4PJ6A

Crystal structure of human insulin regulated aminopeptidase with lysine in active site
Total Genus 296
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
296
sequence length
867
structure length
860
Chain Sequence
b'KLFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucyl-cystinyl aminopeptidase
publication title Crystal structure of human insulin-regulated aminopeptidase with specificity for cyclic peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 296
structure length 860
sequence length 867
chains with identical sequence B
ec nomenclature ec 3.4.11.3: Cystinyl aminopeptidase.
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF11838 ERAP1_C ERAP1-like C-terminal domain
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.60 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4pj6A02
1.25.50.20 Mainly Alpha Alpha Horseshoe Zincin-like fold Zincin-like fold 4pj6A04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 4pj6A01
2.60.40.1910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pj6A03
3CHPA 3QJXA 4ZX4A 3CHSA 4XMTA 1HS6A 4K5OA 3FTXA 3RJOA 4QUOA 3B34A 4K5MA 3Q43A 4FKHA 4XN9A 4NZ8A 3FU0A 3FU3A 3FUMA 3FTUA 4R5TA 3B2XA 3B7RL 2YD0A 4FYRA 3FH5A 5DLLA 4K5PA 4ZW7A 4FKKA 1Z5HA 4Q4IA 4XMVA 4XN5A 3U9WA 4ZW8A 3CIAA 4KX8A 4Q4EA 4ZW3A 4XMWA 4F5CA 3FUNA 3B37A 4X2UA 4ZQTA 4WZ9A 2VJ8A 5DYFA 4ZW6A 1Z1WA 4XN7A 2XQ0A 4QIRA 4KX9A 2DQMA 4Z7IA 2XPYA 3FTVA 3FUKA 3FUDA 1SQMA 2ZXGA 4OU3A 4K5LA 5C97A 3FH7A 5FWQA 4K5NA 4FYTA 4RVBA 3FH8A 4ZX5A 3FTSA 4XN4A 3Q44A 3FU6A 2XPZA 3MDJA 5LG6A 4XN2A 3FTWA 4XO3A 3B2PA 3B3BA 3T8VA 4PVBA 4FYQA 4XMXA 3SE6A 3EBHA 2DQ6A 3FUHA 3FTYA 1H19A 3FUJA 3FUEA 4RSYA 4ZX3A 4KX7A 4MKTA 4KXAA 4XO4A 2GTQA 3B7UX 4XN8A 3FHEA 4XMZA 4FKEA 3CHOA 5AB2A 3CHQA 4L2LA 4MS6A 4GAAA 4QHPA 4XNAA 3PUUA 3EBGA 4ZW5A 3CHRA 4XO5A 5LDSA 4XN1A 5BPPA 4XNDA 4J3BA 4NAQA 4R7LA 4R5VA 3FULA 4XMUA 3FTZA 2R59A 3B7SA 1GW6A 4DPRA 5AENA 3FU5A 3FUFA 5J5EA 5LHDA 3Q7JA 4XNBA 4HOMA 4E36A 4KXBA 4PW4A 5AB0A 3B7TA 5J6SA 4QPEA 4JBSA 4R5XA 2HPOA 4KXCA 3QNFA 3EBIA 4PU2A 5K1VA 4P8QA 4QMEA 4ZX6A 4FYSA 4PJ6A 4FGMA 3KEDA 4KXDA 2HPTA 5CU5A 3FUIA
chains in the Genus database with same CATH superfamily
1NDMA 1BIIA 1FFPA 4PIBA 3OC8A 2BFVL 1ZLWK 3FDWA 3C87A 4QRSB 3QUML 5IESH 2WZPA 6TMNE 3VWJC 3BXNB 4WY7L 4Z7NB 2G3MA 3TZVD 3BPCA 4R3SA 1U36A 1JZ6A 4KPHL 3PP3K 5HHNA 2XRAL 1EDQA 2A38A 4HUXA 2AK4A 2YD9A 5IKCA 1NDTA 3L9YA 3GLZA 2YGOA 4PRPA 1BQLL 5I6OA 1KXTB 1FJVA 4N1EA 2DQGH 3AG4B 4UILH 3D18B 1KBKA 2VWEE 5KSBA 2ADFH 3HMXL 4KRPD 5DSCA 5ACLA 1DN0B 3GIZL 4HUKB 4EIGB 1QMUA 3BFQG 3D2UD 3CVHL 4WW2F 1UYWL 3QWRD 4GAJL 1DVFD 2C4FT 3WSQL 1FL6A 4GRLD 1U4GA 2FH6A 3F7YA 3WTUA 2C9PA 2PYED 3QW9A 5DHMC 1DQQB 4K7PL 2CGRH 3FTSA 5FCUH 3BAEH 2COQA 1LWRA 2M1KA 2M83A 4D2NA 1XF5A 1IQWH 3HPJA 4LCYA 4DN3H 4EF3A 3NAAH 4G11A 3MBXH 4WK0B 3U7YH 3GBDA 1GXEA 3O9WC 2W0FA 4PJIB 1KIUB 3PABB 1KB3A 4ZFGL 1NICA 1H19A 4LLQB 3VGBA 3R7QA 4CC4C 4KX7A 4LP5A 4Z6AT 2DD8L 5E24E 1KGJA 3CIQA 3Q2NA 3ZLQC 5ADPH 3TF4A 1KJMA 1RIVL 2DTML 4MMZA 4PY7A 2B1AH 5EC1B 1HKLL 2WN2A 3GMMA 3MRIA 4U3CA 4W9ZA 1EX0A 1OP3H 3AQYA 1DEEB 4I88A 3WN5A 2IOOA 4R7DA 4IGBA 5F0PB 2L7EA 4DHLA 5TFSH 5L7XH 2VXVH 2VT0A 2VERN 3IT8D 3HUJE 3CZGA 4JJOA 3V0DA 2R59A 2ITEA 3ZDYF 1NGXB 4OUUA 2DQJH 3CFNA 4HSCX 5C6TH 1YEJH 1KELL 3DYPA 2OMYB 1YAIA 1PYWA 4DN4H 1N0XH 1P6AB 1BOYA 1E4XL 3FTGA 5DPEE 4P59H 4FAAB 3LKPA 5CEZL 1WO2A 2AZAA 2NSQA 1OL0A 4N2OA 5D93C 2WO3B 1LNAE 3H7BB 3PPSA 2OCJA 4P5TD 2DQIL 2X0VA 4LBAA 4OGXH 2WI0A 2VDRH 1KOAA 5C0RL 5J1AB 1DUYB 2VW6A 1GHFL 1NMCB 2HPTA 2EDYA 3CC5A 1XZ0B 3IE4A 4AL8L 3JWOH 1R34A 3R1GL 2Y0SA 1FL3B 3IKCA 5KZCB 5EDSA 4Z3EA 3C08L 3WTVA 1F2XK 2HFTA 3O4LA 4KWUA 4AXWB 4TV3A 3HE6C 4PRBA 1EMTH 1FL5B 3IYLW 3W11C 1EEYB 1OKEA 1A8ZA 5HHOE 2D7TH 1JHKH 4HXBL 3G5ZB 5JPNB 5CILL 2VC2L 3Q2LA 4FNTA 1A64A 4MD0A 3QEHA 3MV8A 1QVOB 1FO0L 2VDKL 2F15A 2H45A 3VRLF 4YQXL 4BDVA 4K71C 4MYWB 3KBHE 2PCPA 5BUGA 5FFLA 5HBBA 3BZEA 2APXA 2AJXL 2NLJB 3HI1B 1BBJA 1QOKA 2QGBA 3FU8A 1MNNA 2FEEI 3FB6A 3Q6GL 1AQKH 3MXVH 4GG8B 4H8QA 2AK4E 3VW3L 4HS8H 3WN5C 1W72L 4PRPE 5BZDA 1H0DA 1RUPH 1AR1D 4IGBC 2H2PC 5KSUA 4S1SL 4QHMB 5DUBA 5KSBE 3V5DA 3DI2B 4GSXA 3DMMD 4J8RB 1A2YB 4BWTA 3AQZA 3FKUS 4ZUVB 4F7KA 3B83A 3V8CA 4JQVA 4M61B 3GM0A 3APDA 2CQVA 2OKMA 3GD1C 4ONOA 3KLQA 1KUMA 1QX1A 1MCKA 1VZHA 1XGRA 1ZSDA 5J89A 5LAXA 2J8OA 3U0TA 1F4YL 4WGKA 5BQ7B 1CGUA 32C2B 1INQA 1QNZL 4WK2B 1TETH 5FYKD 2E0PA 4YDZA 3DVNA 4JVPA 4UAOB 3MZTA 1NIBA 1VACB 5MEOB 1BM7A 5CP7A 1IIKA 3DXAB 1T7VA 4Q52A 2G2PA 5KBNC 4NQSA 4BKLA 1XT5A 3P2TA 5AFAA 1IBBA 2P8PB 1GMEA 2A9MH 5C9JA 1R5WA 1Z3RA 3FU5A 1N0LB 4HU2A 3IU3B 4R7VA 2LQRA 1I85A 4ZXBA 4Z8FL 2YKKA 2XQYG 3NIDE 1MJ7H 3QO0A 2AKRA 3T77A 2X12A 3L2LA 3ULVL 4OTXH 4NENB 2EECA 3BWZA 1IAOB 4YK4B 2PP7A 4OGYL 4OI9A 3FCTB 5BNXD 3AADB 3D4GA 2I26N 1L7TL 2WXKA 1I1AA 3QNZA 1DVZA 2VQ4A 4F8LA 3VSQA 3VWKC 1LO5A 3AS1A 1U95A 3VGEA 3NQXA 2NNFA 3VQ1C 2E9JA 3JWDC 1MVYA 4L4VB 3WO4C 4MJ4A 5DC9B 5DHVA 2CKBA 2R4SH 1B2WL 4B9CA 5EF2A 3TC9A 3T8MA 1M3IA 3K1DA 2XQYA 1CDIA 2IAAC 4LIQL 4Z7QB 3GTNA 5KVGH 2LABA 3NJNA 4HAGA 3B7RL 3UP6A 4GBXB 