4PJ5E

Structure of human mr1-ac-6-fp in complex with human mait trbv6-1 tcr
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
243
structure length
243
Chain Sequence
b'AGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSVWTGEGSGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 58
structure length 243
sequence length 243
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pj5E01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pj5E02
2DJUA 3Q1SL 5ACLA 3HE6C 3RWHA 2FD6L 4HKZA 4OZFB 5E8PB 3V0WL 1RZGA 4Z18A 1N3NA 2FZ3B 4C54A 1J8HA 3MROB 5EUOE 1N59B 3HUJB 3OAYK 1IC7H 3IRPX 4FFVC 4X9FA 3MCLL 1S7UB 3EAKA 2DD8L 3NCMA 4PJIE 5KSAC 5B38G 1S7WA 1FL5B 1LK3L 2K3TA 4DUXA 5D8JH 1U8OB 3N1FC 3QDGD 4Y16C 1T03H 3QUKB 3GMOA 1PG7W 3GGWA 3BQUC 4KKAC 3GJEA 1SEBB 3G6DH 4OIAA 5JIPA 2IPKA 5HYJB 3MJ9H 1KLUB 4NN6C 3OZ9H 5JPNA 2X5PA 3L3KA 4DZ8A 1G0XA 5FUZH 2BXZA 1QLFA 2D3VA 1NLBL 1AXSA 1KB9J 4E5XA 3DMMD 4EIGB 5FDWB 4M6NL 5KS9F 3HAEB 5ETUB 5LGKA 3Q0HA 3JSSA 3MLVH 5E6YA 2GAZA 2I60H 4HUWB 2D03H 3RDTD 5D2NC 3QNZB 2XFXA 5JO5A 5TF0A 2DTML 3D39A 4FQCL 2D7OA 5E95B 4PRPA 5EIVA 3NH7H 4ESKA 2DQFB 1H15B 4WNQB 5DFVC 1SJHB 2YPLB 1BECA 3ZL4L 5BW7C 3LS4H 5TE7H 4P2OB 1B0RA 2FB4H 5GRVK 1TITA 3O6FC 3KS0J 2LVCA 4XI5D 3HZMB 1RZJL 4XMKH 1KIQA 4LLQB 1MCBA 5SWZE 4JPKH 3D69B 3SGDH 5HGGS 2ARWA 4JRXA 4M7ZB 4GKZB 4KQ3H 5CJQH 1DQLL 4M6AA 3WJLC 3ZE2F 3WD5L 3LKSA 1YC7A 1BQUA 3SE8L 3KPTA 1UWEL 5ESAB 2CIIB 1AR2A 3S4SA 1TJIL 1G7HA 5IVZB 2I07A 3HNTH 2JLLA 1MRCL 3WS3A 3DVGB 4QXWA 5C0GB 2D0HA 2QQKL 3MRCA 4PV9B 3TZVC 5IJVB 3MNZB 5HBBA 2EDQA 3CPLB 1D6EB 3D2UD 3OKMB 3L3OB 2QTEA 4M43H 4PJHB 3GJFK 5DMGD 3LKQA 4NOBA 4JANB 3BYYA 1ACYH 4LF3A 4OCLC 4FP8L 3B2UD 2WM0A 1G7MB 1A47A 1QNZL 3KJ6H 4CVXA 3S3JA 4Z78B 5HY9B 4X8XA 2AK4D 1F90H 2IH1A 1PSKH 3UYRL 7FABL 1RZ7L 2XIDA 2EDDA 2Z92A 1MQKL 4O2FB 1TZHB 1FFNA 4ODHL 4BJLA 1ACZA 2XXMB 4GMSL 4X4YB 1C12B 2ADFH 4RNRA 3DPBA 4OM0L 4JO1L 3ZSSA 2BJMH 4IRJD 3IGAA 3IS0X 1ZMYA 3KPQA 5FXCH 1CTOA 1Q1JH 4HZLB 1A3RL 3OPZL 4QRPE 4ZNCD 5DD6B 3T65A 2RCSL 3LS5H 3DLQR 5HHVH 3T4YB 1EIBA 5E8NB 3JXAA 4Z8FH 3VRLF 3GMLB 2C1OA 4JHWL 5FGSA 1FYTE 4NBXB 1NL0H 3NVQA 3Q5OA 4GRLB 3U0WL 4WWKC 3ZT7A 5F9WB 3X14B 4Y88A 4JFYA 1RJZB 4FA8A 4Y0GA 1DVFB 5D4QA 4R3SA 1YUHB 2DAVA 1U95A 5F21B 3MRPA 3MLYL 1IAKA 2IBBA 4Z7UB 1FVDA 3BUTA 4HDIA 4ETQA 3SKUD 2YPKA 3X3FL 5I2IA 5HI5C 2OZ4L 4AEHH 3WLWC 2BNUB 4KRNA 3ARGD 3QO1A 3I75B 1BX2B 4BQCA 3AU1A 1YNLH 1HQRB 2VXUL 4HBQA 5H2BA 1D5IL 2VDQL 5IB2A 4OLXH 3F5WB 1FVEB 4OZGA 1N4XH 2DQCL 3BUYA 3IXTB 2QADD 5GSVA 2Z8VC 4V1DD 2X4OB 3AAZA 3MV9E 3CFBB 2F53B 3A6OA 4IOFC 1C5BL 1T5WB 1S5HA 1MH5A 3QIBC 5J9PA 2HKFH 5GJTL 1YYLL 4MDIB 4HF5H 1LEGB 4OLWL 4AT6A 4ZXBD 4F3FB 4I48B 3SQOH 3O0RL 1MWAL 1U8MB 3MCKA 1JGUH 3MGAA 2NTFB 1FZOB 1NJ9B 5DMKB 3B9KC 4S1RH 4D9QE 3O45B 2NY3C 3O4LA 2AKRA 3VXUA 1XIWA 3NZHL 4PJGF 3UPAA 1KJMA 3VA6A 5CD5D 2ZKHL 2FX9H 2R0LL 5E2TL 4DGYL 4YO0A 3QISA 3L5XH 5DDHB 5LWYL 3NOIA 2E8ZA 4B41A 3HPJA 1ROWA 1UYWH 1G7QA 1SJXA 1HHJB 1RD6A 3RWCA 3BH9B 3LQMA 4E0RA 4OF5A 3K2UH 5FFLA 1A22B 3TNMA 1XGTB 3MLRH 5DS8A 2X40A 5HHOA 5E8DH 1K4DA 4LCIH 5FOBB 5EG6C 2DJ4A 4YHIA 5K93A 4J3OC 1IGMH 4Y5XB 1EK3A 2UYLB 3WUWA 3V6ZA 5ACZB 4X99B 4IRSB 2KZWA 2E27L 4YGVB 4Y4HB 3C60B 2X1XR 5E8EB 1U8KB 1FIEA 1P4BH 1VCAA 2IPUG 1L7IL 2EE3A 5D7KD 4XHJC 2H9GA 4QTIH 2Y06L 2FLRT 3WIHA 5D70L 5C08D 4UT7L 5FUOH 3CFJB 1U3HA 1E4JA 1A1NA 2BRQA 2ITCB 5B8CC 5MHSE 3B4NA 1XCTA 4R97C 4MNHB 3QFDB 5F6HI 5SWZB 1B0GA 1F4YH 1R3LA 1GC1H 1S9VA 5IEKA 2IANA 2LVEA 5L8JB 2KQNA 3ARFC 3EGSA 2XV6B 2HT3D 2XWTA 1HHHA 1A5FL 2K9UA 3VFTA 3WFZA 3RGHA 5IVOA 1BWMA 4XBEH 1JTOA 4YNYA 3QHZH 3LEVH 4NKQB 5C71A 4RCAA 3D48R 4OV6F 3CMOH 3BP6B 4JFQB 3KLSA 1T20A 1U92B 1WTLA 4NZTL 4AG4H 3WFHA 3HE7C 3VWKC 4PBVC 4NO0B 3QDGE 3QXDA 3NCFB 2DM7A 2P8LA 5JXED 3TNNB 5A2JH 4PJFA 5GSRA 3TYFB 1WIUA 3U6RB 4LLYB 4G6KL 1YEHL 1LMKA 5A43C 5ALCL 3O3UN 4GG8B 1S7RB 5HDQH 2HJLB 4I0CC 1J0KA 1KIPA 2OP4H 5HPOA 1FGNH 4G6JL 4JPVH 3V5KA 5D6DC 1IGIL 4PLKC 3H9SB 3L7EA 5D5MA 3V4UL 2BNQD 4NRZA 3KPLB 1T22A 3BP7A 4BQ8A 4HV8B 1ZVSA 1FSKB 1GYAA 4JVPA 1JZ5A 2QQNH 4W6WB 2ADIA 3SDAD 3CZFB 3J7HA 4QRPB 2NY6B 3RUGA 1G9NH 1YY8A 5H94B 4XCFH 1T5XA 5I1KL 1RIHL 3QEHA 4IEFB 3O3BB 1MIML 2F9BT 1FV1A 4BM7A 3DSFH 5KSVB 1UJ3B 3O41B 2VKXA 4M62L 1FO0L 1UXSB 1VFBA 3G6JF 3VFUA 2AEWA 3LY6A 4Q7DA 3ZO0A 3RVXD 5C0DA 4HQQL 3W2DL 2FLBT 2VZUA 3MLUH 1JGDA 5GRUL 2R23A 1T1YB 1HH9A 1TVDA 4CADB 3P0YH 1FH5L 3BXNB 4HK0B 3KPSD 4KK6C 4RX4D 4MD0A 1F2XK 5E9DD 2GITA 5F7LB 4YWGH 2A74A 3MYZA 2HRPL 4FOMA 4P9HC 5KVEL 2DQTH 4FMKA 1TZGH 3MV9B 4ZNEE 1L6XA 3ES6A 1M6OB 3C9NB 3KR3H 4G80B 3U1SH 2BY2A 2AK4E 2W9EL 4HZAA 4KWUA 1H8NA 3G5ZB 3NFPB 1KXVC 4JLRB 4PJGE 2BSTB 5I66A 1GHFL 4MXQD 2FATH 4P2QD 5IK3B 1NAKH 3HZKA 4YBQD 3V6OE 3H42L 2A1WH 4UDUB 4LP4A 2VDLH 4WRLA 2ITDB 3C5ZB 1QLEL 2X1PA 4FQ2L 2W9DH 3GB7B 1KJ3H 4F37F 2QQLH 5B4MC 2AQ1A 2P24A 3OKLA 3VD9A 3QR2A 2GK0B 3CAFA 2X05A 5M7QA 3STZB 1MVUB 1WEJL 4L4VB 2QSQA 3M1BA 3OJ2C 4KQ4H 2EYSB 2A38A 4WU5B 5GGSY 5GGVH 3LKRB 4QF1B 1FG2B 3BKCH 2B20A 5KVMC 2JB5L 4AJ0A 3EYSL 