1SWCA 2FKGA 3VE1A 1E02A 1AB0A 1Y53X 3MVFA 1OBQA 3S60A 4ML7B 1X8NA 2RCTA 3SZJA 5LJGA 5D45A 1CRBA 2X32A 4NV8A 1D2UA 3IFBA 2RN4A 4O3YA 3VE2A 3ZW0A 4A8ZA 4OS8A 2X45A 2FS6A 1BBPA 2LKKA 2X8FA 1EI5A 1GT1A 2OY1O 4BQUA 2RTRB 1NP4A 4XMCA 1Y9LA 4BVMA 3STMX 2W2AA 3VHHA 3KVNA 5B29A 1HXLA 2BT9A 3FEKA 1OPAA 1MM9A 2KD2A 4AZOA 2OF8A 4GGRA 3ZW0B 1GX9A 2G5LA 4YDBA 3D95A 1RXKA 1X8PA 1SWAA 4XMHA 2AH7X 3SLJA 1SWDA 4INNA 1IFCA 3O2YA 5FQ7E 3UEWA 3ZW2A 3OJYC 3VG2A 2LFOA 4A1YA 5EEEA 2CAMA 2IZKA 1CBIA 1GT4A 2IZFB 2X4MA 4OEMA 4I3DA 2Q9SA 2ASNX 2OVSA 4OMXA 3SAOA 2A8GA 2HMBA 1O1UA 3APUA 3H3IA 3O19A 4GK9A 3HWEA 1VWEB 2OY7A 4O3XB 4CDEA 1KGLA 2RTLA 4YMYA 3ZUIA 4A1HA 1G7NA 5L3YA 1LNMA 3P02A 1DZJA 4ALOA 4AZMA 3LTWA 1T68X 1ZRYA 3RDXA 1BWYA 3BLGA 4CPHA 4NLJA 2A0AA 1SRGA 1VWDB 2RQ0A 4WHIA 5H9LA 4AZNA 2X46A 2WUTA 4IB6A 4AYHA 3PQSA 4ES7A 1SWPA 2RTFB 2JU8A 4YCHA 4ZHGA 2BS5A 1YIVA 1JZUA 2GTFX 2ZAGA 3HOEA 4Z2PA 1KFFA 1STSB 3B2LA 3FLLA 1EIIA 2R74A 3SOTA 3T1DA 1JIWI 1LIEA 4U46A 4CPHB 1SXYA 2Y32A 4ZGFA 4ODDA 1VWHB 5EZ2A 2RTDB 5LJBA 2VDFA 2OFBA 4OKAA 1DC9A 4XMEA 2OF9A 1N7YA 4CPFA 5F6BA 4TKJA 1EPBA 3C76X 4MIRA 3U0DA 1CBQA 3APVA 3WOVA 4HFOA 2OL6O 2NNQA 1FE3A 2A2UA 1SWLA 3VG7A 1CBSA 3HK1A 2A13A 4QZUA 3TGAA 1SY2A 4QZTA 1LICA 1QFVA 5HZ5A 4GNWA 4TKBA 3SLTA 4U9CA 1FELA 3NR3A 4U3QA 4ZHFA 1VYGA 1X71A 2OY5O 2RTOB 1N4JA 2HKDA 4HPDA 4TKHA 3FR4A 2QOMA 4FQBB 2QM9A 5FQ6E 3MM0A 4I9RA 1QY1A 4XMFA 2A5CA 1MX8A 1SWRA 1SWEA 1FEMA 4EQAC 4QNIA 1BSYA 2IZBA 3JS1A 3WXQA 1DF3A 1AVDA 1K24A 1Z24A 4IBAA 3FIDA 2ACOA 2FKJA 1AVEA 4QGWA 2VFCA 2PY1A 5F6ZA 2OVAA 5LJDA 1HN2A 3FA8A 1RXHA 1RXJA 1GXAA 2AKQA 3STNA 2W2BA 3D96A 1TOWA 2AT6X 2Y3EA 3BS2A 5F58A 1SLFB 3MBTA 4Z28A 1LIFA 1KL3A 1Y52X 3P6GA 4KC8A 3UAQA 5HCCC 5IXGA 1R0UA 1JYDA 3OBLA 5JD2A 5KHPA 3NQKA 1YWAA 1E5PA 5H9NA
chains in the Genus database with same CATH topology
2MWHA 3P6CA 5HBSA 1ZNEA 2FTBA 4ZCBA 4NYQA 1ZNDA 1FTPA 4I9SA 3HWDA 2NNEA 3G7XA 5BVTA 3VPJE 2A3FX 4M7MA 2WWPA 3B2KA 4Y0RA 1S44A 4IB9A 2HNXA 3FIQA 2OZQA 1QABE 2CZUA 3NADA 2L9CA 1HQPA 1G5WA 2MO5A 2L67A 2NNDA 5L8IA 3CR6A 3WJDA 1GT3A 4ON1A 1ZNGA 5C0NA 4LQZA 1PM1X 1GKAA 1OBPA 4ORSA 4UU2A 4TLJA 3D97A 3MX7A 5D8JA 4YBPA 1HBPA 1QQSA 2GJ5A 2MM3A 3B2IA 5LJKA 5AEOA 5HTEA 3TGBA 4QYNA 3BY0A 4MISA 3WJFA 1PEEA 1GKAB 1NP1A 3C78X 4KC7A 2A2GA 2JW1A 5KICA 4KH8A 2N93A 2Q2PA 1YWBA 2JN3A 2XKLA 1A3YA 1KT6A 1L6MA 1ICMA 4NNSA 1AVGI 4QYPA 4YDAA 2X8TA 1E00A 1LIBA 3FEPA 3UEVA 4O3WA 1KQXA 1MVGA 3PP6A 4YKOA 4MVKA 1ACDA 1BSOA 1BSQA 1RBPA 4YFPA 3ZQ3A 5EEDA 1CBRA 1GGLA 1GX8A 1N0SA 4YBUA 1E06A 3I17A 1BLRA 1OEEA 4GRJA 3V8UA 3OD9A 1AQBA 4QAEA 1DV9A 3RBYA 2HZQA 1ERXA 4GETA 2Q4NA 2FWVA 2R73A 4QQ1A 2GTLO 2F09A 4QRLA 2BHVA 3GE2A 4N7CA 3K3LA 3KFFA 1KT5A 1KQWA 1KZXA 1VPRA 1X8QA 1BRQA 2AT8X 1PMPA 3F9DA 4RUUA 4XMGA 4GKCA 3BRNA 3CBCA 4LKTA 4R0BA 5AJCA 4O4OA 4ZR2A 2GTLM 3U9PC 2X8SA 3DTQA 3EMMA 1KZWA 2AL0X 4ZHDA 1D3SA 1FDQA 1EUOA 2JU3A 4IAWA 4PSQA 4O4SA 4TNNA 3VG6A 3C77X 1BRPA 1IIUA 1QG5A 5AQ6A 5BVSA 1OEKA 2OFMX 3UEUA 3B2JA 3EM0A 5LKEA 3CWKA 4EFGA 1LF7A 1O1VA 5CYBA 3TZSA 5HAEA 2AT0X 4IMOA 4UU3A 5B27A 4NYRA 1EW3A 1ALBA 1JBHA 3NP1A 4YFQA 4ZHCA 4AZQA 4OS3A 3LV4A 5H9KA 4YGHA 5H8TA 3DSZA 5FAZA 2QO4A 3RWXA 4ZGUA 4Y0QA 2QO6A 5AJBA 4AW8A 4ZHHA 4IABA 3FENA 4MVEA 1CJ5A 3ZW1A 3CQRA 4L3RA 2W2FA 4ZH6A 1Y9TA 4EEJA 3EYCA 3AKNA 