4PJ5E

Structure of human mr1-ac-6-fp in complex with human mait trbv6-1 tcr
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
243
structure length
243
Chain Sequence
AGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSVWTGEGSGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 243
sequence length 243
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pj5E01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pj5E02
2A6JB 2NY4B 2IALB 1QFHA 3ARED 4I5BB 4S2SB 4OFVA 3QG7L 4PJIB 4BKLB 2J6EA 1ONQB 4P4RB 5DHVH 3M1BA 4UI2A 1D5IL 4WO4D 5AZ2H 4K71B 3RWHA 2LABA 4HJGB 4JRXB 2G9HA 5EOQH 3O8XB 1H8SA 4OQTL 5GGTA 4WV1C 2ADJB 2Z93B 4EXPX 4RBPH 2IPKA 2DWDA 2X89D 3KXFE 2AJ3B 4U1JA 2AEIT 4ALAL 1WTGT 4X83A 3TFKD 4HHAA 3VRLE 1GGYA 4X6DA 1XMWA 4Z0XA 3BHBB 1TVDA 5CBAA 5L0QC 4ODSH 5FYJU 4NN5B 1YY8A 5CEZH 4WHDA 4HH8A 4F7EB 3TYFB 1S7TB 5TE6H 5E6ID 4NQCE 3E2HC 3OR7B 3KYKL 1F02I 3P4LA 2IFFL 3LCYA 1F6FB 4PJIF 5ADPL 1CK0H 3TLRA 25C8L 1R3KB 2AEPL 2P47B 4O2CB 3PGFH 1MCCA 3RIAK 2XA8L 2CMRL 2YUXA 2A0LD 2QSCH 1HKLL 1QFWL 4XHQA 2NR6C 4FQ1L 4MDJA 4GAFB 1FC1A 4LBEA 3PP3K 3BX7C 2WW8A 5BOZG 4TVSa 2VDRL 4WUKH 1I85C 1T2XA 2D7PA 3D5OF 4OCLC 4PJDA 2XQYK 1VEPA 5TGBB 1T83C 1EIBA 5D7LE 4XNUH 1S5HA 4POZC 4TRPL 2A6DA 3F58L 1T3FA 3OBAA 3ULSB 1T6VN 4KQ4L 3GM0A 5E5RB 5IBLC 4L3EA 4LEOA 5AYQA 5BS0D 5D2NE 1A6AB 2WUBH 2GFBB 1P84J 4M61B 3MV9B 4X7DC 5I1IH 5IG7B 4P3CL 1UQSA 3WMSA 5DR5H 5EU6A 4MA7H 1RIHH 1RJCA 5EULV 3DIFA 3EYOA 1HHHB 3OF6A 3K2UH 3QUYC 4F9PA 4LKXB 4OFYD 4QHMA 2CSPA 2GJ6A 1CT8A 3RKDD 4RGNC 1IBGL 2KQNA 3RNKA 5ISZE 3AS2A 4X9HA 3CPLA 3IYLW 2E3VA 4U6HA 2HLAA 2EE3A 3CUPA 4XNQB 5KVDH 1HHKA 4JFEB 1A7PL 4RWYH 3T09A 4TUKH 2UYLA 4TSBH 3VI4E 3BWAB 1C5BH 5TH2A 1I8LC 2DWEB 5DJYA 5SX5K 5EUKA 5FOBB 4U6YA 3BXNA 4U1IB 4U31A 5FM5O 1YNLH 4P2OD 3BO8A 5IK3A 2LVCA 5KSBB 3WFDL 4R3SB 2BSRA 3HI1B 1JZ5A 5I1DB 4U33A 5TDOB 4EVNB 4P46A 3ZTNL 5GJTH 1A9BB 3FQWB 3T0DA 3DRQB 4WGVB 4DVBA 2VLRE 1T0MA 1CD9B 1VADA 3D9AH 3JWOH 4OD1H 5I16B 1IL1A 4OLUH 1PFCA 2F58H 1MSPA 1MJ7H 1RSFA 2HRLA 2JE8A 4D9LH 3ARSA 4FABH 1KGCD 4I2XB 4NQVA 4PJ8A 3WNKA 1OPGL 3Q5TA 4HFUH 1PBYA 2W0PA 2C7UA 3LAFA 3BEVB 4Y4HB 3BKJH 4YDVA 6CGTA 2F53A 5CEXA 4ELME 1P4BH 1UA6H 5IESL 1S9WB 2DQCL 1ORQB 1ZGLA 1AFVH 3S37L 1XIWC 1HHGB 1KTRL 3GSOB 2HVKB 1XF3A 3RPIA 4QHUB 3O4LB 5CD3A 4GXVL 2PXYA 3L3JB 1UZ8A 2NPLX 4JZNA 3AGVA 5E9DA 1TETH 1EJ6A 4RDQF 3EHBD 2X4OB 5BW7C 4O51A 2F8XC 4OM1L 4NWUL 5C2BH 2RIKA 4DCQA 2BVPB 5JPNB 3L1OH 4LFHD 4AIZB 1TJIL 4Y16D 3QULB 2A6KA 2XZAL 3HMXL 2FL5A 2X1WL 3Q1SL 3WO4C 3M45A 3HCVB 2QEJA 3AMLA 4ODWA 1DLHA 3AAZA 4KMLB 1ZHKB 5KJRH 1S7VB 1QACA 1WIUA 4I8DA 4X6CE 1MFDH 4TSCH 3OJMB 4LSUH 3MJ8A 4Q9RL 4YHMH 3P40A 5DUML 1SYVB 4MHHG 1AQKL 2ICES 1PLGH 3HTLX 4OCRL 2FHFA 2VXQH 4OQTA 3L3OA 2E8YA 4Z7WA 1NAMH 2ICWA 4XP1H 4Y4KC 3BYYA 3CXDL 4I3SL 1F4WH 2DYPD 5TF1L 5D2LF 4FZ8L 3T65A 4F9LA 1DQJA 4LASL 4XP5L 2HJFB 4K3JH 4OTXH 2QKIA 2RB8A 4OFKA 5D7KD 2YD5A 4N0YH 3FAXA 2JK5A 2IANB 2ZCHH 1E4XL 1CLOH 4QHLB 1AI1H 1YC8A 5K9JH 2PYEB 3IVKA 5DQDH 2RHEA 4KH2A 1JPFA 2V2XB 1GGBH 5HTSA 1G6RL 5LAXA 3KPSE 5E00B 4D9RE 3CVHH 4QO1A 4GSDL 1GOHA 2HKFL 4NM4L 1GAFL 4XCEA 5DJDA 4MAYC 4NHCH 4A2LA 5IVXA 3DRTA 3D48R 1IAMA 2R1WB 3OL2A 3QHTC 2ATPB 1KIRB 3I85A 4JFPB 1FN4B 4MDIB 4MSWA 4JAMB 3CFKA 1UVQB 1RU9L 2BK8A 1JMXA 5C0JA 1NH6A 1PY4A 2OZ4L 3U46B 2AEQH 4CMHC 3LHPH 3GMQA 1A4KA 2GTZA 4LEXH 1T89C 1TPXB 1XF5B 3P73B 1MHHA 1U2CA 3B9KA 4LCYA 3GSNA 3U1SH 1YEGL 4G43B 1KCKA 4UTBH 3IDJB 1WT5C 4JKMA 3GRWA 4KKLD 3VFSB 5DS8A 2PO6A 5DO2D 2EIBA 5KW9L 4LLDA 4UILL 2BSSB 2X4UB 3I6KB 4NUJB 5I1HL 1QSEB 3I2CH 1MIMH 1A1MB 4Z6AT 5BZWA 4PJEF 3L3HA 1CVRA 3R8QA 5J0BA 3WV0A 4RQQA 4NO3A 1QBLH 3GUTA 8FABA 1F5WA 3L9RA 2EEDA 4GRMB 4ZYKB 2ZWLT 3WE6A 1EUUA 2O26U 4H88H 1FNHA 4OGYL 3CAFA 3GIVB 5HHMB 1X7QA 2IPUK 3G5VB 3WBDA 1P4LA 3A6BL 4WFHD 2VDLH 1LEGA 3V0WH 3BZFB 1T22B 3T77A 3ROOB 3IXTB 3VFTB 2VISA 5DZNA 4E0RA 2FO4A 2VDKH 2HT4C 4DTGH 3KGRA 3RY6A 2XRAL 1BX2B 5GGRA 3UBXA 4RISL 3QCTH 1NFIB 4HS3B 3OMZA 4LAQH 4R90H 4PJ5A 5DA0B 2BZDA 1H3XA 1H3VA 5JO5A 1P7KB 4KTEH 4EI5B 3L6FA 1XCQA 4XVSH 4NKQB 1H15B 1NBVL 4KGLA 3L3IB 1QFWI 2I60L 4TSAH 3TIDB 1BD2A 1V3LA 2NR6D 5ESVA 2QTEA 3H3KA 2R0LH 4NOFA 1NMCB 3MRPB 1IAKB 2Q8AL 3F7QA 3B5HA 1RMFH 1G9NL 2DF3A 3F6IA 5T5FL 5HHOB 2CRIA 3HPLA 5EORL 3ALWA 5GHWH 1S7QA 4Z7QE 4WENB 5IUSA 4PYGA 3PHSA 3GB7B 4POZD 3MOQA 4EQ2A 3T2NH 2ARJB 3K81A 1P1ZB 4OFIA 4GLRH 5E56A 3ZYOA 4DGVH 5MEQB 5IBLD 4HAFA 4XVJL 4MD5A 2RAMA 1OAKL 1DZBA 3RI5F 4HEME 5KVGH 5EBGA 2NX5B 3NN8B 4ZS6C 5SWSE 1Z2KA 4POUB 2VXUH 5H8DA 3QDAA 4MX7A 3RWFB 1KB5H 2V5YA 1JP5A 4XMKL 1J1XH 1JUFA 3QUYD 4JFFA 3L3DB 4RZCA 4GKSA 4JY4A 2FCBA 2AKRA 4RGND 1EH9A 1EMTH 4CJ0A 2LU3A 3GIZH 4HKJB 3RX5A 4JANA 5FYJL 4QTIH 1XGQA 4F9PC 2UWEA 1ZHNB 1FZKB 3S96B 4BFGA 2MCPH 4LLVA 4XC1L 3IU3A 3NIGE 3S35L 1DQQB 4MCZA 3VE0B 1CGSL 3X3GL 2QBWA 2ITDA 1GGCH 1RZIB 1I8MA 3V95A 2VNCA 4KVNH 2ZCLH 4TTGA 5IHUH 4I4WB 4OZFH 4PY7A 1U8MA 2OQJA 2BERA 1IM9A 4M00A 2BCKA 2GK2A 2I27N 1C5DB 4WRLA 3NTCL 1VENA 3WKMH 1K4DA 3OKLA 5J9PA 1T1XB 4LHUB 3BP7B 2D9CA 