4PJ6A

Crystal structure of human insulin regulated aminopeptidase with lysine in active site
Total Genus 296
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
296
sequence length
867
structure length
860
Chain Sequence
KLFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human insulin-regulated aminopeptidase with specificity for cyclic peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Leucyl-cystinyl aminopeptidase
total genus 296
structure length 860
sequence length 867
chains with identical sequence B
ec nomenclature ec 3.4.11.3: Cystinyl aminopeptidase.
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF11838 ERAP1_C ERAP1-like C-terminal domain
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.60 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4pj6A02
1.25.50.20 Mainly Alpha Alpha Horseshoe Zincin-like fold Zincin-like fold 4pj6A04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 4pj6A01
2.60.40.1910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pj6A03
4FGMA 4ZW5A 3FUEA 3B7SA 4XMWA 4PW4A 4F5CA 4E36A 3EBGA 4R7LA 5AENA 3FU5A 3FUKA 4KX9A 3FHEA 4XNBA 3B7RL 5J6SA 3FUDA 4ZX5A 2HPOA 4R5XA 2XPYA 2R59A 4RVBA 4KXDA 4WZ9A 4XNAA 4FKKA 4HOMA 4NAQA 3FTZA 1SQMA 4ZW6A 4FKHA 4XMZA 3FH5A 3CHPA 3FUNA 3Q44A 3B34A 3FTWA 2VJ8A 3EBIA 4QPEA 5LHDA 4Z7IA 3FUIA 4XN8A 5AB0A 3FTYA 4ZW7A 3FU6A 4P8QA 4K5LA 4Q4EA 4R5VA 3QJXA 4OU3A 1H19A 3B2PA 3T8VA 4KXCA 4K5PA 3FULA 3B2XA 4XN4A 4XN1A 4MKTA 3FTXA 4ZW8A 4PU2A 4QHPA 3SE6A 4KXAA 4XNDA 4XO5A 4K5MA 4ZX6A 4R5TA 4XMXA 4RSYA 4NZ8A 4KX8A 5K1VA 4FYTA 1HS6A 3B37A 4MS6A 4K5OA 4XO4A 4X2UA 2DQMA 4FKEA 5FWQA 5AB2A 3B7UX 3Q43A 5CU5A 4FYRA 4ZW3A 4JBSA 3FUFA 5DLLA 5DYFA 5J5EA 3B7TA 4QMEA 4XMUA 3MDJA 3CHRA 4PVBA 4XN5A 4ZQTA 4ZX3A 4KXBA 2DQ6A 4FYQA 5LG6A 3EBHA 4KX7A 4GAAA 3FTUA 3B3BA 1Z1WA 3CHSA 3FUMA 3Q7JA 3FU3A 3FH7A 4XN2A 4DPRA 4K5NA 3FUHA 4L2LA 3QNFA 3KEDA 4PJ6A 4QIRA 3CIAA 2HPTA 3FU0A 3RJOA 3U9WA 3FTVA 3CHQA 3CHOA 1Z5HA 3FTSA 4FYSA 4ZX4A 4XMTA 2YD0A 2GTQA 3FUJA 3PUUA 4Q4IA 2ZXGA 5C97A 4J3BA 5LDSA 4XN9A 5BPPA 4XO3A 4QUOA 1GW6A 4XMVA 2XPZA 2XQ0A 3FH8A 4XN7A
chains in the Genus database with same CATH superfamily
2JKTM 4PJBE 3V4VL 5CIPB 4B9IA 3N85H 3ZW3A 3HUJF 3P9WB 1IGMH 5KSAD 1BXVA 2B7DT 2NT1A 3W39A 5ERWA 5JXNE 3KPMA 3VMNA 2A0LD 1AS7A 1XO8A 2VZ1A 3IXTB 2IALB 4HKJB 4YK4B 1W72A 8CGTA 2RAMA 3MNWB 3MRKA 1UVQB 4WFED 4RMUA 1AE6H 4QXUL 3T2IE 4UQIM 2PWEA 1UFGA 2EIMB 3NABL 3NZHL 3I6LE 4PJXB 3V2AR 3VQLA 3OKMA 3E9TA 3K2UL 4ZNEE 2Y24A 5E51A 5HYJB 4U1MB 3MRGB 1KUMA 3W38A 1RPUA 3LPFA 4DWHA 4OQTH 2BSSA 1MCLA 3BP6B 2BP5M 2Y07L 2YFNA 2FJUB 1NCCH 2GY7B 4KJWC 3H3KA 5IHUH 4G1MB 4CC4C 3ESMA 3B83A 3PJSA 2XV0A 5I73C 2JI1A 3EYUL 3TPUA 1KLGB 1G0DA 1BQLL 4YK4C 1I1RA 4GUPA 2FYYA 5JIQA 3RVUD 4KROD 3BFWA 4KQ3L 1CE6A 1TF4A 4UF7C 1D2PA 3V0EA 4HWEL 2O4EA 4P4KA 3E8UH 5E6YA 3SIKA 2ZXQA 3NA9L 1A4CA 4HKZB 3CN0A 3GKZA 2NX5E 5TE4H 2DN7A 2GQHA 2X4OA 3AQYA 2PW1B 1MXGA 1NIFA 1S9VB 1SFDA 1S7WB 3C6SA 4Q6YA 2W9LA 2LR4A 2HYMA 2BIHA 4GRMB 4BE6A 3RB5A 4IKLA 2YGVA 1CIUA 4KVCH 5LGJA 1SJXA 4NQEE 3L3DA 3L4TA 3GI9H 4NSKA 5CIPA 4G6JL 3LIZH 4IGBA 3GZOA 1KPVB 2YAPA 3KPSE 3HG1B 5E8PA 4BFIB 1PZ3A 5GQBA 1EJ8A 1J0IA 2R1XA 2F9BT 1CG9A 3IXTA 4HKJA 4JM2F 1W72B 1WA1X 2VN7A 3MRKB 3UTSE 4PJ9B 1ESOA 3GHBL 4MVBC 4PJXA 1SPDA 3L45A 3FT0A 4A37A 2MKWA 4J3SA 2EDFA 5TFSL 1XZ0B 3HB3C 3OKMB 3RGHA 3TZVD 4Y4HC 4BZ2A 4A2MA 1USQA 2BHFA 3MJWA 2I5YH 3SPJA 3ZMNA 5MI0C 1LEIA 1KULA 4PJXF 2W88A 2XG5B 2IIJA 3RFRA 1IAIH 3QDMB 4CC0A 3A6BL 1Q94A 1TVHA 4G1MA 4GQ9H 2DL9A 5I1GL 1I8KB 1KLGA 4PBVC 1S6NA 1CL7L 4R4BA 2WYTA 3DMMA 3RU8L 2FYYB 2ZXGA 4LSRL 1M71A 1AC6A 3SYAA 1NIAA 5IMKA 1CE6B 3DWTA 3EJUA 