1NGLA 4FBOA 4AZPA 1G85A 2CM4A 5KIDA 1I4UA 5LJEA 4EXZA 1IW2A 3P6FA 3D4RA 4I6SA 3S26A 4ARHA 4M6SA 4ZJ0A 3PH5A 1G74A 3P6HA 3ZW1B 3L4RA 4PJ2A 1YP7A 1YUPA 2JU7A 2KTDA 2ZAIA 4CV7A 3S5VA 1OEJA 4ORYA 1KT3A 2HLVA 1OBUA 2KTSA 1U0XA 2GTLN 2P8GA 5JR8A 3KFGA 3BX7A 3S5XA 2HZRA 4HPAA 5H9AA 5DG4A 4I95A 2FS7A 3BDRA 3FELA 3Q6LA 4O49A 1B8EA 4QGVA 1BM5A 5CE4A 5EDBA 1PBOA 4D6BA 4U8UO 1AELA 4ALBA 4LZUA 1YWDA 1BJ7A 2GC9A 1RLBE 1IKEA 5L8OA 1EPAA 3WBGA 5FENA 4BOEA 1TVQA 1KOIA 1KXOA 1ERBA 4ORWA 4IB7A 4OMWA 3BU1A 2G78A 2WSJA 2ANSA 3O22A 4U8UM 1ZNKA 1EIOA 1KT4A 1S7DA 3NPOA 4DQ3A 3UEXA 1P6PA 5F7GA 3CMPA 4WFUA 2G7BA 3EBWA 1QWDA 3P6EA 3ZUOA 2DM5A 2WQ9A 1TOUA 3KFHA 1LPJA 4KT5A 5HTDA 2CBRA 1A57A 2ACPX 2K23A 4FBVA 1UREA 2F73A 5BVQA 2BLGA 4ORXA 2AMMX 1LKEA 3ZI8A 3CBSA 2LBVA 4EDEA 2OVDA 1IFBA 2QOSC 2YMSA 3JQOA 2JOZA 3RZYA 5HZ6A 4CK4A 1U17A 1FENA 2R56A 3PECA 4IB8A 4O3ZA 5HWZA 4IAXA 3JSQA 4GZVA 2CBSA 4O4UA 1LFOA 1T0VA 3BSZE 2LB6A 3F8AA 5HA0A 2CZTA 4L1NA 3AKMA 1A18A 4GNYA 3VG3A 4TQ2A 4YFRA 1JJXA 2FLJA 3NX1A 3TF6A 3HOLA 3HWGA 1H91A 4FGIB 3F6ZB 3PQUA 3E3CA 3ELXA 1DZMA 3NBXX 4NW4A 1T8VA 5D4AA 5IO5A 3NQ9A 2AT5X 3FA9A 1TXLA 2MJIA 3NX2A 3QKGA 1TW4A 3ZZVA 5BYPA 1MDCA 1SXWA 4RUNA 3VG5A 3B2HA 2EU7X 2OVEA 4MVIA 3EBKA 4COTA 1YP6A 1I05A 1EQDA 5D47A 4KIIA 2QO5A 3HWFA 4GU8A 2XSTA 3WJEA 4NP1A 1QY2A 1SXXA 4O9SA 4HPCA 2BS6A 4Y0SA 4U8UN 4YKMA 1GM6A 2HYSA 2WR6A 2FR2A 4GDZA 1JZUA 1ZNLA 4CSBA 2NP1A 1UZ2X 1I04A 3STKA 5EPQA 1GT5A 2FRSA 1ZNHA 1JYJA 2Z4HA 4JGLA 3IA8A 4YGGA 4A60A 1JJJA 2OFRX 1SMPI 3APWA 1S2PA 2YG2A 4GE1A 4IMNA 3TGCA 3NQ3A 5DPQA 4ORRA 3CQNA 2M4LA 2WEXA 5HA1A 5IO6A 1B0OA 3HTYA 2KW1A 3ELZA 1OPBA 3WJCA 4I3BA 3KFIA 3APXA 3PH6A 3LHNA 4MVLA 5IO7A 3FW4A 3N91A 4ORUA 1LIDA 3WJBA 1JV4A 4LZVA 2LA7A 1ML7A 4QGXA 1SY3A 3PPTA 1YWCA 2L68A 1X89A 4TJZA 3FA6A 3KQ0A 1I06A 1QFTA 1SY1A 5EDCA 2MHDA 4O4XA 5L8NA 5K06A 2ALLX 1MX7A 1O8VA 1B56A 2AT3X 2POAA 3RKGA 5F1EA 2RA6A 1XKIA 5LJCA 4YCEA 4NLIA 4OS0A 1MUPA 3I0AA 3GAQA 3OE3A 1HMRA 1HMSA 2G79A 3FMZA 4WBKA 2RCQA 2IFBA 3KZAA 1EALA 1XCAA 5HCDC 2QMIA 1ICNA 1SY0A 2K62A 3BU9A 3VU1A 1BEBA 5LJBA 4HPBA 5HZQA 2Q2MA 2WQAE 4KCAA 3WVMA 4FBRA 5LKFA 3FYFA 2Z4IA 1EXSA 5FFHA 5D48A 4I3CA 1HMTA 2RD7C 3P24A 1KT7A 2E4JA 1U18A 2O62A 4YH0A 1X8UA 3VG4A 2Q39A 4DQ4A 5HZ8A 1SXUA 1ADLA 3RSWA 2CM9A 3BX8A 2KT4B 2L5PA 4ID2A 1IKJA 3WJGA 4NNTA 1A2DA 4Y0PA 3P6DA 3FA7A 4GH7A 4LKPA 4D6AA 3FR2A 2WEWA 1DFVA 1HBQA 1SA8A 4YGZA 5FQ8E 4ZH9A 1VYFA 1QY0A 4XMDA 1DZPA 3PEDA 2JMBA 5HCEC 2FT9A 3FW5A 1B4MA 3FR5A 3ZWEA 4ZFXA 4WFVA 5HZ9A 2LBAA 4HWMA 4AZRA 3U03A 2FR3A 4N7DA 1DZKA 5LJHA 4K19A 1X8OA 3VE1A 1E02A 1AB0A 3MVFA 1OBQA 3S60A 4ML7B 1X8NA 2RCTA 5LJGA 5D45A 1CRBA 1D2UA 3IFBA 2RN4A 4O3YA 3VE2A 3ZW0A 4A8ZA 4OS8A 2X45A 2FS6A 1BBPA 2LKKA 2X8FA 1EI5A 1GT1A 4BQUA 4BVMA 1NP4A 4XMCA 1Y9LA 3STMX 2W2AA 5B29A 2BT9A 3FEKA 1OPAA 2KD2A 4AZOA 3ZW0B 1GX9A 4YDBA 3D95A 1X8PA 4XMHA 2AH7X 5FQ7E 4INNA 1IFCA 3O2YA 3UEWA 3ZW2A 3OJYC 3VG2A 2LFOA 4A1YA 5EEEA 1CBIA 1GT4A 4I3DA 2Q9SA 2ASNX 2OVSA 4OMXA 3SAOA 2HMBA 1O1UA 3APUA 3H3IA 3O19A 4GK9A 3HWEA 1KGLA 4O3XB 4YMYA 3ZUIA 4A1HA 1G7NA 1LNMA 3P02A 1DZJA 4ALOA 4AZMA 1T68X 1ZRYA 1BWYA 3BLGA 4NLJA 2A0AA 2RQ0A 5H9LA 4AZNA 4WHIA 2X46A 2WUTA 4IB6A 4AYHA 3PQSA 4ES7A 2JU8A 4YCHA 4ZHGA 2BS5A 1YIVA 2GTFX 2ZAGA 3HOEA 3B2LA 3FLLA 1EIIA 2R74A 3SOTA 3T1DA 