1OW0A 3HVDA 3T9WA 2D3LA 3S8WA 3DUHA 2UY7B 1TNNA 4UDUA 5CEYA 5C09B 5BV7L 3MRFB 3DVGA 4N0UA 1CT8A 4I77H 1IGCL 5FGRA 1F3JB 2YGNA 1T5WA 3CG8A 3MLRH 4ZAKB 1S78D 2AQRA 2FSEA 4N2HA 3O4LE 3TNNA 1D5BA 5CFHA 5K39B 4TTDD 3NJHA 5IVXE 5I75B 1EIBA 5KUMA 1CLVA 2VIRB 4DAGH 3FB7A 3T2HE 3F7KA 3VD4A 2FLMA 3K2KA 3ZKQD 2GSGB 1IBFA 4QYOA 2OJ1A 3MV8E 4YHYB 3VD3A 2FX8H 2WIIB 3DRTA 3D06A 3V4LA 1KIRB 3KWUA 4ZXBC 5J1SC 1I85C 1LD9A 3VFWB 4F1ZA 1UHVA 2AJVH 2JJUA 1RHFA 4KXAA 1SYSA 3NA4A 2W65B 5BOZG 1ADQA 3NEEA 1NEUA 1JPEA 4BYHA 1K72A 5IJDC 1I1AC 3QUHA 1UOKA 4HV8B 4Y16B 1JGLH 3BH4A 4I0PB 4PY8J 3V52H 43CAA 4ZTOH 3K2UL 4MJ5A 5EFIB 1SJEB 5D72L 1G6RB 2XV2A 4X5WA 4MAZA 4YSTA 2J6EH 4Q6IA 4G8EB 4XO5A 4XN1A 4K8RC 1GGYA 1NL0H 3P0VH 5IBLC 3UTPD 2DRUA 3GS0A 3KJ4B 3MRMA 3NCFB 1YEEH 3DX8B 1P5UB 3BAEL 2KUTA 1Z9SA 2ZP8A 3I2CH 3UPRB 1JNNL 1UXWA 1X5LA 1IQWL 1ZVSA 3M46A 3S35X 4DN3L 4JFOB 1OW0C 4DKAA 4YWGH 2R23B 4PW4A 3X14B 4CC1A 1QFWI 2VRAA 3U7YL 4EI5A 3PCYA 1OP5K 3CFDA 4X6EA 4L2YA 5MEPA 3V4VH 3NESA 3L8QA 4B3VA 4KO7A 3RVXD 5D7LB 3ARRA 3CMOH 3IB4A 5HGBB 4N8CH 2DQCH 3RDTB 2BVPA 3X11A 4R4FL 3ATBA 2YPKA 3TA3D 1BP3B 2W94A 5FF6A 2CIIB 5MERB 3CQPA 3Q13A 4E42A 3MRHA 2CHDA 5B4MC 3GMRB 1TZHA 3UYPB 4DJMA 2EEBA 5JMOC 1LK3H 3BZ5A 5TFSL 5L7XL 1JUFB 2VXVL 3L45A 4HFWB 2VN7A 4L0ZA 3RAJH 5M7QA 3KBFA 4LPUA 1ITCA 1TEGA 3ZE0E 2WCGA 5AD0A 3F28A 2X4RA 5C0DA 1CDBA 1H3PH 1U8IB 2I27N 4P57B 1O9WA 2P80A 1Y6NR 1MCFA 3O81A 2PO6A 3MUJA 4PP2A 3EYQD 4X99A 2VLLB 3QPKA 4TQ8A 3PJLA 3LQMA 4L05A 1URLA 2NW2A 5IJVB 1W9XA 7PAZA 4HSQA 3G5VA 4NC1C 2FIKB 1CDHA 4G7RB 1J5IA 4U1IA 4JO3L 2V3EA 3MYZA 2DM3A 4MJID 4OGXL 4FA7B 4PGEA 2VDRL 2DWEA 4MMYB 4KY2A 2EYSA 4Q6IC 5E51A 1RUQL 3G3LA 1ONQB 3JWOL 5FO8A 1I9RH 4NP9A 3QXVA 2XG4B 3VE0B 4N0UE 2O5YL 4Z7OE 1IM9B 3ROLB 4XMXA 3OAYH 1NUDA 3ARDA 4YHOH 3WDJA 1HINH 1HSAA 3EO9L 4U6HB 3DPBA 2D7TL 4QAWA 4XCYB 4X5RA 4QWWC 4EI5C 1UD8A 3CFTA 4PFEA 4O02L 2E59A 4Z95H 2GT9A 1UT2A 2ZUWA 1MW0A 3SY0A 1K9TA 1T20B 3GXIA 3ECVA 4Y19D 1WWCA 3ZSTA 4U0RB 4F37F 3BFOA 2ZE0A 5ALBL 4X0KA 2BRRH 3I6KA 4M7LT 1NMBL 3KGTA 3Q6FA 3ZL4H 2BRQA 2WXPA 1QFHA 3E6HA 1RZJL 3MXVL 3QDMD 4NLAA 3MYJA 2P5PA 4Q8BA 2AFNA 4HS8L 2AS5M 1JHLL 1FJ1A 3KW8A 1R17A 4IHOA 4LU5H 4AYMC 1M57B 1GY2A 4N20A 2VR8A 3CAFA 1T1WB 2K70A 4LLMB 4KI5F 4YHKH 5TF1L 4QOKA 4FQ1H 4NC1E 2APTA 3BZ4B 2ZXQA 1ZLSL 4XVUC 3KPPA 4RETB 1H6UA 2WW8A 3ULAB 2DIJA 2PO6C 5AW7B 1DBMH 1J10A 2R2CA 3PU7A 1AQMA 1U91A 2OQJB 4W4OA 4DKTA 3DBXB 2EVIA 3O2WL 1HL5A 4NIKB 1KWKA 3VSUA 2YMOA 4KJQC 4ECNA 1R3JA 5LBSL 2NY0B 2Y36L 1CYXA 3U9UB 1H3GA 2ZUYA 4OZHB 2XYBA 1HHJB 4X7DC 2BVOA 1IFHL 3NIDF 4FRWA 4KDTA 1G9MC 4JY4A 3T65A 5EZPA 4LSQH 5LGKA 5LCVA 3OVUB 4BV1A 5G4NA 2EXWC 2G60L 4D0DA 1BF5A 4BGDA 5HD8D 3X3GL 1ZLWH 3RVTD 2DJUA 1MJ7L 1WFOA 2EH7L 4UZUA 4G7VH 5I19H 4OTXL 5HQDA 3GPSA 1K4CA 4XHJD 3CXHK 1T04A 3MS3A 3EOTL 1XQ4A 3K2MC 2ITFA 3MRBA 1F4WH 4L1BA 3QISA 2HJKB 4NOBA 4XX1G 1GZPA 5ALCL 43C9B 3FH8A 3EYOA 4LQFH 5I28A 1WH0A 3STLA 3TBSA 1EAJA 4P3WA 3WFEH 2XTJE 2R4SL 5KS9A 3BN9C 2B4CH 4OLVH 4K90A 2HTKC 3T6VA 4MWFB 3TIDB 1IM3A 5GZOD 3I6LD 5KVGL 2X4NB 2XKNA 2R27A 3OKOA 4Z7WB 4APXB 1MXGA 2XWTB 4JFZL 5BVJA 3N85H 4HS3B 3Q06A 4UOQA 5I0YA 1VGEH 4AENA 4D8PA 3RWGA 1TMQA 2QVFB 7FABL 4HULB 5JQHC 4NS0A 5TE6H 4GERA 1S9WB 1FNGB 2HTLC 4I77L 4X5XB 5EA0H 5DU7A 4JKPH 4W4OC 1MELA 1UQSA 4RISH 3APCA 4F91B 5C0EA 3GGWB 1A9VA 4UQCA 2JELL 1WISA 4JPQA 4G42A 2EUZA 1P4IL 2RHEA 5L4IA 4I9WE 3LPPA 3SYQA 1X9RA 1N7MH 2N56A 4DAGL 1DQDH 3VX0A 5DMYA 5DRNA 5HPOA 3OHXA 3OXRB 2BY3A 3NRQA 4KDTC 5C8JB 5IVXB 5CIPB 1R46A 2F8IA 4KROB 3Q8FA 1P7HL 3N41B 2Y25A 3HR5B 1QLEL 2IPKA 4XPBH 4NXSA 3BSZH 3VYPA 3S3SA 1CMOA 4NFCA 2EKJA 3UH8A 1JN6A 4OCMC 2DQUH 3TN0A 3EFDH 1IEHA 1JWUA 2X1QA 5EN2A 1MCWW 4PIRF 3TBTA 3EFOA 1FBIH 1PS3A 1MHPH 2ZXWB 5GGTH 1E7VA 2ENJA 1TZ8A 2UWEB 3V52L 4N90E 5HVHB 4ZTOL 2Q86B 2KZWA 1XGPB 2QVTA 5CHNA 4B0MM 3SPGA 5JPMB 5E6YA 1KYDA 5IQ7H 3HBGA 4JG1H 2ZXAA 4QOKE 2XI9A 5D9SB 2VM4A 2VISA 3APNA 2B39A 1NL0L 2I7OA 3LDBB 3DBKA 3U2SA 3UTZA 2FWOB 1BYNA 2CLRA 1E8WA 4ZW7A 1JV2B 3MLTA 1AXSA 1UD6A 4GW1A 4L3EB 2F8VA 2WLYA 4R7NB 1DQLH 2EH8L 5AZUA 2NY2C 1NCCH 2YA1A 2WP3T 3WE6A 2DWXA 2R1XB 1KDJA 4ICXA 4NSKB 4YWGL 2JB6B 3H0TB 3EH1A 5F7DA 4BZ1A 2JCCE 4GH7B 4N5UA 3GSRB 3N1GC 3UJIL 3V4VL 2ZKWA 4CADB 4B52A 5GISL 1M7XA 2BVUA 2EP6A 2F61A 2OL3A 2EINB 5I82A 3WHXB 2AQTA 4X9BA 2V5RA 4M8UA 1AXTH 2F74B 2QADB 1U92B 3AREB 3QI9A 1RULH 4K3JL 5AWNL 3K8KA 5G5DB 4AQAA 2P8MA 3OHXC 2G5RA 3ZRCC 2J73A 1NM4A 2E75C 3GI9H 1FNSL 1V3MA 3KLLA 2VGLM 1OZUA 2V37A 3QDJA 5KVEL 3BCDA 5L3UE 3DTXB 1M7UA 2X4UA 3JV4A 5GRVL 3L9BA 4Z0XB 4GXUM 2R0ZL 2OMVB 3AAZA 4HIHA 4YDVA 1TQBB 3TN0C 3HS0A 4WJG3 2W9DH 3A47A 4XAKD 1NAKH 2V7NA 5FW7A 2IALA 5DD3L 3UJJH 1ZWIB 5LQBH 4FFWC 3CHQA 3GLDA 3MUGB 3MODL 2X1OA 3OB8A 4DP2X 3P02A 5KS9E 4MLIA 4QHPA 5BOJA 1NWOA 2P26A 3M7FB 3HJEA 1G84A 3AQXA 5E95B 5T3XD 4HKBB 3P7QE 1I3GH 3KLSA 3TYFA 3V4UL 3RDJA 1QFWH 4YXLH 4GLRH 3UBGA 1GMIA 3ZR5A 1AGDA 1BQHA 1I9RL 4FLOA 2XZQH 3I9GH 5ITBL 3O3EA 3L16A 3QRBA 4MZIA 4JQIL 1N2RB 2BSCA 1MNUH 1QWHA 3F6JA 1QKZH 2WTRB 1FI8C 4PJ9B 4HQQH 4WJ5B 1MHCB 4P4KB 1MCCA 4FNQA 4XTRC 4G8IA 3D0VA 3M17B 2Y22A 