2ZJSH 5DVNA 5JIKA 3WN5B 3FMGH 4NN6C 4TOYL 4U1NB 3CFIC 1T1WB 4MNQA 4IMKA 3S7GA 2DIAA 5E8EB 1ZTXH 1J7VR 3S5LG 2FBJL 2HT2C 3D39A 3QG7H 1WITA 2C1PA 4NZTH 1AH1A 5JXEA 4U3HA 4JZOB 5CMAA 1AGDB 4KFZC 1IGFL 4XCCH 2N56A 1NDMB 4NQSA 2ZUQB 3V0AC 2NY5C 2HJLA 4NM8H 4FQQB 3JWDL 5C9JA 3WJJA 1G6RA 2GAZB 1Q9WA 2GSIA 3H42H 3B9DA 2R1YB 4U1GB 4PJ8C 3H3PH 3BD5A 4HQQL 3W82A 4LLMA 1RD6A 1XIWD 5F44A 3KXFD 3VFRB 2ZZUT 3IT8D 4WDIA 4OD2A 1OW0A 1KPRB 2JCCA 3UXFA 1QBMH 4PJ7F 2OZ4A 1MAML 5ADPH 3W11C 4KHXH 4HBCL 3B4NA 2AEPH 4DUWA 3H8NA 3LN9A 2OP4H 2PXYC 3MLYL 4LF3A 4O02H 1AHWC 1KV3A 4PGJA 3KPPA 1YUHA 4FQ1H 2ADIA 3UC0L 1EHAA 1V3KA 2Z8RA 4OKVB 1NGXB 2CJUL 1IKFH 1A02N 5EU7C 1QFUH 1JYNA 1JBJA 1QLRB 4IRSB 4NFBA 1AGCA 4XVTH 5BJTA 2CRMA 3T0EE 5CD5C 3NZHH 4O2EB 1IC4L 5HSFA 1RK0A 3QXVA 3C5JA 4RGMB 2Y5TA 1MCHA 3DGGA 5J6GA 3G04A 2BNQB 4XPAL 2ITCA 3T3ME 4Y4KD 2DD8L 2WP3O 3DURB 5CIPH 4IRJA 2Q1EA 4DQOL 4LSSL 2ZCKL 2GCYB 5LWYL 1RJLA 1MCBA 3MCKA 4FNLL 1GYAA 1E4WL 4YHPB 5FGCE 1E4XI 4BM7A 1GOFA 4JRXE 4IOIA 4S10A 4XPGH 5D7SL 1IBGH 1BBJA 4EUPH 5KSUB 4PRPA 5F7MC 4S1RH 1MCOH 3MNWB 4DKFH 3WO3B 2GJZA 2P48B 1S7XA 2FD6H 3D18B 2AQ2A 2EE9A 2FYYA 3GJEA 3INUL 3QHFL 1PSKH 5JUEL 4JHWL 1ZKAA 3HKFA 5EZLB 3MV8D 1IKNA 1NBQA 4MAYD 4NO0B 2XICA 2BRRH 4RAUA 2Y36L 1KB9J 3QXAA 3QNXA 5IFAH 4C56D 4J8RB 1MCEA 2BOBB 3HC0B 3STZB 1OB1B 4HH9B 5LQBL 1U8IA 4KK8C 2Q8BH 4QNPE 1QLEH 4KKAC 4P3WA 3WFDH 1SMAA 4D3CL 4P5TA 3GBNH 5T1DH 1ZHBA 2YC1B 3PL6A 5CSZB 4PJFA 4B41A 3C5SA 5D1ZA 4BZ2H 3HAEH 4DKEL 1K5NB 3FQTB 5MI0C 4E9LA 1KIPB 4N1HB 5I18H 2DI8A 1EFQA 1ZS8B 1U9KA 4HC1H 1KJVB 3DARA 3SN6N 2PCPA 4CL7A 5CZVL 5JLZA 1CL7L 3PJSB 5C71A 3FOMA 4H1LH 3LD8B 3EO1A 3EOAB 2PO6C 1CDCA 1CFNA 5HGAA 2EZ0C 4PRNB 5HJ3B 1E6OH 3A0OA 2H32H 3PGDB 2ZOKA 2FR4A 2G60L 1ZLVK 4W81A 2YUWA 1UM5H 5CILL 5A40E 3BMVA 3ESUF 5M95B 4L29B 5C0BB 4WI9A 4X98B 3TO2A 4ZFGL 5T1KD 1MCQA 4L8SA 1S9XA 3IFNL 3ZKXC 1L0YA 2LFGA 4JFOA 2YD9A 1G7JB 3QT2A 2Q7NA 1XGYH 4NSKA 3JV6A 3TA3B 1FFNB 3HR6A 3RY6C 1TJIH 3SKMB 3F7PC 1WBXB 1P84K 1OP9A 2A83B 4JFEE 3KPOA 3QQ3A 3KLHC 5ILTL 4G9FA 2D7QA 3MBEA 4RSVA 3W2DL 1DDHA 1HILB 2FNBA 1FVDA 3IRPX 1UB5B 3EYFA 5I17A 1IEBA 3AC0A 4QCIB 3NFSH 4YUEH 1U6AL 3NZ8A 3V5DA 4MZ2A 2BOCA 1BEYL 3EO9L 3L5WA 4P4KA 3V0VB 5KSBE 4JO3H 2BVOB 2RFXA 3O11A 1LO5B 3WFBH 1KXVC 1L7TH 4OJFL 4HUUB 4UQ2A 3P77B 5KAQG 4FZ8H 3CPLB 1B2WL 4DGYH 5E6YA 4AIXA 3U82B 5BCAA 2NY3C 1I3GH 5DJAA 4ZS6D 1DN0A 1S3KH 4K8RC 4HIEB 1JZ4A 2AJUL 4L3ED 1WWBX 3LN4A 4I2XE 4XC3H 4Y1AB 3UYOD 5TH2B 1IGTA 3G6AB 3HC3H 3DETD 3D25A 4XAKD 1CFTA 1F11B 5ICXA 4EI6A 3MJ7B 3ROLA 4HGWA 5EUKB 4U2YA 5EU6D 5IB3B 5DC4B 3S6CA 3CLEL 2GY5A 3BO8B 1S9VA 5IW6B 3GKZA 3OF6D 1MCRA 5E03A 5GRUH 3KPMB 4OCSL 2GJ6D 4G8IB 3O4LE 1AKJB 1G7HB 1RU9H 3GSXB 3NOIA 1S5IL 1A6VL 1U3HA 3TC9A 3WHXB 5I15H 1S7RA 4L9LC 1RJYA 3DMMA 2X4PB 5FM8A 3MLVL 3TM6A 3L7FB 4E41B 1J05B 1MJJA 2R4RL 5TE4L 3HRZA 3V52L 4NN5C 5E2TL 4UZGA 1EEUA 2O5XL 1KENL 3VFUA 3V5KA 1M7IA 5T1LD 1UWEL 4JFDA 2O93L 1I8KA 3LH2H 5HHVH 5CJOL 3DX6B 4ZNCD 4X8JA 3CJJA 3U4EB 5KW9H 3EYVB 2HT2D 2QJDA 1IMHC 1SM3L 4OT1L 1YQ2A 3WFEH 2D3VA 1P69B 3GEWB 43C9B 3LIZH 2CUMA 2EKJA 1MPAH 4IMKC 3BKYL 4QLRA 4G6KL 3TBTA 1GL4B 4JZNB 1X6NA 2Q87A 5JXEC 2XWJA 3WL9A 1LMKA 2R1XA 1HCVA 5D1XB 3SKNA 4O5LL 1JJUA 3TNMB 3A6BH 1K9TA 4JDZA 4LMQI 5FYKD 4OIBA 4PJ8D 3UEZA 1S9KC 4OV5A 5CZXC 1IGIH 1EO5A 2PKDA 3G6JF 4BQ9A 5C0IB 4WHYG 3LKSB 2F53D 3WJJC 1UC6A 4N0UB 1FFQA 3VDAA 2P8PB 2IANE 4I13B 4QRRB 3DUHA 5GRVL 3FO2B 1J88A 4M6ML 1D9KA 1JPTL 2X1XR 5F89B 1IC5H 3W11D 2V6HA 3D3VB 4QXGH 1KLUA 3RZCB 3BP6B 5C1MB 1CG9B 2PXYD 4KUZH 3VCLA 1IE5A 1OW0C 3JXAA 3TCXA 4GRLB 5HYFA 2I60H 3QUXB 2CK0L 1JIBA 4MXWL 5E9DD 2DICA 3VFPA 3SDYH 5I66A 1DUYB 1NGZB 2WUCH 3BGMA 1ZOXA 3AXLB 4ZPVA 3UJTL 3C2AH 4Z8FH 1FL6A 4R26H 4KKBC 1IGML 1CLYL 1G9NH 2P24A 3LQAL 4Z95L 5MENB 1WBZB 3D0LA 4OBSA 5T5FH 4NOBA 5HGDA 5JW4N 3MRHA 4RMRA 4PGCB 2XACC 3OZ9L 2Q76B 2FJHA 5CD5D 4ZTPL 3MGOB 4OF7A 3PDOB 1KJ2B 2BHZA 3LPGA 3EW3B 4LLYA 1JFQL 4YDKL 3PWPA 1K4CA 1I1RA 1I7TA 3A67L 1ZVYA 4V2BA 2ED8A 5C08A 2JIXB 5E08L 5TF0A 1OAKH 3UMTA 5LAXB 5IGXL 3QEHB 3WXVL 2XG5A 5JOEA 2FX7H 4HKZB 1KPUB 4HUXA 4LMQE 1NGYB 3IJHB 1I3RA 2YN3A 4HJJL 2Z4QA 1QSEE 2FLBT 1L9MA 5JORB 1XH3A 5GIRA 4JQIL 1RZKH 3PIQB 1G7QB 3C08H 4IRJC 3ULVF 4Y4FA 3AU1A 5EA0H 4NRYB 1I9JH 4NWTH 5FO8A 4HX1B 4RA0C 2EYRB 1QQDB 3S34L 4WUUB 4P3DB 2V5SA 2DQEL 1BZ7A 5IHZB 5BZDA 5TPWH 2FDBP 1C08B 1N0LA 3VFVA 5IMOA 5L2KA 3S97C 4QRSB 1I7RA 5K9OB 4LKCA 1HYSC 1F2QA 2VLJB 3ALXA 1CE6A 5ERWA 4JY6A 4BELD 5BV7B 3BIKA 4QTHA 3SJVB 2DLFH 5BVPL 2BNUB 3GI9H 2Z35B 3QIWB 1BVKA 2R56H 5F1NA 3OXSB 1FGNL 3MCG1 1IKNC 2XV6B 4KK8D 3ARYA 4ZTOL 1FBIL 1QR1B 5F70A 4KKAD 4QRPA 1R3LA 4WFFE 3L3HB 3S98A 4X4YB 1QYGH 1HXYB 1ZWIA 4DEPB 3PQYA 3MV01 5HYJB 5C0AE 1JV5B 2HT3C 4P5TC 1EPFA 4KRLB 1BIHA 1LO0L 3PL6C 3S5LB 3VI3E 4F7MB 1A14L 5EB9A 1CL7I 5D1ZC 3TBWA 4KY1L 5HHOE 3KVQA 4E0RB 1ETZB 5CWSB 4AL8H 3CLFL 4PJGA 4HFWA 1BLNA 2PO6D 2EZ0D 2AV7A 2H3NA 1UXSB 2IBZY 1X9QA 1QSFB 3W9DA 3DROA 3SE8H 3VD9A 1P2CA 4OLXH 2ZSVB 2AK4A 3GGWA 3KPRA 2XZCL 4LCUA 1A9EB 3MLTA 1U8JA 