1JIWI 1LIEA 1SXYA 4ZGFA 4ODDA 5EZ2A 1DC9A 4XMEA 5F6BA 4TKJA 1EPBA 3C76X 4MIRA 3U0DA 1CBQA 3APVA 3WOVA 4HFOA 2NNQA 1FE3A 2A2UA 3VG7A 1CBSA 3HK1A 2A13A 4QZUA 3TGAA 1SY2A 4QZTA 1LICA 1QFVA 5HZ5A 4GNWA 4TKBA 4U9CA 1FELA 3NR3A 4U3QA 4ZHFA 1VYGA 1X71A 4HPDA 4TKHA 3FR4A 4FQBB 2QM9A 5FQ6E 4I9RA 1QY1A 4XMFA 1MX8A 1DF3A 1FEMA 4EQAC 4QNIA 1BSYA 3WXQA 3JS1A 1Z24A 4IBAA 2ACOA 4QGWA 2PY1A 5F6ZA 2OVAA 5LJDA 1HN2A 3FA8A 2AKQA 1GXAA 3STNA 2W2BA 3D96A 1TOWA 2AT6X 3BS2A 5F58A 3MBTA 1LIFA 3P6GA 4KC8A 3UAQA 5HCCC 1R0UA 1JYDA 3OBLA 5KHPA 3NQKA 1YWAA 1E5PA 5H9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OD9 A;  4PJ2 A; 
#chains in the Genus database with same CATH topology
 2MWH A;  3P6C A;  5HBS A;  3SZI A;  1ZNE A;  2FTB A;  1VYO A;  4ZCB A;  4NYQ A;  1ZND A;  1FTP A;  4I9S A;  3HWD A;  2NNE A;  3G7X A;  5BVT A;  1NQN A;  4CPI A;  1VWG B;  3VPJ E;  5K67 A;  2A3F X;  1LDQ A;  4M7M A;  2WWP A;  2X55 A;  3B2K A;  4Y0R A;  1S44 A;  1VWN B;  4IB9 A;  2HNX A;  3FIQ A;  2OZQ A;  1QAB E;  2ZSC A;  2CZU A;  3NAD A;  2L9C A;  1LUQ A;  1HQP A;  4Y59 A;  1G5W A;  2IZH B;  2MO5 A;  2L67 A;  2NND A;  5L8I A;  3CR6 A;  3WJD A;  1GT3 A;  4ON1 A;  5B5G A;  1ZNG A;  5C0N A;  1I9H A;  4LQZ A;  1PM1 X;  1GKA A;  1OBP A;  4ORS A;  5F2B A;  4UU2 A;  1IJ8 A;  4TLJ A;  3D97 A;  3MX7 A;  5D8J A;  4YBP A;  1HBP A;  1SWG A;  1QQS A;  2GJ5 A;  2MM3 A;  3B2I A;  5LJK A;  5AEO A;  5HTE A;  3TGB A;  2BC3 A;  2MF6 A;  4QYN A;  2OYB O;  3BY0 A;  4MIS A;  3WJF A;  1VWR B;  1PEE A;  3Q34 A;  1GKA B;  1NP1 A;  1VWC B;  3C78 X;  2A2G A;  2JW1 A;  4GDA A;  4KC7 A;  4KH8 A;  4MEE A;  4CDF A;  5KIC A;  2N93 A;  2Q2P A;  3QQ2 A;  1YWB A;  2JN3 A;  4I60 A;  2XKL A;  1A3Y A;  1KT6 A;  1L6M A;  1ICM A;  1VWJ B;  4NNS A;  1AVG I;  4QYP A;  4YDA A;  4ZJ0 A;  2X8T A;  3EW2 A;  1E00 A;  4Z2V A;  4Z27 A;  1LIB A;  3FEP A;  3UEV A;  4O3W A;  1KQX A;  1MVG A;  2C1Q A;  3PP6 A;  4YKO A;  1JMX A;  4MVK A;  2AF5 A;  1RST B;  1ACD A;  1BSO A;  1BSQ A;  1RBP A;  4YFP A;  3ZQ3 A;  5EED A;  1CBR A;  1MOY A;  1GGL A;  1GX8 A;  1N0S A;  4YBU A;  1E06 A;  3I17 A;  1SWK A;  1SRF A;  1OEE A;  4GRJ A;  3V8U A;  1BLR A;  3OD9 A;  4BJ8 A;  1VWP B;  2X56 A;  1AQB A;  3WZP A;  4QAE A;  1DV9 A;  3RBY A;  1HQQ A;  2HZQ A;  1W4T A;  1ERX A;  1LCV A;  4GET A;  5B11 O;  2Q4N A;  2FWV A;  2R73 A;  4QQ1 A;  2GTL O;  1I78 A;  2F09 A;  4QRL A;  3T6F A;  2BHV A;  3GE2 A;  4DCB A;  4BX6 A;  4N7C A;  3K3L A;  3KFF A;  1KT5 A;  1KQW A;  1LCZ A;  1VPR A;  1X8Q A;  1BRQ A;  1UYO X;  1JMZ A;  1PMP A;  2AT8 X;  3F9D A;  4RUU A;  4XMG A;  4GKC A;  3BRN A;  3CBC A;  4LKT A;  1N43 A;  2RTQ B;  4R0B A;  4O4O A;  1VWQ B;  5AJC A;  3VGW A;  1KL5 A;  3RDQ A;  4ZR2 A;  2GTL M;  2IZJ A;  2X8S A;  3DTQ A;  3EMM A;  3U9P C;  4BX6 B;  1KZW A;  2AL0 X;  2BSZ A;  4ZHD A;  1SRI A;  1D3S A;  1FDQ A;  2UYW A;  1EUO A;  2JU3 A;  5CHK A;  4IAW A;  4PSQ A;  4O4S A;  4IRW A;  4TNN A;  3VG6 A;  3C77 X;  2RTN B;  1BRP A;  1IIU A;  4JHQ A;  1QG5 A;  1SWO A;  2FHL A;  1OEK A;  2OFM X;  2RTA A;  5AQ6 A;  5BVS A;  3UEU A;  1OSP O;  3B2J A;  3EM0 A;  5LKE A;  3CWK A;  1MEP A;  1LF7 A;  1O1V A;  1STP A;  4EFG A;  5CYB A;  4JNJ A;  3SLO A;  3CKF A;  3TZS A;  1SWB A;  5HAE A;  2AT0 X;  4IMO A;  4UU3 A;  3RE5 A;  5B27 A;  