1BFOA 2IBBA 2VB5A 1NAML 1SDDA 5ENWB 3VXMD 2A9DA 1E65A 1GC1C 2K45A 1EVTC 3Q3GB 5HJGA 5IB1B 1RERA 1DLHB 4DP7X 2RGSA 3BO8B 1A7OH 3VFTA 3MC0A 5DI8A 2C3GA 4IOFC 2IBZX 4NNXB 4LHUD 1EANA 2PW1A 2RIKA 1JZ4A 3QI9C 4JL2A 2NNAA 3OKKA 3DX1A 3RY4A 3FT3A 4G1MA 1BQUA 3BD4A 4OW3A 1CGYA 3VU2A 3BIKB 2Y7MA 3X13A 3UG4A 3BDYH 4QEGA 3D1MC 4WJKB 3UAFA 1MRFH 3ULSA 1HEJC 5DUJA 4LU5L 3QFDB 2VSDA 1JL8A 2GIYA 3MROA 1O7SA 4HJJL 2KLSA 3WKNA 4YFDB 3ES6B 2D7NA 4P3DB 3CFQA 2FL5B 3FO2A 3QVAA 2ESVD 3HS0C 3X1FA 1A4JA 1QSFB 3MBEA 1IC7L 3HB3B 1OGSA 2ZXGA 2WNWA 5CFAA 1X9UA 1Q9LB 8PAZA 1N5YH 2PTUA 4LVOB 1TJHH 1PG7X 2GC4C 3JTTA 1YG9A 2H8PB 3FXIC 1ECYA 1ZOXA 2LT9A 5C0FB 1XF2A 3DX3A 4HC1A 2YR3A 1NPUA 2XWEA 3F04A 2WMPB 1GGBH 2H32H 3FTYA 1KLUA 1Y1UA 2IXQA 4FQLH 4R9HA 5F7KC 1MCDA 1KGXA 2NY4D 4F7CB 2WXMA 4QRTB 1TJIH 2C9SA 2KLTA 1QEWA 3UIZA 1QO3B 3AU1B 4W68A 4XN8A 4IRJD 5FO7B 2YPVA 1E9OB 4IIZA 2MCMA 3E7JA 3VFVB 3TURA 1J87A 4PVMA 3RUGF 4ZJ9A 1AI1L 2GG1A 1F3RB 1OARL 2A6KA 2X89A 4N0FA 3RL1A 2G4ZA 2GC7C 1QLFB 1DTUA 1LEIA 1HXYB 4XWOC 1RZ8B 3UTQB 1ZGLA 3QDJE 1JZ5A 2IPTH 2AV1B 1A21A 2R69L 1PVHA 1UD3A 4HP5A 1EFQA 5D4QA 2E9BA 2IBZY 3UIYA 2G9HA 1WZ1H 3MPCA 4LLAA 1M6UA 1Y6KR 3B9KA 5F7AA 3RPIA 3WFEL 3GXUB 4DUVA 2GCYB 4YX2H 5K7TA 2B4CL 4L4TA 1UKTA 4OLVL 3UZQA 4N68A 2NYYC 5BRZD 3QUYB 4P49A 5IROA 2ZOUA 1XO8A 3PWPD 1BD2B 4JFQB 3BXNA 5I71B 4M29A 1GL4B 2PETA 2OR8A 2VUYA 1U8PB 1VFBA 1T66D 3MLYH 4AZUA 1BMWA 1G9EA 3GT6A 1O7DC 2HLFD 4LARL 1QQDA 3F2PA 4XPHH 5IQMA 3KE0A 3MBEC 1TLIA 3IBOA 5TE6L 3V5HB 1HILB 3MJGX 3L7EB 3F58H 4ALAL 3GZKA 1D6VL 4KJWD 5JORB 2CCLA 1MREL 3AQDA 5HDWA 2QTVA 1CE1L 2HKFH 3V2AR 1RZ7L 3EXLA 3VD1A 2F53B 4X6DA 5TLNA 3HG1D 4PJ8B 3ULVD 1T6BX 4JCWA 4BH8A 5MP6H 4PJ5D 1R5VB 1N7ML 5C6PB 1DQDL 1LQBC 3KH3A 3DKHA 3LRSA 4AUYA 2YAFA 3QIBB 5ECGA 1BVNP 1G7MB 3H56A 4LCUA 5A2KH 1CI3M 4P4RA 5EUOB 5FYJD 4YUEH 5SWZB 1OGAB 1DQIA 2RA1A 1HL8A 4PJDB 4UQ3A 1F8TH 1UUSA 4H20H 3PFUA 4NZRH 3VMOA 4QF1B 2DQUL 3BT0A 3KLHD 4UV4L 4Y2DA 2DF3A 1YDPA 1HC1A 4AH2B 5EEVA 2HWZH 1C5CH 1KIUA 3H6AA 3ETSA 1IAMA 4ELMB 2B9AA 3B5GA 3QHFH 4WSGA 4DK5A 5G4MA 2ZWKA 5GGTL 4L8BB 3N43F 1OAYH 4CN6A 1HOCA 1F90H 1TMCB 4PG9B 3OLEA 7TAAA 1VFAA 2FEDD 4IOIA 1OCWH 3A22A 4I3RH 1M7DA 5JW3L 4E0RA 2GJJA 3CH1B 4TVPD 1HYRC 2EXYC 1O7DE 1FGVH 2N59A 2X2YA 3B9KC 1WFNA 2APVA 1NCGA 4QXTA 4S0HA 2Q7YA 2ARWA 2PNDA 1MZYA 3MGTA 3KG5A 4JX0A 5HDQH 1JF1B 5IROC 3CPUA 3QXDB 1FNFA 1JNLL 1IC5H 4RWYH 3TYGH 3F65A 1DQLL 2OMWB 2IAMA 2FVNA 1NCCL 1UENA 4XGZA 2BOCA 3U4AA 1EO8H 1SN0A 4RMUA 1NGXA 2P7TA 2VDLH 4JGUA 2VZVA 3F83A 5F0JB 1GS6X 5F7WC 2ID5A 3QK0A 5AOJA 4B96A 5L88H 2B59B 4RGND 4ZPVA 4DEWA 1ACCA 1X5ZA 2D7MA 2WPGA 3T1FB 4LZKA 4R2GD 1E9QB 3GMPA 3OJMB 4XMUA 1MAJA 1UG9A 3DSFL 5T8IA 4EN3D 4NHUA 1A5FL 1DUYA 2C3XA 4PUBH 4E36A 1WCBB 4NN7B 1MLBB 4UU9A 3BMWA 1U8JB 2ZIDA 1U3JA 1EWHA 3G9AB 3IMVA 1HSBA 3FAWA 1EZMA 3RNQB 4B9ZA 1ZA6A 2G3NA 1TU2B 4MAYD 5KS9F 1BA9A 3CFMA 4WHYG 3OB0K 4F7MA 4J3OC 3UJTL 4G59C 2WGNB 4YSOA 4YGVB 1PZ3A 3ZE1E 4U1NB 5JIPA 4Y2DC 3VXTB 2QDWA 3G5YB 1XIWB 4NBXB 4E9WA 1LEGB 3OSKA 1GPOH 3EGDA 2BW4A 4L4TE 1T2QL 1TTUA 15C8H 1JK9A 3QUXD 2VMEA 1JI2A 4ZS6C 4JM2D 5FKAA 4NZFA 2JE8A 1KSRA 1N18A 2MNUA 3FH5A 4B53A 2QLVB 1I7ZB 1HQ4B 1XH1A 3S8GB 1BXVA 1K5NA 3HN3A 1LEKB 4HBCL 2CR6A 2EC9U 5AOMA 3PAUA 4YSCA 5B21A 4RNRB 1YZZA 3I9GL 3OG6B 1MCWM 2GJ6D 4A7SA 2FRGP 4G7YH 4OLZH 4XVSH 3MHZA 1MNUL 1QKZL 4Y8AA 5DHDA 3EJZC 2JKNA 2IAMC 4D9QE 4JKNA 4KX9A 4X6DE 1BLNB 3MMEA 3WY2A 2OMXA 1NFIB 4X4YA 5LLIC 3UAAA 1KJ2A 3EJCA 3DURB 1A7OL 1J86A 1WJ3A 4X4XA 5DO2C 4WO0A 5D7SL 5J12B 4FA8A 3U9PH 2YAQA 3DX6A 2BHYA 3WFBH 4JY5H 3SB3A 4RMRA 4AM0A 2HVBA 2VSCA 3NT0A 5EBLA 4PRDA 2AXGB 3RHWK 1AKJD 3I9IA 3OL2A 1SMOA 4DP5X 4U1GB 1HFUA 1KLGB 2ROXA 3BDYL 1KN2L 1MRFL 2JVUA 3LX9A 4OM1L 2XFXB 1O6TA 1TOXA 1A4AA 5IY5B 5IFHH 4UINH 1K3IA 1J9CT 1GS7A 5E2JA 1BZDA 3BVWA 5K93A 5KW9H 1I9JH 1XGTB 4AI7A 1TRLA 2B16A 5FECB 3VFNB 1J1PL 3D48R 1NGPL 5CZXC 3ARYA 1TJHL 2YS4A 5BZWA 3VU1A 1C08B 2XLLA 2AXJA 3C09B 4GUPA 2K0RA 1F6FB 1XSKA 2R4RH 2X9XA 3FS9A 2NR6D 1D5MA 1CF1A 1RJYA 4GMSL 4OD2A 4N0YL 4Y5YA 4FN0A 4HYTB 2F5AH 4A7QA 4IBWA 2ZNWA 4JRXB 2LR4A 4Y4FD 1GGBL 1HH6A 4HT1H 4B9FA 2NSMA 2ARJA 4MQXD 1E6OH 2VCOA 4XZUB 5DS8B 3X1GA 1OP9A 4PRHB 3X1BA 1K2DA 2OK0H 2Y7LA 2XZAH 5LWDE 3FO9A 2A6IA 3QFJA 4GKSA 1RHHB 2FX7H 4WCYH 3BUTA 2EDMA 5DC2A 4BHUI 4RSVA 5KVDH 3Q1SL 5T3ZE 4CVWA 1UXMA 3FYEB 3ZKNC 4H8PA 2FYYB 3TO4D 2NZ1A 4APQD 5CEXB 5C07E 1IARB 3VRIA 3BPLB 2QQLH 2FNWA 2H3XC 5K39A 5CBAA 2NDFA 1N70A 1ZANH 4AIZB 4YMPA 1N3NB 1WZ1L 5BZXA 4YX2L 5JTWA 2WXNA 3WFCH 5FYLL 3WMSA 4DKDC 5DHEA 2R39A 3M8OH 5DJXB 1W6LA 8FABA 1CLYH 2N1TE 2VO8A 1JV5A 5BO1L 4WLCA 1TZIA 3MLYL 3BX7C 4JFDD 1LO3H 4D7PA 2X70A 4DTGH 4IRSB 4FFTA 4EDXA 4JHBA 4FYTA 4KK9D 4FXKA 1Q0XH 3N42B 1PKOA 1RK1B 3F5WB 3LYRA 4KRLB 1KY6A 3DO4A 4N6RA 2WLJA 3WLBA 3E38A 4X7EC 1GXWA 3MNWB 5TDNB 1FHNA 4TSBH 1YNLH 4I0PA 4G9FB 3WD5L 2HVKB 1EEUA 5MP6L 5LBGA 1SJEA 2DTSA 2QSTA 4KK8D 1RMFL 4Y5YC 3NDYE 5KSAB 3B3IA 2IDCA 1F02I 5SWSA 1R3KB 2PTTA 2OZ4A 1A6VL 1G0YR 3EYSL 3APMA 3WDIA 1MJ8H 3VXOB 3S98A 3SQOH 3ISRA 1T21A 1YNTB 2YSTA 3V4PB 4FKEA 4DKEH 5K1JA 1MWOA 3BUYA 4YBLB 4YFLI 5KG9B 