4M4RA 4MCZB 5KS9B 2R2EB 3DX8A 3SJVA 5C8JA 3WUZA 3INUH 4JFXA 1DEEA 3MLWH 3CCHA 4BSWA 3Q5TA 3EYFB 1BZ7B 2IBZX 1FIGL 4TVPD 3ALXA 2V17H 5BRZB 1EHNA 1MCHA 4RISH 1CDCA 3O6FA 5DT1H 1S7TA 5CBAB 3ZTNH 3QUZD 5CBEA 1P2CA 3K8KA 4TULL 5EA0L 4XNYH 5GPRA 4L4TD 5FGBA 3P4MB 1J88A 1D9KD 1R3JA 1U3YA 3ARDB 3MSPA 1DN0B 4N8CL 1WZ1L 3ZHDA 1X44A 1AO7D 4V1DE 1JV5A 2ZUVA 3I6GA 2HA1A 4JFDA 1JWUB 3MV01 3QI9A 4MJIB 3W0WD 1EPFA 1T2JA 3W82A 1UB6A 1JNJA 1C5DB 1RI8A 4K94C 4Q9RL 4ZODA 3RPIB 1C08B 5TQ0L 3K0WA 1AGDA 2XWJB 1G7JA 2BFVL 4G8GB 1ZEAL 3T1FB 1TNNA 5LAXB 1QBML 3N9GH 5AYUH 2AV7A 4HWBH 4N5EC 2XKSA 1GPOL 5EC2B 1JHKH 4I0KA 1RUQL 1OAQH 4HPOH 5E7FA 4LOUC 2A6KB 3V95A 2HH0H 1NCWL 3K4ZA 4PG2A 1NBYB 3OKKB 1AIFA 1KTLA 3IDIB 2FECI 5FKPA 2ZG1A 4LQFH 3NCJH 4XCYA 3QDGB 2IBGA 4YQXH 1BMGA 1NKOA 3CSGA 2A2QT 3BPCB 3R0NA 5ITFA 4WY7L 1MF2L 3LEXB 5LXGH 3DETD 4LCWD 1U3ZA 1R3KB 3TA3D 3VFPB 5JDSA 1RU9H 2YXMA 4APQA 2EC9T 3O8XA 1ITBB 3IJYA 3IKCA 4K8RL 3C6LD 3GFUA 4F58L 2GKIA 1CLOL 5DI8A 3LN5A 4FNLL 4Q6YA 5IVXA 3OGCA 5C0IB 3RNQB 3I2CL 1OF2A 5D7IF 3V0VA 3EJZC 3R4DA 1INQB 5D7KE 1T83A 4UOJA 3V7MA 3MBEB 5I8EB 4OIIH 2YBRA 1GGUA 4OLYL 3VGAC 3DJ9A 4D9LL 3DHMA 3LMJH 1IFHL 3SGJA 2J8UE 1CFTA 3QEQA 2FEEL 5EC1B 5I74C 2V9RA 3G6JE 8CGTA 4JM2D 5EN2B 4Y5YB 1EAPA 1AI1H 3FCTA 3FHQA 2NY5H 3AM8A 5K9KA 1Q9WB 4GKNA 1A6UH 1YJDH 1KCRL 1GL4B 2HFFA 3QYCA 4HKBA 1A6AB 5HGDB 5IOPB 2A0LC 3T0EB 3BIKA 4R7DB 1I3RA 1SM3L 5C0CD 2VC2L 1KFAH 4QHKI 1MPAL 1X5KA 4MA8H 4R4FH 3IDYC 4ZSOA 3NAAH 1T21B 3S5LG 1NBVH 1MJ8H 5HHMB 2R1YB 4JR9L 1T1XA 3C5SA 4FQ1L 2Z0BA 5CWSA 1WWCA 1GC1C 3TT1H 1K4CB 5DMIH 3WNLA 1FL6A 4LSPH 2FSEA 1CDIA 2XA8L 1BAFH 3MV7D 1UWGL 1NC2A 4Z76B 5EFIB 1B4JH 2ZOKA 5T3ZL 5IB3B 1U58A 4XRCA 5MENA 1W8NA 4PJAA 5DXWA 1MJUL 3MGOB 5TFSH 1W0WA 4I18C 4WUKH 1V8HA 4S2SB 4W4NA 4JZNA 3LEYL 2YMXL 1H0DA 4L8SC 2VSDA 2BVTA 3QDJA 3HI1B 3QPQC 2IPUK 3UJJH 5BVPH 5E00B 1U6AL 4DKEH 5LGJB 3OG6B 5DYOB 1BIIB 2AJSH 2HMID 4WJ5A 4IRZH 5F88A 4FTVD 3LPWA 3PHOA 4NQED 3L3JB 4EXKA 4KMTL 3T4AB 1QR4A 4R96A 4EDXB 2V9QA 3FOMA 4Z9KB 3HA0A 1A0QL 1EVUA 1N8ZB 1IT9L 2DKMA 2F74B 3ZKQD 1ZGLA 4XVSH 4XCEB 4EDWL 3ULSA 3WL9B 2EDWA 5CEXB 3EBAA 1PFCA 2WV3A 4I0PA 1AHWA 1IM9B 5DJ8A 2C3VA 4JO3H 2C3WA 4O58H 4PGDA 2DQUH 1CVSC 1NBZA 3QH3B 1JE6A 1G9NC 4PJ8B 3LVEA 4YAQA 3P9LB 3MA9L 5L9DL 3E3QC 5CEZL 4MMXC 2NPLX 5I8CA 4R90H 3LB6D 1IQDB 3KPSE 4MXWL 3IDJB 3F6LA 3PNWA 1QFUH 1EBAA 5E9DE 4Y2OA 3GO1L 2H1PL 4DGIH 2Q8AL 2DM4A 2AXGB 3RKDD 1VEOA 3SKMA 5D7LE 3T0WA 4YDKH 1Q8MA 3KPRA 5IB4B 3VFMA 3O4OC 4YFLF 1A7OH 3AROA 4H26B 3UYPA 1T7XA 2I9LB 2AJYH 2VO5A 4GRMB 2R1WB 1A6WL 1ZT7B 5EOTA 1A64A 1JWMB 2AK1L 2W0FB 1FAKT 4P57B 1AR1D 4P2QE 3JWDL 3T04D 4A6YB 2ZOLB 3TF7C 3OBAA 4LNRB 4Z7VF 1MCSA 4HIIA 3UYOD 1CICD 3SHSA 4UV4H 1K2DB 3H8NA 5KSUA 1I7TB 5A16A 3W11D 4KKCD 5GIRA 1YY9C 4IIQB 4HXBH 5EBMB 4Z7OF 2I26N 4PUBH 4X8JB 3ARPA 3DROA 3B83A 2RFXA 4NNXB 4P2CG 5DSCB 2VXVL 1VGEH 5D93C 3UCRA 4GG6F 1FE8L 1KPUA 4MJ4A 4MJ5A 5D1XA 2XTJD 4TVPE 1I1AD 4P2OC 4AH2A 1M7DB 1SHMA 2EXWC 5DUML 5DMYA 5D7IE 2ZSWA 3MZGB 4Z77B 5IMLA 1XF4A 3X11B 5AAWA 4L4TE 4XWGL 1EO8L 4M7ZC 4HJJH 3FAXA 1HHGB 1CLZH 4OCYH 2PR4H 3AREA 1F4HA 4KJQD 3QIUD 1AO7E 1OWRM 4KZEL 4L29A 4M6MH 3W0WE 1CK0L 2OTUA 2VDRH 5JIKA 4HFWB 4ZD3L 4KPHH 4NFDA 1INDH 5C08B 1JNLL 1IKFL 2D7MA 5E24E 4HLZH 1P84J 5L2KA 4MB3A 1FGVL 2BSRB 4MA3B 4RGOL 5JHLH 2P5WA 3G6JB 4KUZL 3UTTD 2BP3A 1ED3B 2FJGA 4NSKB 3N1MC 3ESUF 3MFFA 4MS8C 4LFHG 5IB5B 5C0JA 4E41B 1VPOL 1V3MA 4QWWD 1NGWB 3O3EA 1EFXB 1NGPL 3ARZA 4RZCB 1VGKA 3O11B 4R4BA 2EKSA 3RHWK 4R4NC 5J1SC 15C8H 1HCVA 5T1LB 3R06A 5CP7B 1YA5A 1QEWB 1YQVH 4QOKD 1CGSH 2V2XB 1T1WA 2PF6A 2FIRT 1I3VA 1A4JA 3L95A 1Q0YL 4TYUA 5EU4A 2PXYC 4I3SH 3RWEA 3D3VD 4JFZH 1NLDH 3EZ8A 4Y4FD 3QA3A 4KXZH 4R7NA 3L6FA 4PRID 5FYJU 2ZCLH 5GQBA 1QBLL 1UCBH 2E6PA 2W65B 4OCRH 1DCLA 2VXSL 4ZAKC 3QBTB 3U9UA 1OAZL 3ARUA 1RAMA 1AKJB 4M7LT 4DN4H 1GGIL 5IMKB 2PTVA 3NIFE 4HJ0D 4LCWE 3GMQA 3H7BA 5HVHC 3QUML 4LLMA 3VWJD 1QHOA 3FONA 2H2PC 4ZOBA 5F9WC 3TJHC 3O2VH 1T89C 4JKPL 1RZFH 3FHAA 4LU5L 4MD5A 1KIUA 5D71L 3MFGB 3ZDYF 4ACPA 1DVFC 4YX2L 2BNQB 3FFCB 4JZJC 3ARBB 4X6DE 4HGWB 1VFOA 4Q6IC 3CDFA 1HYSD 5IM7B 1TIUA 2IG2L 4UU9A 1Q9OB 3TBWB 1OTUD 2UWEB 2CJUH 4G43B 4LLDB 4GXVH 5HPMA 5HGHB 3SDYH 2DYPA 1JGEB 4XWOD 4CMHB 3BEVA 4Q9BA 2BOCB 3MRHB 3G9AB 3UBXG 3RWIA 4K2UH 3DECA 4RMVA 5DJDA 3CX5J 1LWRA 1QFOA 1YZZA 4OGXL 4CKVX 4D8PB 2FGWL 2VYRE 4U1NA 3ZSTA 4OT1L 4QKXB 4AL8H 4KU1A 4DVBB 4NZRL 5C0CE 4XP6H 1XEDA 1J5OH 3MTRA 4PRHB 5EPMB 2DLFL 3GRWL 1REIA 4LVHC 3IETA 5GXBB 1KCSH 5E9DB 1FFPA 2X9XA 1QSFD 3MV7E 3DRQB 3VMNA 1MCKA 4LCCB 3QFJA 3BDBA 1FNEA 2QEJA 4HLJA 4N8PA 2CDFA 5D1QC 2HKHL 1J8HD 2JK5A 5BS0A 5I1DA 2D7QA 4G6ML 4Z7VE 3UJTH 1MAML 2ZSVB 4U1MA 5D2LA 5SWSD 1T4KB 3F65A 4Z0XA 3VFOB 1U8PA 1MHCA 4P2QB 5GJSL 3H9HB 4GRWB 5IFHH 3OJVC 4Z7OE 1NEZA 4M5ZH 4ELKB 3DTXB 3ALPA 1NANI 1JPGB 2C5DC 1VEPA 1U8IB 8FABA 1QVOA 3HKFA 4K3DH 5I1IL 3L7FB 4FTVE 4Y5XC 1MREH 3TWCH 1ZHKB 4YXHH 4GG6E 4LCYA 5GGQL 1V3KA 4JVUA 1QBAA 1E6OL 2GJZB 2H3NB 2PO6A 5GGUB 3LZFH 4P49A 4IRSC 1NAMH 4TN9A 1CTNA 3C60C 1CGVA 