4NYR A;  1EW3 A;  1ALB A;  1JBH A;  3NP1 A;  2IZD B;  4YFQ A;  4ZHC A;  1KL4 A;  1PTS A;  3WZO A;  4AZQ A;  4OS3 A;  3LV4 A;  5H9K A;  4YGH A;  5H8T A;  3DSZ A;  5FAZ A;  1VWF B;  2QO4 A;  1HY2 A;  3RWX A;  4ZGU A;  4Y0Q A;  2QO6 A;  4GJV A;  5AJB A;  5IRU A;  3T2X A;  4AW8 A;  4ZHH A;  4IAB A;  2RTB B;  3FEN A;  4MVE A;  1CJ5 A;  1NBX A;  3CQR A;  4L3R A;  2W2F A;  5B10 O;  2A5B A;  1Y9T A;  4ZH6 A;  3ZW1 A;  3EYC A;  4EEJ A;  3AKN A;  1NGL A;  4FBO A;  4AZP A;  1G85 A;  2CM4 A;  5B2A O;  1I4U A;  5KID A;  5LJE A;  4CDC A;  4EXZ A;  1IW2 A;  3P6F A;  4BCS A;  1NC9 A;  5IRW A;  3D4R A;  4I6S A;  3S26 A;  2FGS A;  2RTE B;  4M6S A;  4ARH A;  1SWT A;  3PH5 A;  1G74 A;  3P6H A;  3ZW1 B;  3L4R A;  4PJ2 A;  1YP7 A;  1YUP A;  2JU7 A;  2KTD A;  2ZAI A;  4CV7 A;  3S5V A;  1OEJ A;  4ORY A;  1KT3 A;  3AEH A;  2HLV A;  4Z2O A;  1OBU A;  2KTS A;  1U0X A;  1WBI A;  2GTL N;  2P8G A;  2RTH B;  3PK2 A;  4C5P A;  5JR8 A;  3KFG A;  3BX7 A;  4OEL A;  4CPE A;  3S5X A;  3RY1 A;  2HZR A;  4HPA A;  5H9A A;  5DG4 A;  4I95 A;  2FS7 A;  3BDR A;  3FEL A;  3Q6L A;  4O49 A;  1B8E A;  5B3M O;  4QGV A;  5CE4 A;  1BM5 A;  1N9M A;  1PBO A;  5EDB A;  1PBY A;  4D6B A;  4U8U O;  1AEL A;  2RTJ A;  4ALB A;  1N9Y A;  4LZU A;  3AUM O;  1YWD A;  1BJ7 A;  4BX5 A;  2GH7 A;  2GC9 A;  1RLB E;  1IKE A;  3MG5 A;  1SLG B;  2WPU A;  5L8O A;  1EPA A;  3D9W A;  5B5F A;  3WBG A;  5FEN A;  2C1S A;  4BOE A;  1TVQ A;  1VWA B;  1KOI A;  1KXO A;  1ERB A;  3HPE A;  4ORW A;  4IB7 A;  4OMW A;  3X00 A;  3BU1 A;  2G78 A;  2WSJ A;  4BX5 B;  2ANS A;  3O22 A;  4U8U M;  1SWS A;  1SWN A;  2Y3F A;  1SRJ A;  1ZNK A;  1EIO A;  1KT4 A;  1S7D A;  1RAV A;  3NPO A;  4NV7 A;  4DQ3 A;  3UEX A;  1P6P A;  5F7G A;  3CMP A;  4WFU A;  2G7B A;  1FJ1 E;  1VWI B;  3T6L A;  3RE6 A;  3EBW A;  1QWD A;  1UYN X;  3P6E A;  3ZUO A;  3RDS A;  2DM5 A;  2WQ9 A;  1TOU A;  3KFH A;  4EKV A;  1LPJ A;  4GJS A;  4KT5 A;  1SRE A;  5HTD A;  1SWJ A;  2CBR A;  2X34 A;  2ACP X;  2K23 A;  4FBV A;  1URE A;  3T2W A;  1A57 A;  2F73 A;  5BVQ A;  2BLG A;  4ORX A;  2AMM X;  3RDM A;  1LKE A;  3ZI8 A;  3CBS A;  2LBV A;  4EDE A;  2OVD A;  1IFB A;  2QOS C;  2PI3 O;  2YMS A;  2JOZ A;  3JQO A;  3RZY A;  5HZ6 A;  4CK4 A;  1U17 A;  1FEN A;  2R56 A;  3PEC A;  4IB8 A;  4O3Z A;  3WZN A;  4A60 A;  1VWB B;  2RTI B;  5HWZ A;  4IAX A;  1RSU B;  3JSQ A;  4GZV A;  2CBS A;  4O4U A;  1VWO B;  2OY8 A;  1LFO A;  1T0V A;  2DJF A;  3BSZ E;  2LB6 A;  3F8A A;  5HA0 A;  2CZT A;  4L1N A;  1Y0G A;  1A18 A;  3AKM A;  4GNY A;  2UZ2 A;  3VG3 A;  4TQ2 A;  3RY2 A;  4YFR A;  1JJX A;  2FLJ A;  3NX1 A;  3TF6 A;  3HOL A;  4B55 A;  3HWG A;  1H91 A;  3CKG A;  4FGI B;  4JO6 A;  3F6Z B;  3PQU A;  3E3C A;  3ELX A;  1DZM A;  3NBX X;  3WZQ A;  1E2T A;  1T8V A;  4NW4 A;  5D4A A;  3RDU A;  2F01 A;  3NQ9 A;  5IO5 A;  4Z6J A;  2AT5 X;  3FA9 A;  1TXL A;  2MJI A;  3NX2 A;  3QKG A;  1TW4 A;  3ZZV A;  5BYP A;  4GD9 A;  1MDC A;  2C4I A;  1Y55 X;  1SXW A;  4RUN A;  3VG5 A;  3B2H A;  2EU7 X;  2OVE A;  4MVI A;  3EBK A;  4COT A;  1YP6 A;  1I05 A;  1EQD A;  5D47 A;  4KII A;  2QO5 A;  3PDF A;  3HWF A;  4GU8 A;  2XST A;  3WJE A;  3FDC A;  1QY2 A;  1SXX A;  4GUZ A;  4HPC A;  2BS6 A;  4NP1 A;  4O9S A;  4U8U N;  4Y0S A;  4YKM A;  1GM6 A;  2HYS A;  2WR6 A;  2FR2 A;  2FHN