1UWGL 3N21A 3MLSL 4HKZA 2Y1AA 3MNZA 4W9KC 4Y9FA 3GSQA 4NKDB 3BUPA 3C6LA 4HIIB 4X5PA 4HIXH 4HQQH 3NCFB 4MAZA 4PV9B 1S9VA 3A6CL 1EEYA 1RKRA 2YOCA 5CP3A 2FWSA 3PHAA 4LEEA 2NXZC 2PYED 2EEBA 4M9OA 4UI2A 3MLRH 1GZHA 4KKZA 2B4CH 5D93B 3D12B 4KMLB 3EUDA 3TX4A 4O5LH 3G6DH 5CP7A 1C08B 1JZFA 1JXJA 1JNHB 4IGBB 2HG5B 3LMJL 3HG1A 5EB9A 4MCMA 1AZVA 5E8PB 1AXTL 4IM8A 4ZFZA 5I75C 4LOFA 5A2BA 5JXAH 2ZAHA 1FLRL 4P9ML 2BSBA 3ULVD 1DSFH 4NXSA 3RJQB 4TQ8A 3VYNA 3VD1A 4PJCA 4ABVA 3SYOA 3AQDA 5EF2A 1KEMH 4DIXA 3PFUA 3MJ9H 1XZ0A 1UTDA 5CZVH 4RISH 32C2B 4JCLA 4AG4L 3PY9A 3I3EA 1PKQB 4LXFA 2X1WL 4IGBC 2AJUH 1M2OA 4FQQB 2XG5A 4QRPD 2IPTH 3WTUA 1LE9A 4YS4A 3LJ3A 5T1DH 1I8KA 2XVBA 4HJ1A 2R2EA 4G8FB 4K4KA 4PJHA 1JZHA 5B4MD 4HP5A 2EYSB 1AH1A 1LEKB 4OF8A 5A3IC 4FYRA 3MNZB 4HBCH 3T6ZA 4EZMA 3NQXA 1I9IH 2G5UA 1YY8B 2BERA 1J0JA 4NKDA 4RGOH 3C6LB 3C5SB 2IAAC 3OLIA 3O3AB 1HWWA 1GCYA 1EEYB 3ZMEA 3EHBD 1IV8A 1TRLA 1KLUA 3EBHA 3TWCH 3QR1A 5F7YC 3TP4A 3GXTA 3WLWC 4YDLB 3JQOB 3QUML 4U6VL 1MVYA 4L2LA 1JNHA 3BISA 2HG5A 2NY2C 3EGDA 3OXRA 5E5LA 3QG7L 3RIAF 1DDTA 2OR8A 4IIZA 2WB7A 2HJLA 2O6CA 3RNQB 4NZFA 4XBGB 3PWJB 1BVNT 2DWEB 2F54B 3FT2B 3UTTE 4P2CG 4X5XB 1U4GA 4QRRE 4M7KL 3W1ZA 4JZNB 2ZSVB 1HESA 3U1PA 1I53A 2FZ3A 3CE1A 1BFVL 2IAMB 4TUJB 4U3HA 1PKQA 4L8DA 3WEOA 2WN3A 5EZIH 3QYMA 3P11L 4FC3E 1LE9B 2DQTL 5IVXF 5L4JA 1FZMA 4XP1H 1M2VA 2NXZD 2B4CC 4ZNEA 1CCZA 5I16B 1NGYA 2ERJC 3I74A 3DX4A 3L2NA 3CZSA 4E5XB 5TH2B 2DLFH 1KENH 4ZMQA 5B39G 3VXME 3ZHNA 1FJQA 1IU1A 4Q9QL 2EYSA 4YHPB 1SMDA 2GHZA 3E3QC 3LNFA 3Q01A 1YYLL 2YXMA 1A6UL 2SODB 2ZYIA 4N0RA 5IB2B 3QIUD 2BS9A 3POCA 3DHPA 2K9FB 4QPEA 4OZIA 3FCGA 1KLUB 2ZKHL 1NAKL 3CFDB 3WTTA 5BQ7B 2HRPH 2A38A 3GXIA 3TNNA 1J87A 3LH9A 3PABB 5I18L 1NIDA 3GXDA 1XBRA 2V5MA 4YQXL 3MA7B 3N2JA 1AACA 1EO7A 1N7ML 2BO0A 2YWZA 7TLNA 2OMBA 4GQQA 1DCLA 1XH1A 1JN6B 1BDYA 5B1AB 1J1PL 3PWJA 4P99A 1P7HL 2P5PA 2VUOA 3DDFA 2F54A 5CUSL 2ZUTA 3IMVA 3KBPA 1D3CA 4X5XA 4NN5B 4JZNA 3VWJC 5F70A 3LIZL 5HGHB 3CVHL 3W0WE 1QNZH 3NCJL 1DSYA 1V10A 4UT6H 3UJJL 5LWYH 5E6IA 2B5IB 3DX3A 1SLUA 5IUSA 1RD6A 1L7IL 1WV7T 4OZFG 2IANA 5SWZB 4MRCA 3IB4A 3S36X 5ALBH 4AVHA 4CKVX 3IXAB 3T2QA 3FN0H 4C57C 3CXDL 3OR7B 5IHWA 2EUXA 1M4KA 3LS4H 1LWJA 4F7CA 5CEZL 4PJIA 4PW9A 2JFCA 3KWWB 3WTXA 3F7PC 1KN2H 3TT1L 3VXSE 5JDJA 2OMYB 2DF3A 2DQFB 5MEND 2I5YL 5JHLL 5GGUB 3BSGA 2OYLA 2XQYA 1ZA6B 4QRPA 3A67H 3MLTA 4NP4L 2VMEA 3RU8H 2XWBA 3BKJL 2F6AA 4LNVA 4X99B 2ED7A 4UINL 1UWGH 2VXUL 1RP8A 4B9PA 3MOQA 2FO4A 1XCXA 3O4LA 4GLRI 4UYQA 1A6AA 1PY0A 3TNNB 5M7QA 2CUIA 3GO1H 2FLRT 3DX7A 5FC9A 1IEBA 4OQ1A 3OPZH 3TIDA 2WV3A 3ZGHA 2TSAA 4ILDA 3LH2L 4UDUA 3AS3A 3MN8A 4K7PH 2Y7LA 1R0AH 4NKMA 1M1SA 1MAJA 4F3FA 4I0CC 1CDGA 1MPAL 2AJSH 4JN1L 1GC1H 4GUCA 4F9LC 1WRFA 2R9HC 1NLBL 4LVHC 5T1LD 2WJ7A 3FH5A 4K3JH 2FBRA 4TVPH 2IANB 5SWZA 2QBWA 3DECA 3V0DA 5GS0C 3KDMA 2J8HA 3FO0H 4PJIB 4TM9A 1TZIB 3LPPA 4G6ML 4OFIA 2XXMB 3SYPA 2DMBA 4KRPB 2OMYA 2DQFA 3CVCA 1WFMA 5D7KE 2DMGA 3LYRA 4HYTB 3D33A 2DWTA 1MCPH 2CRYA 3HG3A 3ZE0E 3K2MC 5EIIG 3L4CA 2G9HB 1CK0H 4J3OH 4MJ4A 3MLTB 1HL8A 4P46A 2XWBB 2EE2A 1KZQA 4LFHG 5ALCL 4X99A 1FE8H 3ZR6A 4NBZB 5DPEE 5HDWA 4AQ1A 5HI4D 2FO4B 7TLIA 5IEHB 1OM9A 1YUHA 1EHLL 1QBMH 3QEHA 3HS0C 4LSTL 5C08B 2XXFA 4EOWH 1EO8L 2H9GA 3VRIA 4U0RB 1BD2E 3IDYC 5HDLA 1F4WH 5EO0A 1DBJL 1IC4H 2IMMA 3VI4B 3O0LA 2EXWD 4HUVB 2C9PA 3PXJA 4NKMB 5FYJE 3IF1A 2E9WA 2VE6B 2DL2A 4GW5B 4NLHA 1E7VA 3CPLA 2XFXB 4O2CA 4FULA 1R17A 3Q7JA 1E5AA 3CVIH 3MUGA 2XTSA 5FDWA 3TYGL 4AUUA 3L08A 4Q14A 4OZGF 1T03L 4PJ6A 3DX6B 4HC1L 5BRZD 2R0KH 4RMQA 3KJ6L 1MFDL 3L4VA 43C9A 4ZFOA 3BH4A 3RY4A 4PG2C 3UXFA 4KZEL 5KSAA 1IQWL 4MXQC 1UZ6F 1IB5A 2ESVA 3PQYE 4KI1A 2YRBA 4WTXA 1LK3H 