4P23D 5HI3C 1GGCH 2DQEH 2BOBB 2MCPH 3ECBA 4FQIH 3IDGA 2H8PB 1ONQB 1DANT 3MRJA 3MGTA 4FZ8H 4XP1H 4U1HB 3SKNB 2C3XA 4PGZA 3BAEL 3FN0L 3VFRA 5GZOD 1Z3GH 1Y0LA 1QFWI 3PL6D 1WBXA 4JQXC 2J88H 5D7IB 1DBKH 1S9YA 3QUZB 3GSNB 3HC0B 1AJ7L 1SYSA 5LG1A 3GUTB 4N0FA 2R0KH 1MRDH 1YEDA 3UTQB 5J11B 2M1KA 4UOW1 1K8DA 1LO5A 1U0QA 2BCKB 2BSSA 3QUYC 4UI2A 4PLJC 3RZCA 5HHXH 1ZE3C 4OLEA 4ODSH 1JHLL 4CN4A 5DC4B 3LQZB 1L6ZA 5IHUL 1AXTH 4X0KA 3NABL 4EI5C 4MAYA 5I71B 3EUUA 1BZ9B 3GSQB 3R0MA 4JPIA 4MLIA 3T08A 4AIZB 4UQ3B 4DUWA 3BT2L 3PF2A 5B39G 4OZ4B 3PDOA 1CFQA 4ZDHA 3RWFA 5KANI 3BRGC 2ICWB 2EC9U 1NMBL 3LKNB 4NRYA 5FIEA 3DV4B 1MI5A 3VGBA 4ZPTA 3ZKSD 1T0MA 5EOCJ 1ZT1B 4G7VH 2EDLA 2IQAB 3K80A 3NN8A 5BMFH 2JJSA 5IF0B 9CGTA 2HJFB 2XNAB 4PJDB 3GSOA 5JHDB 3QCUL 5LJYH 5F7EL 1Z2KA 1CG9B 3D1MC 2I24N 3IDMB 3VU2A 3PV7A 3FT3B 2XTJE 1GOGA 2V9TA 3ZDYE 3EDJA 1LNUB 3TA3B 4LLUA 3FB5A 4X7CC 2A6JA 1FG9C 2Y7QB 4NC0B 4JFFA 3QRFM 1NANH 3DV6A 3FB7A 1WWAX 1HNGA 1PYWA 1RSFA 4U1SB 3QAZB 1HINL 5I1CH 4Q0XH 1XGQA 3MRIA 2CRMA 2VL5A 5D7SH 1BBDH 3QPXL 1GIGL 5CIPB 5FYKD 1U91A 5DO2C 2BMKA 1FL3A 1QR1A 3EO9H 3D85A 5KN5A 1DBJL 1NSNH 4TSCH 1QFWM 2WIIB 1L9MA 1X9QA 1TVHA 3BP4A 4QRRA 3F58H 4J3SA 2YA2A 5KAQF 3UTTE 1DJSA 4RFNC 3BGFB 1UEMA 3CX2A 5T3ZE 4OZFA 2W9LA 5E8PA 5IB1A 1WUNT 3UC0L 4CJ0A 4A6YH 1QRKA 2FZ3A 5CJ5A 1QFWH 3MROA 5FYLH 3VRJA 3TIEB 3HUJA 1H3VA 3WSQL 4M48H 2W60B 3S88H 1U36A 1S7UA 1XR9A 4HUUB 3VFSB 1BBJA 4OFVA 1M4KA 4QOKE 3AS2A 1HK6A 2FCBA 4PJEF 3JTSA 5C3LD 1FL5A 3BDXA 3HFMH 5E2UH 2E7BA 5GRXG 4PJCF 3D3VE 2Q3AA 3ZHKA 4MGXA 5KOMC 2BDNL 5E08H 2OI9C 4PG9B 4PRIE 2HVJB 1MCFA 5I1GL 1SEBA 5HYJA 1KLUA 3HG1B 3O4LD 5E6IA 3OAZK 1JTPA 2HWZL 2CUMA 1XIWD 3HHRB 2IFFH 1IGJA 1OCWH 2X6MA 5FDWA 3L9RB 1X5ZA 3HAEA 2OTWB 4ENED 1KELH 5ETUA 3H0TB 3NCBB 2W59A 1BREA 3CDGB 3L5WB 1MCWW 3PWLA 1F4XH 1J8KA 3QNZA 2V2TB 5FHBL 4AMKL 5KSBF 3GSXB 5M94B 2J6EH 4JPWL 4XVUC 4AEEA 1JNNL 3CH1A 5I8OH 3KNBB 4OUOA 2X42A 2WBJB 1H15A 4WNQA 2VLKD 3VXNB 2YPLA 1OAKL 3ULUD 3UTSB 3EYUH 3PGFH 1DBBL 3WO4B 2W07A 2F5AL 1OWWA 4NQEB 4LLQA 1JPFB 4FQHA 5F7DB 3D69A 5T3XL 4KI5D 3NA9H 4YZFE 4GKZA 1I8MB 3MCG1 4U0RB 4DFHA 2D7NA 3SOBL 3CFCL 5IJKC 3V6FA 3D0LA 4LVNB 1TLKA 4N1CA 5ESAA 5BXFB 3VXPB 2CIIA 5IR1B 3PGDB 2XZAL 2FX8L 4X6CF 1C8PA 2JKXA 1NMAL 3DVGA 3WFCL 5C0GA 1IAOB 3PDDA 2NR6D 3I02B 3QJHA 4QO1A 2GJJA 3CU1A 4I3RH 3MNZA 4PB0H 3CPLA 4FFZL 1D6EA 1G9ML 3P9MB 3OKMA 2NCMA 5JR1L 4ZTOH 4XXCC 4PJHA 2NYYC 4PJXB 2ZNXA 5CUSH 5H35B 1WBYB 4JANA 3BKMH 35C8L 4OI8A 4GQPH 4U3XA 1QSFE 3U4BH 1G7MA 2EXYD 3BSZL 3W9EB 4Z78A 4YBLB 1Z6JT 4GS7C 4GAYB 4XCNA 4K3EH 1J8HE 1W72B 2R0ZL 3LPFA 2XN9B 4O2CB 5IFJB 1P1ZB 1RPQA 4LMQE 3OSKA 3MNWB 4O2FA 1TVBB 4MNQD 1TZHA 5HGBB 2A9NL 5I76A 3WHXB 1OB1B 4X4YA 1C12A 4PS4H 5SWSE 5H8DA 3MXVH 5IFAH 3BWAA 3I50H 4X7TB 1Y18B 1T80A 4HWBA 2KPNA 3EJYC 4HZLA 3HZYB 1CICB 2ED9A 5E4EB 1WLHA 1SY6A 3VA2C 2AS5M 1ZLVH 3T4YA 3KWWB 3LQAC 3G9VA 3NPSB 5E8NA 3X12B 3THML 3RU8H 5CP3H 3GMLA 2D2OA 1CGXA 2LAAA 4NC1E 4GRLA 1VSCA 4ZFFB 3X14A 2KH2B 1DSFH 3RGVD 3DBXB 3ULUF 1RJZA 2BVQA 3O2WL 1SVCP 1DVFA 1YUHA 1VA9A 1KIRB 2HTKD 3D39E 4F33B 3B9EA 5JPMB 4RFOL 4TRPH 1TJHH 4PRPE 5JW4M 1WQVT 4WUUD 5TE4H 3E0GA 4LHUG 2BNUA 5JZ7C 1I9JH 4OB5L 3I75A 2NXYB 1BX2A 4M5YL 3V2AR 1HQRA 3BW9B 2BVOB 3B43A 3F5WA 1FVEA 4NKIL 2ICWI 5ADOH 1DQMH 4FQLH 1JTTA 1RVFH 4G7YH 4DJMA 2A6DA 2X4OA 3CFBA 2F53A 5FHAH 1T5WA 3QIUB 1V7ML 1YECL 1BVZA 1BD2D 1JGLL 1LO3H 2VRAA 4OFPA 4WEBH 3PABB 4MDIA 4PRBB 2D31B 2DQIH 4KZDL 1LEGA 3OQ3B 3QRGH 4I48A 4XC3H 4F3FA 3MRMB 5BV7H 4Y8AA 4PJ9D 1PGRB 3UXFA 1U8MA 4J3VA 3CVHB 3IFOB 2NTFA 1FZOA 1NJ9A 5DJAB 4G8EB 5DMKA 3UTTB 3O45A 3CFIC 1BQLH 3T0VA 5FYJH 4U6VL 4GBXC 4RMQA 4YC2B 3DYPA 4GRWH 4CRPA 1CE1L 1FLRH 3HE6D 4PJEE 5D7JA 1QLRB 1D5MA 1P6FA 5ANMB 4DW2L 4P4KB 4PJCE 1CR9H 3UO1L 3O9WA 4FFVD 4Y19B 5DDHA 5KSAD 3E6FB 4PJFF 5DZOA 1HHJA 3A0OA 3BH9A 2D9CA 3AS1A 3QULB 4PRIB 4ZPVB 3HMXA 5HHNB 4Y16D 1CIUA 2Z8WC 2AJVL 5IESL 4JN1L 4KKAD 3BQUD 3EDFA 4DN3H 2EIEA 5I9QB 2ENSA 5T3XD 5IW6B 3VXRD 1MUJB 3VWJB 4KROD 1AH1A 2UYLA 1UACL 3PXHA 2EDRA 1F58L 5ACZA 5GS2H 4X99A 5I15L 3GSNH 3O6ML 3SGKC 4HIJB 4PGCB 4YGVA 5E8EA 4Y4HA 2GSGB 1HOCB 1EO7A 3MMEB 4BH8B 1U8KA 3UPRB 1AY1H 4X5XB 2AQ3A 2DQJL 3D5OF 4W68A 1I8IB 2VLRD 2FBJL 1QSVA 4QXTB 5CKGA 1FORL 1OD9A 4O00A 3RIFF 1KC5L 3F7VB 2HFEB 5DFVD 43CAB 3CFJA 2ITCA 4P0DA 4YXLH 3AY4A 3QWOB 2VH5L 4TQEL 3MUHL 3O6FD 5L0QB 2NMSA 4MNHA 3QFDA 5SWZA 1I7RB 3TO4C 3QXWA 1YMMD 1BVLB 1RK1B 4LKCB 5I8KL 2GQHA 1ULVA 1S78C 2VMFA 5J3HC 5DJ2A 1UT9A 5TDNB 3SDDC 1YDPB 3NFNB 2QHRL 2DDQL 1FFRA 3OKNB 4S10A 1JZ3A 3PWUB 5CGYC 4NZDA 1RIVH 3P30H 3BP6A 5I6XB 3Q3GB 2RB8A 2DLGA 4JFQA 3QIWC 1U92A 1VACA 5FA4B 3TZVD 2O61A 4X7FC 5F72S 5EZIL 2HN7B 2NY2B 4JN2B 3ZE0E 4CBPA 3TFKC 5FUCE 4H5SB 4PY8I 3TYFA 3U6RA 4ZG1A 2RHEA 3DRTB 4WI8A 4LLYA 3O4LE 1F42A 4WHYG 2GT9A 1A8JH 3ARXA 1EHLH 3RNKB 4GG8A 4RWYL 3P77B 4WTZG 4OLZL 2HJLA 3RQ3A 1FZKB 4IIQC 4ELMF 5I1HL 1A6VH 4KDTA 4IS6B 5I1LA 3JWOH 3EFDL 3H9SA 1YNTB 4XGZB 1AGEA 4XP4L 3KPLA 2OBGA 4R2GB 5C6WH 3RJDA 4UBDC 5DD1L 5E2VH 3L3DB 3OR7B 3S36H 4XAKD 2CR6A 