3QWOB 3UYRL 4BK4A 5DT1L 3HC4H 5F1IB 1U8KA 4FFZH 2CR6A 1V05A 2SEBA 1W0WA 3SY0A 2NX5E 4A2MA 1PJ9A 1G1YA 4JLRA 4M3JA 4LCWE 4GS7C 4CADB 5HGBA 3UTSD 1Z6JT 1T20B 1XGPA 4G6JL 3LKRB 2AAVA 4L8SC 2LU4A 4JJHA 5DI8B 5DJ0A 3GKWL 1DN2A 1XF4B 1HSAB 3HE6A 3MLYH 4PRIA 1U8QA 1XF1A 1XGUB 4XCFH 1LE5B 3O2WL 4I77L 4BQ6A 1S8DA 4WW1B 2YPVL 3EOBB 3N1MC 1DTUA 5L7XH 4OCXH 4JPVH 4R96B 3KLHD 1SVZA 1RVFL 3KAAA 5IMLB 3ZKQD 1EZVY 2GHWB 4PJ5D 3VGFA 4R7DA 1EGJH 5C09A 4LLAA 4XP6H 3BPNC 2FWOB 4HKBB 3MRLB 1YN6A 3VXUB 1JHTA 5CGTA 1BD2D 1MRDH 3MBEC 2DKMA 4GMTH 1B4JL 4M1DH 4K2UH 2DD8H 1FNFA 1A1NA 1EEYA 3JSSA 1A8JH 1II4E 3ULVL 4HGKC 2VL5B 3K1DA 5EO0B 1MFCH 4NHUA 2OMBA 4JN1L 3FOLB 5EU4A 3IDYB 4JANB 3JWDC 4MJIE 1HEZA 3MGAA 2XA3A 1WZLA 4LLVB 2NY3D 1KJ2L 4K8RD 3JBG7 3U30B 3VD5A 4JDVB 2NXZC 1YMMA 4JGJA 1LE9A 1KPVA 2NY7L 4LAJH 4ZUVB 1MWAB 3PABA 3INUH 5MERA 4MA3A 5D70L 5DMKA 1BIIB 4I18A 5EU3A 1W72B 4TQEL 1BGXL 4JFFD 3T1FA 4XCNA 1G0YR 2IQAA 4G8GB 3V6ZA 1GGTA 1T2QL 2MTPA 2XG4A 3TV3H 5H94A 5IB1B 3VGGA 4KI5E 1FIGL 2IFGA 3JV0A 1OAXL 5I1GL 1OD9A 2DRUA 2EDOA 5KS9B 1SJXA 2EH7L 1QVOB 3MROA 1INQA 2K1MA 2X7LB 2R29H 4X5WA 1WAAF 2CDGB 3BGFC 1U3HC 5HHNA 4OIIL 2E5EA 3DMMC 1BFOA 4HKXA 2C26A 4XGZA 3TZVA 1ZHLA 4F33A 5CZVH 2CKNA 3RFZC 1GJIA 2XTLA 1Z5LB 4ONGH 3MJGX 5DRXA 4EI5C 3WHE0 4RAVB 5FYLE 1XAUA 1FV1A 3ES6B 4JRYE 5EPMA 2FO1A 4YXHH 4MNQD 1X5FA 5DK0A 3UJIH 1PQZA 1DUZA 3HZKB 3D39D 2ZG2A 1Q0YL 1IQWL 5JXED 2BNQE 2CGRH 5F3BB 4X9BA 5F9AC 3MXVH 4ZFGH 1BJ1J 5FB8A 3WD5L 4ODUA 5CZXD 3PHQA 4UDTB 1P7HL 2VZ1A 1KEMH 4AEIH 1JZ8A 3CMOH 1A5FL 3VXRB 4LRNL 1KLGB 4JM4L 1H0DB 4M7JH 1AO7E 3HS0A 3MV9D 4EOWH 4G9DB 3FQXA 1DBJH 3MA7A 4IS6A 5HVHC 2OL3B 4HDIA 3G9VA 1IRAY 2W60A 7FABH 3OKEB 4AENB 2E7CA 2AJXL 4YHZH 3HNTH 3T0AA 2B4CL 7CGTA 4QXUL 5DD6A 4FQCH 2HMIC 5FUCC 4YBHA 1D9KC 2J88H 3OKKB 4YR6B 4BJLA 1M6OA 5JQHC 5IEHB 2UZYB 4M6OL 3V7AG 4PLKC 4KKBD 1QFPA 1U8OB 3WFHA 1KF9B 4QT5B 3ZE1E 1JNNH 4CRPA 2CIIA 4KRNA 3G6JA 3OHXB 3OSKA 4R0LA 4WCYH 3U9UB 2IH1B 1PYWB 1XGTA 3MLUL 4C4KO 2GT9A 1BBJB 1BMGA 4Z9KB 4PRPB 5ALCL 5DJZA 5FYLH 4NDMB 1ZVSB 1KB9K 2A1WL 1R3HB 3I6GA 3VXNA 1S7XB 2G5BA 1ZGLM 1TJHL 2LE9A 1A7QL 3CVIH 4XWOC 4MD4A 2CLRA 1C16A 1ZANL 4MHHI 4F7TA 4IRJD 2VDMH 2ESVA 4U7MA 4V1DB 3D0VA 3OR6B 5D6CB 4X4ZA 4NQEA 2X4NA 2B8OT 3H6JA 3MOBL 4OCSH 2CXKA 4UINL 3CC5A 4Y4FC 3FRPG 3C5SB 5C6TH 2IGFH 1HYSD 2ED7A 1JWMB 3ZDXF 4FQPA 5FDYA 4UOW0 1Q94A 5CGYC 3BE1L 5I73C 5TE4H 3EDFA 3U6RA 1OARH 3UTQA 4NIKB 5JZ7C 2P5EA 2B2XH 1QNZL 1RUAL 4PJDE 4Z76A 2FX8H 5MP6L 1W72L 4PRBB 3PWVA 1MLBA 3MUGB 4HS6B 3W0WA 3LB6C 4C83A 3D69A 3HG1B 3EYQC 1VGEL 1U8LA 3CMGA 5HPMB 2HT3D 4OT1H 4P5TD 4U1MA 1JHKH 2M2DA 2J6EH 3PL6D 4MNHB 1GPOL 2I9TA 4EDXA 4U6XB 5JHDA 5DMIH 1LEKB 1LGVA 3MRKB 5D1ZD 5C07A 1J18A 1JYXA 4M1GH 5B22A 4ZODA 4IRSC 5E2WL 3L7EA 2A73A 1D5MA 4JFXA 4RIRB 5GGTH 3V4UL 3BPOC 5F9JA 2Q6WB 1B0WA 3SKOA 4MB4A 3C5ZA 5F8RC 1XR9B 1TMCB 3ARGB 4LSVL 3KPLB 3IDGA 4D8PA 4CN4A 4RGMC 5D5MA 1U91B 5KTEL 3CFBA 5MHSD 2FH8A 4IOSD 2DQHH 3ISWA 2N7BA 3MRGA 1JTOA 1KCRL 4DKDC 1BECA 5DDHA 4H20L 5EZOL 4DN4L 4PLOB 4Y1AE 3ARUA 3I6LE 1OL0A 1E4KA 5DRNA 5HPOA 5ENWA 2WBJA 1PG7L 3MV7B 5FYJD 3PGCB 3EYFB 1QBBA 3BEWB 4MQ7B 1H3WM 2DKUA 3U0TB 1OGAA 1FZJA 1C7SA 3V5DB 1QLFA 3QO0B 2PYED 1JGVL 4UU9A 3WUWG 2VH5H 1C12B 2XN9A 3HE6C 2YS4A 3WS3A 1CLYH 3LQAH 5CLWA 4Z95H 2X70B 2E6PA 3ELAT 4YWGL 2EIDA 3NAAL 2WV3A 1J8KA 4E41E 2OL3L 3OZ9H 1IEAA 3REVB 1MHPH 2ENYA 1TCRA 5DVMA 3LV3B 4G9FD 4UUJB 4WWKB 3MBED 1G7IB 4MQSB 3U9PH 1JZ2A 1X4XA 5F7EL 3FFCB 3RBSA 1ZT7A 3T2QA 5FKPA 1A0QL 5ICYB 1YPZB 5GGQL 2V9TA 2YRLA 4CU7A 1NCNA 2R0ZL 5FM4A 5FUZH 4P4KD 4LLUA 3EFDL 2EDKA 4HJJH 4IHOB 4JQIH 3THMH 3SQBA 4O9HL 4AM0B 3QDJB 2VERN 3ARQA 4N5EC 2ORBH 5TQ2L 1AJ7L 5JW4Q 2I07A 2NXZD 3HUJB 3ZDZF 1BZQK 3KDMA 1Z3GH 3MXWH 4U1SB 3WLWC 3BH8A 5L88L 3UTTA 4F3FB 4GT7A 1BOGB 5J1AA 3N85L 4FTVA 5KSAB 3DECA 4DOHB 1RIVL 1VFAA 2APTA 4ZFOB 5LBSL 4R6UA 4MA8L 5B21A 4HEPG 4N0UE 5HHMD 4KDWA 1HCFX 5KSVB 4LP4A 2R2EA 3LEXB 5EOCH 2ZUYA 4HW6A 4QRRE 3VWJB 1YPZF 4LVNB 4ZTOH 4HWUA 3VXPB 5CEYB 3WIIH 4JVWA 1OY3B 4TNWF 3WCYA 2MQ0A 1U3HD 1MFNA 3QXDB 3HFML 4ZQKA 3DMMD 5EBLB 3U36A 4Y19B 5JXAH 1GCFA 3RUGA 5IM7B 2XWJB 3RL1B 4JFHD 1X5KA 3HUJF 4L4VB 2O5ZL 3ARDB 2WP3T 1OF2A 4EI5D 5MENE 1BZ9A 4QF1A 3DI3B 4ZO7A 1SHMA 1FE8H 1BQHG 4JFDD 3T3PE 2VZOA 3KYAA 4KQ3L 3TZVC 2KBGA 3ZLQC 1K6QH 2GSGA 5I8CB 4GW5A 2H6PB 2R2HB 4M5YH 5C0RH 3TYGL 1DQDL 5IB4A 5JHLL 3LSOB 4KDTC 1BAFL 3GFUA 3LS5H 4AJ0A 1MCKA 2WWMD 5KOMC 5DEFB 5I9QC 3T8XB 3G08A 2J7LA 3VFWA 4Q0XH 3K8KA 1Q72H 3P4OA 1EA9C 1X5GA 2H45A 4G6JH 1CFVH 4YBQC 3CDGA 3PWNB 1U8NB 2P24B 3IAQA 5CP3A 3U0PA 1D6EA 5GJSH 4WUUE 3DVNA 1AXIB 4J3VA 4Z7VA 4X6FA 5FHBL 4MNGA 2VIRB 2OCFD 4MD0A 5F1SA 6FABL 1AY1L 2VLJE 4G6AC 5JQ6L 2HMID 4DGIL 1D9KD 1LO4L 1HDMA 2UZIL 3SJVE 4PV8A 3V6OC 3BD4A 2AJZA 3NACH 4PLKD 5CUSL 1YEJH 1WK0A 4BH8A 2WINB 3IFLH 4X4XB 4NCDA 3UTPE 1YEFH 1B4JH 5C0FB 4FFYL 4ELKA 1EO7A 4K9EH 2J8UB 5FO8B 1RHHB 5DTFB 3S9DB 5HYJE 5FK9A 1PEZA 1EAJA 5HI4C 1NCDH 5INCA 2DQJH 3AB0B 3FTGB 4GKZA 5GRYA 3PWPD 5DUBB 4XWOD 1TTGA 5C08D 4YXLL 2EEAA 3WNMA 