2OSLB 3LH8A 2XZCH 3EJJX 5EZIL 4Z6AT 2QQLL 5GGRY 4LRIA 2VR6A 4PV8A 4WW2C 4XNYH 2YK1L 3EFOA 3PGCB 5T3ZL 2G9HA 2N0KA 3GPEA 3IMBA 4S1QH 3MRLB 4HLZH 2A74B 4KUCF 1FYTD 3V0VA 1K4DB 5KANG 1JGLL 4AENB 1BAGA 2IGLA 5GS2H 4LCCC 3PS6A 4BH7B 4TNFA 4LQ1A 4H8VA 3GB7A 4EIZC 1FFQA 4U1GC 3L5XL 4P3CH 1DLFH 1YUHB 2FO8A 3DV6B 3EGSA 2CUHA 1BQKA 2H32B 3IRZA 3FK3A 1ZLSH 5FECB 2CLRB 1HINH 1TQUA 3TURA 1M3JA 3RPIA 3KW7A 4UCFA 3M07A 3QVAA 4R0LB 2V0AA 3C6LC 4IOFD 1A7PL 5EO0B 3S5LB 1HL9A 1CLVA 2ARWA 2H0EA 2JI3A 1NEZA 4Z7QB 5LQBL 2BVQA 3IF1B 4UOW0 1RURH 5CBAB 4NCDA 5ETUA 1E4XL 2WBKA 1BVLB 2JJUA 4Y2DA 3SCMA 4KUZL 3CPLB 3X11B 2MJWA 3H9SA 3ZT6A 3ESVF 3FMGL 3Q8FA 4O2CB 3GRWH 2F7IA 4YHZH 5H35A 3D2UD 4OLEA 1HZHH 3MUGB 4AUJA 3TXAA 5GGQL 1U8LA 4UILH 1WT5A 2NY6C 3DX6A 1J88A 3C9NB 5CMAA 2NY5H 4CVWA 4ZFOB 1TCRA 2VAAB 3MRFA 4X4KA 5KSAB 3FNKA 2B2XL 4MTMA 5TE7H 3MBEA 1JHLL 4X4ME 2KDGA 2OSLA 2D03H 4FLSA 3EJYC 1E6OH 3FCTA 4G8GE 1UT9A 4H1LB 4YXKH 2AEQH 5EEUA 1Q9OA 2EADA 3AAZB 6FABH 3PGCA 5HVFB 1CYGA 1AMYA 3LHAA 4UQAA 4A38A 5SWSB 3O45A 2VH5L 4PVLA 2A74A 4HKXA 3V0VB 2F7PA 1N64H 3RX8A 4AENA 1FIEA 4HG4J 4BH7A 2R39A 3TVMC 1XL4A 3DIVA 5DA0B 4AXWB 5IMMB 2BY0A 2BNQB 4OFPA 5CD3B 4ODVL 4F7MA 4OF5A 3QXAA 2ICEB 3MBXH 3NCCB 4B9ZA 2CLRA 3RPIB 3NYKA 5EOQL 2ATPA 1XR8A 4R0LA 1KBPA 1P1ZB 4U6XA 5CGYC 4LU5H 2WHZA 3WKML 3BN3B 1NEZB 1BPVA 2Q76B 4BYHA 2Z92B 3P2TA 1EBAA 1MAML 3GINA 3CFKB 2EDOA 3D0LA 3QXDA 4PJXE 1OQOA 4Y9EA 4BSWB 3CZEA 3H9SB 3MCG1 1ZT1B 3ESNA 3NIFE 4TSAH 5H35B 3UTQA 1BZDA 4AEFA 1VZIA 2E9JA 4IDJH 2F5BL 1U8LB 3BVTA 2EH7H 2XRAL 3M6DA 5CMAB 4YSDA 4HSCX 5H2BB 1TCRB 2VAAA 1YEHL 3MRFB 4R84A 4JQIA 4ZYKB 2QADC 1TNMA 5MEPA 4YO0A 4UB0L 4DZBA 4X9GA 4HK0B 1KACB 3QUGA 4Y9CA 3FCTB 4IW4C 4H40A 7PAZA 1WZ1H 1Q9OB 3NK3A 2YQ3A 4TSBH 1T04A 2AQRA 2EDMA 3N1PC 5I26A 4ZS7H 1K8DA 2BMKB 2DQCH 5SWSA 1LDPL 1XSJA 1ZVSB 3PF2A 3J2PA 4NOBA 1ZT4A 1DJZA 4HKXB 4FABL 4G6MH 5DZPA 2XT1B 4WCYL 2YIHA 2HCZX 3ET9F 4P48A 1BBJA 4F7EB 3VFOA 3X14B 3HJ0A 4BWWA 5K7TA 1YEJH 5IWLC 3IDMB 2WBJB 2R69A 2BNQA 4PYHA 2WTPA 3ALPA 1J9SA 1NBCA 3GEFA 5CD3A 3H2QA 4F7MB 3NZSA 3QXAB 5DJXB 1CU4H 4Q9RH 1RIHH 1ZV9A 4NQXB 4POZD 4U6XB 4NHCH 3BQUC 3IDIB 4XGZB 5KYWB 3ZZSA 4OW3A 4UT7H 2CBOA 5FFLA 2QGDA 2BOLA 2Y9RT 1CT8A 2Z92A 4XE0A 4M1CD 5FUCE 3CFKA 5E2VL 3D5OF 2NSQA 2APXA 3D0LB 3QXDB 2E8YA 2XIIA 3ZLQC 1GR7A 4GG6E 2GY5A 3E0GA 3K1KC 4XVSH 5BQDA 1HHJA 2Y25A 4HU8A 4XB8A 1OD7A 1EQWA 1UA6H 3ARZA 4GSUA 4B9JA 5CCKL 1NUDA 4DVRH 1GGYA 1MFNA 2QJDA 2BFGA 4XC1L 5DD0H 4L4VA 3DMMD 4ZUWA 2ISDA 2QQNL 3BQUB 4HJGA 1MLBB 4ZUSA 5DLLA 3JUZA 1ADWA 4KO9A 5DUPH 1U8CB 1OP5H 3A23A 4OB5H 5E70A 5AW4B 5AW6B 4DZBB 5LBGA 4NUQA 1RUKH 3EJRA 3HE6D 1J9RA 1BLNA 3QISA 3PNWA 4FNTA 5MP6L 4N26A 5IESH 3LS5L 3E9UA 3UDWC 1SYSA 1RU9H 2HFFA 4HZAA 1U33A 2DW5A 4LZKA 3ZBMA 1IE4A 2Q8BL 1YO4A 2BOCB 3FCBA 3HC2A 3HMXL 2FSDA 5CSGA 4JG0H 3VFOB 5JO5B 3X14A 4F7EA 1GS8A 3AS0A 4QKXB 4U33A 1TLMA 1U93A 5C0IA 4QRSA 3C8DA 2LLLA 4BBWA 3BAXA 5DJ6A 3TFKC 3T08A 2ARJB 1YMME 2EP6A 2P42B 1T5WB 2ZG1A 1R24B 1MUJA 3KS0H 3QORC 1CFSB 1RZIB 4DAGL 1VEOA 2ZXAA 2H5UA 3GS4A 1GW6A 3EW3B 5I74C 2Y2WA 1J1XL 3HZMA 4IJTA 3X1BA 4M02A 3ENEA 4WU7A 1RUAL 5FFOA 5IQMA 1TJIH 5I0WA 4X4XB 4C4KT 4MCYB 3S35H 3ARGC 3MO1A 5AVWB 3OKKA 3QDAA 2ZUWA 1NCAL 2P26A 3GMRA 4MHHI 2VDKL 1WWWX 3FCQA 3NAAL 1FNLA 1G7QA 3IJ9A 4D2NA 1XCWA 4PJCE 2XN9D 2Z0UA 2ZCKH 3BQUA 3E38A 4HJGB 2BZ7A 3D50A 3LV3B 1U8CA 4GQZA 3R1GL 4M4PA 1H5BC 1KBGH 3GRWL 4YHZL 1AD9A 3BVUA 3S8GB 1G7IA 2AF2A 1SDYA 2DQJL 1CFVH 2ZSWB 1S7QA 3V4VA 2MCPH 3DX0A 2KLRA 4ZSOE 4H2CA 6TAAA 1KPRA 3U0WH 3B9VA 2HFFB 2W8CA 4YH6A 3UL4A 2VDQH 5D6CA 3WO3B 2FECI 5ICZA 3DROB 4PCTA 1ADQH 2VXVL 4KK5C 3D85D 1LDSA 2YSTA 5CEYB 3RA7L 2W95A 5E4AA 