3L3DB 4Y4HD 3ILQD 3QJHA 1H9DA 4H20L 3UPRA 4NZRL 4XNAA 4MMXB 4K89A 1E28A 1QASA 2R23A 3NIGE 4ODBD 4RMQA 3X14A 1T22B 4AY0A 2HG5A 1ORQB 2C4XA 4Y5XA 4TNVF 2WVVB 1IFGA 2BS9A 5AVYB 3MLUH 4WO4A 1VESA 5CWSA 3ZO9A 2KPWA 2Q76B 1O6SB 4DK3A 3BYTA 1OCWL 2Z9TA 1CTOA 1M05A 4I3RL 1I8AA 4NCDA 4TULH 3ZQXA 5I75C 5K59E 4N2FA 4MJJA 2DMCA 4HKXB 4YSEA 4UM9D 1HCYA 4K8RH 3ZYZA 3R8QA 3SHSA 3KHQA 1CYGA 1T1XB 2CLVA 2AXFB 3UYPA 2CGYA 1WEJL 2YGVA 1KCLA 3OPZH 3EJTA 3AXLA 4RWYL 4P2RA 3P11H 4I0KA 4ZD3H 3CDCA 3OXSB 7TLNA 1XL4A 1A6TB 1WA2X 2VDLL 2KERA 5GZND 4HXAH 4NERA 4HUNB 3VGFA 5D5MF 4FXKC 5IMKB 4GAFB 1FC1A 1NFKA 5L88L 5LGJA 4AUJA 2C1PA 4KVNH 2XJLA 1GZQB 4I0PC 3ZE2E 1Y6MR 3ASNB 4X4KA 5DZOA 1DE4A 1MUJA 3WTTA 4LE8A 2K6WA 4U1HB 3QFJE 4GAGH 2NY1B 3TOPA 1G7HA 3DHUA 3W0WA 3LIUA 5EU6A 1U8CB 3LS4L 4GKZB 2IDUA 2O6CA 5CINH 3DV6A 3GHEH 1ZVYA 4D9LL 4TOYL 2WWMC 1TKWA 4YR6A 4FNPA 1ANUA 2ZSVB 5IQNA 5C0CA 5T1MA 3NTCH 4KTGA 2RQEA 4HUVA 2OMZB 1ADQH 3OQ3B 4Y5XC 5FW6A 3VXSA 1BVNT 4XODA 5AL0A 4YLQT 1TZAA 1Z3GH 4PJAA 2NTFA 4WO4C 1T20A 2OSLB 3VO0A 5INCA 3DOSA 1PLGH 3P73A 1VIWA 3QJQB 4WI8A 1G0DA 2YRZA 1WAAA 4OFYD 1J1OL 1KIQB 2K6YA 1L3FE 4EZKA 4I1NB 5J6GA 2R7EB 3QIWA 4L9LB 1FYTA 4QRPD 2Z34A 3GUFA 5ABZA 4OZIA 3D09A 5TQ0H 5DMKA 1PIGA 2R0WL 4G7YL 4TQPA 4PSRA 2X4SB 4KTEH 4XVSL 2I5YL 2J7LA 1BM3H 4JL1A 5ESQA 1PE7A 1QSEE 4PV9B 5DZLA 5JS3E 1D5IH 3ARBD 5C1MB 1AE6H 2D2OA 4EAEA 5FLVA 2YUXA 4Y1SA 4Q7DA 3BUPA 1NUFA 4M5YL 3FZUC 2UX7A 2ZXBA 1EZSA 2P28B 4J3OF 4JS7A 4P2QA 5E8PB 4FTDA 1NCIA 2VTFA 5SWSE 3KWXA 2ZG2A 4JPKH 5CSGA 1W8OA 1CIDA 2D31A 4PJIF 1ZTXE 4IBUA 2JIXA 4ORGA 3ZU8A 2OAAA 3WFBL 2GJZA 5LUMA 3QQ3B 4JAMA 5DFWH 1KNOB 2ICEB 1U8NA 1XH3A 3T0DA 1ZEAH 3D39D 3VTTA 4PU2A 2X6VA 3QHZH 4O58H 1YEDB 5DRWB 1JZDC 2LHAA 3N2JA 3WELA 4F2EA 1IEBB 4G6ML 3ILEA 1P6FA 5F1NA 4UT6L 5IFHL 1RVFH 2DLHA 4RAUA 2OJEB 1DBAH 5KW9L 1I9JL 1VSCA 1CXKA 4G8GA 4Z7AA 1DJSA 1HZHH 1ZHNA 2AGJH 2EDOA 3NRPA 1PDKA 1I3RA 3L5WB 4GP8B 3BP4A 5D6DA 2YQGA 2CPUA 1SUJA 1UA6H 5GS1B 1OE1A 1JTOA 3H9SD 3N1MC 3PL6B 2J8UB 4PCTA 4Z7VB 3RB7A 2R4RL 3T1WA 4P2RE 5J1TC 4DW2H 4H26B 3BP5B 1WP6A 4CVXB 2F5AL 3FRPG 3QIWC 3UTTB 2DM4A 1CD0A 5B7EA 2P5WD 1KJOA 2Y7SA 4UCFA 4HT1L 5D1XA 5HI4D 4X6FA 1MFBH 3QIUD 2VOTA 4GKOA 5DHYA 3IRPX 5JDSB 4FNLL 2OK0L 2QR0A 1Z5LA 2XZAL 4UQ2B 5TDOB 3SSGA 5IMMA 2V2TB 4WCYL 4HIPA 1C7TA 1J8HB 4Z7UB 3BUDA 1R1CA 3OKMA 2BNRA 4AYFA 4IKIA 1FNGA 3BKCH 1EBAA 4JO4L 3HE7D 2F1AA 4PTUB 3LV3B 3S0PA 5EU6E 2GK2A 4WKXA 2QFPA 4Y8DC 3QEUB 5DRZB 2XWJB 4A7VA 3T3MB 3KWWB 5IREA 1KCRH 1NGYA 2V4LA 1AS6A 3TL5A 5CLXA 1KCUH 1CLCA 2VJXA 4L5FE 3SCMA 4CDGC 3JWDL 3NK4A 5C0CE 3SKMA 4RMBA 3LN4B 3OXRA 1WSST 3JVGA 3WFCL 2BHUA 3BEVB 3D85A 3DO2A 1JGDA 3U6XA 3CSYB 4LNRB 3NUKA 5I6PA 3VXSE 4ABQA 3HR5A 4PJAE 1C16B 3AITA 3VFRA 1MWAA 2YBGA 4M6NH 5EOQH 4ZUUA 5IHUL 1PCXA 1UFGA 1NIAA 1WAAE 4DTGL 4MA8H 2IWKA 4UQBA 4Y9GA 1MLCA 1FYTE 1Q0XL 3MCKB 4YLCA 4YDIL 5LXGL 1LO2H 4ABUA 5LNEA 3TV3H 1BAGA 4OZIE 2WUBH 4LF3A 1PW3A 5D6DC 3C5ZA 1EBPA 3UGUA 2VL5B 3MNVA 5E9DD 1OTSD 3RWEB 5ADOH 2P24B 3RPBA 3MGOB 4QXVA 4AV0A 4IU2A 1T3FB 2BCKB 3G5XA 4X8GA 2FWLB 2R83A 2X4PB 2YQBA 3S35H 1AO7B 1KGWA 4NI3A 3O8XD 5D1XC 4J5VA 4P2QE 5PCYA 5LCVH 2VLKB 1GSKA 3QH5A 4OJAA 4HZ1A 4JUSA 3PDOA 3SQRA 5TH2B 2XKSA 2Z65C 3QDHA 5F71A 3P4NA 1EK3A 4BQ8A 1D7DA 1SN2A 1QBAA 4BSWB 2Q0ZX 1I8IB 3OB0H 3MSNA 1HTYA 2CO6B 3O6KH 4N5PE 1FYHB 3NIGB 4QKXB 4FMFA 3V0FA 2P48B 4NRZB 3WHXA 1K4DA 3S3JA 4EEEA 5F9AC 1IGJB 2SEBB 3BZFB 1N8ZA 4WZ9A 3SCMC 4K94C 2YC1B 5B3JE 4AYDC 3KWTA 4K8RL 3JVGC 1DBKH 2CKBL 5F3BB 4XX5A 2XVGA 1AYOA 3BVNA 3MLPA 4G8GE 3O0RH 2GUOB 1INEL 2XA8H 2QPSA 2VQUA 4U0QB 3IFPA 1NGZA 2IBGA 3DTXA 3V8OA 5I66A 4M3JA 4K23L 1VPOH 4LKCA 4UTCA 4Z7QF 4HXAL 3CK0H 4PJHB 5CJOH 5LVEA 3HZMA 4JQXA 1WFJA 4N2DA 4Y9EA 4QXGH 3D69A 5I0XA 5DVPA 1YMMD 2XPGB 3GQFA 2NW3B 3EUDA 4PBVC 2IDFA 4PWIA 1BOGB 4P3CH 5HVHC 5DZAA 3NZHH 4EMZA 1E4KA 1MIEL 2HT4D 2FJUB 3LH9A 1BHGA 1NH6A 5K9OA 3TIEB 4AEIH 3FHEA 3CBRA 1KZQA 3RJDA 5GRJL 2BNRE 2CJ3A 2Z92B 5CINL 4XNZB 1YEGH 3GHEL 3CVIH 3GZQA 1NCBH 4PJ9A 4HIJA 5I8CA 4MSWB 3T8DA 1MHCA 2IADB 2X28A 3GM8A 5BMFL 3IDYC 3WO3B 3T74A 1CGSH 2Q6WA 3JTSB 4V1DB 4TUJA 3L3HA 4MDRA 3FUFA 3ZKMD 1ADQL 5IVNA 3HZVB 5KZCD 2C1OB 3T2LA 2ZCKL 1J0ZA 3POHA 4JHAL 2VDML 3SN6N 3T4AB 1F45A 1G87A 1PLGL 3TVMD 1J0JA 3WGUB 5C70A 5E08H 1I8KB 1TFHA 2MMXA 3LRGA 3LNHA 1IUZA 5F72S 2PPCA 3MFFA 3J07A 5IK3A 3UG5A 1LE9B 5T1KA 1PKQB 3SZ6A 3LRLA 3V6FB 4HZLA 1XCXA 4JY6A 1NBYA 4KTEL 1MXDA 5F9JB 4IBQA 5HDBB 1S9KC 3VH8G 4OCWH 1DL7H 2FJFA 5ECJE 4PY8I 1TLPE 1P9MA 2AV7A 3PLYA 1S4IA 3UP1A 1YEFH 2EE6A 4NKDA 1NUNB 3IGAA 3K5RA 1NC2B 1NDGA 2A7GE 3U9WA 1MQKH 2FZ3A 1H3WM 2XHNA 3K6NA 4LHQB 1AJ7H 3OJDB 4JPKL 4EXKA 5CD3A 4U6XA 5JHDE 2YPLA 5ICZA 2UUDK 1G7LA 4BSVB 3E8VA 4U2YA 4BJLA 5B39B 3NG5A 1J9TA 4LGPB 1YUKB 3D3VB 3L3OB 1A6ZA 2IWEA 1E4KC 5CBEB 1CC3A 1JXDA 1ZV5A 3RWIB 5HVFB 3B8SA 4G80B 2C9XA 4N0CC 4HOXA 3WEXB 1ZEAL 5DJZA 1ULVA 2MOQA 3PWUA 2K3TA 4O58L 1KPVA 2IV9A 4PP1D 5FA4A 2WC7A 1A3LH 4QI3A 2XXFA 3HHSB 4PJ9C 2OSYA 2CIKB 1UWXK 1UM5H 1HHIA 3FQWB 4XNQB 2H1PH 5ABAA 3LJ3A 2YZ1A 3C6SB 4N22A 1E9OA 3CJJA 5F88A 2RAMA 4HUCA 3V9FA 1Q9KA 3DXAD 1HZHL 1ZIBA 