3QSKB 3RX8A 4Z77A 3S88H 1QSFE 1KC5H 4GBXA 1KG0B 5LGHH 3LVEA 3CFEA 4PJBA 4NUGH 1LO3L 3G5ZA 3HB3C 1FDLL 4N8CL 4ZDHA 4B7LA 4PPTA 2PR4L 4NQXB 2BNRB 1PG7W 1CD0A 5DEGA 5DF0A 3Q0HA 2J3SA 3PWJB 4Y4FD 5JR1H 4AG4L 3WXWL 4PRHA 4QEGA 2NTFB 1FIGH 1KIQA 2J8UF 3NCFB 3GSUB 3IAGC 1A7RH 3X11B 1JGEB 5L2KD 4K7PL 5CGYD 4WI3A 4CN6A 1JF1A 3SO3C 4NKIL 1U95B 3MV11 4PGDA 5JZ7D 2GY7B 5D8JL 2YWYA 4PRDB 3P4MB 3OGCA 3LKOA 2R4SH 3T4AB 1B0GA 4AEEA 5BV7H 3GRWH 5KN5B 1KCLA 4TNVK 3CZFB 2AV7B 5I75C 5C3TA 3LB6D 5FUOL 2Y07H 1F97A 3EYQD 4Q74A 2AK4B 2HN7A 3MOAH 4GQ9H 4R4FL 5DURD 5F3HA 4GRLC 5GGSY 2P4AB 2VLLB 3FHAA 4XNZB 2YMXL 5JNYA 1PW3A 1TNMA 2HKHH 2CRYA 1S7SA 3ULVC 4HXAH 3VXUE 1NANI 5DRZB 2W65A 3SGEH 3G6DL 3D85A 4IRSD 3LQZA 2IH3B 4BUHA 1F3JA 4JM2B 3FCTB 5EZIL 2VWEE 5L2JA 1T1YB 1K8DB 5TE7H 4QRQA 4ODXB 2X4RA 5A2JH 4PJCB 1DL7H 4N0CC 2EDRA 1QPXA 1WAAE 3ZO0A 3DX8B 3H9SB 2YRPA 4JPIA 2NW2B 4JM4H 3C5ZC 5D6DC 5T1MA 4GH7B 5KG9B 3OB0H 3KPRD 3U0WL 5EFIA 2H2PC 2B20A 2CKBB 2HP4A 5JW4R 1KCUL 3GBMH 3O0RL 3S4SA 5ADOL 4KZDL 1ES0B 4F8QA 1RJZB 2GK0A 3EUUA 1B9ZA 3NH7H 1EXUB 2EC9T 1AGFB 2ZUUA 2ZUSA 3OAZK 3FO9A 5EBWB 4TVPL 4UAOB 1HIML 2R8SH 5FF6B 4G6MH 2R2BB 3SE3A 5BVJA 2NXYB 3FT2B 4G8GE 3HE6D 3BQUA 4JM2F 3S36L 4CNIA 4PRID 4EJ1C 2FX9L 5T3XD 1UKQA 2AGJL 1MHEA 4N1EA 5KS9E 5E70A 2XQBH 3VA2C 1QA9B 4WW2B 3U7WH 4ZXBA 5ANMA 1FZMB 1OAZH 3QIWC 3O41A 12E8L 2E27L 3RHWF 2K9UA 3QWQB 3ARFA 4IRZH 5C09D 3RVVC 2JJSA 4K8RH 2VABA 3P11H 1YMHB 4KHTH 4JE4B 3DX9A 4HWEH 4LSPH 1NBYA 5TQ0L 4D0BA 1ADQL 1IJ9A 4DEPC 1CLZL 1HH6A 2Z92B 5ID0A 1INDH 4H25B 1ZANH 3T1FB 1OQOA 3ZZ1A 4CVZA 2P5WB 4OFDA 5I1KH 1N0XL 2A6IB 1OP3K 5J1SC 3GSQB 4N5ED 1JF6A 3BISA 5DFTA 4J23A 3MLZL 1CICA 5INDA 3TP4A 4P49A 3MOBH 4F7PA 2EYSB 3WLWD 2OJZL 4P23A 5DHXB 5EO1B 1O5DT 1TNNA 1FNSH 1I75A 5HHNB 3VXQA 1UCBL 3IXAA 3EO0B 4X7CC 1YMMD 3DVFA 2EDQA 3VXOA 3VXRE 1UCTA 2YA2A 1RUPH 3O4OC 5C0BD 4GG6A 1GZQA 1MREL 5ESQA 5L8JB 3O3EB 5DUPL 4D0DA 1MWAH 5IVZA 4HULB 5D96B 4HPYL 4QOKA 4HK0B 3CFDB 1QNZH 4CMMB 1T7WA 3TBSB 2OJEB 3QJFA 1F00I 1G9ML 1LP9B 2IAMA 4LHJB 4QY8B 1J1PL 2P8LA 2FJFA 4NNPL 2NY0B 3RWDA 2P42B 3MO1A 4LDEB 4WHTB 2ZSWB 3CX2A 1RZFL 4MJ5A 2V5RA 1LNUB 4YHNB 1ZEAL 2HYMA 1DQTA 1JNLL 5EC2B 5EU5A 1D5BA 3SDAB 1VESA 4D94A 5IIEB 1A3RH 3QIBA 1OAYL 3ME0A 1E28A 1KFAL 3FB7B 5L9DL 2AXGA 1I1CA 4GAGH 4P2QA 4P9HL 3K74B 2DQGL 1NANH 2IQ9L 5EOTB 3ZSTA 1RZJL 3LRHA 1FAIH 4IEFB 2DOCA 1T7XA 3TZVD 4PG9A 5I1EL 3BP5A 4JKLA 4XH2A 3BAEH 4A6YB 5I1JL 3ZDXE 3FQXB 4LNVA 2VE6B 4PRPE 3TO4A 5FGBA 1QRNA 5D93B 4TUOB 3M8OL 3FRUB 3GSWA 4JHAH 5DJ8A 4ZFZB 3P0VL 1EHXA 1FFPA 4CVXA 2APVA 1LP9F 3ZSSA 1K85A 5LCVL 2EE2A 1NCWH 3QHZL 2V7HB 4HBQA 1P4IH 3IJYA 4I9WD 3QDMA 3FT4A 3G5XA 4AH2B 4CVWA 4YBQD 3I50L 1FLRL 4V1DE 4TULL 3RKPA 1YEKL 4QKXB 4PJHA 3P9LB 3QUZB 3U30C 4ETQA 3Q6FB 4XNYL 3GHEL 4X6BB 4EEEA 4JQXA 4AZ8A 5CBEB 3FT3A 4U0RC 4G6AD 4N5UA 4M8QA 1RULL 4OLZL 1NCAL 4YWGH 3NAAH 1VCAA 3WUWB 3O2VL 3P9MA 4P2RA 3OAUH 4GKNB 2ZPKH 2OL3H 1MELA 5FO9B 5H2BA 3TN0C 1OOAA 4YXKL 3DUUB 4JHZA 5DZOA 1NQBA 5J1TC 1N4XL 1JNHA 4OB5L 5GGVL 3P4NB 2XWTA 4NNYA 4UNVA 1EJOL 1YJDH 1YYLL 5J11B 5F96H 2Z91B 5DJCA 5F7EH 4X0KB 1C16B 3PDGA 1N6QL 3NIFE 2AV1A 3GZKA 1YNKH 3SDDB 2QQLH 4EKXA 3HG1E 3WSQL 3VRJA 1CGWA 3CSPA 4LPTA 4ZPTB 5FHAH 1HQ4B 2X4NB 2LAAA 5HI4D 4F8TA 1VFOA 1R5VB 5D7JB 1DVFA 5E99H 5I19H 3FB6A 4EN3B 2NMSA 3TVMB 4R2GC 2F54A 2FH6A 4M5ZL 5BMFL 3H9HA 4PGEB 2NYYC 3OV6A 5I8KL 1FRGL 4N9GA 2YK1L 2VLKA 4PREB 4JZJB 1WWAX 1M7DB 3MRCB 3JVGA 3N85H 4YHKH 3E3QC 3NPZB 4Z76B 5I1AA 4XAWL 3IDNA 4K55A 3HB3D 3EOYG 1KN2L 5JIPA 4OCYL 4YQXH 4HCRL 1OM3L 1JNJA 1Z9OA 2DQIL 3CFCH 1MLCB 4Q6IC 3LRSB 3VXSB 5FFLA 4NC1E 5TDNA 1SJEB 2ESVD 1H9VA 1AC6A 1ZE3C 4GBXC 2EDEA 2O61B 2OK0L 1FNGB 3QZWG 4L1HA 4NPYB 3NCBB 4HWBA 4BZ1H 2UUDH 1AQDA 3MV7E 3LMJH 4ZSOA 3KNBB 3EYSL 2F5BH 3MLXL 1YEDB 2WAHA 4YO0A 2FJGA 1SY6A 2GITB 2IWGA 4XPBL 2NTSP 3VFOA 5FGSA 4P59H 4NNXB 3WFCH 5LXGL 3RVXC 5BRZB 4APQB 4J1UA 3BDYL 4RMQA 2VDQL 3DX7B 1TJGH 3BRFA 1XZ0A 3D3VD 5E8NB 1TLKA 1I1AB 1FP5A 4JG0L 4MXQC 4OZFG 3ZDZE 5ESAA 3VRIA 5I2IB 4GRLD 3QEUA 1FCGA 4U1KA 5FKAA 4RMSA 4KQ3H 1SBSL 2W91A 3QH3B 3W0WD 3ULVD 3TWCL 5IOPA 1BQHB 4XNXL 4AMKL 3MLWL 5IB2A 4Z7NE 3DO7B 3RWIB 4ZO8A 2CR3A 2YPLB 4CW1A 4DW2L 4OGAC 1J9CT 3FFCE 1DQMH 5T3ZL 1BAFH 4KAQL 5JHDD 2OX5A 2PTTB 4YHIB 1CZ8H 4Y5VA 2E9WA 5C07D 3PV6B 1YPZE 3FB8B 1T5WB 3MRFB 4FXLA 4LSQH 2LVEA 2AK1H 2X5PA 4N0CD 3OPZH 4UT6H 1JRHL 1G7LB 5TDPA 1NGWA 2Z8WC 5A16B 1RFDH 4XBGA 3C5ZD 5EH1A 1WFOA 3QDJE 5JDSB 2J1KA 4M7KL 4A6YL 5D71H 1UFUA 3NCJH 2DBLL 2H2PD 4OZGA 5I30L 3HUJE 2YD6A 1A1OA 2Y06H 2R23B 2C1OA 3DXAA 3KYMA 3DBXA 4UTAL 1B3JA 1AY1H 4FQJH 4DOHE 1WCBA 4WHYH 2C3GA 3C6LA 5ITFB 5C70A 5C0DB 3JTSB 3UDWC 2PYFB 3IDXL 3L5HA 5FKPB 2J2ZA 1OGAD 4GUPA 2CDFB 2ADFH 5JW3L 1CE1L 3BZ4A 1R5IA 2B1HL 3QDHA 4CBPA 3QXTA 1OT1A 4FQXB 3PXHA 4L4TA 5E6IA 5C7XH 4U6VH 2APBA 4FFYH 3SE3C 1YEEH 1DP0A 3BKCL 4WU7A 2XN9D 3BQUC 2DDQL 3V4VH 3M17A 1CF8L 3MODH 3QIWD 2VXSL 2VZSA 4ORZC 1MVFA 4K94L 5DVOA 4Y19E 5ABDE 5C92A 5MEOA 3RVVD 2D9QB 5FO7A 2EC8A 3O3UN 4P99A 4ZXBC 4YAQB 4L4VE 1JHLH 