2EDRA 1U93B 3VYOA 1QKZL 3OWEA 2FATL 1N0LA 1X9LA 1GW0A 3TLIA 5DJ6B 3P7RE 3FB8B 2GC4C 1ZDPE 4MZNE 1B0IA 1PF3A 3Q6FB 1UCBL 5F88A 3SKUD 3VGFA 1XTMA 1WEJL 3JWNG 1OT4A 1R24A 3NPZB 3NEEA 4RAVA 3ZT5A 1MUJB 3WAJA 2YQGA 5DLMH 5MENA 5B8CB 4YHMH 3FVPA 5GGRA 4I3GA 4L1HA 5HHME 2Z35B 4FQLH 1R3KA 1R3LB 2WWMC 2IPKB 5DFAA 5BOJA 1N67A 1I1YA 3E2HC 3QAZC 1U4EA 3FQRA 4JFHD 4PUBH 4WV1A 1RMFL 1DYZA 2FT6A 4YLCA 3FB7A 4U1GB 4YBQC 2BOBB 3HNSL 4H25B 5CILL 3E8UL 4IOSA 4XBEL 5DK0A 3CC1A 3OKKB 4LU5L 5AW7B 1Q1JH 5I0YA 2WZ0A 5DRXB 1FGNH 2BIIA 1BM3H 2Q9OA 3L7FB 1G94A 1BW8A 1TQCC 2ZWYA 2Y7QB 1OAQH 4ODXB 3BT0A 4X50A 3CMOL 3M8OH 5LWDE 4OM0H 4YUEH 2GAZB 3BI9X 1NOFA 4JCMA 4QRUA 1GOFA 3LV3A 1BZ9B 3KEDA 3WNMA 1IEAB 3UAJC 4PVNA 2VERA 4TUUA 5BMFL 4OCWH 1AD9B 3V5KB 1G7IB 4E9SA 1IM9A 3HBGA 3NJIA 4DVBA 2NY2D 8PAZA 1L0QA 2G2PA 3TMNE 5GJSH 1JXFA 3U25A 4PJIF 2XG4B 3DROA 3BJ91 4HK3J 1CFNA 3UBXA 2DJ4A 1S2EA 2F1BA 1DJYA 4L48A 1N19A 1DQDL 1ED3A 3S5YA 3X2QB 3C8KA 2ADGB 1SXBA 4KGLA 5E9NA 2Y2YA 3ABLB 3CFTA 1N0LB 2MOGA 5IW6B 4JO4H 1FZJB 1RZJH 3Q6FA 5F88B 1T2QH 3Q8AA 2DTML 4DKAA 4JKWA 1T83A 5ISZA 4RAVB 1JGIA 1PIGA 1RK1A 3FLFA 5MENB 1U58B 3H42H 4J6IA 3TBVB 4TSCH 1XH2A 2OXHB 1I1CA 2Z35A 4FKKA 1R3KB 1SXZA 3F28A 1HCYA 1CBVL 4II7A 3FQRB 4LSRH 4WV1B 5EC2B 2OFQA 4G6AC 4GRLC 3FB7B 4M7ZC 4GMTL 2BOBA 1JPGA 4H25A 1NGXA 5LCVA 3QI9C 5DK0B 1T6BX 4AC4A 2AQNA 5DRXA 3L7FA 4LHUB 3TYFA 1OF0A 3AT0A 3ULSB 1FP5A 1E40A 5AAMA 2RB8A 2X9XA 4N0UB 5B22A 2ZF8A 3CLFL 2O6EA 3QJFA 5TGBA 5EZOH 1E8ZA 3ZDXB 3CCHB 4KQ3H 4WHCA 3OJMB 3V5KA 5F0PB 4HJJH 3O0RL 5D70L 5C0CE 3IJEB 4LPYA 4AK1A 4NKIL 2JIXA 2D3VA 4WU5A 4D0BB 5D5MF 4ECNA 3UIYA 1CDJA 3MOAH 1S3KL 3ZRCC 5F9JB 3HI6H 4PJIE 5F3BB 1SXNA 1D5XA 1TJHH 4RGNC 4GRWH 1ED3B 4X4MA 1MVFA 4YHYB 5ADPL 3D0AA 4Y2DD 1IARB 4QHMA 3D52A 1FZJA 1KJVB 1DVFA 3P69A 2VXTL 3MOBL 4ZXBA 1GGBH 3TF7C 1Q0EA 3TBCA 2TMNE 4DTGL 4KXBA 4X4ZA 1KT2A 5ISZB 2ROYA 3P73B 3SZKC 2GJ6D 4XHJD 5C0NC 3TBVA 3BAEL 3UAJD 4ALAH 3RWJB 3CH8A 4LSPH 3TTSA 1RIVH 4HS8L 4N5EC 4PRID 1KL6A 3VX0A 1FWXA 4Y7OC 1CL7I 1G1YA 5EC2A 4JFOA 2KKQA 4DKEH 3FONA 4LSUL 1GGCL 4L23A 1JPGB 3MA9L 1MDAA 2HZHA 4NPJA 1JL8A 3IWUA 4LHUA 1WC7A 1JNNL 1SDDB 2PWHA 3A4FA 2AK4B 3BH9A 3IDNB 1WE5A 3GUFA 4FFZA 1MRDH 4N0UA 3TOPA 3HAEG 1MRCH 1QO3B 2PXYA 5DO2D 4WI6A 3OV6A 3L3HA 5AYTA 3B5GA 2WD0A 4UIMB 2WMPB 3S3CB 3FSZA 4BKLB 1JGUH 5FGCB 1AHMA 1WCBB 2BHYA 3BD3A 3RUGF 4MNGA 2J1ZA 4KO6A 3D4CA 2AEIT 2EDNA 3H3BC 3QG7H 3MBWA 4RNRB 1D5BA 5F9JA 2AV7A 3BRFA 4LCWE 1D5XB 4YHOL 3BUBA 2W59A 3VRJB 3GHBH 1Z9NA 3FUNA 5TFSH 5AW2B 3VGAB 1CLYH 1WFUA 4K3EL 3EBIA 3KD4A 3LMJH 4G7VL 4O2FB 2O6PA 1JVLA 4FQPA 4YZFE 1MCWW 3VQ1C 1BF8A 2WZ5A 3EKCA 4NFDA 4Q8BA 5I8KL 1PG7L 3AQZA 4JPVL 4JPSA 1XR9A 4AGLA 1WITA 2P47B 2LOEA 1O6SB 5I1IH 4NRZA 3CV5A 3FONB 1WS7A 4LEOB 3F7LA 2G4EA 2W0FB 3H9SE 1MJ7H 3BUQA 4UDTA 1BVZA 1EVUA 2YA2A 2DOCA 4Q6KA 1ODAA 2DEXX 2ZCLH 4RZCA 4K23L 4TF4A 1MY5A 1VZHA 1QF1A 2DQEH 3UJTL 3N1MC 5CJ5A 3EYVA 5LBSL 4KY2A 3SBRA 4FCHA 4ZRGA 1LLAA 1XT5A 1A3LL 1QLFB 5DHVA 5FM5M 5ICYB 2VB5A 4HWEH 3UPRA 4G6FB 4UIMA 4H7VA 3SB3A 2CXKA 3MLRL 2UX6A 3MV8D 2GYSA 4Q9CA 4F7KA 3RY5A 4PS7A 1QLEL 3RZWA 3NG5A 3RUGE 3CHRA 2XICA 1BMWA 3CMOH 2DD8L 4L1LA 2DQ6A 4L4VE 1OP5K 2AXWA 4WI0B 2BNRA 3WS3B 4YJZL 2AV7B 5D2LF 3BCDA 4BFRA 3QRGL 2E56A 4XVJH 2VXQL 3RE0A 3AM8C 5HHOB 4KWUA 3ZKXB 5LGYA 1AI1L 1SNRA 1S4IA 4G6JH 4FNLL 1Y0LB 2BDNH 2IOOA 2AXHA 4YBHA 3LIUA 4ODWA 1KCRH 1G87A 5EU4A 3LKSA 5FB8A 4CMMA 5LXGL 1Q0YL 3KBEA 4MASA 1WK0A 2IPTL 1A6ZA 1BECA 1LO3L 1A0QH 1BEYL 4LHUD 3BGFB 4N25A 1HH6A 1QRKA 2I25N 2J5LC 4XMPH 4BZ1A 5CEZH 5I71C 1O6SA 2QQKH 2E86A 1JV2B 3FF7A 1SYVB 3FB0A 4ZW5A 2W0FA 4OD1L 5E5RB 3U4KA 5GXBB 4UDTB 4NUJB 2VTFA 4FJZA 5EC1A 4N4EE 