2WLZA 5J3HC 1I53A 1C7SA 5MEQB 4JPVL 3GSQB 2V7HB 5F3HA 5KANG 1AOZA 1UA6L 4LDCA 4M4RB 4C4KT 5I1AA 3ZSSA 4F57H 3DX9B 2R15A 4PRID 3LEVL 1N19A 4DW2L 3IVKB 25C8H 5FC9A 3ZI6A 3NFPB 4N2LA 3KYOB 1RJLB 1T0OA 1G9ML 3CZNA 3PWJA 2X7LB 3VXRB 4JFHD 1QBMH 5EU5B 2ITDB 2WWOA 2YKLL 5CJ8A 2QBWA 1I75A 3DIFA 4YHZH 1Z5YD 2DQFA 4BEIA 3ZGIA 2XNAA 1J1XH 3O3DB 4IKKA 2PP8A 4QRQB 1C1EH 1P9MC 2XN0A 3G9VA 3OQRA 4U6TA 4MCNA 2O4EA 3V4PH 4L4VD 2NOYA 4HCIA 4OGZA 3LNFA 3AT9A 5JORA 3FONA 3VI4A 5KBKA 4I2XB 2NXYB 4M5TA 4ZFFB 1KJ3H 4GXVH 3FQTA 4HWZA 5CCHE 3MOAL 4PJ8A 2C7FA 4NO0A 1KCRL 3SDAA 3O11A 4POYA 4GBXD 1KCUL 4MJ2A 4YAQB 2IGFL 1KTJA 1DFBL 1FH5L 1OB1A 2AERT 3T8CA 2FSDA 3LB6D 3T0EE 2AQQA 2PCXA 5AZEH 2IMMA 2BP0A 4MJ6A 1P7QA 4NP4L 3KJ6L 4Z18A 5C09D 1M6OB 3R0MA 4R26H 6PCYA 1OCOB 2XTSA 5EUOA 4ZAKD 4OZIF 1J9RA 4NZTH 2XACC 3W57A 5SWQB 3O6FA 4QHLA 4PJ7E 5EOQL 3BRFA 1VB9A 1N68A 1RV6X 1ACZA 4MA8L 1ZMYA 4HPHA 3OF6A 1EXHA 4BM7A 2BSRA 1RK0B 3MCG1 4TKWA 3ILPA 3CFKB 4WAFA 5LGHH 3TV3L 1EXGA 2NUTA 1MH5A 2WUBL 4W9CC 4PREB 4M4PA 2HCZX 3BLPX 4PWHA 5E1AB 3X1EA 3RB5A 5LWYL 3K91A 3ZZSA 1G5AA 1BQ5A 2XQ0A 2WXIA 1FUNA 1EGJH 1N9PA 2HLEB 3B2VH 4JR9L 3AC0A 4JZJA 4NEHB 4MA3A 3VXQA 4HC1H 5FO2A 1NCTA 2KH2B 1PD1A 3CVBA 5FGCB 4BZYA 5A6LA 3NIFE 5D7EA 4KTYA 2BHFA 4A2EA 2ZOOA 4OZHF 2HVJA 4TLUA 5LCVL 1TJGL 4NO5A 2Z7YA 4KQ3H 1PPIA 1URZA 4MQTB 1S7TB 4Y16D 2YPLE 3U4EA 4XO9A 5J7CC 1EZLA 2QGCA 4JFFA 2DWDB 4KK5D 2BC4A 4GRWB 1A25A 2B8OT 1UM4H 2YPVH 2ZOTA 3LRHA 3ETTA 3O6ML 3C60A 2VW7A 1R24A 3MX0A 4TQHA 6TAAA 2NXZC 3O6KL 4YIQB 2E7BA 3NSFA 2B59A 1F56A 2DQDL 4JFEB 1IBYA 2VR9A 1JPFA 2F19H 3SIKA 4EUPG 3GXMA 4L3AA 1T5XA 4LL4A 2ZCHH 4PJ8C 2N0KA 4YE4H 4GSUA 4AK1A 3SDAC 4LVNC 3MSFA 3RX9A 5A7BA 3QZWG 3P30H 3QFGA 1Z0NA 2VZ3A 5IQOA 1PCSA 1TSHA 4KVPA 5AQ0A 4F2MA 3E2HC 2E8YA 4MYPA 1T4KB 1FZJA 2XA8L 5D7LD 4DP4X 1YY8A 1S7SB 4OCYL 1S2EA 1LP9B 4Y4KA 3O6FC 4AIXA 1YEHL 1JTTA 2A9NH 1X4ZA 3CPLA 3EG9A 3IMSA 3P4LA 4JUTA 4NUGH 3RDTD 3UO1H 3LXBA 3IMRA 4GKLA 1AD9A 1FVCA 2WQVA 3CK0L 2E47A 4U1NA 1CGVA 3VWJD 5CJOL 4EJ1C 4TNEA 4Z7WF 3ZN6A 1DJWA 3KPLB 3VRJB 3WS6A 1DVUA 3MRJB 3FSVA 3MKGA 3US0A 4XPFH 2A83A 2CDGB 3QZWA 3WKPA 2EKSB 4P3CL 5J56B 1H3VA 3VXPA 4JO5A 1TO4A 1NBZB 2E74C 4FYSA 3BWAA 4JZJC 2JB5L 2GPZA 4AGLA 4OJCA 1LEKA 2EEFA 4RX4D 1EDHA 3K3QA 5DVKA 1P6WA 4ZZFA 1BF8A 3EW3B 3AWEA 3DGGA 1CWVA 3UTSA 3KR3H 1IX2A 3VVVA 2NNCA 4UOW0 2PXYA 2ZKHL 3S34L 4R8WH 4S0TD 3REVB 3CVIL 4ZFOB 4E9RA 3QRFM 3N41F 1ZLVH 4K5PA 4O5LH 4U3SB 3HS9A 1QACA 4ZTEA 2O5ZH 1QR4A 2XXCB 3P4MB 3FRPB 3C60C 2E7CA 5C0AA 1XXFC 4HJTA 3FYIB 3D2UB 1KYOK 3EOAA 3BKMH 5H35A 4GRLB 3FCSA 3NCWA 3BP6B 3O9WD 4TLNA 2DKSA 1PZAA 4K0OA 1LWHA 2PYEB 4FZEH 3T71A 3OR6A 4Z0BL 3I3BA 1G1YA 4NKOA 4CA4A 4LEOA 1PU0A 2WCPA 3V5KB 4R84A 3T2QA 1Q1PA 4YVUA 4YSQA 1BZOA 3L54A 5GS0H 3FN0H 2HT3C 4ZFZB 2O93L 3BRDA 4J1UA 2PTVA 5D4IA 3TO2A 5FKPA 5I2IB 1GJIA 2FD6L 3ZBMA 5HP5A 2AEPH 1A6AA 2WTOA 3C5XA 3I6GB 3AT8A 1IBGH 5MENA 4WFEE 4OCWL 4Y4KC 1DL7L 4ONHB 2J1KA 4F8PA 3MTRA 4N25A 1MW3A 1GKOA 1PG7H 3KYAA 4BZ1L 5BW7A 1ASPA 1YEFL 3MRQA 2FK9A 4WEEA 2WZPD 3VD2A 1GC1L 4PLJD 1MQKL 2WBXA 3WS6C 1AJ7L 3FQRA 3TS8A 2F58H 2OL3L 2G5UA 1MG3C 1SUHA 4K7PX 1C08A 4IYKA 1UJ3B 1KLFA 3LKQA 5CGMA 3H53A 4WVRA 5EIIG 1U58B 2JLLA 2FLRT 1ORSB 2ATPA 1PF3A 4JFFE 1GCFA 4WEBL 1H8NA 1MJUL 5L4JA 2FE0A 2EZ0C 1BYOA 5T3ZH 5L9DL 2W59A 2CDEB 2KL6A 3CHRA 4J7RA 1FZKB 2D2CC 3RGVB 3DUUB 5CUSH 3L3JA 4HLZG 2PXYC 4PRHA 1A3LL 1BXXA 3U46B 7CGTA 2BVQB 4XR8C 1A4KA 3FU7A 1B9KA 4LP4A 2ADGA 4HF5H 1J7VR 3IWVA 5C0ND 4NC2B 4Z9KB 4AR8A 3AB0C 5F7EL 3WLWC 5E8NA 3ULUH 2L8AA 5DZPA 1DUZA 5J6HA 2NUPA 2ATAA 1YN6A 5DK0B 4F2ME 2A1WL 5IM7A 4L8CA 4JE0A 2HPOA 4KXCA 2WKOF 5E99L 2AABH 4UZGA 5T33H 3BWUC 4NUQA 4F57L 4WW1B 4PJBF 3C8HA 3LH2H 1JWSB 2VQXA 3WUWG 3WKMH 25C8L 1LK2A 1KV3A 2YMXH 2VN5A 3ALXA 3TTYA 4UTBA 3VUAA 4UTAA 2DOCA 2CLZB 1AYRA 2QSQA 4PGCA 1K6QH 1MFCL 1WFUA 1Y0LA 3BH9B 3TEYA 3L08A 2KQNA 3FTUA 2EEXA 3TASA 1J1XL 4TPRL 4P2OA 1UUNA 5CO1A 5AKSA 2E8ZA 1C1EL 2IV8A 1QTPA 4LLWA 3RVUC 5KSVB 3DLQR 4IRSA 4HPYL 3C8KB 2VDNB 4YZFE 3T8XA 3HFMH 1HNFA 4G71B 4PLKD 1O75A 1F97A 4M6MH 3WUWA 4KZ0A 5DDHB 3UTSE 3V6OE 4A7GA 1M1XB 2OYKA 4LLDB 1QPXA 2OW6A 2OCCB 4J27A 5K33A 2FAUA 2F6AA 2CUMA 1RZFL 4OH2A 2W8CA 4LAQL 2R56H 2IGTA 3SKJL 2G2RA 5I6KA 4K7PY 5FB8A 4S0SD 4WWKB 1N6VA 4G7SB 5CZVH 3DMMB 4JFPB 5JYMA 3B9DA 3LCYA 1VFUA 4JREB 4GO9A 4PCYA 2WTPA 1MAMH 4X83A 2W9EH 5C0AE 1U8MB 4BFIA 1FFOB 5BJTA 5JSSE 1Q0EA 2DMGA 3HZYB 4NO2A 2A9BA 4QT5B 4YDKH 2LU4A 2XZZA 5IG7A 1B0RA 1I4FA 2PKDA 1LGVA 3H9ZA 2AVFA 2VAAA 1T0MB 2CK0H 2TSAA 3ARZA 4KBPA 1PZ2A 2DZEA 4O51B 1IEAA 3E6FA 2GTQA 4KROD 4ZSOA 4XNYL 3U30B 5HHME 3AUVA 4Y1AB 2YOCA 1USZA 2XV3A 4J2XA 1HHGB 4XP4H 4AW7A 1BFSA 2FO4B 5MENE 3MV8D 3S3PA 3L5XH 5FYKU 3I6SA 3VSTA 3B2VL 4NQDB 4HH8A 4LLVB 3HNSL 2EDNA 4S1DC 5C0BB 2AC0A 1RIHH 4HC1L 4Y7MA 5TDPB 1ES0A 3D30A 2OP4L 3DO7A 2MPAL 4Q2ZB 2OTUB 2B2XH 4LFHG 3CFEB 4XP6H 4YDMA 4NO3B 2GTZA 3W56A 5I73B 2Z35B 3CC1A 5F7UA 2C7UA 1XEUA 1Q0YH 3WN6A 3IDMB 1SFDA 4AQEB 2YXFA 2YPVL 3KD4A 4NT6B 2YWYA 2VXSH 1E4JA 4IRSC 4DWHA 1SM3H 2GTWB 5LN4A 2DAVA 5IW6A 3QUZA 4HUWA 1RD6A 3BGMB 1S7UA 1S9YA 2GY5A 3L3IA 1AZVA 