X;  1VWL B;  1GX3 A;  1ZNL A;  2RTM A;  4GDZ A;  4CSB A;  2NP1 A;  1UZ2 X;  1I04 A;  3STK A;  5EPQ A;  1GT5 A;  2FRS A;  1ZNH A;  1JYJ A;  2AVI A;  2IZA A;  2Z4H A;  3IA8 A;  4JGL A;  4YGG A;  2OFR X;  1WUB A;  3VHI A;  1JJJ A;  1SMP I;  3APW A;  1SRH A;  1S2P A;  2RTP B;  1JQP A;  2YG2 A;  1K3B A;  4GE1 A;  1DF8 A;  1MK5 A;  4IMN A;  3TGC A;  2G8C O;  3NQ3 A;  5DPQ A;  4ORR A;  3CQN A;  2M4L A;  2WEX A;  5HA1 A;  4GGT A;  5IO6 A;  2IZC B;  1B0O A;  1W6F A;  2KW1 A;  3ELZ A;  1OPB A;  3HTY A;  3WJC A;  4I3B A;  3KFI A;  1STR B;  4YVB A;  3APX A;  5CSE A;  3PH6 A;  3WYQ A;  3LHN A;  4MVL A;  5IO7 A;  3FW4 A;  3N91 A;  4ORU A;  1LID A;  3WJB A;  1JV4 A;  4LZV A;  2IZL B;  4DNE A;  2DJG A;  2LA7 A;  1ML7 A;  4QGX A;  1SY3 A;  3PPT A;  3SZH A;  1YWC A;  2L68 A;  1X89 A;  4TJZ A;  3FA6 A;  3KQ0 A;  1I06 A;  1QFT A;  1SY1 A;  5EDC A;  4CDD A;  1LCW A;  1SWH A;  2MHD A;  4O4X A;  5L8N A;  5K06 A;  2ALL X;  1MX7 A;  1O8V A;  1B56 A;  2AT3 X;  2POA A;  3RKG A;  5F1E A;  2RA6 A;  1XKI A;  1SWQ A;  5LJC A;  1KZX A;  4YCE A;  4NLI A;  1SWF A;  2RTK A;  4OS0 A;  1MUP A;  3I0A A;  4BBO A;  3GAQ A;  2VFB A;  3EW1 A;  3OE3 A;  1HMR A;  1HMS A;  4BX7 A;  1JJU A;  2G79 A;  1NQM A;  3FMZ A;  2RTG B;  4WBK A;  2IZG B;  1LDO A;  2RCQ A;  2IFB A;  2JGS A;  3KZA A;  3RDO A;  1EAL A;  1XCA A;  1HXZ A;  1VWK B;  5HCD C;  2QMI A;  1ICN A;  5K68 A;  2I5Z O;  4GGZ A;  1SY0 A;  2K62 A;  3BU9 A;  3VU1 A;  1BEB A;  3EC5 A;  4HPB A;  4BX7 B;  5HZQ A;  2Q2M A;  1LEL A;  2WQA E;  4KCA A;  4Y5D A;  5LKF A;  1W5R A;  3FYF A;  3WVM A;  2Z4I A;  2I5V O;  1EXS A;  5FFH A;  4FBR A;  5D48 A;  4I3C A;  1HMT A;  2RD7 C;  3P24 A;  1KT7 A;  2E4J A;  1U18 A;  2O62 A;  4YH0 A;  1X8U A;  3VG4 A;  2Q39 A;  4DQ4 A;  5HZ8 A;  1VWM B;  1SWU A;  1SXU A;  1ADL A;  1SLD B;  3RSW A;  2CM9 A;  1NDJ A;  3BX8 A;  2KT4 B;  3VHM A;  2L5P A;  2OL8 O;  4ID2 A;  1IKJ A;  2IZE B;  3WJG A;  4NNT A;  1A2D A;  4Y0P A;  4BGF A;  3P6D A;  3FA7 A;  4GH7 A;  4LKP A;  4D6A A;  3FR2 A;  2OL7 A;  2WEW A;  1DFV A;  1HBQ A;  1SA8 A;  2RTC B;  4YGZ A;  5FQ8 E;  4ZH9 A;  1VYF A;  1QY0 A;  2OFA A;  4XMD A;  1DZP A;  3PED A;  2JMB A;  5HCE C;  2FT9 A;  3WYP A;  3FW5 A;  1B4M A;  2QCB A;  3FR5 A;  1SLE B;  3ZWE A;  4WFV A;  4ZFX A;  5HZ9 A;  2LBA A;  4HWM A;  4AZR A;  3U03 A;  2FR3 A;  4N7D A;  5IRA A;  1DZK A;  5LJH A;  4K19 A;  1X8O A;  2IZI A;  1SWC A;  2FKG A;  3VE1 A;  1E02 A;  1AB0 A;  1Y53 X;  3MVF A;  1OBQ A;  3S60 A;  4ML7 B;  1X8N A;  2RCT A;  3SZJ A;  5LJG A;  5D45 A;  1CRB A;  2X32 A;  4NV8 A;  1D2U A;  3IFB A;  2RN4 A;  4O3Y A;  3VE2 A;  3ZW0 A;  4A8Z A;  4OS8 A;  2X45 A;  2FS6 A;  1BBP A;  2LKK A;  2X8F A;  1EI5 A;  1GT1 A;  2OY1 O;  4BQU A;  2RTR B;  1NP4 A;  4XMC A;  1Y9L A;  4BVM A;  3STM X;  2W2A A;  3VHH A;  3KVN A;  5B29 A;  1HXL A;  2BT9 A;  3FEK A;  1OPA A;  1MM9 A;  2KD2 A;  4AZO A;  2OF8 A;  4GGR A;  3ZW0 B;  1GX9 A;  2G5L A;  4YDB A;  3D95 A;  1RXK A;  1X8P A;  1SWA A;  4XMH A;  2AH7 X;  3SLJ A;  1SWD A;  4INN A;  1IFC A;  3O2Y A;  5FQ7 E;  3UEW A;  3ZW2 A;  3OJY C;  3VG2 A;  2LFO A;  4A1Y A;  5EEE A;  2CAM A;  2IZK A;  1CBI A;  1GT4 A;  2IZF B;  2X4M A;  4OEM A;  4I3D A;  2Q9S A;  2ASN X;  2OVS A;  4OMX A;  3SAO A;  2A8G A;  2HMB A;  1O1U A;  3APU