3SE9L 2BHYA 3DUSA 1JZ7A 3T4YA 4RFNC 1A64A 4NYLB 1PZ5B 5HYQA 5CHNA 4YXLH 3V4PH 2VRAA 4GAJL 2DI7A 4WNQB 4M48H 1JGDB 4LVOC 3UJJL 4ZUSB 1JTTA 4ZUWA 1CBVH 5HYSG 3K4ZA 2MJWA 3BVNA 1N64L 2ERJB 1UXWA 1CS6A 1P7QA 4N8CH 1AIFA 1FG2B 5CKAA 4ZS7H 2FIKA 1CFSA 1BPVA 4PB0L 2OSLB 4XX1G 1CICC 2VDPH 1PKQB 5T5NG 4BK5A 3KHQA 3DVGB 2DQTH 1TZGL 2VSCA 3KPNA 4ODVL 3RA7H 3UTTD 4D0CB 5CJQL 3MLSL 4FTVD 5F7WC 2D4FA 3JV4A 4Q2ZB 4OFYA 2XIDA 3GK8H 2F19L 2K7PA 3ZHKA 3TPUA 4LVHB 2PW1B 3B6SA 1RUQH 2GKIA 3NFNB 1OAQL 4L3AA 2XKSA 5SWZB 2XPGB 3RWEB 4XWGL 4PJXA 5DLML 1IAIH 3MRIA 4MWFA 4C4KT 4BSWA 2K7QA 5IBUG 4Z78A 5L8KB 4M9PA 1QTYT 4TUJB 1BWWA 1W0YT 3GMPB 2VDNL 4WY7L 1LD9B 3NCYP 1ZT4A 3MRDB 2CLVA 1KT2A 4HT1H 1NCBH 5JOPE 3RL2B 4BQ8A 3D6GA 3VJ6B 2YEZA 3QIBC 3DSNA 3SKJH 4HJ0C 4LRIA 4Q9QH 1GVIA 4TPRL 1GHFH 1JPSH 1D5XB 2J8UE 1VKXB 4RA3A 4WFGD 1FSKB 1MFEL 3U0PB 4JPKH 1D6VL 3MNZB 1A6TA 3DVNB 4XMPL 4ZUTA 4EDWH 3JZ7A 3QI9B 4OUUA 1TIUA 2KUTA 3HMWL 3VRLF 3BD3A 4UV4H 1NGQL 5D1QB 3QEQB 4ZD3L 3BKMH 5IBTL 4UDUA 1NPUA 3TO4C 2W9EL 1NBZB 1G1CA 5E8OB 1JCKA 5FGBC 5I76B 4WI8A 3LEYH 2OR9H 1G7MB 1UJ3B 4I3RH 4D9QD 4NQDD 2GIYA 1T03H 4NZJA 1A6UH 1NC4A 1QBAA 4QHKJ 3VFGL 5IMKA 2QQNH 1EEQA 3CGTA 3H0TA 1WWCA 2YZ1A 4OLWH 4YX2H 1HSBA 1N8ZA 1U93A 4QRPE 3FQRA 1FJ1A 2OXHA 4LOUC 2BNRE 3BZDA 5IT2H 3UPAA 1OTUC 1EUTA 3RTQB 1SVCP 4H0IA 1FVEB 4N0FB 5C8JB 4JQVA 2NNAB 3HNVL 3NPSB 5EOQL 5KSAC 4Y2DB 4RNRA 2ZUTA 3QJHA 3IFOA 3F7VB 1YA5A 3MJ9A 2BVYA 3L3GB 4ZAKB 3TN0D 1I7ZA 2DTMH 4JQXC 4AQ1B 4IOFC 5J12B 2F74A 5JA8B 5AAMA 3DOSA 12E8H 2E27H 4XBPB 3UX9B 2DIJA 3GMLA 1HH9B 3QFJB 3TCLA 3WS6A 4PJGE 1CWVA 1X5IA 2AJYH 1XCTB 1GC1L 2BXZA 4ODSL 5B8CB 4OAWB 3KYOA 2EC9U 1Y6KR 3EOTH 4JCLA 2AK4E 5TE6L 5F9WB 5D4QA 4Y7MA 3V6FA 3GJFA 5DEGB 3P3YA 1IC7H 3R0NA 2QQQA 5DC0A 1H5BB 1CK0L 4R2GD 3VXMA 3C60B 4HUVA 4NN7B 3PGFL 5GGUA 4LARH 3LPFA 4JG1H 2NYYD 2XFXA 1LDPH 1PX4A 1TQCB 1HXMB 1KTLB 4NZUH 4FXGA 4PJCE 1UM4H 1PGRB 5CZKA 3KJ4B 32C2A 1I7UB 4XNMB 2DYPA 1CDJA 5J6HB 5DGRA 5I74B 3H9SE 1JN6A 3C87A 3DJ9A 3HZVA 3K3QA 3FB5A 4HWNA 3VI4F 4GBXD 4XNUL 1MJ8H 5ELIA 2WIIB 4FA8A 1MCFA 3IS0X 3UPCA 3O6FA 3SOBH 4DN3H 2X4SA 1DEEB 3HHRB 2N1KA 3REWA 1A3LL 2VAAB 1J1PH 2VZTA 2WUBL 4K3GA 2F9BT 5I1IL 4PRHD 3B9AA 2BSTA 2W65B 4GG8B 2Y25A 4XBEH 3C9NB 1TQBC 5DYOB 4LP5A 4MA7L 1DBKH 1RIHL 4OZ4A 3QFDA 3BW9A 1UWXH 3RVXD 5JDJA 2H9GA 4MZ3A 3K2UL 5GGRY 2QHLA 4JFQA 1ZA3A 5KBNC 1F4AA 4M7ZB 4MXQD 3WYRA 2MHAB 1RZJH 4Y8DC 1QO3A 1B0RB 1ZA6A 3QAZB 1FAKT 4NRZA 4UT9H 3V7AE 1WBYA 2CH8A 4JPIB 5CP7A 5KVDL 4RRPA 3JWNC 5D7IA 4X7TA 4RWYL 3RDTA 1PD6A 3D2UA 5FCSH 3ARBA 4TUKL 1A3QA 3MLPA 2OMNA 4TSBL 2H26A 1HHIB 4OGAD 2VQ1A 1C5BL 3STLA 4ELMF 1FFOA 3O9WB 4QRTA 3P0VH 2RR3A 2FB4L 2E8ZA 2HVJA 1FYTD 3D85D 3FO9B 5LCVH 1YNLL 2E6QA 4B7IA 3DV6A 3QHZH 2ED9A 1JGUH 3GJFK 4Y5VC 1ED3A 2P5WE 1FLRH 4OZIB 1NFDA 1PY9A 3QUMB 2KZWA 4ZOBA 5GJTL 4RFEA 3VG9B 1N5AA 1R3JB 3D9AL 5DJ2A 5T3XH 3DSFH 4BFBD 3JWOL 1SYSB 4LSTL 4OD1L 4XNYH 4OLUL 4LCCA 4L1DA 1IGYA 1J10A 2F58L 1MJ7L 1D3CA 2AXHA 4LFHG 3ARFB 2BY3A 5EUOB 5DSCA 4YGVB 4OCNC 4D9LL 4FABL 2CKBH 1G9MC 1FO0A 4HFUL 4HLJA 1F6LL 3BKJL 4HUWA 5HDQL 3V8OA 4UQ3A 2I5YL 2FRGP 4CAGA 1KJMB 4PV9B 1P4BL 4OB5H 1UA6L 4ZNEA 2A9ML 1XGRB 3TBVA 3C6LC 4F2MA 1LP9E 1AFVL 2HWZH 4B53A 3BQUD 4LIQH 4KROB 2CIKA 4P9HC 3MTRA 4Z7OF 3T04D 5AEAA 4OLVH 1RZGB 4OZIF 5C0CA 5T3ZE 5GGSA 4YPGA 3FO1A 3RWCA 4F7PB 4ZXBD 1TETL 4L8BB 3KWWB 4RCAA 2R69H 2QV2A 3SQOH 1JWUB 3FQNA 2UVEA 4M5ZH 2P7TA 5BMFH 1OP5K 3MJ6A 4JDTL 1IT9H 1JE6A 2BY0A 1Y0LA 3TNNB 1ZSDA 5C2BL 1I85A 3L1OL 5E94B 5EUOF 3MGTA 1UADC 4AT6B 3QDGB 2C3VA 4D0DB 5HXMA 3CSYB 1NEZG 5IWLA 1IQDB 4CN1A 1ZLWH 3RY4A 1XR8A 4UIMB 2XI9A 2XTJB 2DQIH 1T7YA 4H26B 2VO5A 5KJRL 1HKFA 5GRZA 1CQKA 5DHVA 1MFDL 3MRBA 4TSCL 4LSUL 4F7CB 4YHML 3LKPA 2IBGA 5GS0C 1CICD 3V5HA 1OWRM 4GAYB 3GMNB 3CDCA 2VXQL 1NAML 3QZWB 4XP1L 4PLJC 1GZPA 3GDBA 2V2WA 2W0FA 3MLXH 3QUYA 1F4WL 1DQLH 2Y6SC 4U1HA 1QEWB 1FZOA 1S9YB 3X14A 4GW4B 4JJ5B 4PG9B 1XF2A 1D5ZB 4K3JL 4OTXL 1N2RB 4QOKD 4NKMA 3FONA 3GMRB 3KR3L 3QRGH 2EDHA 5E0QA 1U92B 1CLOL 4UAOC 1AI1L 5K9JL 1I9IH 4Y5YA 5DQDL 4IM8A 4OZFB 1GGBL 1MI5A 2WLYA 1LO2H 1I8LA 2VKWA 1KNOB 3K2MC 5GSRA 3CVHL 2EDJA 1RUMH 4KJYA 2HAZA 4GW1A 3QIBD 4NHCL 3U79A 5T3ZH 2YPKB 3QDMB 4MJ6B 4HJ0D 5DK2B 4P2QD 1JK8A 1BFSA 1PEWA 1EAPA 1OSZA 5EC1B 3AM8C 1FL5B 4PJHB 3CCHA 4NQEE 4U3CA 3MYJA 2AEQL 2WSKA 3LHPL 4NKOA 3OXRB 3PWUA 4LPVA 4GXUN 3TO4D 1ZAGA 1QRND 3U1SL 2DBJA 4UTBL 3IKCB 3B9VA 2Z31A 2WQ8A 4KZEH 2P5EE 2DLTA 2XYCA 1TVHB 3QA3A 4M9OA 4NNYB 4X80H 1SBBA 3O2DA 4G6FD 4JB9H 5IQ9B 4LOUD 4YNYA 1MIML 1IVLA 2O5YH 3VXSE 1OTUD 1XIWA 1DE4A 3KXFA 1YQVL 5EIQA 1MUJB 3VGEA 2VLMD 5FA4B 5KSAD 1FNEB 2YSSA 1QBLL 3F7YA 1G9EA 1FVCB 3BKCH 2BVQB 3C8KA 4RBPK 4MCYA 4YDLB 4IOFD 2NY1C 1G7PA 3MRJB 2VXSH 4JQVC 2VDLL 1J8HD 3O6LL 5ECJE 1FC2D 4P2RD 4G8FB 4HMDA 5B39G 1T21A 1AP2B 1LWRA 2VDKL 3ULUE 2FSEA 4DTGL 4HLZG 5SX4H 4NQCA 1HOCA 4ZFFA 1NLBL 3QCTL 3ALPA 5D72L 1T4KB 3WS6C 5EZJA 2FATH 5I1AB 4LAQL 1BWMA 5I1CH 4R90L 4Y19D 5T33H 3UJJH 1ZMYA 4KTEL 4OLYH 4XVSL 4G42B 4ERSH 3RGVB 1I4FA 4G80B 2KKQA 1YN7A 2YPLE 