5EEUA 2F19L 4L29A 4L3ED 4P5MB 5GGVL 4OQTA 2FGWH 1RUKH 2A0LC 5CSZA 5TE4H 3VH8B 4GW5B 1AIFB 3E1F1 4OFQA 2XBTA 1YYLL 1LO0H 1ZLSH 2D7QA 3B34A 4GKNA 3O3BB 1WUNT 1HIML 3ZYOA 4YHMH 1KT2B 4IDJL 3PWLA 3H55A 4XO8A 1K3ZA 1ZS8A 1PZUB 2X0WA 3ARED 1CQYA 3SGKA 1G1OA 3LD8C 3ZKSD 5DXWA 1GOHA 3I75B 4K3EH 4W81A 3OSVA 2QGDA 4IBZA 5I9QB 3FOMB 1X7TA 3HA0A 1V10A 1GJUA 3WMQA 1UOWA 2G5BB 3QQ9D 1TG8A 4IDLA 4XPFL 3L3GB 4PJCA 4KTDL 3VI4F 5L0QB 4XPTH 2CALA 3OMZA 2C5DC 3MNZB 3EIMA 2F08A 4XB7A 4RA0C 4AEHH 1I1AD 1MFMA 4MAUH 3QNXB 1RUAH 4MXVF 4MZRA 2ZZUT 3TJEH 2V9UA 1HYTA 3PNRB 2EYRB 3KR3L 3JXAA 1ND0B 4MA1C 1L6ZA 2VZUA 2Y69B 1S9VB 1FN4A 3TH4T 5EUOF 1NOLA 4O5LL 5ESAB 3SGDI 2P5EB 1NCJA 1N26A 2O5ZL 3F7VB 4PJDF 3ZDXF 4B60A 5IMLA 3QQDA 1ZVHA 5E8PA 3E8UL 5EN3A 4HDIB 3QUZC 2LV4A 5TK2A 4AT6A 2HZHA 4OZ4A 3NBNA 3L5JA 4ONGL 2X05A 4CBZA 3CSGA 1FO0A 3K6IA 3FW6A 5CXPA 2EVHA 3EH4B 3V0WH 4ELMF 5EF0A 4P4KD 2DDQL 3FCUB 4WV1B 3BSHA 1KJVB 3IN0A 4P5KA 2Z3FA 1OEZW 4DZ8B 2GI0A 1T2JA 3QEGH 3WENA 2Y6SD 4LVEA 3IDUA 2DEXX 2X4TA 2FJSA 4ZSOE 2HJFB 2GSIB 3D4CA 1IBGL 4JLRA 3MTXA 2FUQA 4FQQB 1XTMA 2X2UA 4FHKA 1TQCB 1UCBL 4HFUL 1ZRUA 5HGDB 3IJYA 5EBMA 3FQNA 5B4MD 5DK3A 3SGKC 1MFAH 3WKYA 5J6SA 4DQOH 3IDNA 5GS3A 3QT2A 4L23A 1EEQA 3RWJA 2DBLH 1B0WA 3MRGB 4A63A 1SYVA 4ZX6A 3JWNG 3P4OB 4JZNB 1U42A 4K3DH 2FB4H 3GMNB 1S7WB 3CSTA 2ZQKA 4M7ZC 1P7KA 4JHZA 4AJYV 4BBWA 4AIOA 1AP2A 1HQRA 3KPOB 5CCKH 3VM7A 4UM8B 2AQ2A 5T3ZL 3U48A 2GVYA 4FD0A 5G2NA 1QSFD 3HB3D 2CH8A 2UYLB 4UIMA 4LSRL 3MV7A 4MXQC 1NMAH 2RFXB 2JI1A 1R3LB 2OMUA 2WP3O 3Q5YA 5AYUH 4XMPL 5I76B 3FAXA 1OAQH 3ZMEA 5JDSA 5H4ZA 1L6XA 3BPOC 5CCJA 3BDBA 4LCWB 3EHBB 2Z4QB 4DCQB 5JR1L 1J8RA 3CDGA 1CFSB 1RU9L 4W9IC 3D9AL 3II1A 4WTWA 3WY3A 2F54A 3VJ6B 1QPKA 1EHLL 2H3NA 1ZPUA 3TCXA 4MJIB 4NPJA 1YYMH 5DR5L 2C34A 1XL6A 4U3HA 4QWWD 2BK8A 4M65A 5T33L 2JTYA 3UYOD 3QS3A 3OTTA 2EVJA 1IGIH 3LH2L 3NJIA 3O45B 2XT1B 1JPTH 3CZLA 3WKML 2VXTH 2YMXL 4NQEA 2YGQA 5KAQG 3A4DA 3GUTB 3J8F7 4MRBA 2FECI 3P54A 4YJZL 2H6OA 3RWDA 3BEVA 1ZT1B 4KKAD 5D7IA 1G7PA 1BG1A 3SDYL 4QO1B 5E8OA 3B2UD 3RVWD 4OF7A 2JK5B 2CNZA 3ILDA 2EIZB 1MCOH 1ZT4B 4RSYA 2APWA 2F7RA 4TSCH 4EUPB 1SLUA 4PJCE 1HYSC 1MCNA 2P43B 3FT4B 4Y19B 3WIIH 2QJDA 3SE4C 1U33A 4WFFE 4YSAA 3ECBA 4PB0H 1KJ2L 4JE4B 3NSJA 5ID0B 2P3YA 2MKLC 4I89A 4XVUD 3QDMB 5IB2B 2XTJD 1T1YB 2G75A 1BZ7B 5LDSA 2BINA 2ICWA 4ZFQA 4F33B 3RA7L 3RURA 4Z3IA 2PO6D 3IETA 1TTFA 3U6RA 2RCSL 1X7QA 2IDSA 3BWUF 3G6JB 1MN4A 2YBRB 5I6XC 1M71A 2Q3XA 3IJ7A 4UQ9A 5KANI 2G3ZA 4ACTA 1VEPA 1Y3GE 3RHWF 1IFRA 1MAML 1F5WA 3MO1B 4PGDB 2HFEA 2BVTA 4KXZH 3GMOA 3LKNB 2QHRL 4ODHL 1Q8MA 1QRNB 3ARFA 1AZNA 3B7TA 2IF7A 2XWBA 4JKMA 5JNYB 1JYVA 2WKGA 3GZOA 1CQKA 2ZPKH 3ARDD 5GSVB 3QIBD 4V2BA 3LHPL 4F15C 4I9WD 2CO6A 5B1KA 5HGHA 4NFBA 4ZMLA 5CLZA 3NMEA 4Q0XH 1M2VA 3UZVB 1YEKH 5T1LA 4AWJC 1OGAD 2PPEA 1QUPA 2VZ1A 4OVUA 2BNQA 2F2HA 4XH2B 5IHBA 1PNCA 5MHSE 3L5XL 3U2IA 4NN6B 1J05A 2V8LA 4K5MA 4OT1H 4YSRA 2MOVA 1RIHL 3H42L 4R5TA 3HC0B 2IH3B 1H15A 1D5ZA 3BFWA 5JW4M 1U3HA 2B2XL 3ZDWA 5E5MB 3IDIA 3QH3A 1R5IB 4M9PA 5JIIA 3GBEA 1FC2D 4N4YB 5D1ZA 1DDHA 4D0BA 4JRYA 4K73A 1Q0YL 4CN1A 3CN3A 4DGYH 4ZYKA 4ERSH 1U8QA 2HTKD 2VXSL 4N90D 1Z1WA 1EDYA 5JXED 4GI6A 5JUEL 3FTVA 2VQ1B 1JGIA 2YD7A 4A1RA 4HHGA 2VLME 3MRNA 4LSPL 3FJTA 3MV7E 4LCCA 3VFPA 2ROYA 1ZLEA 2X41A 5E8EB 5EU4B 2FGWL 1RUKL 4MNQB 4FHJA 5TE4L 3PV6A 2HTLD 4JG9A 4NJAL 3SOTA 2X40A 2YGPA 3CH8A 3QULB 4K94H 3LXUX 1YVLA 3VCLA 1LO0L 2QQNH 3GI8L 1VFOA 1RZKC 2ZCZA 2F54E 3JWNE 3HZKA 4GQZA 2ZUQB 4KHXL 5IBUG 1F6AB 1GRWA 1KTDA 5KYYB 3GC3A 3OX8B 4L8SA 1MPAH 1YPZB 4JEGB 4FTVA 4YHML 4JHWH 3TPUB 4F7PB 1MWAH 3KAAA 5D2NA 3ARFC 4CMHC 1V55B 5EIIB 4L3CB 4PH8A 3RX7A 1MI5A 4N3UA 5A2CA 3SJVA 1S7QA 5E56A 4K3EL 1JXJA 4NQEE 2ZOKA 1FHGA 3LKOA 3KVQA 4GYBA 4U1KA 1DANU 4NZJA 4RAVA 5D7IE 3KYNA 3AU0A 3VAEA 2GK0A 3N42F 1OTTC 1IU1A 4XPTL 1ZD6A 1FG2A 4HHAA 3FB5B 1G6RL 2YIHA 1HVXA 5IB3A 4MAUL 4WU5B 4ZT1A 5AVTB 1RUAL 2OZ4L 1XIWD 1U3HC 1J9QA 4PS4H 1RQ5A 2WWKT 4PJXA 1ZTXL 1QLRA 3MR9B 5D1ZC 5F7HA 4JFTA 2YXWA 4NN5B 4PJGB 4G6FD 4QRUB 2VLJA 4YSDA 1XF3B 1YNTF 3BT2L 3NGBC 5E4EB 5EOTB 3QP3A 3EOBA 1BVKB 4H1LG 1NCWH 4IU3B 5HDRA 1UT9A 1FZOA 1PD0A 1OO2A 4G83A 2NY2D 2HJLB 1V7ML 1RJZB 3JZYA 4K9EH 4FMKA 2H6UA 5E6SB 4LCCC 5I1KL 2KYIA 3LNDA 4DGIL 2CNYA 4FCHA 4YSUA 4DKFL 4FXGA 1XGYH 2VXQA 3GSVA 5TF0A 3ELAT 5JXAH 4YXKH 1E6JH 3K72A 3L95B 4E9LA 3U4BL 3RWFA 2G30A 2PCFA 3QEGL 3DRQA 4QJ5B 4B9KC 4AG4L 4E2OA 4ELKA 4Z76A 1CVSC 2EC9T 2XZCH 3ZUCA 1DBJH 1GIGH 4L8SC 5BS0A 4HCRA 3SE9H 5JOFA 4NUJA 3QUMB 4P99A 5AB9A 4PB9L 3FQXA 4NQTA 3ZHNA 2AJZA 3IGKA 4H1LA 3T6QC 1NKRA 4PTTB 2BNQE 5D2NC 4TL5A 1GCYA 3TEUA 4KZDH 3GWJA 4G6AC 3K8LA 5D1QA 4DQOL 1A8JH 1DVQA 1KGYE 4MLSA 4ONFL 1HJCA 2BY0A 3OR7B 3ZR6A 1AHWB 1KBGH 3GMLA 4UOW1 3V9CA 4D9WA 4X6CB 1PZDA 4QHNB 1JGEB 3INOA 3QCTL 2VDNH 3KPTA 5DLMH 3QYMA 4HJGB 4O4YH 4JRYE 4DEPC 1YN7B 3SGDH 4Y2OB 1Q1JL 3CVHB 4QCIB 4WNJA 3T0VA 3B6SA 3HPLA 3PIQA 5DCCA 3MJ8B 3IMTA 5D96C 5ITFB 4ZX3A 5EU5A 2OXGA 1P1ZA 1YUHB 4YE0A 3V0IA 2HFGH 3QRGL 3D0LA 4KKLD 3DX7B 2PW2B 4L5FL 1AMYA 2X0UA 3ZVVA 3IAPA 5JOPE 1QA9B 2WQ8A 1NEZB 3S3DB 1XZWA 2DICA 3FFCB 4JRXD 4S1QL 3QZNA 3GTTA 