1IC1A 4XMLH 5B3NA 1OGAD 2VLKE 3CZFA 4QXUH 1G9EA 1JHTB 4QRPA 3ULUE 2R2CA 1XGRB 2NY0B 5FCSH 5CIPH 5HHPB 5IBTH 5HHOE 3FQWA 4GKSB 5H94A 4LRNH 4Z7WF 1LILA 5E0QA 5DD3H 3LKOB 3O3BA 1KEGH 1IC7L 4G42B 1FYTA 1N2RB 1UA6H 1N7MH 4KI5E 2YA0A 5KSVA 4HCRH 1UJ3A 4QCIB 3B2VL 3FO2B 3O41A 4WWKD 4HIEB 4XPGL 3BIBX 4P23B 3R8BB 4DTGL 1WZLA 1UXSA 3LN9A 12E8L 1BFTA 1CLYL 1BFSA 3S5LB 1NUNB 2DL9A 2MPAH 4NKDB 4U49A 2LV4A 1T03L 2R4SL 5KTEH 4YHOL 3G6DL 1T1YA 3MJ9L 4CADA 4DWHA 3OZ9L 1NFIB 3PL6B 5TPWH 3BXNA 4HK0A 5HI5D 5JQHC 1PDKA 5FUZL 2Z31C 1BF8A 3WLWD 3KAAA 1KG0B 1SJEA 4H0HB 1MCIA 4PREB 3MLVL 1U3JA 2I60L 3MV9A 2D03L 2X4TB 3I9GH 3RIAF 3C9NA 4X7SH 3WHE0 4G80A 4FXGB 4IOFD 3QIBD 3G5ZA 3NFPA 5LCVH 3NH7L 2DRUA 4KHTH 2JF1A 3TH3T 1X5FA 4MNQE 1E4KC 2BSTA 3O3AB 4P59H 5TF1H 4KTDH 1OP5K 5IK3A 3LS4L 5TE7L 5GS1C 3QQ4B 3PHSA 4NUJB 4NWUH 4QHUA 1EAJA 1C7TA 2OJZH 4XMKL 3B9KD 4AQ1B 4UDUA 5TQ2H 2NY3D 5FGCE 2ITDA 3C5ZA 4PJEB 2Q3ZA 3ZDZF 4JPKL 2GJ6B 1NC2D 4PJFE 3GB7A 4KQ3L 5CJQL 2DQDH 2GK0A 4HEPG 3V7AE 3STZA 1MVUA 4L4VA 3UDWC 3LDBB 2EYSA 2VDMH 4WU5A 3ARSA 4UT9L 3LKRA 3HNTL 5CSZA 1O7VA 1WAAF 5KS9A 5I1JH 4MCZA 2P8PA 2R2EA 5D5ME 1Q0XH 3MODH 3P0GB 3ZTJG 3EYFA 1BZ7A 3PWJA 4M43L 4WUUE 2PKDA 4Y2DB 1NCAH 5BRZA 5KSBB 3MLPA 1ACYL 5FV1L 2HFGH 2B4CH 2R8SH 5CBAA 3KJ6L 3S37H 2MWCA 3B6SB 1F90L 1OARH 1KJ2A 1PSKL 1T7YA 1WC7B 3ARDA 1XGPB 1GGBH 3F12B 3C09B 4I2XB 1KLGB 1JWUA 1DR9A 4BYHA 4MJIA 5DD5H 1BD2E 2ADFL 1PKOA 3VDAA 5JA8B 3QT2A 1W72H 2ZUYA 4XHJD 1C5DA 2BJML 2GI7A 4J3WA 3WKMH 4EQ2A 3RPIA 4L3CB 1C08A 1Q1JL 2V2WB 3FQRB 2XWJA 1I8LA 4BZ2H 3T1FA 1A14H 3FOLB 4F7MB 4OD2B 5HHVL 5LAXA 4X6CB 4GSDH 4F9LA 4Z8FL 5EC2A 4LCCC 4GW5A 5ECJE 5KVFH 1NL0L 5JUEL 1MELA 1MCQA 2OXHA 3ARFD 3ZKXC 2OK0H 2A6KA 3BPLB 3QQ9C 3TH4T 5BV7C 4HK3N 3KPRD 3CXDH 3BPOB 1NBYA 3OKKA 3IDIA 1CDGA 1TQCB 1JPSL 2VXQH 1Q94B 3BMVA 1HDMB 3EIFA 2MNUA 3CH8A 1A6TB 5JOFB 2V5RA 5CILH 3IJSA 2GTZB 3QDGA 4OTXH 2OYPA 4LKXB 1G1CA 3VWKD 1S7SB 4HIHB 4PJAF 3BPCA 3GMMB 1YNLL 4L3EB 4OLXL 3LEXA 4NO5A 2F54D 1N4XL 5GGTH 3MRGA 4MVBD 1R3KA 4JJ5A 4J3TA 5C09B 3VFPA 4AIOA 5T3XE 3ZZ1A 1MFDH 3I85A 3VXRE 3TESA 4GW1B 4UZGA 2N56A 3Q48A 1QRND 4LL9A 4N9OB 4W81A 2HKFL 2EE9A 5DQJB 2FIKB 1EFQA 3G04A 5I0ZA 4XB8A 1TQBB 2P1YA 4J6RH 4HF5L 3HNVH 5EU5B 4XZUB 5D2NE 1P7KB 3RNQA 5ISZB 1DUZA 4Z7WE 2X70B 1JGUL 1N5YH 1HH6B 3MBEA 2VLRE 4I4WB 4XMPH 1P69B 2CD0A 4DUVA 1D5ZB 1I3GH 3S8WA 2E8YA 4S1RL 4I9WD 3TBVB 4BQ6A 3NPZB 2X9WA 5IT2L 5D1XD 5K59F 3UP1A 5L8KB 4ONHB 2NZ9D 4WO4C 5FO7B 4JHBA 5EN2A 4Y5YA 2FX9L 1CFSB 4M8QA 2D7TH 4LMQI 1YMME 2EDKA 3L5XL 4GFTB 5HGDA 5IOPA 2IAMB 3T0EA 4XH2B 4R7DA 2HRLA 2Z8SA 1UYWL 2ICCA 2IFGA 2V7HB 3C08H 3OB0K 1R3HA 4I8DA 4XB7A 5J11C 1UJTA 1EZVX 3K2UL 4XTRC 3LKPA 4ZOAA 1DN2A 4KY1L 1T21A 5ESQB 1OW0C 1I8KB 4NJAH 3E2HB 3MLRL 3T3MF 2R1YA 1P9MC 5E8DL 1RV6X 1L0YA 4GAGH 4LCIL 4WHTB 4WW1B 3U4EB 2FNBA 4PBWD 2EH7H 1K4CA 1IGML 2P5WD 4KRLB 2WWKT 3RI5K 4KK6D 4U3HA 4N0YH 4Z76A 4L8CB 5EFIA 5J06A 1W2KT 3PJSA 3TPUA 4WFHD 2AK4A 4X80H 1P4BL 4QTHA 1IGTB 3MGOA 2O26U 3ORJA 1KYOJ 4MNQB 4NYLB 2PTUA 1KCVL 4PJGA 5EOQH 5F9OH 4QTIL 3ZDZE 4YK4B 5FUOL 5IEHB 3TO2A 4LEXH 4PY8J 3V6OA 5GGSB 2C26A 1SEQH 2NY1B 3HI1A 4IRJA 5E00A 3N85H 5FCUH 4XAKE 5LGJA 1YEIH 3MJ8A 5DYOA 1F4YL 1OGAE 5A2KH 1BIIA 4EVNB 1HQ4B 1GC1L 4NQCD 4N8VB 1UM6H 1WAAE 3L3JA 1UWXH 4PJ7F 1GCFA 4EDXA 3UBXB 5B4MD 1I75A 1N8ZA 5F9JA 4XBEL 4XCEA 4L1DA 5CEXA 3WL9A 3QHZL 3RGVB 1T3FB 4PR5B 2MFNA 3ROLB 1IM9A 3CMOL 2H32B 5ENWA 1MCEA 4KKNA 5IVXE 2YRZA 1MLCB 1J1PH 4ODBD 4AG4L 5JTWA 1NCTA 4ONFH 4HKXA 3QH3A 4L9DA 4PJ8A 4WUUB 5INCB 4CNIA 1NGXB 2DBLH 2H2SD 1JF1A 4MB4A 3EO0B 1LDPH 1HKFA 2Y5TB 3IDJA 1TJGH 1CZ8H 2ERJC 1AC6A 3GHBH 4BUHA 5HDQL 1KEMH 2X4NB 4FQXB 1A7QL 1CQYA 2OP4L 4L4JA 4JPVL 1SYVB 3C6SB 4WFED 3WE6B 4M7LH 5J57B 5IB4A 4D2NA 3ZLQC 4Z95H 1ZWIB 1BD2B 5ALBH 4O9HH 3U0PB 4GMTL 4RQQB 4K7PY 2VLJB 4YHKH 4RGND 3UJIH 2ADJB 3LV3B 4GRMA 3SKJH 4ZUUB 2VAJA 1ZT7A 2ED8A 2QQNL 4PJ9B 5D72H 1JWSB 2VDPH 2W0FA 4P57A 4LAJH 4NQVB 1JPTH 4L8BB 2H26A 1G9NL 3IF1A 4A6YA 4XCFL 2ZOLA 4LNRA 3RBGA 2P44B 4E42B 1K2DA 3HE6B 3K2MC 4N5ED 5C0NC 3AS3A 2L4OA 4NQDD 3DSFL 3GSUB 2P43B 3KYKH 5EBMA 1KCUH 4ZFGH 4LOUD 2YD4A 5TH2B 5J6GB 2XYCA 4PJAE 4DCQB 4PY7B 2X4SB 4NNXA 1QA9B 5DSCA 3U7WH 3VXTB 4H88H 5KSAB 1X7QA 3O6KH 1DFBL 1LE9B 3MLUL 2Y6SC 1KN2H 3G08B 3LRGA 4P3WA 4QHNB 4ZFZB 4AY0A 4A2LA 5CAYB 3HB3D 2JIXB 5LGHH 3P0YL 4ELMB 5EU3B 3VFVB 5T1MB 2WBJC 1S3KH 5SX5K 4Q74A 3W5MA 4YWGL 4AZ8A 1J7VR 2ZG3A 5E1HB 4NN6B 1WJ3A 4TTDC 2JJTC 1M7DA 2DQTL 1TZIB 3VXRB 1IM3B 1TZGL 2QHLA 4BFGA 3X11A 3KR3L 3U1SL 1X4ZA 3LSOB 5IMMA 1HHGA 3IB4A 3R8QA 2J6EA 3HI5H 2QR0B 5K59E 2MMXA 2AJUH 5HDBF 1U93B 2FGZA 1J1XH 4Z7WB 4LVNC 3DX6B 3V4VH 2CMRH 2FATL 2COQA 3EJZD 2ZCKH 4HFWA 4H0IA 5C08A 3WDHA 2A1WL 2VDLL 2CLRB 2BSRA 2R56H 3G6JA 25C8H 4GXUM 4NSKA 4KTEH 4O51B 5I0DA 2W9DL 5IB5A 1GXEA 4E41A 1G7LB 1KJ3L 4XHQA 2QQLL 4PP1C 5F93C 3WIFB 1NGWA 1CGWA 4RZCA 5B39B 3BO8A 1MFBH 1YMMB 4KQ4L 3O11A 3A6CH 3OF6A 1EEZB 3MRFB 3GBLA 5GGVL 2WWMD 4YBLC 2BVYA 2B2XL 5EUKB 4K3JH 4MSWB 3BKCL 1FC1A 5T1LA 4QRSB 1EGJH 2A0LD 4AK1A 2EDXA 1QEWA 2BY0A 