3GHBL 3I9GH 4TSAL 4YZFF 5GS1B 3QG6A 5M94B 3X12A 1UGNA 5HYSB 2R0LL 1TTFA 1ZLSH 4PJ9A 5B4MC 5CIPB 2F54D 4PB0H 5IF0A 1IM3B 1RMFL 3VFOB 5D7LA 5HDBE 4HIJA 4DJMA 1AD0A 5IROA 1OCWH 1MVUB 3JV5A 4BSVB 5GHWL 1CDUA 4J1UB 3RWGA 2VLKD 1Y18B 5AG8A 2ZG3A 4CU6A 2ZUVA 4QGYA 3VWKA 5D2NA 3T2NL 4EUPB 4TVPD 4I48B 4OF5A 3V6BR 4DGVL 5JW5A 3HZYA 3LKQA 2F19H 5FCUH 3O6MH 2Y9RT 1MRCH 3RVTC 3WLBB 5IB2B 3P30H 5H35B 4NO5B 5DLMH 4RMUA 2VXUL 5FECB 5KZCD 5MEPA 1KB5L 3LZFH 3X13A 1L0QA 1J1XL 5ISZA 4XMLH 5IBUB 1WFNA 3P0YH 1BQSA 1C5CL 1EMTL 4K94C 3GIZL 3LN5A 2E7MA 3AREB 3D87B 1Q8MA 1R24A 3KLDA 4BH7A 4XBGB 3MUHL 4NO2A 4BFIA 3ULUH 2V2TA 4RGOL 4IDLA 4EBQH 5HVGB 1S7WB 2MCPL 4JVUA 1LK3H 4WO4B 5F9OH 3O3BB 4OZGB 1GGCL 5B38G 4ONHB 4KVNL 2ZCLL 1RZ7H 3ESVF 1MJUH 5IHUL 1WT5A 4IIQA 3RNQB 4KKNA 2G5RA 2HJKB 3CK0L 3RDTC 1KCSH 3ARBC 5IBTH 3OJ2C 4RMTA 1UB6B 3WKML 2EKSB 3QQ4A 4TN9A 5E1AA 4ETYA 1QSZA 2VLRA 2ZJSL 1AXTH 3FMGL 1NAMA 1GSMA 1NJ9B 2DLEA 1P5VA 3DWTA 4S0TD 4PTTA 4WU5A 4EN3C 3JTTB 4LQ1A 1ZTXL 4K7FB 3GSVA 4PB9H 2L4OA 1X5LA 4NZTL 3O3DB 4EIZC 3OJVC 1VFUA 1MIEH 4JZJC 1CU4H 5FGCB 5T1KA 1PKQE 3SGDH 1NL0L 4AEFA 3HNVH 4XCCL 3RUGE 3NFPB 1UYWH 1EFXA 1F58H 4LCCC 3VH8B 3DXAD 3QNYA 4NM8L 2FLRT 1VPOL 3MRMA 1AGEA 4HG4J 4NBYB 5C9KA 4OZHA 5IW1B 2IG2H 3H42L 3C6LD 1FIEA 3CU1A 1I8IA 3CVHA 3H3PL 1J87A 3FAWA 3KLAA 1KELH 3O45A 1KTDB 1GC1H 1K2DA 2J4WH 2A77L 2JJTA 2Q7YA 2XNAB 5DQ9A 5E2VH 5SWZE 3EGSB 1U58B 3T3MF 4DAGH 2MQ3A 4L4TD 1RURH 2OTUB 1QBML 3V9FA 5F7DA 5BS0B 1A6ZB 1CFQB 2A74B 3HLAA 4KHXL 4U7KA 4HIHA 3LS4H 1L6ZA 4L8CB 2OP4L 4M93B 2ICEA 4O02L 5FGRA 4HPOH 1M05B 4X8XA 4NT6A 2F8OA 5HGGS 3MMEB 1OT2A 1IKFL 4X6CA 1QFUL 4O2FB 4W70A 2N7AA 4FQIH 3SPVA 4XVTL 4Z7VE 5DMGC 4ISVA 4E5XB 5I1LB 3VD4A 5IR1B 5CFHA 4HZLB 3QEQE 2BDNL 5IWLC 1ZV5A 1IAOB 1BOYA 5FDWB 3NZHL 5GS0D 1K8IB 3BPLC 5ID1B 1P7QD 5ALBH 3OJDA 3HR5B 3ARXA 1EHLH 5KVEH 1NLDH 1A3LH 4PLJD 1O7SA 4QNPF 3HPJB 2CLVB 5HHPA 2Y6SD 1WZ1H 5D9SB 4YHLL 1P6AB 1RV6X 4P2OB 1MQKL 4XXCA 2BJML 5E4EC 2OTWA 2QHRH 4YEEA 2RCSL 2XQYG 5HHQA 2MQCA 5KOVC 4HWZB 3MRRA 4E42B 4M6NL 2KDGA 4XPGL 3SDCA 3TBYB 4S1RL 4Z7UA 1MCOL 5GISL 4DKFL 4QHKI 4YDJB 2MOVA 1JF5A 2FD6L 4YEFA 1PSKL 2X9WA 5ACZA 3QFJE 2VJXA 3F12A 1JWSA 4Y5YC 2BRRL 4FQXC 1ORSA 2PW2A 5EIVA 1Q9OB 5IFAL 5T1LA 2CLZB 2FB4H 1BP3B 3BPCA 1JZ6A 4Y5XB 3IGAB 1LK2A 2H41A 2Q8BL 3SCMA 3ZE2F 3GMMB 5GZOC 4G8EB 3PNWA 1QLEL 3OKMB 3GBNL 5T1DL 2HFFA 1ZLUH 2GQHA 3WIHA 3HI5H 3DV4A 5HY9B 1HINH 4BZ2L 4LLQB 4WWID 4P5MA 3UPRB 2AABH 4LSTH 1ACYL 3HZMB 5I18L 3EZJB 1RK1B 2FIRT 4HC1L 3C8DA 5I6XB 1R5WA 2YD7A 1N59B 2NQCA 1X5HA 1MCDA 2FZ3A 3EBAA 2Z31C 1KB5A 4PRAA 3S3SA 1DFBH 1QFOA 4OF3A 3BDXA 1NC4D 3ILPA 4Y16B 4KRPB 5EIIB 1MH5A 5HDQH 2XKNB 1E6OL 2I5YH 3L95A 1JVKA 3T2PA 3IDMB 3NGBB 2G75A 2A9MH 3NCEB 1UM5L 4S1SH 4KUCF 2ZOLA 3T08A 2VUOA 5BXFB 1TXKA 5KSBF 4P57B 2NY1D 3BH9A 4N8VA 4ZMAT 2BFVH 1F3DH 4XXDB 1BQUA 1A4JA 1AHWA 4L8DB 4Q9BA 4K3EH 2DQFA 2R9HC 1T04A 1XGYL 1YYMH 3QEGL 1N7MH 4D2NA 4JDTH 1DCLA 3MLRL 2V5TA 1IFHH 2NW3A 2NY2C 1E6JH 1VGKA 4JN2B 4MJ4A 4ODHH 3PF2A 2HG5B 1T5XB 3OAZH 1AXSB 3MFFA 4HIIA 4WJ5A 3PWLB 3PG2A 1NEZB 1MF2L 4Z0BH 3QNZA 5B4MD 3VXMD 1CXHA 5ICZB 2J8OA 4YC2C 2EIZA 2UV3A 4YUEL 3NFSL 1FSKC 1HQRB 3E1F1 4QYOA 3KPQB 3IF1B 3JWOC 4JO3L 4Z7OE 1KJ3H 5SWQA 3IDIB 2VQTA 4FQHB 4PJ9C 2ARWA 2LAGB 3B43A 3W39A 3TF7C 4PR5B 4OZIE 3WFBL 4AEHH 3RAJH 1L7TL 3CH1B 3FFDA 3HE7A 4XZUA 4P5KB 5IROC 4GLRI 1AC0A 3OX8A 2B5IC 1U8HA 4YJZL 3L3KB 3ARPA 4DGYL 5EO9A 4NP4L 1F4YL 5ANME 3VWKC 5D2NC 3RVTD 5DA4A 3C09C 1I3GL 3O6FD 3KR3H 1G6VK 1S3KL 2HFEB 5EUOE 3SE4C 1ULVA 1WUNT 4XC3L 2AXFA 3HC3L 2FECL 3F5WB 4YFDB 3KYNB 5F1OB 1PAMA 2HH0H 2NY6C 4JKPH 1OP3H 2VR4A 5KVMC 2IMNA 2ZKHH 4JO1H 2ARJQ 1NDGB 4Y2DC 2QR0A 3B3IB 3RY5A 5AZEH 5GRUL 3QBTB 4PJAB 2I9LB 4JO4H 2ADGA 3LKNB 4JREC 3SDXB 1FHGA 3FQUA 3E6HB 4QXTB 5CJBA 2YWZA 5I15L 4WV1B 3ZHLA 5LGJB 4ZUUA 1SJVA 1IGYB 3OKNA 4HV8A 3EFFB 3R8BB 3RDTD 3D2UD 1CD1B 3ARBD 1Q1JH 4N9OB 2F5AH 5IMMB 4Z5RA 4YGAB 2XZQL 3OAYH 5L0QB 5AD0A 4JFZL 3QDGE 4IIQC 4P9ML 3LH2L 5GSVA 5HHVL 1TENA 5IVNA 2L7JA 4EN3D 1ZT1A 2H8PB 1J0JA 4JO2H 1BJ1H 4LNRA 4N8VG 4DFIA 2XTJE 3E2HB 4MQXC 5GRWA 3WFEL 1BM3L 2JB6A 3UYPA 3LIZL 5JPMA 2B0SL 1TQCC 5F88A 2YBRA 1MPAL 1JI2A 1YQVH 2WNGA 3QUMH 2C9AA 4YLQT 4YHYC 3FO1B 3UTSA 3KS0H 5HGHA 5JW4M 5LKNA 3FQNB 4X9FA 3MRNB 4X6EA 3O6LH 1IGIL 4PP2B 3EKCA 5I8EA 1NLBH 2D31B 4M7LH 1YEIH 1AGBA 1OLLA 4QXWA 5B39B 1EBAA 3BUYB 1TZHB 2JKXA 5D72H 5AYUL 4LSDA 1FLTX 1Q9LB 3GNMH 3NA9H 1J0HA 5BQ7B 5KVFH 1N5YH 1F4XL 2JJTC 5F7YC 5BRZD 1IC5L 1RZ8B 3B5TA 4QXGL 1UM6L 3CSGA 2GUOA 4KUZL 2H1PH 5C0CD 2DJ4A 3KJ6H 4M7ZC 4JKWA 2IPUG 3GHBH 3O3AA 2OS7A 3R06B 3HAEA 2X4TB 4POYA 5C0AB 3QDME 3QAZC 3SDYL 3CFJB 5E8PB 2WUCL 3E6FB 1I1FA 3C2AL 3Q3GA 4Z8FL 3T0EA 3GSRA 4R26L 3IRZA 4PJHE 2V7NA 4P2CG 1I1YA 4U1HB 3TIEB 4RGNB 4KTDL 1UKSA 1AD9B 1EK3A 5IFJB 2VMFA 5DMGD 3Q2CA 4H1LA 1U8PA 4ORGA 1T6WA 3MFGB 4ONFH 1BBDH 4WFED 2MPAH 2H32A 2NLJB 4BQBA 1T1ZB 4S11A 1IEHA 2A6JA 1VFBB 2IALA 2Y7QB 4I5BA 4S2SA 1A6WH 4PJIA 1WQVT 4BKLA 2GEEA 1ONQA 5EN2B 4P4RA 5DHYB 4M43H 1MCPH 2FX7L 1INEH 4LCWB 4HJGA 