2CJUL 3CQQA 2CRMA 4OLWH 2A73B 4GRMB 4XTRD 2A99A 3QQ4B 5EWIH 3R7RA 1IVLA 1INDH 3KPRA 4FTVE 3BH8A 1CICA 2LTQB 4FXGC 3HC2A 5LJYH 3BUQA 5TGBB 1JPTL 2YN3A 1XAUA 3KNBA 5D2NE 1VHPA 1K8DB 1CB4A 1PEZA 4NPKA 1D6EA 2ZX7A 4HOMA 5DJYB 3SJVE 3QHTC 1XGUB 1MVUA 4FI7A 1LE5A 5AVZB 3AS2A 3DO3A 3VXMB 1IVTA 5FHBL 4PLOB 4UT7L 3N91A 4R90H 3RU8H 2BSEA 4JFXB 5HVWA 1S3KH 1X5MA 4KO5A 1PE5A 3UCRA 1KKKA 3RWCB 1Q9WB 4F2FA 5D1QC 4KXDA 4P46B 1OZTG 4PB0L 3QJXA 4FQ2H 4XMTA 1AQDA 2ZOLA 1SOXA 4DH2A 1GGCH 1AS8A 3PNWA 2BZ7A 3DUSA 4UNUA 4KVCH 4KNUA 4PJXE 5JDJA 5DUPH 3OGCB 5LNDA 1ZHLB 2VLJE 1FFNB 2VXUL 4UQDA 5DEGA 4XPAH 1B3JA 1SNRA 3C6EA 1DFXA 4MD4B 3WMPA 3Q8BA 1JYXA 4BKTC 3P9WB 2VMDA 3A67H 3UTOA 3ESMA 4UUJB 3VMNA 4LSSH 2FO1A 4QGTA 1JPSL 1TR7A 4M7KH 4PRNB 1UM6H 4P9HC 2VC2B 4Y9CA 2AHIA 3T08A 2J8HA 5DFTA 5GJSL 1NFDB 4IBVA 2VDKB 4FNSA 3VXUB 5C97A 3SO3C 3NP3A 4UDTA 2CZNA 3O2DA 2GITB 3L3KB 3IJEB 4IOSA 5BS0E 3K6SB 1CU4L 3FMGH 1KROA 1MF2H 3L17A 1DQVA 1L9RA 4TN9A 1I7TA 4XP5L 3MUUA 1CICC 4FYQA 3QJTB 5F97E 4AMWA 2WLLB 2NY4B 2WQSA 4A39A 4BZ2A 3LMJH 2J8UF 4Z7VF 3NJLA 4BFEA 1E5YA 3BAKA 1PJWA 2CUHA 3B56A 4XWOD 1AGCA 5D1QE 2F7OA 3K46A 2R8SL 4IRJB 4M48H 1TVDA 1Y18B 3VFMA 4PSPA 1B90A 1GJWA 1QBLH 5I5JA 1T4KA 1WD9A 2GBAA 4OJEH 1A6UH 2UX6A 4OZGB 1MEXH 2CJSA 1FIEA 4QTIL 2NY5H 4RFOH 2UZXA 4X6BB 3HEIB 4FQXA 4DGYL 4UZSA 1QF2A 3QEQA 5C08A 5IEKB 2R1WB 3P9MA 4JK0D 2Y5EA 3X12B 4XAWL 3U82B 1USQA 1MZZA 5EBWB 3AACA 1NSNL 5BPPA 2RH0A 1HXMA 4POZC 5DFVD 1R3HB 4XNDA 4U7MA 3UG3A 4Z7UF 2JQMA 3EO1A 3B7SA 4PYGA 4ZODA 2VZSA 3QNYB 2KKQA 2O61A 3CLWA 1XCWA 4K94L 3D07A 4JVUA 1KTKE 1CG9A 4NX0A 3T3MF 2QQNL 4KDVA 4Y89A 1LNUB 2CHNA 5DWUH 3TZVA 3KPMA 3U36B 1NBCA 1XVSA 1BZ9B 1MPAL 2JMRA 2GABA 4WHTA 5KJ4A 4GMTH 3UGXA 4Z1PA 3O41B 2Z31D 5DTFB 4BH7B 5IT2H 1MWAL 3F2LA 3KPRE 4M03A 4IJ3B 3ZDZB 5CU5A 4RZCA 3FC8A 4OR1A 2NY1D 4PJ5B 1JD7A 2CCWA 3VD0A 2VMJA 2Q9OA 4JM4L 4B5ZA 3IPEA 3QWRA 4RESB 2FCBA 1DVFA 3CN2A 4GRLA 3RVVC 3PP4H 5I1EL 1I1CA 4FADA 2AJSH 2OXHA 4OCXH 2C3WA 2X89D 3GHBH 2HT2D 4WDIA 2O5NA 2X88A 3ZHLA 1HEZB 1MW1A 5F9DC 1U8HB 2X9WA 2J88L 3MCLL 2H9GB 4M62L 4H57A 1QI5A 3D5OF 4PS4L 5EO0B 3ZKXB 3D7PA 2IO5A 5EIQA 3K71B 35C8L 4U6YA 3AW5A 2GW5A 4KNTA 4LCIL 2FBRA 3H9HA 5JO5B 3KCPA 4LPXA 4AQ1B 5EPMA 5HJ3B 4FQXC 4I5BB 1OT1A 3P0GB 3D6GA 3NJVA 4K5LA 1O5PA 3GSOB 4LASH 5BV7B 3HRZA 1A4CA 2Z93B 3JT0A 1AY1H 4ATTA 5FXCH 2BOBB 1SBSH 3GBNH 4XBPA 2DYSB 3KL3A 3DHJA 3G6AB 1CFQB 4QYAA 5J11B 4U1JA 3CSBA 1KPRA 3L4ZA 4NQCE 1N12A 4Z3HA 2BWIA 3C9NA 3V6ZB 1XGYL 4G8FA 1WFTA 2EICA 4WI9A 3TA4D 5HY9A 5DD5L 4YXKL 1E2WA 1E6JL 3RFZA 3LQAH 5I1CL 4F8QA 4D9QD 1ZK9A 5DZ9A 3TZVC 1ZS2A 1KIPA 3TBCA 3QORA 1EEZB 4ES8A 1CURA 5GHWH 2EQDA 1N59A 1VLXA 2W92A 4MNGB 1SXZA 4XZ4A 2NNXA 3BAWA 2H0PA 4HA1A 4RGNB 1HWGB 4YNYA 2FO8A 4URKA 2Z0UA 2XY2A 1CS6A 3MLSL 1ZGLM 4KRPC 3ATFA 4NQXA 1QR1B 5I15H 1CXIA 2A74A 1J12A 2XG5B 2FJGA 1EV2E 4P5TA 1YCSA 4EUPH 1RZPA 2XDHA 3UC0H 3QJRB 1KBGL 2Q7NA 3VD7A 3WUZA 1V3LA 2AQ1A 1HI6A 4PJHF 4MRCA 1XCTA 4XBEL 1AXIB 4DPRA 2F7QA 1DVFC 4R97B 2DKUA 4GRLC 1MCPH 1T1ZB 3OZKA 5J5EA 3W9DB 1PY4A 5F7NC 2WINB 2RTTA 1QPPA 3BVXA 4ZO9A 4BXSV 1F86A 2Z8WC 3QEQE 5C08E 2IFFH 2QTEA 1KCWA 5F9OL 4N8UA 2FDBP 3RWHB 1A1NB 2CLZA 5AG9A 3Q5TA 2VKXA 4ILDA 5FFOA 5ID1B 3CX5J 2DMBA 4XVTH 4WFHE 5ETUA 3P40A 3PL6D 5K1VA 5T5NG 5GS0D 2YO3A 1DQKA 2EUVA 2H2SC 3QUXB 2BO0A 3PXJA 1OT4A 2OM5A 4JM2B 4U6VH 3HRZC 5A2LH 3RKPA 3GDBA 3EJZD 2IAMD 3UPCA 3CFJA 4OLWL 2D3VA 2ADJA 4XT1C 2H3KA 2OX5A 4FFYA 4HPOH 9CGTA 3C2SA 4IBTA 1H6FA 3WFHB 1INDL 2W07B 2CWRA 4WI0B 3QR0A 1TLKA 4RMVA 1NGQH 4PGBA 2J4WL 5DS1A 1W0VB 2VR3A 1TQVA 1G7IA 3HRPA 4KFMA 3AROA 1OP3K 3P9LA 4GI8A 4R7XA 3RFZC 1NCUA 2FJHA 5KVEE 2V9TA 4AV5A 4NBZB 2R69A 3QORC 1GGIH 2V33A 5L6YH 2VDQL 4I13B 4OAWA 3PGCB 2ED7A 5T3ZD 5EOCL 5BZZA 4R90L 1TSRA 3LKRB 3ROOB 1EFXA 1MJJA 3RTLA 4W9DC 5HDBF 4UBDD 4U4BA 5IF0B 3ABKB 1DEDA 5C07D 2A74C 5DYOA 2HRPH 3II3A 4P5TC 3U6XS 2Z6FA 3KLKA 2ZYRA 1PZ5A 5IBUB 2CJTA 4O2EA 4RDBA 4G5ZL 3O4OC 4MS8D 1U2YA 4UNTA 3SDXB 5D2LB 2Y5QA 3UAEA 2YEVB 1GKEA 3K80A 3L4WA 1YNKH 5IP4A 2ZCLL 3ULUD 4HS6B 4QY8A 3VXNB 2VDRB 4HWUA 1SHSA 4DT2A 3EF4A 4F20A 4KKCC 5DEZA 3V0VA 3D8MA 4NKIL 1EJOH 4LLVA 3UBXG 1JRHH 3QXAB 4WW2A 4EOWH 3ME0A 1OPGH 5IHZA 3MRLA 4IEFA 5F6HI 1RZIA 5DJ0A 3WXWL 4NGHL 4DO5A 3I02B 1H8OA 4LSSL 5KYXB 4WKZB 5GGRA 4N2CA 4ZMVA 3EBGA 1UM6L 5E0QA 5FDWB 3GSWA 4JG0H 5F44A 4LOFA 4PRAB 5C7ZA 3T0WA 1HOEA 1JK8A 3TT1L 4EO5A 1SJHB 5I1IH 3FPXA 5JOEA 1FDLH 1XCQB 4O02B 5EZIL 2YSSB 5HI3C 1AO7D 4X98B 2QKIB 2WO2B 5GSRA 2VLKD 4KV5E 3PAZA 1UCTA 1MF2L 4PV8B 1BQBA 4MD5B 3OKLB 2VE6B 2XC8A 1AR1C 4FQIH 4ZPTB 4TSAH 3UBHA 3ZKND 3LSOB 4UTAH 5I1HL 4HLZH 1BAFH 3KWVA 4NIYE 4HIQA 3SE8H 3IK2A 3D0AA 3QNFA 3KYKL 1OK0A 3WIFA 1WZAA 4M00A 1ZT7B 3GB7A 2IDTA 2WO4A 1KGCE 1E8YA 1MEXL 4FJZA 2LFEA 4YHIB 4C56B 4HD9A 4RFOL 4OF0A 4OCRH 3BJ91 3CZSA 5GRUH 3T5WA 2W9LA 2PYFB 1JPGB 4N2EA 5HHQA 1XB8A 4APQB 4FQJH 1EAOA 3MV9A 4FFVD 5KYWA 4KZEL 3AWGA 4KMLB 3HAEG 3P69A 4N66E 4NZ8A 3KW7A 3NA9L 4MDIA 4L37A 4ODUA 1OE3A 1F1GA 1U8KB 4GAYA 3U30C 1HN1A 4KI1A 5C0JA 2A4EA 2J56A 3KDMA 3L3GA 4RQQB 4LRNH 1R3IL 5I18H 4DF9A 1H3UA 3PHQB 4QXWA 4S1RH 3H3BC 5EEYA 