2FYYB 3KPRE 2J12B 1S7XA 2V2XA 3INUL 1F45A 3MLWL 1IAII 2APBA 5CGMA 4RFEB 4YBHA 2V17L 5GRJH 3TZVB 3W39B 3MV11 3BZEB 4RISL 1GJIA 5DT1L 5JXEA 3ZTNL 2R0WH 2W65A 3P9WB 1F97A 3RX7A 1AKJA 1LEKB 4H8WH 5IMKA 3DX9A 2WBWB 2F54E 3NPSC 3P73B 2YXFA 3MYJB 1QZ1A 3GMNB 4XPAH 3UDWA 1QRNE 3VI3F 3SDXB 4J2XA 3IFLH 1NKRA 1X5HA 2BNQA 3FFCA 4O4YH 3ARBA 4HGWA 5IV2B 2ZUTA 4C59B 5DZLA 5J0BA 3DO7B 5BQ7B 5HYSG 3HR5B 1OQXA 3H3PH 5IM7A 4LPCA 4MYWB 1Q9OA 3QPQD 1ORQB 2JCCF 3T3PE 3CFEB 1WT5C 4I9WE 3SDAA 1OGAB 3S7GA 1Z0NA 4M7JH 4G43A 4HMCA 3N9GL 4LLDA 5ICYB 1ZLUH 2Y72A 4ZUTB 2UZIH 5AYUL 1MLBB 5CP3A 2X89D 4HWBL 5FYKH 4E9LA 2CUHA 3VXSB 5HGHA 2NXYC 2ESVB 5DC0A 1OAQL 2CIKB 5C0EB 1JGEA 4KKLC 3GI9L 3TIDA 4OCSH 2HH0L 4JFFD 3GK8H 1MHHB 3NCEB 1KT2B 4EEEA 4U0QB 1QSEB 4D8PA 4WWKB 5IW3A 3DXAB 5E70A 4F7EA 4NCDA 2DI9A 4LQFL 3NCJL 2IH3B 4YQXL 1Q9LA 5EPMA 4U6HB 4NQSB 3S96A 3D85D 5KZCD 1U8NB 3MRKB 5LXGL 1IZJA 3OAZH 4QRRD 3UEZA 5FO9B 5E9DA 2P5WE 4YC2C 1MFCH 1RU9L 2YD1A 3UBXI 3DRQA 3STBA 3BX7C 4P4KC 2V5SA 4LEOB 1RIUH 4QT5A 4WFHE 3OXRB 3KYNB 4BKLB 4H1LA 1TXKA 1IEBA 3MLZH 1F4WH 3IJHB 4QGYA 2AI0L 2ZSVA 4XPFL 1IAIM 3JZ7A 4OIIL 1QP1A 4XVJH 3L1OL 3LIZH 1HXYB 4W4OA 1T2QH 3VFOA 3LMJL 4P2QA 1L0XA 3H9HA 3PWNB 4F7TB 4ELKA 3DTXA 5E2WH 1AP2B 1JPGA 3RY6C 2NY3B 1T04B 1IAIH 1U8IA 4S11A 2NY5L 4PFEA 2QBWA 3L7FA 4NQCE 5I9QC 3ULUH 1A6UL 5SWQB 1YJDL 4LRIA 5SV4A 3VE0B 1I1YB 4M7KH 2G9HB 2RGSA 4PJ5B 2CRYA 2GJZA 4NM4H 1FJ1B 2H3NA 4X9IA 1J87A 1KFAL 1TENA 2X2YA 2ORBH 3DGGB 4MA8L 4IJ3C 4NO2B 2BOBA 4R4FL 2C1PB 4Q2ZB 4CMMB 1GRWA 3ROOB 2H8PA 1NBVL 1MJ8L 1ONQA 1VKXA 5J1TC 4UILL 1X5JA 3RVWD 2ICES 4U1HA 3TT1L 4JGUA 4LSPL 3LRSB 3BIAX 3CSBA 2YPLD 3KLHC 3HMXL 1KENH 4P2OD 5HI4C 1HZHH 1B4JL 5AEAA 5D7IA 1NUFA 1A6ZB 5C7XH 2HYMA 3GSNA 3HC0A 3QUZA 3JV5A 3P4OB 3RRQA 4LSDA 1BLNB 5F7YC 3E6HB 3VG9C 3IAQA 3S9DB 4U1GC 3GUTA 3P0VH 4O02H 5TFSL 4ZUSB 2OMBA 4WUKL 4HH9B 4WFEE 2OR8A 2C4XA 3H7LA 1I1FB 3CU7A 1RK0A 2NNAB 1GZQB 3SBWA 5GZNC 3TC9A 2WWKO 1CL7I 3IXAB 4RGNE 3UJJL 5DLMH 1Y6MR 3SCMC 5BVPL 4FG6C 4WCYH 1P9MA 2FECL 1OY3B 3PP4H 3LQZA 4IRZL 2VE6B 1Q9KA 1B6DA 1M71A 3HUJF 2PYFB 2WQ8A 3BDYH 1UZ6E 2CXGA 4R97B 1BZ9A 4YHMH 4GAFB 4HUNB 3EYOB 1X5YA 2Z35B 4KKBD 2R29H 4UQ3A 4XVSL 4NQDE 3ARFB 1EEUA 3QFJE 2CLVB 1Z0MA 2ICWA 1OTSC 3OKDB 3SDCB 3LKNA 5IHBA 1RZJH 4V2CB 4R4ND 4IDJH 5TGBA 3MXWH 3DV4A 4JO3L 4M00A 5C0BD 4O58L 3BKJH 2A6IB 2DQUL 1ZT1A 2J1KA 5E99H 3LHPL 1FNHA 4JM4H 2E7HA 5IW1B 4R2GC 2PXYD 4LSRH 5IF0A 2HJFA 2XNAA 3V0AC 2ZZUT 2H32H 3HE7B 5JHDA 4R90L 5JIHA 1MHPH 1CG9A 3IDMA 4BFEA 3VGHA 3EHBC 1QFUL 3T8XB 2NY0C 4CU6A 2F54B 4OBSA 4DGIL 2YR3A 1LNUA 3TA3A 4TUKH 4K3GA 2Y7QA 5DHVA 4YDKL 1CLCA 4NRXB 1QRNB 2VISB 4RAVB 1D6VL 1A7OL 2NXZC 1BHGA 4GRLD 2H2PD 4U1SA 3TJHD 3IVKB 1TPXB 5DJXB 2E7LA 2AJYL 1I4FB 1QNZH 1DVFD 1QYGH 1KJVB 3I3DA 4PJ7B 4D3CH 1DP0A 1TCRB 1VFAB 1J86A 1MFNA 3ET9F 2R2HB 5DEGB 5CIPA 3D0VA 5EZOH 3GSWB 3RL1B 3O2DH 1NGYB 4PJBB 1NCCH 4GMSH 4LGSB 1YPZB 3EOTH 1FLTX 3GHEL 5LQBH 4HCRA 3MOAH 4AEFA 3FJTA 2QKIB 1HIMH 4LPVA 4YE4H 4HXBL 5GRWA 3VW3H 3KYAA 2YKLL 4KJYB 3A67H 1Z5LB 4MCYB 3OPZH 3K4AA 3GBMH 2W60A 4D0BB 4HUUA 4X9BA 3VFSA 4Z0BH 2VAAB 1VGEL 2J5LB 5ICXB 4OLUH 5IP4A 3T09A 1O0VA 2C4FU 3DURB 4P2RB 4X5WB 3U0WH 2X1WL 1XR8A 3ZKMC 5J1AA 4LPYA 1V7NH 5F44A 2HVJA 1TCMA 1YEJH 5B3JF 3GZKA 5ICZB 3DUSB 1I7UA 4LBEA 1CL7H 3SE4C 3L9RA 4HJJL 1KTRL 1CLZL 2ATPB 5EORH 4OCYL 2PR4L 3H0TA 3CDGA 3JTTA 3WS6A 1DTUA 5L88H 3L5WA 4F9PC 2V2TA 1WISA 4M6ML 3PE9A 3TBSA 2VDRL 1JF6A 3GSXA 4KPHL 4JFEB 1INDL 2P45B 1NC4B 3KNBA 5D1ZB 5JHLL 4N0UB 5CHNA 4QHMB 4AENA 2HTLC 3VXNA 3NGBC 1EH9A 5CEYB 2WSKA 4Y2DC 1JMZA 1BQSA 2X4QB 3UTSA 3VJ6B 1JL8A 4POZC 2IALB 4NQEA 1QO3B 4MNGB 2Y07H 3FN9A 3K7UA 4L3AA 5F7DA 2W92A 2XZCH 2QQQA 15C8L 2B7DT 4OF0A 4NDMA 3WXWH 4JFFE 4Z7UF 1I8MA 1YQVL 1U8JA 5DJYB 1CGSL 3C8HA 4IRSD 3C60D 4WI7A 3LCYA 4I3SL 5BXFA 1IKNA 3VXPA 4RIRA 5IR1A 1LQSR 1NLDL 1IGFH 1NDMA 3VDCA 3FRUB 2ZCLL 3ZHLA 4G9FB 1UCBL 2NX5B 1IAOA 4XT1C 4OCRL 3QUXC 5LWYH 1BJ8A 4DN4L 4YHLH 1R5VA 3P9MA 1DQJB 4XCCL 1OP9A 3MUGB 3E3QE 1X4YA 4PJXA 4R0LA 1A9EB 5D96C 4QRRE 5ACMA 1WBYA 4P3CL 5JIIA 1DDHB 2XT1B 2J8HA 1HEZA 3W9EA 3O2VL 1MCNA 4GAYA 1RZFL 3NTCH 1W72A 4O2CA 3AB0C 5IFJA 2XN9A 1P1ZA 3QO0B 3HUJE 1AQKH 3FZUC 3MNWA 4EI6B 2Q7YB 1TVBA 2MJWA 5HGBA 1TQCC 5HYQA 3WHXA 3WV0A 5HSFA 1OB1A 2NW3B 4URTB 4LGPB 3QUYD 4PLJD 5AAMA 3LOWA 4FXLA 2CJUL 2FO4B 4ZFOB 2R15A 4X7TA 1Y18A 4GXVL 4NO0D 3CIQA 4FQJH 3SDYL 3HZYA 1CICA 2FH8A 4EI5D 5D70H 4CGTA 3KWWA 4JZOB 4K2UL 4NQDB 1N6UA 3X12A 4MQXD 5I73B 3QEUB 2LU3A 2DQHH 4RAUB 1A1MB 4ZFFA 4AL8L 3DBXA 5HHQB 3WNKA 1J5OL 3GBNH 3TCLB 3H9SD 3TN0B 1HKLH 2YUVA 5JPMA 3GDBA 2H6PB 2BHYA 1CFNB 3MR9B 5GGTA 1KCSL 3PIQB 1I1AA 1UM5H 2YPLE 1WWWX 4KAQH 1J10A 5IWLA 5T1DH 1PKQE 3BW9A 2BVOA 4NZTH 4QEGA 3ARGC 4BSVB 1BM3H 2JCCB 3QXVA 4CW1B 2CKNA 4NZUH 4JQVC 2ZUXA 4JFPB 3ILQD 3QWRA 4P4RB 1U2CA 2QADC 3QIUA 3G5VB 3KG5A 2NY7H 1KV3A 5IQ9B 1J05B 2P5EB 5CJXC 1FBIL 4WFGD 3L3HB 3CZJA 2D31A 1GGYA 4PRBA 4ZS6C 1OP5H 2FX7H 5IFHL 3MRMA 5F1SA 1I9IH 3E2HC 4M5ZL 5DO2D 2MSPA 1OTTC 5EU6B 3CVHA 3IFOA 3QQ3B 3OXSB 5DJAA 