A;  3H3I A;  3O19 A;  4GK9 A;  3HWE A;  1VWE B;  2OY7 A;  4O3X B;  4CDE A;  1KGL A;  2RTL A;  4YMY A;  3ZUI A;  4A1H A;  1G7N A;  5L3Y A;  1LNM A;  3P02 A;  1DZJ A;  4ALO A;  4AZM A;  3LTW A;  1T68 X;  1ZRY A;  3RDX A;  1BWY A;  3BLG A;  4CPH A;  4NLJ A;  2A0A A;  1SRG A;  1VWD B;  2RQ0 A;  4WHI A;  5H9L A;  4AZN A;  2X46 A;  2WUT A;  4IB6 A;  4AYH A;  3PQS A;  4ES7 A;  1SWP A;  2RTF B;  2JU8 A;  4YCH A;  4ZHG A;  2BS5 A;  1YIV A;  1JZU A;  2GTF X;  2ZAG A;  3HOE A;  4Z2P A;  1KFF A;  1STS B;  3B2L A;  3FLL A;  1EII A;  2R74 A;  3SOT A;  3T1D A;  1JIW I;  1LIE A;  4U46 A;  4CPH B;  1SXY A;  2Y32 A;  4ZGF A;  4ODD A;  1VWH B;  5EZ2 A;  2RTD B;  5LJB A;  2VDF A;  2OFB A;  4OKA A;  1DC9 A;  4XME A;  2OF9 A;  1N7Y A;  4CPF A;  5F6B A;  4TKJ A;  1EPB A;  3C76 X;  4MIR A;  3U0D A;  1CBQ A;  3APV A;  3WOV A;  4HFO A;  2OL6 O;  2NNQ A;  1FE3 A;  2A2U A;  1SWL A;  3VG7 A;  1CBS A;  3HK1 A;  2A13 A;  4QZU A;  3TGA A;  1SY2 A;  4QZT A;  1LIC A;  1QFV A;  5HZ5 A;  4GNW A;  4TKB A;  3SLT A;  4U9C A;  1FEL A;  3NR3 A;  4U3Q A;  4ZHF A;  1VYG A;  1X71 A;  2OY5 O;  2RTO B;  1N4J A;  2HKD A;  4HPD A;  4TKH A;  3FR4 A;  2QOM A;  4FQB B;  2QM9 A;  5FQ6 E;  3MM0 A;  4I9R A;  1QY1 A;  4XMF A;  2A5C A;  1MX8 A;  1SWR A;  1SWE A;  1FEM A;  4EQA C;  4QNI A;  1BSY A;  2IZB A;  3JS1 A;  3WXQ A;  1DF3 A;  1AVD A;  1K24 A;  1Z24 A;  4IBA A;  3FID A;  2ACO A;  2FKJ A;  1AVE A;  4QGW A;  2VFC A;  2PY1 A;  5F6Z A;  2OVA A;  5LJD A;  1HN2 A;  3FA8 A;  1RXH A;  1RXJ A;  1GXA A;  2AKQ A;  3STN A;  2W2B A;  3D96 A;  1TOW A;  2AT6 X;  2Y3E A;  3BS2 A;  5F58 A;  1SLF B;  3MBT A;  4Z28 A;  1LIF A;  1KL3 A;  1Y52 X;  3P6G A;  4KC8 A;  3UAQ A;  5HCC C;  5IXG A;  1R0U A;  1JYD A;  3OBL A;  5JD2 A;  5KHP A;  3NQK A;  1YWA A;  1E5P A;  5H9N A; 
#chains in the Genus database with same CATH homology
 2MWH A;  3P6C A;  5HBS A;  1ZNE A;  2FTB A;  4ZCB A;  4NYQ A;  1ZND A;  1FTP A;  4I9S A;  3HWD A;  2NNE A;  3G7X A;  5BVT A;  3VPJ E;  2A3F X;  4M7M A;  2WWP A;  3B2K A;  4Y0R A;  1S44 A;  4IB9 A;  2HNX A;  3FIQ A;  2OZQ A;  1QAB E;  2CZU A;  3NAD A;  2L9C A;  1HQP A;  1G5W A;  2MO5 A;  2L67 A;  2NND A;  5L8I A;  3CR6 A;  3WJD A;  1GT3 A;  4ON1 A;  1ZNG A;  5C0N A;  4LQZ A;  1PM1 X;  1GKA A;  1OBP A;  4ORS A;  4UU2 A;  4TLJ A;  3D97 A;  3MX7 A;  5D8J A;  4YBP A;  1HBP A;  1QQS A;  2GJ5 A;  2MM3 A;  3B2I A;  5LJK A;  5AEO A;  5HTE A;  3TGB A;  4QYN A;  3BY0 A;  4MIS A;  3WJF A;  1PEE A;  1GKA B;  1NP1 A;  3C78 X;  4KC7 A;  2A2G A;  2JW1 A;  5KIC A;  4KH8 A;  2N93 A;  2Q2P A;  1YWB A;  2JN3 A;  2XKL A;  1A3Y A;  1KT6 A;  1L6M A;  1ICM A;  4NNS A;  1AVG I;  4QYP A;  4YDA A;  2X8T A;  1E00 A;  1LIB A;  3FEP A;  3UEV A;  4O3W A;  1KQX A;  1MVG A;  3PP6 A;  4YKO A;  4MVK A;  1ACD A;  1BSO A;  1BSQ A;  1RBP A;  4YFP A;  3ZQ3 A;  5EED A;  1CBR A;  1GGL A;  1GX8 A;  1N0S A;  4YBU A;  1E06 A;  3I17 A;  1BLR A;  1OEE A;  4GRJ A;  3V8U A;  3OD9 A;  1AQB A;  4QAE A;  1DV9 A;  3RBY A;  2HZQ A;  1ERX A;  4GET A;  2Q4N A;  2FWV A;  2R73 A;  4QQ1 A;  2GTL O;  2F09 A;  4QRL A;  2BHV A;  3GE2 A;  4N7C A;  3K3L A;  3KFF A;  1KT5 A;  1KQW A;  1KZX A;  1VPR A;  1X8Q A;  1BRQ A;  2AT8 X;  1PMP A;  3F9D A;  4RUU A;  4XMG A;  4GKC A;  3BRN A;  3CBC A;  4LKT A;  4R0B A;  