5ISZB 2A6DB 1ODUA 1FLRH 4WW2C 4ANKA 3O3UN 2KHAA 3EYFA 3AVEA 2ZX8A 4HOWA 4XPGH 2AZUA 2IEPA 2VABA 4RCAA 1TITA 1U2HA 4GMTL 1O0VA 4LEXH 1Q94A 1R75A 1MFDL 1ND0A 3L2MA 3C6LB 1HT6A 2A4CA 5I16B 5IEHB 1SEQL 5I8EA 3BQUA 4XCEB 2PPFA 3ARVA 4R6UA 5KTEL 3EGSA 3LZLA 4O00A 4S2SA 2NT0A 2WAHA 4LT7A 4WY7H 3S5YA 5CF3A 2CPCA 3OBAA 4N8VG 2MHAA 3PHOB 3J7HA 5I1DA 2XRAH 3QFJD 1B3IA 2J57A 2MQCA 4N9GB 3SY6A 5CD5C 3PP4L 1AKPA 4FG6D 1KB9J 2LOEA 4OCXL 3VNYA 4TUKL 5DUML 5T5FA 4CVZB 2H26B 4LCVA 3CDZB 2VN6A 2HFFA 3Q01A 5HYFA 2WN3A 4H5SB 4Y4HB 3VSVA 1SLXA 4M93B 1C5BL 3ARPA 1KGIA 4MQ7A 3U25A 3PUCA 3BESR 4DZBA 5LGYA 1S5HA 4D0CA 2Y7QA 1IAKB 1UYWH 3REWB 4GAJH 3FT2A 4G1EA 4UOZA 1DQJA 4YFEA 4XOCA 3S9DB 3MRDA 3FQYA 5GIRA 4GS7B 3PJSA 2FR4B 1S78C 3T3PB 3TNMA 3KXFB 4TTDC 3SDDB 1QATA 1YY9C 1B4TA 1UKQA 3FRUB 1SBSL 3N3EA 4GRWF 4U1LB 4EE2A 4XRCA 3WI9A 3TA3A 3IGLA 3P4OA 1UWFA 4M1CC 5L2KB 1OTUC 3IJHA 2IJ0C 2N4IA 3GMNA 3PYCA 4ZFGH 1SEBA 1HNYA 1X5YA 2Z8SA 3L48A 1EJ8A 1DSWA 2CM6A 4A67A 2IWGA 4O2FA 1QSED 3IXTA 4YHPA 3QDGB 4R0LB 1RIVH 2DTMH 1ACXA 3EO0A 4HK3J 2EUXA 3PRZA 5B38G 3MBWA 1HKLH 3EJJX 3VB9A 4YDLB 1X5AA 4QLWA 4J12A 1QLEB 2PCYA 5ERWB 2MIZA 4JHVA 1Z66A 3ZT5A 3BQUC 1HKFA 3SKOB 4XCNA 2ZSWA 4FCAA 2B77A 4GG6B 2K8QA 4MX7B 5HYSA 1LP9F 4A7TA 2WBWB 3MRRB 4E9YA 2KLRA 3UC0L 1OAUH 1TQWA 2E7LA 4XE5B 1HDMB 2I69A 1RP8A 3PQYB 4QHKJ 4V33A 4F80A 3HLKA 2NSXA 4ZOCA 3IXAA 1HH9A 3KDPB 1MCPL 2NY3B 4ICWA 4ZUSB 2Q3AA 5DJ8A 2P8LA 2XXGA 1FJ3A 2I9LA 4G43A 5CEZH 4M1GH 1FV1B 4WO4D 3ZDYE 2IFFL 3QO1A 1I7UB 2C9RA 3MV9E 2EIKB 1JNHB 3RFRA 5C0RH 1VKXB 4QO1A 2V9QA 5EG6C 1E4HA 5LDUA 5EC2B 2UZYA 1QAWA 1S7RB 1T89A 2QL1A 1S9XB 3T4YA 4U33A 1UC6A 3WFDL 4JDZA 5DQDH 4HIEA 4OFIA 4W9HC 3RVXC 3R06A 2HRLA 2XY1A 4FL4B 3DVFA 3VI3B 4F58L 2UY6B 3NCMA 5CLTA 4YL4A 3V4VB 2MNJB 3QS2A 4HALA 4H8VA 2X6AA 1OGTA 4OCSL 3TA3C 4QHUA 3BPNC 4HPOL 3KLAB 3ZT7A 1FO0H 2VDKH 2YWZA 1G7JB 2B5IC 4YQXH 4OI8A 3CCHB 3ZYIA 2AEQL 4RRPG 1J8SA 1JXGA 1KTLB 4XMLL 5AW9B 4OI7A 2C3VB 3ARBB 3G6JA 1NOAA 5LO7A 2YBRA 2E27L 1SQ2N 2AJXH 4F7TB 1SY6A 3E9TA 4HEPG 4PD4K 5CCGE 4L1DA 1GGIL 4LL1A 5DC0A 3X3FL 3VRLE 1VGKB 3HG4A 5ANMA 1BV8A 3Q6GH 3VW3H 2BIPA 2C8NA 2WBKA 3LKNA 1W72H 1HHKB 3EYQC 3MNDA 4F9LA 1JOIA 2NY6B 1S5IH 4FQCH 3UTPE 1G7QB 1TMNE 1U0QA 4A2DA 1JZ3A 4IW4C 3KPNA 4S1SH 1QSVA 2BZDA 3SDCA 4OZFG 1CK0L 2EDEA 1I1FA 1FJQA 3CLFL 1L9MA 2E7LC 3BGFB 2VR6A 5EZJA 3I50L 4RRPA 1Z9LA 3GSUB 3PWVA 4KUCD 2QELA 1ZHKA 1YNKL 4XH2A 4HEPA 3PXHA 3RLSA 2J21A 3VXSD 1CN4A 1EJOL 1JRHL 1RXLA 1F4YH 4CAGA 3MACL 3GRGA 1QNZH 4PGJA 4XHQA 3NN8B 5H2BA 1XTLA 5BXFB 3MJ9A 5DJAB 4PR5B 1CFTB 1FYTD 1T89C 4EIUA 1H5BB 4OZFA 2GFBA 4JG0L 3FU3A 2ZKMX 4FLSA 4QTHA 3JWNH 1NAMB 3KPSB 3SD5A 5I1IL 1DQML 3P7SE 3BE1H 3MA7A 4DQAA 3DV4B 4DOHE 4U49A 5D70H 1DCLA 4BQCA 1DVXA 1TO5A 4OKVB 3Q8AA 5DJ2B 4OIBA 1BZQK 2DJ4A 2JLPA 4OGYH 3FXPA 3QIUB 8TLNE 4WNQB 5GZOA 1GAFL 5L41E 3FCBA 3BEWB 1S7XA 3BHBB 4UTBL 4UTAL 2WBJA 3RNQA 5GGSA 3QCVH 3T0XA 4JFYA 5C0GB 1JHTB 3MQIA 3PWNA 4AR9A 1UB5B 4KMTL 4K5NA 4HUUA 4JFED 4UNIA 2Q7AA 4K9JA 4LDEB 4MXJE 4U31A 1N4XL 2XXMB 1B2WH 3TPUA 3HE7B 4F9LC 3MDJA 1CR9L 3LN5A 1C5DB 4RFNC 4HGWB 2IANE 2NPLX 4LIQH 1QFUH 2VMFA 4FQJL 3NZ8A 3F01A 3SDCC 4Z78B 5L8JB 2HN7A 4NQVA 2XVKA 3SKNA 3LEXB 1KWGA 1KB5A 1EUTA 5KWYC 5B22A 5J9PA 3EXJA 5DZNA 3C5SB 4GEIA 4ABWA 5BV7H 5D7JA 1IGCH 4M1DL 3D05A 1A3ZA 4LRNL 5I18L 4G8GD 1H6TA 4H7VA 5JLZA 2X4QB 1A9BA 1U9KA 4PJEB 2W60A 1RZKH 5HD8C 1EXUB 4HHWA 5KN5B 2EEAA 3RVTC 3EFFA 3ZQ9A 2V2XB 4K7FA 4PMFA 2BCMA 4OLEA 3MRCA 4LEXL 2X6UA 2R2BB 4K07A 1T2XA 2Z7WA 4UQAA 1ETZB 2W0LA 3PREA 4XBGA 1TJXA 4XHJC 5I1JL 3AGVA 3IDGB 3JT2A 4JN2A 4ADGA 1HK6A 3IRZA 4QRUA 5AVVB 4L8DA 1K85A 3FTZA 4PW9A 1VZGA 5E9DB 5AENA 4U05A 4ZQKA 4KJPC 4XWGH 4NJ9H 4XNMB 1U30A 8CGTA 2CHXA 3U79A 1E4WH 3EDJA 4YDJA 2K3HA 4ZG1A 3FQUB 1AIZA 5E6IA 4TVSa 2TRHA 2BIQA 3FCGA 4RFEB 3O8XB 5ANME 2PWHA 5FYLE 3ET9F 3VACA 2BNRD 2ITCA 4PJBB 2X38A 2Z7ZA 4ZUTB 5GZOC 3VGAB 4N5ED 3K2UH 1FGNL 2WBJC 2WHZA 3MREB 5AL8A 2YEQA 5D72H 2ADIA 1SRDA 3AY4A 4ES9A 4I4WA 3SCMD 1LXMA 2GAZA 3FOLB 1TCRB 3GJFA 2X3CA 4B9JA 1ZE3H 3FU0A 3QUKB 5EUKB 3GLAA 3HE6A 3L13A 4OIAA 3RRQA 3P7PE 5D55A 1JNNH 4IMLB 4WU7B 3WEBA 4KJYB 5I24A 4NYLA 4N24A 5FUOH 3F84A 2JKRM 1SHMA 4X6CA 3RX5A 5HYJA 5D7JC 3GSXB 4OQTL 5DJDB 4PLNC 4NKMA 4DNLA 4B95C 2KPNA 4WUUE 3NSYA 3K0YA 5GJTL 4QCIA 3VFUB 3C5ZD 4GSDL 3ZTJG 5IJBC 4B7IA 1XR9A 4NCC1 2JH2A 2BXYA 3LVEA 1SXSA 3RTQD 4R4FH 2UXGA 2NYKA 3L7FA 1FSKC 4BK5A 1YUHA 1QFPA 1KEML 2Z4TA 1S8DB 1WTLA 1WHOA 3TH3T 4XOEA 3O3AB 4M9OA 3SYOA 3WS3A 5F7MC 1YMMB 5JHDD 1UZ8B 4JPSA 3K4AA 3HNTH 4LPCA 5E6RB 5I74C 3RJQB 2CHZA 3RIAK 3VG9C 5DRXA 3PY9A 4PPTA 2WQUA 1XFPA 4UT6A 3ARXA 4B27A 3ZIYA 4PJFB 5K5YA 4JZOA 1KPUB 1OAUL 4GP4B 3RGVD 5E6IC 3FXSA 4LHUG 3RGBA 2V3DA 4LNVA 1TVHB 1OF0A 2Z91A 5KJRL 4WEUD 5ESVB 3RY5A 1L0YA 1IGTA 4CDHA 2DYPD 3H85A 5IQ9B 1OGPA 5TGBA 4M1GL 1ZLUH 2FBJL 5D7KD 3WG7B 4DK6A 4JO3H 2WJ5A 4QRRA 3AY4C 2HRGA 4L0YA 1BJ8A 1RUQH 3FO1B 2XWZA 1RI8A 2B1HL 1LNBE 3ARGB 4KI5C 4M8VA 3NQKA 5DQDL 2O5YH 2P4AB 3PGDB 2K4AA 5GGUA 4AEFA 3TJPA 3TVMB 1PQZA 3TBBA 1U8OA 4LHUA 1VA9A 3EO9H 4EI6A 1HHHB 2X53A 3ENEA 1FVEA 4M6AA 4HH9B 4YOKA 2E9IA 2GIXA