4ICWA 4LLDB 4AQEA 3LEXB 3UJIL 4RBPK 3ILQD 1IGYB 1QBLL 1INQA 2O26U 2VDLL 4KKNA 4AEIH 4MB4A 3FCSA 1XB3A 1QLFA 1SZNA 2XZZA 1U8HA 4J3OF 4S1SH 5DHVB 3BVNB 2Q8AL 3SY0B 3AACA 1S7RA 4JG1H 5HJGA 2CZNA 4XPGH 2D2OA 3VCLA 1AOHA 3KYMA 3O6FB 1YNTA 3JV0A 4AVJA 4FAAB 3TBWA 5IEKB 2OR7A 4IBZA 3T1FA 4DGVL 4K71B 4PREB 4JREC 1PFOA 2BNRB 4MJID 3WS3A 5IQ7L 1MI5B 3GSNH 1QF2A 4HCRH 4O02H 2B9BA 5EOCH 4ZW8A 5KYXA 2B4CL 2VDNL 4Y2LA 5FYKU 3ZXAC 2QMKA 5ABDE 1A7RL 1NIBA 4YFLI 2XKUA 1XF2A 4GKLA 1SJVA 5KAQF 2OL3A 5EU4B 2IH1B 4CMMB 4J4PA 1TJHL 3VNYA 1UJ3C 7FABL 2Z91B 4IYKA 1QW8A 5IJKC 2PWFA 4LSQH 3HE7A 1KEML 3NRQA 1T66D 2COQA 4CGUB 3ZOAA 1UXLA 2HFGL 4P3DA 5I6LA 1BYPA 1VFAB 5BW7C 3QIBD 3I75A 2VUKA 1OGTB 1SYVA 2QTVA 3HC0B 3NCJH 2UZXB 4BDVA 4C56D 4NUJA 3ROLB 4LLDA 5C0AB 1UHVA 1IBZA 5I24A 5KSBB 4E0RA 3BEVA 2OI9B 5FDYA 3MV9E 3JTTA 1WWBX 4ENED 3QZMA 1INQB 1RZKH 2E74C 2J25A 1RUQL 3GNML 1J18A 1CLZH 3G7TA 3S36L 3FCSB 1U8HB 1GGCH 4JGNA 5DRNB 1HIMH 3FU3A 1PL3A 4D0DA 3VCLB 1JPEA 3QYCA 3QHZL 1N0XH 1A64A 2G60L 3O6FA 1YNTB 5IEKA 4PP1C 2UWEE 2A5UA 3HZYA 2CK0L 1JHKH 5IMOB 4NQDB 3DHJA 5KJ4A 4R96A 4X6CE 3WN5C 3QT2A 1PLGL 4IRSD 4ICXA 1JYXA 2XTJC 2EIDA 2JJWA 1PY9A 1XTLA 3K6FA 4JPWH 3NPSB 2X6UA 3KCPB 2DYPB 3P3RA 4WGVB 4J3UA 1MQKH 3HKZA 4JFYA 1XF2B 1GZHC 3OMZA 4X8JB 1FNHA 2Y6TE 2AABH 2VSCA 1XEDA 3QCVL 4PW4A 1NFDA 3FT4A 2IH1A 3NIDF 4P2RB 4R7LA 3QUXC 4CVZA 4NNYB 5DVLA 1YN6B 4QHLA 2Z91A 1MLCA 2BNUA 1SXAA 1RZQA 3DYPA 3FU8A 1PDKA 3HE7B 3UAFA 4RGNB 2KPWA 4RRPG 1HH9A 2XWJA 1TMNE 5DJYB 2AJSL 4JN1H 2Z3FA 4PJ9C 4YHYC 4G7VH 1OGTA 4ONFL 4FQJL 1UB6B 2UZXA 4BDVB 1G1OA 1W8EA 5L2KB 3DJTA 2DZEA 4LNRB 2BVYA 4B5ZA 3FTWA 5C0AA 5KSBA 2F0CA 1G43A 2X38A 1T83C 3SDYH 4OVUA 4S0HA 5L8PE 3A67L 2V9UA 3JTTB 4NJ9H 5DEJA 2YD8A 1XF5B 3MRMA 2C1OB 1E9OA 1IBGH 4Y5XC 2B3IA 1U3YA 3OAZH 4B5EA 3KBFA 3HPJA 2X6BA 3GMQA 5B7EA 5DRNA 2DEYX 4EIUA 5D1XA 1OSPL 4JFDD 1QUNA 2CIKA 1SHXA 2CO4A 4Y4HA 3SGEH 1II4E 3ARXA 2OYPA 4MSWA 3NA4A 4JFEA 5BJTB 4Y19D 2ZWSA 3SDDB 3HZYB 2A4CA 2VKXA 4XNUH 3SDAA 4NQDA 3WXWL 3UYRH 4DP5X 5EN2A 4OGQC 5AZEH 4TNVK 5J11B 3J27A 3N0PB 2F8OA 1SBBA 5J1SC 2EDYA 1GZQA 2HH0H 4ERSH 1DQQA 5KTEH 2YXVA 3BUTA 2N3JA 1SMOA 3RVUC 3REWA 3HRZA 1L0YA 1I7ZA 3CFCL 3WTWA 3KCPA 2DYPA 2JKLA 4B9CA 4N66E 2O6FA 1DHKA 2A3TA 5J6HB 3DO0A 1FFOA 4L8SB 4X8JA 9PCYA 3NSXA 3MCYA 3FMGH 1A3RL 3F62A 4I8DA 5FF6B 1PAZA 3SSGA 2BSRB 3JYBA 1E90A 5KVEH 1NFDB 1IQDA 4CVZB 1K9TA 1G9NC 4HS3A 4KK9C 1KDIA 1NGPH 2YLHA 1WVZA 1N12A 4NNYA 5DLHA 3U6RB 4K90A 4Y4KA 3AREA 3TO2B 1MLCB 1C12A 3L5JA 3PV7A 5LGHH 4IEFA 4W81A 5HYSA 2VDRB 3T0EE 1HH9B 2AQSA 5I19H 2ZONA 2D7OA 3MR9B 3UZVB 1JK8A 4NO0A 4TTGA 5DFTA 1LVEA 4P46D 5AVYB 1VA9A 3L3GB 4AR8A 3MSNA 3PE9A 4B97A 4EPSA 4OTXL 2O5XH 4IRSC 4MQ7A 1J5CA 3ULUF 1ZS2A 5AW3B 5H37A 1M3IA 1NMBL 5SV4A 1KXHA 1TEYA 3KMDA 3QFDB 4DUWA 4XMPL 3LS4L 3REVB 5I1JH 2VQXA 5ESVB 2F74B 3ZN6A 3D4YA 3H0TB 2X40A 2KPNA 4HXAH 2DIEA 2IADB 1F3JB 1SGKA 4HIJB 3ZKSD 4JFEB 2QSVA 3SDAD 1KXTB 5BJTA 1EHLH 5F7MC 1FZKB 5JSSE 3HN3A 3ULUH 1XGPB 4NP4H 1G5AA 1GYCA 4P2OC 4BH8B 2AJVH 1I3UA 1NL0L 2J3SA 1RXLA 3GEWB 4GI9A 1DQQB 3T8FA 3V6FA 3IE9A 2FQGA 5AL0A 1MAMH 3CQFA 4JJHA 1RERA 3ARGD 3FTZA 4JN2B 4L8SA 5E7BA 1IKOP 3BUDA 5B1KA 5FF6A 3MMEA 3AG1B 3O6MH 4KNTA 1IQDB 4HS3B 5L6YL 1A7PH 4DO6A 1A22B 1XF3B 4XXDB 4UWQB 3U6RA 4Y4KB 2YHGA 5ELIA 5IIEB 1MREL 4P23C 3QCTL 1W6LA 3C60C 3T4AA 4PRNB 1YNKH 4NJAH 5D1QD 4PPTA 2C1PA 5GRVL 4Y5YB 1BQSA 1XIWC 3PGDB 2R51A 3L3GA 1SLVA 1ZLWK 3KPQB 3WNKA 1A1MA 2YD2A 4TSBL 1VFOA 2WOBA 3OJVC 3ULVC 4KNQA 2L0DA 4MJ6B 2GABA 3NTCH 3AC0A 2W07B 3MHZA 3UO8B 4UOQA 2DWDB 3RVVC 1RZFL 1XBDA 4YHKH 5FR3A 2EVJA 2MPAH 4HWBA 4HIJA 4AYSA 2O5ZL 3IMRA 2F8XC 1JRHH 3EJYD 3UEZA 3W81A 4BFKA 1YMMD 