5AJC A;  4O4O A;  4ZR2 A;  2GTL M;  3U9P C;  2X8S A;  3DTQ A;  3EMM A;  1KZW A;  2AL0 X;  4ZHD A;  1D3S A;  1FDQ A;  1EUO A;  2JU3 A;  4IAW A;  4PSQ A;  4O4S A;  4TNN A;  3VG6 A;  3C77 X;  1BRP A;  1IIU A;  1QG5 A;  5AQ6 A;  5BVS A;  1OEK A;  2OFM X;  3UEU A;  3B2J A;  3EM0 A;  5LKE A;  3CWK A;  4EFG A;  1LF7 A;  1O1V A;  5CYB A;  3TZS A;  5HAE A;  2AT0 X;  4IMO A;  4UU3 A;  5B27 A;  4NYR A;  1EW3 A;  1ALB A;  1JBH A;  3NP1 A;  4YFQ A;  4ZHC A;  4AZQ A;  4OS3 A;  3LV4 A;  5H9K A;  4YGH A;  5H8T A;  3DSZ A;  5FAZ A;  2QO4 A;  3RWX A;  4ZGU A;  4Y0Q A;  2QO6 A;  5AJB A;  4AW8 A;  4ZHH A;  4IAB A;  3FEN A;  4MVE A;  1CJ5 A;  3ZW1 A;  3CQR A;  4L3R A;  2W2F A;  4ZH6 A;  1Y9T A;  4EEJ A;  3EYC A;  3AKN A;  1NGL A;  4FBO A;  4AZP A;  1G85 A;  2CM4 A;  5KID A;  1I4U A;  5LJE A;  4EXZ A;  1IW2 A;  3P6F A;  3D4R A;  4I6S A;  3S26 A;  4ARH A;  4M6S A;  4ZJ0 A;  3PH5 A;  1G74 A;  3P6H A;  3ZW1 B;  3L4R A;  4PJ2 A;  1YP7 A;  1YUP A;  2JU7 A;  2KTD A;  2ZAI A;  4CV7 A;  3S5V A;  1OEJ A;  4ORY A;  1KT3 A;  2HLV A;  1OBU A;  2KTS A;  1U0X A;  2GTL N;  2P8G A;  5JR8 A;  3KFG A;  3BX7 A;  3S5X A;  2HZR A;  4HPA A;  5H9A A;  5DG4 A;  4I95 A;  2FS7 A;  3BDR A;  3FEL A;  3Q6L A;  4O49 A;  1B8E A;  4QGV A;  1BM5 A;  5CE4 A;  5EDB A;  1PBO A;  4D6B A;  4U8U O;  1AEL A;  4ALB A;  4LZU A;  1YWD A;  1BJ7 A;  2GC9 A;  1RLB E;  1IKE A;  5L8O A;  1EPA A;  3WBG A;  5FEN A;  4BOE A;  1TVQ A;  1KOI A;  1KXO A;  1ERB A;  4ORW A;  4IB7 A;  4OMW A;  3BU1 A;  2G78 A;  2WSJ A;  2ANS A;  3O22 A;  4U8U M;  1ZNK A;  1EIO A;  1KT4 A;  1S7D A;  3NPO A;  4DQ3 A;  3UEX A;  1P6P A;  5F7G A;  3CMP A;  4WFU A;  2G7B A;  3EBW A;  1QWD A;  3P6E A;  3ZUO A;  2DM5 A;  2WQ9 A;  1TOU A;  3KFH A;  1LPJ A;  4KT5 A;  5HTD A;  2CBR A;  1A57 A;  2ACP X;  2K23 A;  4FBV A;  1URE A;  2F73 A;  5BVQ A;  2BLG A;  4ORX A;  2AMM X;  1LKE A;  3ZI8 A;  3CBS A;  2LBV A;  4EDE A;  2OVD A;  1IFB A;  2QOS C;  2YMS A;  3JQO A;  2JOZ A;  3RZY A;  5HZ6 A;  4CK4 A;  1U17 A;  1FEN A;  2R56 A;  3PEC A;  4IB8 A;  4O3Z A;  5HWZ A;  4IAX A;  3JSQ A;  4GZV A;  2CBS A;  4O4U A;  1LFO A;  1T0V A;  3BSZ E;  2LB6 A;  3F8A A;  5HA0 A;  2CZT A;  4L1N A;  3AKM A;  1A18 A;  4GNY A;  3VG3 A;  4TQ2 A;  4YFR A;  1JJX A;  2FLJ A;  3NX1 A;  3TF6 A;  3HOL A;  3HWG A;  1H91 A;  4FGI B;  3F6Z B;  3PQU A;  3E3C A;  3ELX A;  1DZM A;  3NBX X;  4NW4 A;  1T8V A;  5D4A A;  5IO5 A;  3NQ9 A;  2AT5 X;  3FA9 A;  1TXL A;  2MJI A;  3NX2 A;  3QKG A;  1TW4 A;  3ZZV A;  5BYP A;  1MDC A;  1SXW A;  4RUN A;  3VG5 A;  3B2H A;  2EU7 X;  2OVE A;  4MVI A;  3EBK A;  4COT A;  1YP6 A;  1I05 A;  1EQD A;  5D47 A;  4KII A;  2QO5 A;  3HWF A;  4GU8 A;  2XST A;  3WJE A;  4NP1 A;  1QY2 A;  1SXX A;  4O9S A;  4HPC A;  2BS6 A;  4Y0S A;  4U8U N;  4YKM A;  1GM6 A;  2HYS A;  2WR6 A;  2FR2 A;  4GDZ A;  1JZU A;  1ZNL A;  4CSB A;  2NP1 A;  1UZ2 X;  1I04 A;  3STK A;  5EPQ A;  1GT5 A;  2FRS A;  1ZNH A;  1JYJ A;  2Z4H A;  4JGL A;  3IA8 A;  4YGG A;  4A60 A;  1JJJ A;  2OFR X;  1SMP I;  3APW A;  1S2P A;  2YG2 A;  4GE1 A;  4IMN A;  3TGC A;  3NQ3 A;  5DPQ A;  4ORR A;  3CQN A;  2M4L A;  2WEX A;  5HA1 A;  5IO6 A;  1B0O A;  3HTY A;  2KW1 A;  3ELZ A;  1OPB A;  3WJC A;  4I3B A;  3KFI A;  3APX A;  3PH6 A;  3LHN A;  4MVL A;  5IO7 A;  3FW4 A;  