3V4UH 3UTTA 4K3DL 5I74B 1MREL 1LO2H 3TWCL 4YXHL 4PJHE 2Q1EA 4CVZB 1QLRA 3IU4H 4P4KA 5DRWB 3HC4H 1ZS8B 5A3IC 3LZFL 1E28A 2C7UB 4OI7A 1GGCL 2MCPL 1CQKA 3DWTA 3RVTC 1ADQH 1RZGB 4FQIL 3U46B 4XPTH 1RIHH 4IMKC 1JCKA 4Y19A 5C0BE 3NACH 4OI9A 1ES0B 4OFYA 3ZMRA 4YK4C 4CU7A 3AFLA 4XP1L 7CGTA 5TE6H 1F6AA 1Z3GL 3QULA 1S5IH 1H3XA 1FO0H 1MFEH 4PRIA 4ZPVA 5HHNA 2NY1C 4CUCA 1UH4A 1UENA 3BVNB 1DBKL 3EYQD 1G6RB 1ZKAA 1EO5A 3MBXH 2VB5A 5IW6A 3GJEB 1RZJC 3ZDXF 5C0RH 4GO6B 2DF3A 2IPKB 2R0KL 5JPNB 1MUJA 5J4MA 1MRDL 3VWJA 2EEAA 1QBBA 4E5XB 3S35H 5KVDL 3VD4A 2FHCA 4L4VD 3WN5C 4HIJA 4PGCA 2GSGA 1HOCA 4BH8A 4I18B 2DM3A 3UPRA 4X5XA 1X6LA 3I3BA 1I8IA 2X4PB 3CSPA 4QXTA 4ODSL 1M05B 1QG3A 3F7VA 2HFEA 1AXTL 1R6VA 5ESVB 43CAA 4Z7UE 1UQSB 5BRZD 3KHOA 3QWOA 1J18A 2XOTA 4J7RA 2OL3B 1I7RA 3N50A 4R6UA 1B0RB 2MQ3A 3NCCB 2CK0H 4JQIH 4LKCA 1RK1A 4IM8A 1KIQB 2KBGA 5HDOA 1CDBA 1PAMA 1MCPH 4YDVB 4G7VL 4F2MB 3PGCB 1YDPA 3FAWA 4YPGB 2X1OA 1Z9OA 4NWTH 3NFNA 3GSRB 1E27B 2ZP0T 5BMFL 4MJID 4LVOB 3PWUA 5CZVH 1KB5B 1XCQB 3LN4B 3Q3GA 4H20H 4NN5C 1I85C 2R39A 4WV1C 5FA4A 4XBPB 1G7HB 4ALAH 4HC1H 5JW4Q 2JB5H 2HN7A 4JN2A 4G8GD 3EYSH 3RY4A 4YEEA 3RWDB 3UAJD 4ZO7A 1HILB 1JRHI 1QSFA 2Z9TA 3IFNH 1CCZA 3WFDH 3RNKA 3P77A 3LKQB 3Q5YA 2AERT 5D6CB 1FZKA 5I1CL 5BJTB 2F5BL 4Q0XL 4UIKH 2I25N 5IROA 5IQ7L 2CQVA 1H3TA 4IS6A 3O4OB 1IRAY 2RBLA 5AD0B 5D7SL 1BBDL 4XGZA 1KUMA 5SWSA 4ZS7H 3BH8B 3EO9L 1NSNL 4ODTH 4TSCL 4B53A 3SKOA 1DBMH 3L3DA 4EKXA 3F58L 1NUGA 1E6JH 5KJRH 1S7QA 2VN4A 2YK1H 1OOAA 1SMAA 1UH2A 1JHTA 4RNRB 3CJJA 1UADC 4BFIB 4L8DA 4A6YL 3RVUC 1URLA 3KPQB 1QFWL 3LKOA 5DHXB 5FYLL 3QXAB 4PTTB 1ZGLP 4M48L 5GS3A 4QRTA 5GHWH 3SE3A 1DQTA 3FO2A 4HIEA 3S34H 1JK8B 1A21A 5DMJB 4P23A 4DVRH 3JBG7 2NZIA 5E2UL 3RAJH 4U1KB 1C16A 1FNAA 3S5LA 5D93B 2WAHA 3PQYD 4HUXB 5E08L 1TNMA 1FN4B 3MBED 3RVXC 1FNSH 3PWVA 3VGDA 2Y5EA 4JDZB 1INEH 1J9CT 1NFIA 3PL6A 1B4RA 3VXMD 2IQ9H 5JZ7D 2DMKA 3MLSH 1PKQB 1OCWL 1KG0A 4JKKA 4J4PC 2YPKB 5I2IB 3RVVC 1KELL 1HSAB 1XZ0B 3CXHJ 3C8DA 3E8UH 3QO1B 4PREA 4Z7NF 4UB0L 1F4XL 2X4TA 1MFAH 4FXGA 4OZGB 4P9HH 3T0ED 1IGYA 5ERWB 3IFPB 2J6EL 4O5LH 1MIEH 5I8OL 1LD9A 1S5HB 2UVFA 4K8RH 3O3AA 5CJBA 4HS6B 5HHMD 3EYUL 1A3LH 3QQ4A 1CD1B 4AT6B 3G6AB 3PGFL 4NUJA 5T5NF 2Q76B 2EICA 2QJDA 4ZOCA 3IU3A 4AEIH 1U8QB 4DKFH 2F19H 4PJEA 3SE4A 4GBXD 4H25B 1OM3L 2GJ6A 3NA9L 1NUDA 3QUMA 4PJCA 4X4XA 1EGJA 5E1AA 3T77B 1ERNA 1F8TH 2UUDK 2VWEC 4OZFG 3H9ZA 4NCC2 1JRHH 3G5XB 5C0BB 2FHBA 3GSVA 3H9SE 4P5KB 4TNVK 5CMAB 2OJEA 1CD9B 1DUYB 2PXYB 2OR9H 4PB0L 5DRXB 1MCLA 1Z9MA 2CH8A 4ZTOL 1QPXA 2HT2C 4Y2DA 5CUSL 2NTSP 5KSBA 2FBOJ 3BKML 4ZAKB 5DA0B 1U2HA 1ZA6B 4GXUN 4P46C 4HWZB 2QV2A 4FQ1H 2YRLA 4QRUB 2O5ZH 3Q6GH 5HVHB 4K3EL 3KXFB 1WC7A 1XGPA 1DL7H 5EBGA 2WP3T 2YEZB 1D9KC 3WKNA 4I2XA 1KLGA 3HAEG 3ARRA 1IM9D 4TTGA 2EDYA 4PS4L 4JZJB 3MXVL 4WFGE 5IFAL 2YS4A 3I50L 2I9TB 4Q6IB 3CGTA 3GRWA 4L3CA 2VUYA 3TVMC 3GIZL 4JVWA 4PJ8D 2V2WA 5HXMA 4OD3H 1OAYH 3MLXH 2DOCA 4MA1C 3FOLA 4F7MA 5F8QC 4K94H 4QGTA 4X6CA 3RU8L 5CZKA 2L7JA 3T2PA 1S78D 4FQQB 5J3HD 2IANB 3T0DA 3HMWL 3KLDA 2DLTA 1AD9A 3SDDD 5C2BH 3KPOB 1NQBA 4ZO6A 4TRPL 1Q94A 1HDMA 1IT9H 2G5RA 1WFNA 2M2DA 5JOFA 5TE4L 4B50A 1ZHBB 5DUBB 1YN7B 3HCVB 2GTZA 4UV7L 1I9JL 1C5CH 1LDSA 4HIHA 2VLLB 3FT4A 1RZKH 3GMMA 3QEGH 4LVHB 4EN3C 1LEIB 4L3EA 3TFKD 2MQCA 5DEFB 5FYLD 1VDGA 4NGHH 5ADOL 3FB8B 2W0LA 1DQML 5C09A 4FQLL 3KPPB 1RVFL 3IT8D 5L9DH 1KTDB 4GW1A 3DETC 5CEZH 5FHAL 4D0DB 4JREC 5D1QB 4KHXH 5DQJA 4XNQB 2FIKA 4MXWH 2EZ0D 4X98B 4BFBD 2AGJH 1GAFH 4L4VE 2DQIL 2R69H 1B9ZA 4XZUA 3QRGL 4XC3L 3C6LC 4POYA 1P7KA 2IC2A 4HG4J 1TETH 1HH6A 4I4WA 4NO3A 5KS9E 5ID0B 4UBDD 1D5ZA 4ODWB 2EDFA 3TBVA 4NRZB 2VLKA 4PRDA 5FYJL 2ZJSH 2HP4A 4NM8H 1FLRL 4ONHA 3KVQA 5BRZE 5IKCB 5FO7A 1CR9L 4OCMC 1ZXQA 2OX5A 3RUGB 4JM2C 3W81A 2WANA 3GNMH 4YFDB 4OZIF 4PIRF 3QEHB 5T33H 4ZOEA 2IAMA 4XH2A 2XICA 5JXAH 2BNRB 3B5GA 4Y4KB 4MJIE 3C2AH 5ESQA 2QSCH 1I8KA 5C1MB 5INDB 3SE9H 3MACH 1FAIH 4DN3L 4LASH 4WHTA 4WW1A 4FABH 5CSBA 3ZE2E 5HDLA 3NCYS 3BD3A 4TVPL 1G0YR 4G8GE 2R23B 3ZTJH 2V7NB 4EXPX 1HH9B 32C2B 4E41D 4L8CA 5ILTH 5DFWH 5L2JA 2OQJB 1EFXD 1HWHB 1RJLB 5T5FH 3GSNL 1JGVL 1NFDF 4L1HA 1G6RH 3OF6D 3HC3H 4D9RD 3SDCC 1IGTA 1AY1L 5T1LD 1T0NA 4MNQA 4NYLA 3DX7B 4BELD 2CLZB 2ILLA 4XX1E 3ZYOA 3RTQB 4PGEA 3FO1B 5HYSB 3QCVH 3QUYB 5IEHA 3WIIH 4C56D 4CU8A 5K9QI 3HS0B 5GGSA 4YXLL 4KZEH 2V5TA 5I66B 4ISVA 4EI5B 1HQ4A 3HZKB 1H9VA 4N8VA 3HPLA 1AKJD 4TUOB 4OGZA 4M1CC 4C83B 3WNNA 4RMRA 3MLTB 2HMIC 3V4PH 5DQ9B 4M9OA 2OL3H 2XKNB 1RMFH 4QNPF 4P3DB 3VFGH 1AE6H 2J8OA 2VJXA 2WUCH 4M1GL 1S9WB 3MV8B 3RGVA 1T3FA 4O2EA 5E03A 3ROLA 1TPXC 1RIVL 3P30L 4NCC1 4JY6A 3FFCD 3PP3K 1MLCA 3ARBD 1OAUH 1XMWA 3PQYE 4QY8B 2VDKH 4WUUA 2IEPA 5INCA 3VRLE 1N64H 1NGXA 1RJCA 1KB5H 5K9OB 4BSWB 3EO0A 3VXME 2B0SH 4U4BA 1EHLL 4XVTH 3GM0A 1E0OB 3LB6C 5AUMB 5K9JL 4HAGA 1G7PA 1S7TB 2G2RB 4FQXA 3AVEA 1A6VL 3KLAA 1SYVA 3C6SA 4ORGB 3WE6A 3BPNC 3JWOL 5CJOH 5C07D 4OCXH 3RKDC 1ZWIA 1BD2A 2J5LC 3T0EE 3U0PA 3BISA 1OLLA 2VLJA 3HNSH 3O2DA 3BGMB 5E2VL 2ADJA 3S36L 4ZUUA 3CFKB 4JFDB 1RUPH 4PRHD 4PJ9A 3KPMB 