2UVFA 1FZKA 2NY7H 1XGPA 1A5FL 2H8PA 2JJTC 35C8L 3P4OB 4BD4A 1GMEA 5FUZL 1EEZA 3FC8A 4WVRA 3K71A 2PCPB 3JVFC 3RBSA 3TF4A 1NCCL 1U0QA 4JANB 1MWAA 3VXTA 4BK5C 2CWRA 3FTUA 4RQQB 3TVMD 1BBDL 3IMUA 1W0VA 1B9KA 1Z1WA 1QOKA 2D4DA 3VI3F 4AT6B 1X9UA 3FJTA 3ZRSA 1PZSA 5JORB 5IROD 3MMEB 3FUHA 4ZPTA 1OAKH 1V27A 4X6DA 3VXNB 2BH0A 1F4WL 3AGWA 4IKNA 1XF3A 4KDVA 2ZPKH 1LNCE 1BXXA 1G6RH 4UILL 1NBZA 4UQEA 3CN2A 4WGKA 3T4AB 4ZX4A 2WLNA 1Z5LB 5CLXA 5D4QA 2P5WE 5DHMC 1KYAA 2EECA 3UH8A 5CLYA 2ALWA 4M8VA 4NP9A 4EUPB 4NN5C 1T6WA 3O6KL 5K9JH 3V79C 1Q9KB 1ROCA 4XCEA 2DPKA 4FQCH 2PYFA 4FQXB 1TENA 1A1MB 5E2TH 1I8IA 4WY7L 5JNYB 4BFFA 2GSGB 1OALA 3UIZA 1NEPA 1BMGA 4FXKB 4LPVA 3KBHE 4F9PA 1NUNB 5EZJB 2GFBA 3OMNB 4TS6A 2BS8A 3JWDL 3V4PL 2ZYRA 4NUGL 3OKOB 2X6AA 3BWAB 4BGDA 2AMUA 2IG2H 5I5RA 3X3FL 2W81C 1FH5L 4XNAA 1NC4D 1FORH 2CLVA 2J20A 4XAKD 5E6IC 3DV4B 4NJ9L 2H6UA 1NDGA 2QELA 5DRZA 4BCYA 4ZMPA 4KNSA 3TA4D 3P4OA 2MH4A 1U6AL 1EEZB 3K80A 4PRDB 4X7EC 4NAJA 4FXKC 1CLCA 3MRJB 3BD5A 2B16A 1KCVH 4JANA 3BPNC 2V9TA 1MWAB 1THLA 1LP9B 2QGCA 3N06B 5DT1H 4PJFE 3PFQA 4QXUH 4YL9A 5DD5L 4LO9A 4QWWD 1OM3H 2FHBA 1P7QD 5JW3H 5KN5A 2R8SH 4NNXA 4AT6A 4KC3B 4XN4A 1CU4L 3NIGE 5AYUH 5EG6C 2R1YA 3OG4B 2FHCA 1LEGA 2Z31D 4QHPA 2CDEB 4WTQA 5AOZA 5GRWA 3VI3A 4KXZI 1ONQA 2XX1A 3N44F 3QIUC 1UOLA 5F0JB 3GHEL 4X6CB 4L0YA 2Y07H 3ZK0A 3ULVE 4MAYB 4YHLH 5J1AA 4AKQA 5EU5B 3LZFL 5IHUL 2LU3A 3DJSA 2WVVA 4YDIL 3VI4E 4L0PB 3MREA 1Z5LA 5IWLA 4PJ7A 2LVEA 3KXFE 4BK5A 5J0BA 4EUPA 1QX1A 3IFPA 3WFEL 2CHZA 3IU3B 3GQFA 3HB3B 2K1MA 1Q9KA 2OZ4H 4KJQC 3TEWA 5KZCD 3N04A 3MODL 2HJFA 4BZ1L 5JNYA 1YYML 3IMWA 3WIHA 1VJSA 3KYAA 3QIUB 4N0YL 5AALA 4G11A 3U0WL 2NR6A 4MQXD 2L8AA 4OLWH 1BXAA 2B8OT 4A2LA 1GH7A 3AY4C 1GAFL 1YJDL 3ILDA 4DEPC 4RFEB 1N6VA 3OKOA 3Q0HA 1IKFL 3WS6A 2EDTA 3VFVB 3EGXA 2OJZL 2HLFC 2XTLA 5GRZA 1TTBA 2CHXA 2OJEB 5C9JB 1A7OL 2CLVB 5BZXA 3FUMA 5MP6H 3BAYA 1F00I 3BWSA 3K2UH 2BHZA 1NDGB 4Z7QE 5DRZB 2ITDA 3BZFB 4NZUL 4OSUL 1PBYA 2NW3A 4XOBA 4J5VA 1GPOH 5MHSD 4CJ1A 1L9OA 4I9WD 4JL2A 3MRJA 5FYJU 3ZPDA 2BZDA 1LNEE 1CXEA 2KMWA 3TO4D 2X4NA 2V7NA 1UKSA 1T1XA 4V1DB 3L1FA 2C9AA 4NNXB 5IOKA 3RWDB 4EZKA 5SX4H 1ZS8B 3FZUD 4FI7A 2HJKB 1LEGB 3IGKA 2X89A 2AEOA 1NPUA 2KHAA 3D85A 4QLWA 3TFKD 3CBRA 4FQ1H 1BWWA 3UTTB 4GT7A 2DTSA 4X6CA 3P0VH 1TZGL 2ZWLT 4FP8H 4JFTA 5GS2D 5J1AB 3CNKA 1F1DA 1JMZA 1T1ZB 3T2HE 2WBXA 4RGOL 4G6KH 1U8OA 1B4TA 2YEQA 5JT9E 4OJDH 1K5NB 2VW4A 3H3PH 3H54A 4PJ7B 5FO7A 3WUWG 4Z7WB 1T3FA 3IU3A 5I15H 1KTCA 3T8HA 1XB6A 1CD9B 4CUCA 1ESPA 3JWOH 2LW3A 2AJZB 2XN9A 3BQUD 4N5PE 3C5XA 4JW3A 3U2SA 4BXVA 3GJEA 2WXIA 3DARA 3UG4A 2H4EA 4P23A 4BUGA 3IDXH 2G30A 1ZHLA 2A6JB 2NXYD 3FDWA 3VDAA 1OB1B 3D4GA 3VFVA 3HZKB 1G84A 3KR3L 1QPXA 4WWKC 4CU8A 2OJEA 5C9JA 3ULVH 5JMRA 3P9MA 2Q3AA 3DC0A 4U1NB 4AEEA 4JS7A 4KKAC 2K45A 4XB7A 4X98B 2ITDB 4HGMA 2E9GA 2NW3B 5JXAL 2ZUSA 2VXVH 1U92B 2KBGA 4QY8A 2A74C 4W68A 3RA7H 4JHVA 1L6ZA 1Z9PA 2ZNWA 1L7TL 4EQ3A 4ZMLA 3NGBB 3NZHH 3RWFB 4V1DA 4NT6A 3UG5A 4ZFQA 5IREA 2VISA 4LLUA 5E0FA 4MA8L 5TD4A 4MQXC 4HJSA 4ADGA 3MNDA 3JWNE 4LCIL 1I8LA 3N40P 1HNYA 3GFUA 2VDKH 4WUUE 1KIRA 1TZ8A 5J5EA 1IM3B 3WFDL 5CINH 4NB7A 1AC0A 3OAZK 5I0DA 4I0PC 3Q2LA 5A3YA 4UQ2B 2JVUA 2J43A 4Z7WA 2OK0H 3QJTB 1HCVA 3PQYB 3GIZL 4NO5A 1CGWA 5TPWH 5CCKH 1XGRA 4N2AA 4M8QA 2P3YA 2WLLB 3PL6A 5GSVA 1R47A 2XN9B 3MLYL 3MV9A 1QSFD 3ISRA 2LVCA 1MCOL 3PP3H 3GJEB 2K9UA 3LN4B 2Y06H 2WINA 4NZDA 5CJXC 4AQAA 4H0LC 5CEZD 2NY6B 4P23B 1ZHNA 1O7SA 2A6JA 5DK2B 3BPLB 1RUKL 1FL5A 2OTWA 1EH9A 5FXCH 4DP6X 5AL8A 5IFHL 5JPNB 3DX2A 3P9MB 2D7MA 3TESA 3QUMH 4U6VH 5GJSL 3H9YA 3MU3A 3WJLC 4KROB 3VACA 3UJJH 5IOPA 5K1JA 3VW3L 2VLKD 4OFDA 1P4BH 5DLML 4B0MB 2AJUL 1QEWA 4XCCL 43CAA 