4JRXA 4NJAH 3QIUB 1YZZA 1OSPL 3O8XA 1RZKL 2ADJA 2Z93A 4YH6A 4YZFE 3C08L 2AJ3A 1MHCB 5EA0L 1I9JL 1C5CH 4NWTL 3VI3F 4W6XB 4XXCC 3H9ZA 4L9LA 5EBMB 5TPWL 3PWUB 3BHBA 4RGOH 3HMXA 5CEZD 4R4BB 4TTDC 4L3CB 4H8WH 3BZEB 3SDCC 2ATKB 4F7EA 3TYFA 1S7TA 4FQXD 5DQJB 1MI5D 4R7NB 2IBZX 1IGJB 3OR7A 2DLFL 2OYPA 3GI9L 2YD4A 3CK0H 2R56L 3VFNB 1VACB 5B38B 1HI6B 4JY5H 4I0PB 1R3KA 4O2CA 5GZOD 1P5UA 4HSQA 1WZKA 2YRZA 1QYGL 2WQRA 4LCIH 4DZBB 2YSSB 3SCMC 5E95B 3V8CA 4ZSOE 1SJHB 4AK1A 3G5YB 4MJIB 2BMKB 5TGBA 5LVEA 4X99A 1NL0H 3UBXG 3GM8A 4AL8L 2Z31D 4XX1E 3ULSA 1VPOH 4XRCB 4FMKA 1A6AA 1LQSR 3SE8L 2GFBA 1EZVX 2X10A 2X2YA 4M61A 3MV9A 4OLXL 5IJVB 1JPGB 5K9KB 5IG7A 1N3NA 4NGHH 1I9RL 1KBGH 1NC2B 1SQ2N 2A77H 3HC4L 4FFZL 4OF6A 1HHHA 3DI2B 4ENEC 4X7EC 3GO1H 4QHNB 4CUCA 2J5LC 2X4QB 2CK2A 4LKXA 1KYOJ 2J8HA 3VU2A 4U49A 1URLA 3BFOA 1BJMA 1TITA 4Y4KB 2R9HD 1BVZA 1CDGA 4XNQA 4HIJB 2DLHA 4JFEA 1EDQA 2RGSA 3VA6A 5IB5B 4NQCD 3OKOB 4XCFL 5F7UA 3MREB 1MFAH 3BWAA 3QXUA 2NY2D 5L7XL 4OCXL 4JPVL 4FXKB 2DWEA 4OZGE 5FA3B 5FOBA 4U1IA 5ITBH 4JFYB 3WEXB 1YNTB 4NRXB 2P8MB 3QUKB 1EGJL 5JOFA 1A2YB 5KSBA 4JRYB 5IV2B 1BJ8A 3IU4L 4XP6L 4DK3A 2N4IA 2BDNH 4R3SA 3HI1A 5I1DA 3X3FL 3VFMB 5TDOA 3LDBB 2HA1A 4EVNA 1MRDL 4G7VL 1A9BA 3FQWA 2CDEB 3MV8B 4HWBH 4GMTL 4MAYB 4H5SB 2XY1A 4WGWB 4M1DL 4K2UL 4KI5F 4PJ9D 1U0QA 5I16A 1VEOA 3W9EB 5D7LD 4C56B 1L4IA 1MFCL 2QADC 2OI9B 2WBWB 4C58B 4YHLH 3DTXB 3GBLA 1MQKH 2BJMH 1QUNA 4CMHB 4I2XA 4GKOA 3VWKD 2RCSH 1AO7B 1F45A 3HE7C 4NCC1 3BEVA 5IKCA 4Y4HA 2FGZA 4M6NH 2FECI 4PTUA 5GISH 1S9WA 1UWGH 3ZTJG 1ORQA 1REIA 4X5XA 2NY6D 3C6SB 4DZ8B 3GSOA 2HVKA 3RWJB 5IHBA 3IJSB 1HZHH 4QHUA 3O4LA 4Y2DD 2WM0A 3R1GH 5KANG 5ISZD 3L3JA 4G7YL 4LSRH 4YDLC 5FOJA 4PTTB 3TV3L 1B4RA 1F8TH 5D2LA 2OR7A 1OVZA 3SHSA 5EDXA 5BS0E 2PN5A 3M1BB 2BVPA 5JPNA 4AIZA 4HG4K 2R29L 1KTKE 3BSZH 3RWHB 1L7IL 2G9HB 3HCVA 2W9DL 1W0VA 1MFBH 1ACYH 2IPKB 2DWDB 3ECBA 4U1JB 3BYTA 3J8F7 1R6VA 3TH3T 1ZHKA 1S7VA 4ONGL 4HUNB 4FQ2L 4HHAB 3RGVC 4X6DB 4RMWA 1NGPH 4Z0XB 4MQXD 5CBAB 2VLRD 1QHOA 1KXTB 1SEQH 5DQ9B 1YY8B 4WEUD 4YXHL 3UJIL 5J89A 5HDLA 5EOCJ 1CGUA 1UH3A 1LEIA 1MRFL 4GMSL 3U7YH 2CGRL 3ZE1F 1AR2A 1WICA 3EYUH 3MXVL 2V5MA 2HJFA 4J4PA 3ZE2E 1F13A 4NJ9L 1EFXD 2Y1VA 3ZDYE 2IANA 1FH5H 2HT4D 4LGSB 4MDJB 2KH2B 1KEML 4AEIL 3CMOL 5A2KH 4QHLA 4LBEB 2PYEA 3VXTA 4M7JL 1Q0XH 3QEGH 1NKRA 5J8OA 3F62A 3UP1A 2V2XA 4EOWL 5C0EA 1DBJL 1C1EH 1BREA 2VZVA 3MLRH 4OCWH 5E00A 1G0DA 4PJDB 4PS4H 2FGWL 4X6DF 4PJEA 7FABL 1S5HB 1JPST 5DFVC 2R1WA 2ATPA 1KIRA 1U3JA 4RDQG 1V5JA 2A6DB 3HNTL 4JFPA 4YHZL 1FN4A 4MB3A 1T3FB 2E6JA 3MX0A 5A2FA 4MDIA 4YBLC 4FQCL 4JAMA 3ZYZA 3PP4H 3UZVB 1UVQA 4L3EB 1KGCE 4LEOB 2J88L 35C8H 4RFOH 1MF2H 3U46A 4NZRH 4X7FC 5HVWA 1UQSB 5EU6B 1JNNL 1BVLA 1XF5A 3BP4A 3CNKA 3DIFB 3P73A 4OF0A 3EYOB 4WCYL 5I0DA 4G43A 2Q3ZA 3T0EC 3IDJA 2Y23A 2BHUA 4QHMB 3VFSA 2GJ6B 1CT8B 3IFPA 4JRWA 3RNKB 5FYLL 3UZEA 3OGOE 4U6HB 2BSSA 4NP4H 1F4YH 2HLAB 2X4UA 3I6KA 4GRWB 3CUPB 4NUJA 4PJDF 1HHKB 1QSEA 3ZL4L 1A1MA 5AUMA 3DGCR 2VR9A 3CVIL 2UYLB 4OQ1A 2HFTA 2NY4C 2WZPD 4GRMA 4ZYKA 5DMJB 5DJYB 3MZTA 4NN6B 4U6YB 3BXNB 2VDML 5SV3A 4FFVC 4K71C 5IK3B 1FQ9C 3BZFA 1T22A 4MAUH 3O8XC 3ROOA 3IXTA 2BSRB 3VFTA 4EQ3A 4P46B 4TTDD 1WWWX 1E27A 4LQFL 2Y4SA 1BX2A 5JTWA 5C6TL 2IGFL 4DVBB 3SDCD 3KPSD 1T0MB 1VADB 4D9RD 1NFIA 4HS3A 1IL1B 3U4BH 5CSBA 3BUTA 2IPTH 4GRWF 1KSRA 1OARL 1P7KA 4KK6C 3Q48A 4EI5A 2XZQH 2B2XL 1C7TA 4NQVB 4PJ8B 3LQMA 4L4JA 4WIQA 1H15A 2FX8L 3PHOA 5F97E 2JB5H 1V3MA 3L3IA 4O4YH 2C7UB 4JFZH 3TIDA 4P9MH 1MH5B 4YDVB 3L95B 2CPCA 4CVUA 4W4NA 2F53B 1NMAL 5D7KE 5CEXB 3MRPA 1IAKA 5E6ZA 1ZGLP 3SCMD 5FXCH 1ZGLB 2MFNA 2X6MA 5DD3H 1JHKL 1BM3H 1VDGA 2J6EL 5HHOA 2B0SH 3QDGD 5DMIL 1XF3B 3RPIB 3GB7A 5CD3B 4M1GL 2PXYB 4B50A 1UZ8B 2ARJA 5E9DB 5GGTL 1P1ZA 3VMOA 1PZUB 2OR8A 5MEQA 3MJ9H 3CDFA 4O51B 4M8VA 4DCQB 2NX5A 3NN8A 3HN3A 2NW3B 2A6KB 2DQHL 2FL5B 3QCUH 4ENED 5AYUH 3L3DA 4ODWB 1DLHB 4LPUA 4LDOB 3QCVH 2ENSA 3AAZB 4WTWA 3MFFB 1F4XH 4ODTH 5F6HI 3RU8H 3GJFH 3TT3H 5C86A 3MUY1 1UM6H 5DD0H 3MJ8B 1FZKA 3S96A 4B5EA 1DQQA 3L3OB 2COQA 5B3JF 3VE0A 4Z7WB 2ICWB 1RZIA 4PJAE 4X4ME 2VH5L 2QQKH 4I4WA 4QWWC 3SDXE 5IP4A 4KTDH 3O6KH 3T65B 1DQJB 1C5DA 5EO9B 5J06A 3DYPA 3RI5K 2QKIB 1T1XA 4LHUA 1IGCH 1MHPL 3BP7A 4KWUA 3WN5A 2JK5B 4WFHE 1M1SA 1FPTH 4U1NA 5LG1A 1T1WA 3RJQB 3IVKB 3L5XH 5E8EA 3U9PL 4PJ7A 5E24E 1JPFB 3RIFF 3N1GC 3FN0H 1MNUH 3ARTA 4F15B 4P0DA 3WNLA 1OGTA 4JZOA 5FUZL 2QADD 4XCEB 1W2KT 1AGDA 5DJDB 5IVXB 3DRTB 3KHOA 1OSPH 3THML 5E8DH 1WGOA 1NDMA 2FBOJ 3HE7D 1ZXQA 4MSWB 4Z7WF 4FQQA 3CFKB 2YXFA 1VERA 1WV7T 4J3UA 2ORBL 1YDPA 5JIHA 5C0JB 2GAZA 5SWSD 1FORL 4AY0A 3GMQB 1J0KA 2R1YA 3EAKA 5MI0B 1A4KB 1Z3GL 3MXWL 2GTZB 3T3PF 4KRPC 3QISA 4Y4HC 3B5GA 1MHHB 3B9KB 1RAMA 1L9NA 4LCYB 3VFRA 3GSNB 3NGBC 1CTOA 5DS8B 1KPRA 2MCG1 2PO6B 4ZOCA 5BO1H 4LLDB 1NCCH 5EOCL 4XPHH 3FO0H 3S8WA 3QPXH 1GIGL 3ORJA 5IVXF 3OKYA 3WIIL 5BZWB 1RPQA 1OQXA 3OG6B 3MYZA 4RQQB 3OKDA 4NO3B 1G9NC 3ZKXB 1HWGB 3GUTB 4OKVA 1FFRA 1LILA 8FABB 2X9YA 3L9RB 5JXAL 4HIXH 1QLRA 4IRSA 3WE6B 3UTSB 5F1KC 3U2SA 2R2CA 5HGHB 1X7QB 2W59A 