3N91 A;  4ORU A;  1LID A;  3WJB A;  1JV4 A;  4LZV A;  2LA7 A;  1ML7 A;  4QGX A;  1SY3 A;  3PPT A;  1YWC A;  2L68 A;  1X89 A;  4TJZ A;  3FA6 A;  3KQ0 A;  1I06 A;  1QFT A;  1SY1 A;  5EDC A;  2MHD A;  4O4X A;  5L8N A;  5K06 A;  2ALL X;  1MX7 A;  1O8V A;  1B56 A;  2AT3 X;  2POA A;  3RKG A;  5F1E A;  2RA6 A;  1XKI A;  5LJC A;  4YCE A;  4NLI A;  4OS0 A;  1MUP A;  3I0A A;  3GAQ A;  3OE3 A;  1HMR A;  1HMS A;  2G79 A;  3FMZ A;  4WBK A;  2RCQ A;  2IFB A;  3KZA A;  1EAL A;  1XCA A;  5HCD C;  2QMI A;  1ICN A;  1SY0 A;  2K62 A;  3BU9 A;  3VU1 A;  1BEB A;  5LJB A;  4HPB A;  5HZQ A;  2Q2M A;  2WQA E;  4KCA A;  3WVM A;  4FBR A;  5LKF A;  3FYF A;  2Z4I A;  1EXS A;  5FFH A;  5D48 A;  4I3C A;  1HMT A;  2RD7 C;  3P24 A;  1KT7 A;  2E4J A;  1U18 A;  2O62 A;  4YH0 A;  1X8U A;  3VG4 A;  2Q39 A;  4DQ4 A;  5HZ8 A;  1SXU A;  1ADL A;  3RSW A;  2CM9 A;  3BX8 A;  2KT4 B;  2L5P A;  4ID2 A;  1IKJ A;  3WJG A;  4NNT A;  1A2D A;  4Y0P A;  3P6D A;  3FA7 A;  4GH7 A;  4LKP A;  4D6A A;  3FR2 A;  2WEW A;  1DFV A;  1HBQ A;  1SA8 A;  4YGZ A;  5FQ8 E;  4ZH9 A;  1VYF A;  1QY0 A;  4XMD A;  1DZP A;  3PED A;  2JMB A;  5HCE C;  2FT9 A;  3FW5 A;  1B4M A;  3FR5 A;  3ZWE A;  4ZFX A;  4WFV A;  5HZ9 A;  2LBA A;  4HWM A;  4AZR A;  3U03 A;  2FR3 A;  4N7D A;  1DZK A;  5LJH A;  4K19 A;  1X8O A;  3VE1 A;  1E02 A;  1AB0 A;  3MVF A;  1OBQ A;  3S60 A;  4ML7 B;  1X8N A;  2RCT A;  5LJG A;  5D45 A;  1CRB A;  1D2U A;  3IFB A;  2RN4 A;  4O3Y A;  3VE2 A;  3ZW0 A;  4A8Z A;  4OS8 A;  2X45 A;  2FS6 A;  1BBP A;  2LKK A;  2X8F A;  1EI5 A;  1GT1 A;  4BQU A;  4BVM A;  1NP4 A;  4XMC A;  1Y9L A;  3STM X;  2W2A A;  5B29 A;  2BT9 A;  3FEK A;  1OPA A;  2KD2 A;  4AZO A;  3ZW0 B;  1GX9 A;  4YDB A;  3D95 A;  1X8P A;  4XMH A;  2AH7 X;  5FQ7 E;  4INN A;  1IFC A;  3O2Y A;  3UEW A;  3ZW2 A;  3OJY C;  3VG2 A;  2LFO A;  4A1Y A;  5EEE A;  1CBI A;  1GT4 A;  4I3D A;  2Q9S A;  2ASN X;  2OVS A;  4OMX A;  3SAO A;  2HMB A;  1O1U A;  3APU A;  3H3I A;  3O19 A;  4GK9 A;  3HWE A;  1KGL A;  4O3X B;  4YMY A;  3ZUI A;  4A1H A;  1G7N A;  1LNM A;  3P02 A;  1DZJ A;  4ALO A;  4AZM A;  1T68 X;  1ZRY A;  1BWY A;  3BLG A;  4NLJ A;  2A0A A;  2RQ0 A;  5H9L A;  4AZN A;  4WHI A;  2X46 A;  2WUT A;  4IB6 A;  4AYH A;  3PQS A;  4ES7 A;  2JU8 A;  4YCH A;  4ZHG A;  2BS5 A;  1YIV A;  2GTF X;  2ZAG A;  3HOE A;  3B2L A;  3FLL A;  1EII A;  2R74 A;  3SOT A;  3T1D A;  1JIW I;  1LIE A;  1SXY A;  4ZGF A;  4ODD A;  5EZ2 A;  1DC9 A;  4XME A;  5F6B A;  4TKJ A;  1EPB A;  3C76 X;  4MIR A;  3U0D A;  1CBQ A;  3APV A;  3WOV A;  4HFO A;  2NNQ A;  1FE3 A;  2A2U A;  3VG7 A;  1CBS A;  3HK1 A;  2A13 A;  4QZU A;  3TGA A;  1SY2 A;  4QZT A;  1LIC A;  1QFV A;  5HZ5 A;  4GNW A;  4TKB A;  4U9C A;  1FEL A;  3NR3 A;  4U3Q A;  4ZHF A;  1VYG A;  1X71 A;  4HPD A;  4TKH A;  3FR4 A;  4FQB B;  2QM9 A;  5FQ6 E;  4I9R A;  1QY1 A;  4XMF A;  1MX8 A;  1DF3 A;  1FEM A;  4EQA C;  4QNI A;  1BSY A;  3WXQ A;  3JS1 A;  1Z24 A;  4IBA A;  2ACO A;  4QGW A;  2PY1 A;  5F6Z A;  2OVA A;  5LJD A;  1HN2 A;  3FA8 A;  2AKQ A;  1GXA A;  3STN A;  2W2B A;  3D96 A;  1TOW A;  2AT6 X;  3BS2 A;  5F58 A;  3MBT A;  1LIF A;  3P6G A;  4KC8 A;  3UAQ A;  5HCC C;  1R0U A;  1JYD A;  3OBL A;  5KHP A;  3NQK A;  1YWA A;  1E5P A;  5H9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...