5EUOB 5JXEC 4LK4A 1RFDL 1V3MA 3FUKA 4K8RH 3ASNB 5KUMA 1F8TH 1VGEH 3RGVC 4NT6B 5DSCB 2BJML 2H32H 1PKQE 1CGVA 5CO1A 1Q1JL 3CN1A 4KROC 3I9PA 1CDHA 1KIRB 2JJVA 1J10A 4L1BA 4I1RA 5DD5H 5C0BA 4UOW1 3O41B 1LE5B 4UIKH 3BRGC 4V2CB 1LWHA 4UQ2A 3GPSA 1OWRM 1G7PA 3HNVL 3HW7A 4N20A 2PTTA 2ODIA 2J88L 4MWFB 1KLFA 4NO5B 2D0FA 2FHFA 1FFNA 3ES6A 5IM7A 4YFDB 3GBMH 4PH8A 4M8QB 2GG1A 1NLDH 1R46A 3CZJA 4JZJA 3GZQA 3RWEA 1UZ6E 1DE4B 4MS8D 4YDIH 1UATA 3KGUA 4LOVA 4M4RB 1P7KA 4XNZB 5DHYA 5AZ2H 2X3AA 1OAYL 4HHAA 3LRMA 2QPSA 3LRSA 5JQ6H 1HQRB 5KJ7E 5DK2A 4HJJL 1FL5B 4KX8A 2OTWB 1I7RB 5FA4B 4M65A 2QV2A 5HYQB 3D9AH 4L05A 1JS4A 1YEFH 2CD0A 3L3OA 1JTTA 4AIXA 4G3YH 4B95C 2W0KA 3G6DL 4IRSA 3MV7B 3HIZA 1EX0A 4YOKA 5J1TC 2C7UB 3BH8B 3D48R 5IOPB 4WI7A 1EUTA 3VE0B 1V3LA 4WGWB 1G7HB 2NR6C 3FGDA 1QEWB 3FT3B 3OKLB 43CAB 1CFMA 3K8MA 3WKNA 1E4XI 5D2NA 2K78A 5GHWH 4XBPA 3ARFB 3DJ9A 3KLDA 1FFPA 3JV6A 2BX5A 3ULUC 4DGUA 1KENL 3I3BA 4LLAA 4DKFL 5C0FA 1RPQA 1SBSL 5HGDB 1HK6A 4OLUH 3SQOH 3F7VA 3EAKA 4OM1L 4TUKL 2A6DB 2IBGA 5KYYA 3KG5A 4QTIH 4GRWE 1XCTB 4JRYA 2VLRD 3MLVL 5BZZA 4HS8H 1DFBL 4OV5B 3GXUB 3CK0L 5LBSH 5C0BB 2EIJB 4ZMAT 3C75A 3SDCD 2FT8A 3UAAA 2DBLH 5AVXB 3SCMD 4R90L 2PTTB 4KTEH 3RX7A 2WKGA 2NW2B 1EAPB 2P45B 2QSCH 3B2MA 4MWFA 5FWRA 3E7JA 5IM7B 1P6FA 3P0VL 4AEHH 1A4AA 2X9YA 2NY0D 4HBCL 1KV7A 1LYQA 4JZJB 1X5IA 2ITEA 2KYIA 3VWKD 1FZOB 4P59H 4Z7OE 4IIQA 1P7KB 4H2AA 4I2XA 5F1NB 1AMXA 1IC7L 3HI6L 3QO0A 4HHAB 4XMWA 3QYNA 3GUTA 3Q3GB 2VLMD 1FVEB 2YPLE 4Y1TA 4LE8A 4HWUA 3RG1C 4CSSA 4WIQA 4XNBA 5AQ0A 4R5XA 2WJ5A 3F7YB 5C2UB 2XN2A 4GAGL 5HVWA 1G7LB 2OKMA 2F8IA 3B7YA 3VE0A 1RUMH 4B96A 3FT3A 2Z4TA 3FAXA 4XP4L 3VH8B 3UBXI 4MJ2A 3FN0L 3SKMA 5D2NB 4QYAA 5EO9A 5AVUB 1NOLA 3ARFA 2HT4D 5CBEA 3FUIA 1W2KT 3LB6D 3GRWA 3APDA 4GXFA 3KPOB 1WISA 1UACL 3G3LA 2A6DA 1IGCL 1J1OH 4L29B 5IR1A 2WGXA 4JRYB 3T8DA 2NLJA 4JRWA 1U9KA 1BZEA 2D7QA 3IJHB 4NZTL 3DSNB 4QI3A 4JHWH 1T7VA 4H1LH 5LGKA 4NFBA 5AEAA 4KK8D 2AEWA 4RAUB 5EULV 5A40E 4JRXB 5D1QE 1BAFH 2NW2A 4Z5RA 1HJBC 2V2XA 2C34A 1JGUL 2I69A 5F21B 1IM9D 4ONHA 1EEUA 4H26A 4EZLA 2DQEL 2R1WB 4XP9L 1PE8A 1M7DA 1CK0L 4IIQB 4B9YA 5I5MA 4Z7WE 5CHNA 2P5EE 2A9MH 1HYSC 4G8GB 3T0EA 1H3PL 3KCWA 4G43B 5I73B 3O2DL 1I1FB 2D0HA 4OFQA 3GUTB 1YMHA 4L3EE 4Z7VF 4F2MB 4N90E 3STLA 2FWUA 3U0TA 5T33H 2X9WA 5HI3C 1MCOH 1EVTC 2G3XA 5B38A 1TJGL 2O30A 2VDOL 2Y06L 1PZUB 4H0HB 5E8DL 1WBZA 4Q97A 2FSEB 3OAWA 5EOTA 4XX1G 3BZ5A 4PRPE 1N8ZA 5DO2C 4U31A 3VH8A 4DZ8B 1A3QA 1H6TA 5EO9B 4WO4C 3RVTD 3SO5A 5CBEB 1AI1H 3BKYL 1VADB 2A2QT 4ONOA 4OZHE 4WWKB 3VYPA 1QNZL 2GCYA 4M43H 3HC4L 3WEXB 3VXQA 4ZMWA 2VLKE 3HMWH 4TVSa 2PR4H 3TGXA 1K6QL 5EOCJ 2NT0A 3CVIL 3P2BA 5TE6L 3D4ZA 3T65B 3QZWG 3WFCL 4R0LC 5IR1B 1RP9A 2C26A 4GAYB 2IDFA 1JVKA 1CDUA 2XPGA 1U8QB 2AQTA 5SX5K 1OTTC 3M7FB 1T0OA 4OFYA 5DTFB 2JV6A 3AWEA 2V37A 2IGFL 1MW0A 3ABGA 3ZTJG 4RRPM 5A6MA 4LDOB 3IPBA 5DD1H 4X8GA 4ONHB 4R7DB 4B60A 2D31A 1I1AB 1R3HB 1M7DB 4N2NA 1QWUA 3W9EA 1NOAA 1MRCL 2OQJA 4HCIA 5LO7A 3T0EB 4G43A 3CHPA 4FLHA 3RTQC 5T1LA 4G6FD 1DBJH 1I1FA 1IJ9A 1P5UB 4Q6IA 3RKDD 3RPKA 3TBSB 2J21A 1NJ9A 2Z1PA 3TM6A 3NVQA 4WTZG 5GRYA 1LJMA 3U0TB 5ADOH 3CFNA 4H20H 1R33A 1A14L 3DBXA 4U7MA 1JZ8A 5B38B 4F2EA 4ZXBD 2R4RL 5EOTB 3NIGF 5EU7E 4AITA 2H26A 3EOTL 4K7PL 3RDJA 1C5DB 4PRHA 5T5FL 4BQ9A 2OL3L 4RMVA 5TDNA 4HW6A 4GYBA 1GGIH 3ROOB 3HVDA 2R29A 4DZ8A 5JW4Q 1Z9LA 4QHKJ 4ELMF 1KV3A 1RI8A 2NXZB 3UAEA 2XZQH 1FG9C 1VADA 4UAHA 2UZIL 3VG0L 2ICEC 1DVXA 2EDKA 1SJHA 3KL5A 2XUWA 5T8IA 1DEDA 3K74B 4ZNCD 7FABH 4OLYH 1GS6X 2H0FA 5T1KB 4U1KA 1QTSA 4Q0XH 2DQCL 4FCAA 1U8QA 1XH3B 1AD0B 3A0OA 3DHUA 4PJDF 3VGBA 4Z7NB 5IQNA 1XZWA 5EUKB 2V5TA 2LFEA 4LSSH 4D9LL 1JGVH 4PJBF 3U4EB 1KSRA 3MRNA 