3QI9B 1JWSA 4XMLL 5TDPA 5LKNA 4NQVA 5HHME 1UB6B 1ORSB 5D71H 2HLFC 5IBTL 4YX2H 2VABA 4LRNL 5EO0B 3MRDB 1GZPB 1MAJA 4E42A 5DD3L 3RY5A 1KEGL 3CLEH 1G7JB 3HE6A 1QHPA 2IG2H 4RFNB 3ZYIA 1UA6L 1N7ML 3QDHA 2W1NA 3GSUA 4HCRL 2HJKB 1WITA 5J6GA 4KKCC 4JKWA 2YRPA 4XBGB 2FEDD 1AQDB 5E94B 4PY7A 4DCQA 2X4SA 4K8RC 1BZQK 5DA4A 1F00I 1QA9A 3P11H 3VXTA 3F62A 5KSAA 2MPAL 4TSAL 5DJCA 1CFVH 5KTEL 1JZ2A 2WK2A 3F8UB 1RJYB 3G08A 4QHNA 5F7FA 1AIFB 4KMQA 2JIXA 5TPWL 4ELMA 5EU3A 3VFVA 5D1ZC 3QZWG 5F70A 4OF7A 5FYJD 5T1MA 4Y16A 2OI9B 4DKDC 5CSGA 1CIDA 3BQUA 4JO4H 1NH6A 3H6JA 1XF2B 1UKTA 2KZ1B 4K9EH 2XTJC 3LRHA 3VXRA 1IM3A 1LO4H 4YPJA 3I9GL 4F57H 4X7SL 4ZQKA 1CVRA 2EIZB 4I77L 4PTUB 1K8IB 1CGYA 5LCVL 2Y36H 4APQB 5D2NA 3O8XB 2UWEF 3PHQB 5K33A 1CFBA 1MRFH 4Z7WA 1WBZA 3TLRA 3DX6A 4JY4B 4P59L 5TF1L 4KTDL 2AV1B 3FMGH 2HKHH 2VLRA 5JMRA 1YMHB 3OGCB 1EUUA 4NWUL 1GOFA 1AGCB 2OJZL 5JMOC 1I9RH 3WFEH 4OZIE 2CLRA 3HTLX 5TQ2L 5BW7A 3CVIH 3EOBA 4UDTB 2GSIB 2YBRB 4O51A 5LVEA 1U9KA 1G7LA 2DQDL 4JFHD 2MHAB 3WIFA 3V79C 3U4AA 5GS2D 1JN6B 3QEQB 1HSBB 5B39A 1YMMA 4NKMB 1EEZA 2VDML 3MRFA 1S7VB 2IADB 3VXQB 2O5YH 4F8QA 5EUKA 3FCTB 3WJLA 1Y6KR 3MREB 4MSWA 4QRSA 5LBSH 1CXKA 4MWFB 1ZLWK 5I1JL 2FYYA 2E9BA 1Q0XL 4XTRD 4JG1H 3MODL 1X5XA 4HIXH 2X7LB 4RFEA 4WENB 2XY2A 1NFDE 1MEXH 1NCAL 4MAUH 3TZVA 3W39A 1JZ7A 3BZEA 1KPVB 4ZSOB 2HFGL 2B4CL 2R8SL 3PV6B 4Y4FC 5I1EH 3S37L 3S36X 1LEKA 2OM5A 1OARL 4DK3A 2YD9A 5FYLE 3MUY1 3E1F1 3P73A 2PW1B 1PEWA 2JJUA 4U6YB 1DQDH 5I73C 1GGBL 3L3GB 3TT3H 4HJ0C 3GMNA 4FZEH 4GS7B 4WI9A 3QP3A 1P4IH 1U58B 5MENB 4GRWF 3OJDB 1K6QH 4U33A 5DD5L 2AABH 5J6HB 1W72L 3EW3B 3WYRA 5DJ6B 3TN0C 3WKML 4X5LA 1IEAB 5IV2A 1RZKC 4KV5F 3DO7A 1JNHB 5BQ7A 4BZ2L 4WI6A 1NGZB 1A14L 4NJ9L 1ORQA 4QNPE 5JHDD 1OGAA 4GSDL 1H0DB 4XP9H 4K71C 1U8LB 1NCDH 3MRQB 4PD4J 1MLBA 1WAAA 3QDJB 3TM6A 2ESVA 2WP3O 2CIKA 5C0EA 3DSNA 3T0XA 2O5XL 2OK0L 3TJEH 2P4AB 3WIHH 1EMTH 4G3YL 3BI9X 4U6XB 1MHHA 3W9DB 3CXDL 3TBTB 4BH7B 1QSEA 4WWKA 4R96B 4X6FB 3LAFA 3WJJC 4JDTH 1WFUA 2VXQL 1ZGLB 5MI0B 5CILL 2IH3A 3PQYB 4OTXL 4I0PB 2C3VB 4U6HA 4FFYH 3PWPB 4FS0A 3C87A 2ARJB 5KVGL 4NQSA 4EUPG 5C08E 1U8NA 3VCLB 3VXMB 3JWDC 1R5IB 4LSVH 5GGTL 5FO9A 1RUML 1YEKH 3LD8C 1MFDL 3AMLA 3VH8B 4E41E 1NAMB 4LEOA 3M07A 1A1OB 4Y89A 3RX8A 3OXRA 3KYNA 4BKLA 5HJ3B 3FQTB 3HNVL 4NFCA 4D9RE 3REWA 2H41A 3QIBA 3C5JB 1N5YL 4NC2B 4CDGC 5F1OB 3TV3H 4XMPL 1I3GL 3ISWA 1HXYA 1DBAH 3GJFB 2YUWA 1MNUH 5AZEH 5IVNA 3PWNA 4F7TA 4C56E 4OSUH 5F6HJ 5L6YH 2GY7B 3VDBA 4UUJA 3HZVB 3B9KA 3C8KA 2EE2A 4NT6B 1T04A 3CVHL 1DLHB 4GBXB 3HG1D 1ADQA 4AM0B 5SWQA 43C9A 1WGOA 2D7TL 5C0ND 3VE0A 1I1YA 2Z4QA 5EO9A 4F15B 5IGXL 3C08L 2IMMA 4OZHF 4PJ5A 5GIRB 1FJ1A 3S37X 4PJDF 5F89B 4ZMAT 3DGGA 4NO2A 5AYQA 2C1PA 4Q2ZA 4CMMA 4K7FB 3ROOA 4NJAL 2Y6SD 3NIGF 2BNQE 3FFCE 4GAGL 1T7ZA 2EH7L 2WBJD 3FO9B 1YEEL 4OIBA 4N0YL 4QRQB 3UTSD 2UWEE 4BK5A 3EJJX 3ZKND 3EFFB 3P4OA 5DQDH 1CXLA 4X80L 1BLNA 1RURH 2ZUUA 3E6HA 3OV6A 1S8DA 5MEQB 3FTGB 4ZUSA 4HW6A 5IMLB 3BRFA 4HH9A 1JVKA 5F9OL 1A7PH 5C07E 1I1FA 4L5FH 2NNAA 1GZQA 1T0PB 5E4IA 4LVOC 4LEXL 1B88A 4JO2H 3CSYA 3IXAA 3N85L 1FFOB 4OFKA 1SBSH 4OZIB 2R9HD 1HXMB 4PRHE 4Y5VB 1YEIL 2EYRB 1EJOH 2OTPA 5B8CA 2PYFA 1JNNH 1V3JA 3EYOA 4JY5H 3TO4B 3K8MA 1J1OH 2XPGA 3ARFA 2V5YA 5GRZA 4TNWK 3OKDA 4NHCH 3SDCA 1WCBB 3D18B 4KXZI 3FT2A 5F6IB 2XN9D 2I27N 4IHOB 3SDDB 1J1PL 2A6IA 2FJFB 4ONFL 4HC1A 3GKWL 3O3DB 5I18H 1NFDB 3SY0A 1G7IB 3BE1H 3QG7H 1IBGH 3DVFA 3QIWB 4MJ6B 2DBLL 1P84K 3D9AH 4U1JA 3HE7A 3L95B 3VWKA 4IOIB 2KL6A 5FYJE 1LDPL 1HWGB 3BMWA 4IBLT 4C58B 4GRWE 1TJGL 1CZ8L 1PY9A 4ERSH 3MNVB 3QA3B 4R7NB 3T8XA 3DARA 3GHBL 1KEML 2F54A 1OP3H 4ODUB 5F3HB 3WHE1 5HTSA 3EO1A 2IBZY 4Y7MA 4FFZH 5J56B 4M7LL 4ZUWB 4G9DB 1QRNA 2MQ0A 1IC5H 2VISA 4RAVA 4Z95L 5ALBL 4O9HL 2A83B 4YHKL 4PRAB 5D6DA 3UJIL 5DJXA 3SKJL 1UFUA 1I4FA 3FONB 1KJVA 5D72L 3MOBH 4PJ7A 2VDPL 4OKVB 2VIRB 1TCRA 4U31A 4JHAH 3U30C 4MD5B 1JPTL 3L3IB 4FHBD 3MJ9A 5DEGA 4V2BA 2LABA 5CCKL 3GSWA 4K9EC 4MX7B 3RL1A 1NGYA 2EEDA 4XP5H 1D5BB 4YDIH 1H5BB 2NXYD 4Q97A 1JUFB 2Q20A 1EEQA 2QKIA 4JFHE 4RMUA 4KKLD 1KCUL 4ZFGL 1LO0H 1RHFA 3GEWB 5J12C 4KJYA 1CBVH 1MCRA 1Z5LA 5GS0H 3U7WL 3OHXB 4H88L 3BEVB 4D0BA 5J89A 3O6KL 3Q6FB 5HGAA 3QWRD 2VAAA 3NFSH 5ICXA 1KN2L 2WUBH 5LGHL 4PJXF 3DURA 2KQMA 4P2RA 1S3KL 4YIQA 3CFDB 2P8MB 3MC0A 1KOAA 1ITCA 2PETA 1FNGA 3MPCA 4MQTB 2Z31B 3DUSA 5I75B 3SO5A 1LP9B 3JV0A 5FUCC 2GCYB 3QHFH 4LQ1A 4RAHA 3MRNB 4PJIF 4G8IB 3U9PH 3WXVH 4P4KD 2ATPA 2CRZA 3CX5K 4YXKH 1FFPB 3HI5L 3GMPA 5IHZB 1XIWC 3TYGL 4NHUA 1QPPA 4OB5H 5GGRY 5DUPH 2HT4C 1J1XL 1ZHNB 4TOYL 3V4VL 4ENEC 2CMRL 1ZSDA 4NKIH 3VFNB 4Y19D 2ZCKL 1CF8H 1ZA3B 4QYOA 4S0TD 4OFYD 3HR6A 5BS0B 2B1AH 1I3UA 2ZUSA 4C56B 4RMSA 5F1IB 4EIZC 2HFTA 5D1ZA 2R56L 4N0UA 5D2LB 5EIQA 5GS1B 1YECH 4KTEL 4OZHE 1CDUA 1OSZA 5DHYB 5CEYA 4PJDE 2X4QA 5JHDE 4NQCA 4EBQH 5BZWB 1MFBL 2IALA 1QO3A 3STLB 4MNGA 3A6CL 4C57C 3NIGE 2R2BB 4YEFA 4KRMB 2LU7A 1C1EH 4K3JL 2YZ8A 1EGJL 1JZ8A 3AXLB 1FCGA 4OGYH 4U6VH 1Y6NR 4KI5C 5DJYA 4JFOB 4J1UB 2Q6WA 4DW2H 2ZPKH 3CD4A 1ND0B 1T1ZB 5GRJL 1BPVA 1FNLA 3FRUA 4NP4H 4G9FA 