5TFSL 5DWUH 1P4LB 1LEGB 4FQLH 3T77B 3RGVD 4RGNE 2VISB 2VXVH 2FO4B 1FE8L 1A7NH 4O2EA 3JUYA 1UACH 5CINH 3DYOA 1FO0H 5GGRB 3UBXB 2BNQA 1K6QL 2BRQA 4KI1A 1Z0NA 3DURA 4FP8L 4M5YL 5C0RL 4YHOH 1I9RH 1S7UA 4PJ5B 2GCYA 3LS5L 1RZKC 5JO5B 3L6FB 1XCQB 4J6RH 5IFHL 3O3AB 4YHPA 4G3YH 4Q0XL 1BD2B 3TH4T 5ESVB 1Q72L 1BFVH 3EDEA 3TEUA 1CFVL 3QQNA 4J4PC 3MNWA 1WF5A 2RQ8A 2Y5EA 3D18A 1EERB 4PP1C 3HPLB 5GJSL 1U2HA 1S7QB 5EZLA 4G5ZH 1F4HA 4Q58C 4NO0A 4PGZA 4DUXA 1CXEA 2NY3B 1BQLH 4J8RA 2BOBA 4HLZH 1XEDA 3HC0A 3STZA 1OB1A 4HH9A 4MD5B 3IU4H 1U41A 2XXCB 1WCQA 4HAGA 3Q6GH 3NACL 1R0AL 1YEJL 2YC1A 1GH7A 5CSZA 3X3FH 3IFLL 3U83A 4MX7B 4G7VH 2IJ0C 1YEFL 1K5NA 1JUFB 2A9NH 4JFFB 3FQTA 3T0ED 4RZCB 5DD5H 4GKSB 4JY4B 1KIPA 2BVEA 4K9EL 1ZS8A 5F7HA 2AKRB 1KJVA 1TPXC 3PJSA 4L9LB 5E2UH 4NFDA 1NCDL 1R3IH 1XGQB 2DQJL 4R9HA 2UWEB 3I3BA 4IDJH 4JR9H 3EOAA 3IU3B 1QZ1A 1TVBA 2Z9TA 4MCZB 4PRNA 5HJ3A 1PX3A 3PGDA 2ITDB 2NY4D 1I8MB 2P49B 3VG0H 3EDKA 5BOPA 4K7PY 2BX5A 4PY7B 1U8MB 2OQJB 3S88L 4L29A 1IM9B 2BCKB 5C0BA 1KC5L 5GZNC 4FFVD 4X98A 1KCVH 5LGHL 1K4DB 4JRXD 2J12B 2B39A 3OKLB 4NUGL 5J9PB 3O8XD 4G7YH 5DD1H 5F71A 4N68A 2D7TH 1G7JA 5JR1L 4MNQB 3D39B 3TA3A 3H7LA 2C1PB 1A7RL 1FFNA 1K3IA 1CXIA 5CMAB 3SKMA 1H8OA 2XZZA 1WBXA 1EO8L 1L7IH 4KMTL 2A83A 4X99B 2UWEF 4KK6D 3AY4C 4S1QL 2W9DH 4PBWD 4NQSB 3GSNL 2D0HA 2R4SL 2HJLB 5BV7L 5C9JB 3GRWL 1J11A 1G6RB 2AW2A 1Q9WB 4FQ2H 1HILA 2GSIB 3V79C 2Y07L 1UB5A 4FMFA 1N3NB 2PETA 3MOAL 1KYOK 4GQ9L 1CGVA 3O2DH 4QCIA 1DLFH 4LLMB 2EXWC 3V0VA 4KDTA 2HKHL 2BVOA 5JMRA 3RJDA 2EIEA 1NMCC 4I1NB 4HXAL 4XB7A 3B2VH 4WDIB 1LO5A 4OD2B 2I25N 3MV8E 4XP4H 2JCCB 1A47A 1UH4A 4HUUA 4YIQA 1MRFH 4GMSH 3P77A 5TE7L 5KS9F 1WTLA 4C56E 4HS8H 4C55A 1DL7L 3H3BC 1OLZA 4LF3B 4NJ9H 1OAUH 2DQDL 3KPPB 1YUHB 5CJXA 4HIEA 2ADIB 4Y1AA 3FN9A 4UT7H 2K3TA 3G6AA 1F11A 1KN4H 5FIEA 2HRPH 3MJ7A 3N50A 2WIMA 1AGCB 1MCNA 5BJTB 5IB3A 5GRVK 3GBML 5IW6A 2FGWH 5JOFB 3QIUC 5F7FA 4OM0H 3V6OA 2JJWA 3KPMA 3NH7L 4HXBL 4MQTB 1RK0B 2XT1B 3C5JB 1P6FA 2Y5TB 4G8IA 5AG9A 3DGGB 5J6GB 3G04B 1AKJA 1G7HA 2R8SL 2ITCB 3GSXA 4G6ML 3WHXA 1CDHA 2JCCF 4KJQC 3ZE0E 3UTZA 2X4PA 1CD8A 4X7SH 3L7FA 1YECH 4JFED 4K23H 4QWWD 4BFEA 1J05A 4E41A 4IRJB 3RVWC 1RJLB 4LLWA 3MCKB 3B8SA 4PGBA 2XQBL 3JUZA 3U7WL 4LDLB 5ETUA 1WZMA 3ARWA 5F9DC 1CDIA 1DR9A 1OAZL 5IKCB 4KUCD 4IOIB 5CGMA 3DX6A 4FFWC 3U4EA 4IRZL 4I0PC 1O0VA 4ACPA 4PTUB 3EYVA 4K8RL 2GJZB 3P11L 1UEMA 4KHTL 4X5XB 2R0WL 3GJEB 4HWEL 2FYYB 4LSPL 3ZL4H 3WN5C 43C9A 5I8OH 4OZHE 2P44B 2JELH 4X6DE 1QP1A 3IB4A 4RAUB 3QXAB 1PKOA 3QNXB 1INDL 1JGLH 1NMBH 5E2JA 4UIKL 5I1KL 1ODAA 5H37G 2D0GA 5D1XA 3T0WA 5D2LB 3TNMA 1U8IB 4RWHA 1KUMA 4P5TB 1UT9A 1ZHBB 2ZUQC 3PL6B 2PF6A 4PJFB 2YKLH 4OKDA 4KRPD 4I0KA 4Y4HD 5C0IA 4LQFH 3LKSA 5D1ZB 1FNSL 2IC2A 3PP3H 4WI2A 1U42A 4N0UA 2P8PA 1W0VB 4U1GC 2EH8H 4QRRA 3ECBB 3FO2A 1RUPL 2PCPB 2OTPA 3QYCA 5JLZB 5HYIA 5F89A 1MWAL 3D3VA 5KAQF 3RZCA 3BP6A 3FOMB 3O4LD 5A1AA 1CG9A 1NKOA 4KVCH 2GW5A 4DK6A 2D4DA 4KI5C 3EO1B 4GRLA 3QUXA 1CFNB 5HGAB 5LGKA 3UO1H 5IEKA 1DUYA 1NGZA 1PVHA 4OF8A 1NMAH 2ZOKB 2FR4B 3T0XA 3AXLA 1C8PA 1LEIB 4GS7B 5HD8C 4L3EE 5MENA 1WBZA 1A3RL 3N9GH 4XAKE 2YN5A 3TO2B 3LOWA 4L8SB 4GAGL 1S9XB 3T2OA 4PGCA 5EU6E 4XPFL 2Q76A 4PJFF 4AYFA 3MGOA 4JFOB 3PDOA 1KJ2A 1DBAH 1FAIL 4HK3N 4WHCA 3K0WA 1ITCA 3VXTB 1JMZA 3BAEL 2JIXA 3JV6B 4NSKB 4S1DC 2V9QA 2GJ6E 3Q5OA 5D6DA 5C0EB 3QEHA 3LDBC 4Z7UE 4HKZA 1KPUA 5E5UB 1TTUA 1NGYA 3IJHA 1J5OH 4GRWE 2C3XA 1CDYA 1I3VA 4JHAL 4PJEB 5JORA 3TJEL 1FG9C 1WC7A 3KPOB 2HFGH 3BPNB 1QFWM 3QQ3B 5SX5H 3NIFF 1QKZL 3PIQA 1G7QA 4UMGA 4G9FB 5DZLA 1NCWL 3MBEB 2OI9C 4NRYA 1P4IL 4HX1A 2EYRA 1QQDA 1CVSC 1DDHB 4WUUA 2X9XA 4J4PD 4P3DA 5IHZA 1FVDB 5I17B 1IEBB 1C08A 4PP1D 3NZ8B 1BVLB 4QRSA 2BOCB 2IAND 3BP4B 3L5WB 4P4KB 5GGVY 5K9OA 4F58H 2X44D 1V8HA 2RFXB 2VLJA 4PG2A 1A7OH 3WHE1 3O11B 5B3NA 4YDIH 4OD3H 1XFPA 3IFPB 4UQ2B 3SJVA 3K46A 2BNUA 2Z35A 3QIWA 3UTOA 1HHJA 2DMKA 3OXSA 2AXJA 4J3XA 2NXZB 3RIFK 3OAUL 2ZPKL 1QR1A 2EDBA 3BDBA 5DJAB 5AUMB 1DN0B 3RX7A 1IZJA 1V7MH 4X4YA 4NC0B 3LN4B 5FYKE 1HXYA 3ZT5A 1YJDL 1IGTB 2D03H 2NZ9C 5F96L 3D25B 1CFTB 1DBBH 2ICWI 5ICXB 5HYJA 4EI6B 4KKCC 1JV5A 1YNKL 2F53E 4HGWB 3ROLB 2QQLL 3HRPA 3S5LA 4F7MA 1S9VB 5FHAL 4MXVF 4M1CC 2AVGA 1ETZA 3EJYC 5ACMA 5CWSA 1MEXH 5E99L 5I19L 1FYHB 1E27B 5AAWA 3BIBX 5B3JE 3BGFB 1U3HB 1UXSA 1QSFA 1S7RB 1RJYB 5E9DE 1FORH 3DMMB 4M3KB 3A6CH 2ZSVA 3MPCA 1QSED 3LD8C 1MJJB 3HNSL 1A9EA 4GRWH 3HRZB 3QWOA 5GZND 5F1IA 4WEMB 4YHKL 2FHBA 5EU7E 4LU5L 2X1QA 1BFTA 2DS4A 3VFUB 4F80A 1WEJH 2AI0H 4MLIA 3PHOB 3V5KB 1M7IB 4YQXL 4JFDB 4MLSA 2R0KH 4Z7NF 3CFCL 1S78C 1I8KB 4CADA 1T20A 2VXTL 3EIFA 4X8JB 3LKRA 1VB9A 1U3ZA 1TFHA 5DI8A 3GI8H 4OCMC 1XF4A 1G84A 1HSAA 4B0MM 4BZ1L 1GIGH 2ICCA 3MUJA 1XGUA 1CR9L 3LY6A 1SEBA 3LMJL 1OTSC 4Y88A 1LE5A 3WIHH 2F5BL 4WW1A 2NCMA 3EOBA 3LQAC 3TA3C 3TBTB 4P59L 3VW3L 4Q9CA 3WFCL 4R96A 4NZDA 1VFMA 4OGXH 4Z7WE 2V17L 5IMLA 3WL9B 2R1XB 3SKNB 5DMYA 1TJGL 2AQ3A 5TFSH 2NY5H 4WFFD 3MACL 4JDZB 2FWOA 4HKBA 2D7OA 4OV5B 3MRLA 3VXUA 5HVHB 2LQRA 3MBXL 2BVTA 4PYHA 2YHGA 5FYKH 2EXWD 4Q7DA 5C0AD 3DET<