1YNKH 1WIOA 2R0WL 5TJWK 3KS0H 4J23A 1HN1A 1ZOXA 4M61A 4H8WL 3KLHD 1DQJA 3MUGA 3CMGA 3N1QC 2BVUA 1A9EA 4XNMB 1P5UA 1U3HC 1CE6B 4N5UA 4XPAL 1T66C 3WFBL 4WTZA 4PGBB 3OKEB 3OAYH 4X6EB 4MD4A 2EXYC 5C07B 1RUAH 3IFLL 2YWZA 3QO0A 4O4YL 3VD5A 5B38B 1F11B 4EI6A 2Q7YA 3CLFH 3S98A 1YEDB 1UACH 3H3PL 4GUPB 3RHWF 4DZBA 5GZND 2NW3A 2QL1A 1RZIA 2OR7A 4IDLA 4FG6D 2FO4A 4GT7A 1K8DB 1MCOH 1LK2B 2UZIL 1WF5A 5FYKL 2PUQT 1CXFA 3BZFB 1XT5A 3FN3A 3RZCB 5T1KB 2NY2D 2ZCHH 2FBJH 4OCSL 3KYOB 2Q8BH 3HG1E 4JZOA 4NQDA 3GK8L 5IIEB 4X0KB 3BN9D 4MAYB 1SQ2N 4M1DH 5HYFA 1VESA 4QHKJ 2VH5H 1BEYH 4OF3A 3ZKXB 4RAUA 1ZGLM 1A1MA 1PX4A 4LSSH 3LQAH 1PY4A 5BV7B 5HHQA 2XTLA 1CFQB 5F1NB 5FO8B 2IGFH 3TCLA 3ZT6A 4UINH 3KPNB 4Q9QH 4NRYB 1MI5B 5CLTA 4R2GD 1BOGA 2H6PA 1CFNA 3MR9A 3DIFB 4WTWA 2MTPA 3PIQA 1MFCL 3GIVB 3EHBD 5DR5H 2NY0D 3UTSE 4G6FB 3IAGC 3K8LA 1XGYH 4LSTH 3V8CA 1RIUL 1U8HA 2Z91B 4K7PH 4NQEE 4BSVA 4ORZC 2JCCA 1F4WL 4CW1A 4FFWC 3BGAA 1N6QH 4JFPA 3T2NH 4P4RA 2N7AA 5ADPH 3G5VA 3DV6B 4XVJL 3RBSA 1UC6A 3LIZL 5IQ9A 1J05A 1T2QL 2P5EA 2EDHA 3L3HA 4Y4KC 2VN7A 2OLDA 3ARYA 1N5AA 2DWDB 5E2WL 4DQOH 1IAIL 3QQ3A 3OXSA 1U91B 4JRYD 5FA3B 2BMKB 3GJFH 3ULUL 4EZMA 2XZZA 4WO4B 2AAVA 4M7KL 1TVHB 4PJXE 1RUKH 5DRWA 4NM4L 2UUDH 1ZS8A 2C7UA 4ODXB 5JW5B 2ORBL 5IB1B 4NKOB 4M93C 1NBQA 3BKYH 3U46A 3AMKA 1PJ9A 5C6PB 2GUOB 3VRJB 3RZWA 2XN9E 1OSPH 4AYFA 1ES0A 1CXHA 3WEXB 3MRBB 3NBNA 1XR9B 3RTQC 1BBJB 3B2VH 3ZKMD 4XPGH 1CXEA 3JTSB 4OD1L 4DTGH 1KENL 4Y1AD 3NZ8B 4XAWH 12E8H 1HZHL 3G5YB 2BVEA 1CLYH 2FJHB 4DEPB 3BVNA 5C7XL 3FQUA 1G6RA 3V5HB 2R4SH 1S9XB 4YHOH 4B5EA 2GJ6D 5FM8A 5CD3B 1ZLSH 3P0VL 4O02L 2YPVH 5E6IB 4XNZB 4HT1H 4EJ1C 1IGJB 4FRWA 5DTFB 5JQ6H 2CXKA 4KROC 1X5AA 3OTTA 2YUXA 4I18A 5DLML 4H1LG 3PWLB 4WCYL 1WFTA 2X4PA 1A2YB 1BFOB 1M05A 3PP4L 4FQPA 4L8SA 4OZHB 5ESVA 2HTLD 3BDYL 3WLBB 4U2ZA 1SBBA 2NY4B 3CH1B 4LCUB 1UQSA 2SEBB 1XH3A 4LK4A 4Y2DD 5F3BB 3IRZA 4YHML 2X89A 5I19H 5C6TH 1G9MC 2OL3A 2R29L 2VSCA 2CDEB 4POZD 2YC1B 3OB8A 2WNGA 4HK3J 4LARH 1CN4A 1IQWH 4IDJL 3RWGA 1J11A 3MXWL 1A3QA 4FQHB 3QCTH 1WV7T 1XF3B 2CUIA 2APXA 3BKJL 5FGBC 4YDVA 2J7LA 5E99L 4JM4L 4XNXL 1KF9B 4F2MA 3PGCA 4JB9H 4YPGA 6FABH 3GSRA 1E27A 4LSRL 1KB5A 1XCQA 3LN4A 5CGTA 3V6FB 3D0LB 1MHPL 3QI9C 4UT9H 2H45A 4XBPA 3QUXD 5DURB 5IG7B 4HS3A 3QJHB 3RWDA 1ODAA 4TUKL 3DVNB 1HILA 5GS0C 2ERJB 4OFDA 5JORB 3EYVB 4KVCH 4LIQE 3AS0A 4JG0H 5ANME 4OCNC 5D6CA 5BJTA 5JW3L 1N59A 4MHHG 4LSQH 2A9MH 1QYGL 4RMWA 3KDMB 5AD0A 3HLAB 5F7MC 4D3CL 3FZUD 5EIIB 4XCNB 3R1GH 3P3YA 3RKPA 3RWJB 4RGMB 4BK4A 4Y19E 3BH8A 4PG2C 4WI5A 5EZOL 3O2DL 5E5UB 1U8OA 1NCCL 5I76B 5E7BA 3FQNB 1UM4H 4RRPG 3QUKA 3UZQA 3EOTL 5LQBL 4HAFA 2EH8L 3MOAL 3BWAB 1HIML 1V05A 4YE4L 4L3ED 4BFIA 3VW3L 4W6YB 4CJ1A 2XG5A 4HJGB 5C09D 2WINB 3A67L 3QXAA 1JFQL 2G75B 4UNTA 4PTTA 3FRPA 4NOFA 3GBML 5EU7C 2VZTA 1F3RB 4Z0BL 3O81A 3PDGA 2Q86B 4HUWA 4OLUL 3VG0H 1JK8A 4APQC 5E5RB 3O8XC 4M02A 4XNUH 5DWUH 3TBYB 5JUEH 2B5IC 4U1KA 1S9KC 3FO0H 5ISZD 3UPCA 1V7NL 2R4RH 2BVQB 4HUXA 5DVNA 1FN4A 1YEJL 1YYMH 2DQFA 1SJHA 4JDZA 1MY5A 2GFBB 1MJJB 1T83C 4ZTPH 1MCCA 1CL7L 1JPSH 4P2OA 4NQTA 1PKQA 4LFHD 4U7SA 1HE7A 1IC4L 3HZMA 5EORL 3SGJC 1HSAA 1XZ0A 4G8FB 4KK9C 5CZXC 5F1KC 1UVQB 1A7RH 2WLZA 5L88L 1P53A 5MEPB 4U1LB 4XC1H 3VMPA 5CLWA 3AM8C 2IAMD 3JUZA 4HS8H 1RQ5A 5ERWA 3IFPA 2XI9A 2QSVA 2A6DB 5AWNH 1OT1A 2X09A 3VMOA 4XPHH 5IVZA 4ZS6D 1A9BB 3D6GA 4HS6A 4PV9A 4Z5RB 2DJSA 3TGXA 1CD1A 4KRPB 5IJVA 3G6AA 1OTTD 4JJHA 3QXUA 3MOQA 2Q76A 1U8QA 2Y07L 3L3OA 4NZJA 2PYEB 4H25A 1ZTXH 2XZCL 1MAKA 3V8OA 3ARVA 3WXWL 5IT2H 3KJ4C 1HCFX 2F58L 3T77A 5A3ID 5HY9A 4U6TA 5D7JB 1D5MB 4PPTA 3RX5A 3RVTD 5EUOB 5C0BA 3G5XA 1IGFL 3O9WB 4MQ7B 1BGXH 3PP3H 4PJIB 4P5KA 3OAUL 2HG5B 5CMAA 1DUYA 2PXYA 4F80A 5DRXA 4OJFH 4YHLL 1OPGH 2NY1D 4KGJA 5EB9A 2VZVA 4OLVH 4KY1H 4ZAKA 1ZA6A 4PBXA 5DD6A 1BQHG 4HWZA 4WTXA 1QSZA 3OR6B 4QRUA 1RHHB 3CC5B 3NTCL 3KXFA 3MO1B 5JDJA 1AQKL 2BHZA 2YEZA 1T89A 2IJ0C 5FF6B 4F8TA 4NQUA 3LPGA 5MI0C 2VZOA 4JZJA 3FB6B 3V52H 3H2WA 2I9TA 4I0PC 1AHWC 4K3HA 4Q6IA 4JAMB 1FCCA 4Z7UA 4WW2B 4KC3B 4FQJL 1RFDH 3V5DB 1PD6A 1KCVH 1NCBH 3P4NB 2F8OA 1UH3A 4ONGH 4P5TB 2HLAB 2IF7A 4JRYE 1PLGL 1YEFH 1G84A 4GKOA 4S0SD 2DQHL 1PG7H 4FQXD 3IXTA 1CU4H 4FQQA 4BA8A 3GBNL 1WWBX 1MOEA 1HKLL 2NW2B 5FV2A 3KPOA 1PX3A 5DJ2B 2VLJD 5FDYA 5HD8C 1ZHBA 3QZWB 5DUBA 1YN7A 3HCVA 1UM5L 2UY6A 4KAQL 2DLIA 4WGWB 2VLLA 4Y1AE 1O7SA 3X13B 5T1DL 1LEIA 3BOVA 3H3KA 1VACB 4K07A 1T7WA 2O61B 5DEFA 3FB8A 1BM3L 3KPPA 2GJ6E 2YA1A 4G5ZH 4NN7C 4NZUL 1KTDA 4BSJA 5I30L 4D0DA 1EERB 4F15C 4MVBC 3O6LH 1I7ZB 4K23H 4LLVB 5D1QA 2GT9B 2NY7L 5BCAA 4XNQA 4X98A 3I6KB 1T7VA 1RULH 2FX7L 1A7QH 1IVLA 1I9IL 4R8WL 3P2TA 4NNYB 1TTFA 1WVZA 5I1LB 1P5VA 1NGQH 5ID0A 1DQQB 1AGEB 3DYOA 2JIXD 4ODWA 1XGTA 5CINH 4GMTH 1LO2L 1R3IH 5FOBA 4OQ1A 1U42A 3IU4L 5KSBE 5IKCA 5D1XC 3RVUD 3HC4L 3MRLB 1CWVA 4Y5XA 4F37K 1CGUA 2NZ9C 3CK0H 2PW2B 5DK0B 1ADQL 3FQWB 1YEGH 4XPTL 1ZLVK 1ZLWH 4IRSA 3RA7H 3NACL 2A73B 3VGFA 1FYTB 3C60A 4IJ3B 1HYRC 5TE6L 5F7NC 4UTAH 4I2XE 2BNRA 3ABZA 4K55A 4OZFH 3AREC 1S5IL 2J8UF 4Y4KA 1MFEL 2ICEB 1LHZA 5KBNC