2ETWA 1UENA 3AFLA 3HUJE 4WFEE 4H8WH 1JYVA 1GTFA 3PHOA 4U2YA 4WI9A 4FYQA 3LNIA 2R27A 2EDJA 4KRMB 4ZMNA 1EJOL 3O11B 4G9FD 5DVPA 5GS1B 2Z65C 1IGIH 1O7VA 2OQJB 1TYJA 4N0FB 5CCGE 5T1LB 3SE4A 4CVXA 1HHGB 2UY6B 3ZTEA 1P5UA 4Q6IB 4NX0A 1J8HE 2JCCF 3DX9A 3R0NA 5MEOB 5BO1H 1QHQA 4PJAF 4OF6A 4XRCB 4HK3N 4ISVB 1EFQA 4M5TA 1NAMA 3T4YA 5I23A 1KEGL 1WPCA 2YAHA 5L9DL 2OP4L 3ILPA 4L4TD 1AGFB 2XOTA 5EOQH 5D7LB 3HB3D 5D9SB 4JHBA 5C71A 4DVRL 1DDHA 4GW4A 1YEGL 5BS0E 5KVDH 4DP1X 4MYPA 4FFZH 1C5DA 4G1EB 4PRHB 3UO1H 3QQ4B 4N6RA 2FBOJ 2BRQA 1CO1A 2WXKA 1LL1A 2P43B 1FN4A 2BP0B 5KBLA 5LCVL 5MHSE 3FU5A 1UFUA 1OB0A 1CYWA 3EH1A 3PHSA 1G9MH 2EJ1A 3RL1A 3F64A 4E5XG 5EA0H 1UXWB 3F85A 4NQCA 2YMXL 3OX8B 4U1KB 2XRAH 3BFOA 2V6HA 1NGQL 5EUKA 4BWTA 1QFWI 3IFNL 4FQ2L 3H7BB 5I1EH 4HUWA 3MRNB 4WUKL 2NNRA 1ZGLP 2XZCL 1BJ1H 4GB9A 4JY6B 3DIFA 1N0XL 3Q5TA 1X5KA 2B1HL 3PHOB 5IFJA 1PU0A 2VL5B 2EDLA 4N1CA 1TU2B 3RZCB 3WNLA 4GW1B 3O11A 3U4AA 3ZYZA 2XN9E 1OGAB 1H19A 3PHQA 4LESA 5C3TA 4WK4B 5GS1A 1ZDQA 1ZTXH 1A6VL 2DWXA 4WCYH 3U1QA 3IJSA 4LAJH 1JAEA 4QD2E 4XO9A 4F57H 5MEOA 5F93C 4HALA 4WSKA 4DK6A 1SEQL 4KDWA 4ISVA 2VRAA 3MRCA 4R7NA 5JR1L 4GG6F 4FI8A 3EDFA 1XEUA 1XF4A 1CTMA 1QSFE 1HI6A 1HSAA 4JZJC 1QASA 5AZEL 1T6VN 2BCKB 4KHTL 5IQ7H 2Y5TB 1E4HA 1DDHB 1QRNE 1CGTA 1XSIA 2WQRA 3E80A 3MRDB 3PAZA 3UX9B 5IJCC 3S0PA 1V05A 4G1EA 3RWIB 1KS7A 1ZHKB 3L6FA 3WY2A 1OE1A 2Z8RA 3T0WA 3MV11 4GO9A 4UM8B 5ESQA 3L9EA 3QZWA 4LPXA 2YBRB 3R1GH 3MUJA 1A3RH 4M3JA 5FO2A 2O5YH 2ZUQB 4LOUC 7PCYA 2WANA 5D7SL 5E8NB 5F7DA 3QUYB 3SDYL 4UQ3A 5INCA 3SJVA 5FSJA 4NQCB 3OX8A 5C08E 4RGND 5C0CD 4F93B 1UH4A 5FV1L 2MCAA 2BP8A 1CTOA 4K5NA 2AVGA 5LXVA 1I4FA 2B2XH 4R97B 4HEMA 1EIBA 4WO4A 2GK0A 5F1SA 3G9VA 3N41B 4JO5A 4EI6A 2ZUVA 3QH3A 5B38G 4OR1A 5HHVH 1LGVA 3I6KA 1NMBH 4GW1A 1A9EA 4KQ4H 4WUUB 4NKOA 5IT2H 4JRYE 2YAEA 2E76C 3KGRA 5F7HA 5HHXH 5I1KH 4NKQB 2VZSA 1JOIA 5DFVC 1PZBA 3VUAA 1RZKC 3T3PB 1AR1C 5IK3B 3JV4A 2V8MA 2P5WA 2X1OA 1XB8A 2FDBP 3RVWC 1XF4B 3VXUA 3BAWA 3AG4B 5FHAH 2I24N 5AVRB 4ZDHB 2Z4QA 4HS6B 3S48A 1BV8A 2ICES 2XZAL 5C6PB 1IO4C 4RIRB 1E4WH 1IVLA 4HT1H 1TTFA 2GT9B 1NBQA 4HPOH 1ZHKA 5A2KH 4OM0L 5I19L 4APQC 4M93B 3T6WA 5LUMA 2F58L 4P5TB 3L8QA 4ONGL 1DTUA 2IF7A 3KH4A 2P52A 5DGQA 4HUNB 5E8NA 1BQ5A 4PLJC 5C6WH 4ANVA 2I85A 3DI2B 3SJVB 3BIBX 1JFQH 1GTNA 2ROXA 3MROA 3V6OA 4R9HA 2BP8B 3M1CA 5A7BA 1KB9K 3NSYA 1MG3C 3OBAA 4EXKA 4F8QA 5JA9A 1FL6B 3E2HB 4HXAL 4WO4B 2HTKC 2LFGA 2Z0BA 2WP3T 4POZC 1FJTA 5HYFA 1ID2A 5E03A 1E4KC 1WZ1L 3P3UA 4PGEA 5IBLD 2KC0A 3LN9A 1THCA 2ZTBA 1KB5B 5LQBH 1A9EB 2QT6A 2J8UF 4WUUA 4M62H 2X0UA 1IFRA 3LOWA 1TQCB 2AJVL 1SQ2N 3DUHA 4D9LH 3NSFA 4YR6A 2PCFA 1GY2A 1OSPH 4QGTA 2ID5A 5FWQA 1QVOB 5KVGE 5IK3A 2WWNA 3LKRA 4CU6A 4PGCA 1ORSB 1Q72L 3PGFH 5JW3L 1KTJA 4HIHB 4XMUA 3I3DA 3BDYL 4PRAA 4YXLL 1UCBH 1NDTA 2VC2H 4ABQA 1MRFH 3CU7A 4ZTOL 2M1KA 5HHOE 2Z4QB 4HS6A 5GISH 3WKQA 3U0PB 4L1DA 4J3OC 3RIFF 5BO1L 1U21A 1Z3RA 3IDUA 3QCTH 4Z76A 4WJG3 1F11A 3SE4C 2QGEA 1QA9B 4HOWA 4ZOCA 1LTXA 3CUPA 4I0KA 2CO7A 4GBXB 4JPKH 4G2AA 4BZ2H 2UXGA 4UT9H 2CKNA 5IROC 3IAGC 1G4RA 4FL4B 4K3GA 2JWYA 4GFTB 3TC9A 2YRPA 4ABWA 3RZCD 4EDXA 5K1NA 4HEME 1O6VA 2IFFL 1MFVA 2BSED 3VXRB 4OH2A 3BP5B 4RESB 4I5BA 1K2DB 1HOEA 1FL6A 3OB0H 3CVHA 3O6KH 4OZHA 3S88L 5L4MA 1TZHB 2O5XL 3MLWL 4ODTL 2AQPA 3B7SA 1GXWA 1U2HA 4UNIA 1AZRA 3TN0B 4WAFA 5JOFB 3ARFD 1XGYL 4HF5H 5L0QB 1DQML 5D7IB 3WHXB 3A3YB 4APQD 1JP5A 5ERWB 1GPOL 2R59A 4PGZA 3HMXH 1A21A 1UVQA 3P4LA 5T1DL 2PO6A 4M6NL 3QS2A 3ML8A 3IRPX 5HGAB 4HIHA 4KVNL 4NQQA 2N7SA 4H88H 3FQ4A 4U1MA 1KN2L 1RK0A 3TT1H 2DTMH 3TN0C 1KJOA 4AIZA 4ES9A 1A6VH 4URTB 4GP5B 3B9KC 4V11A 3TCXA 3QUYD 1MQ8A 5I8OH 1BG1A 3CX5K 5DR5L 4J27A 4Z76B 2VR4A 4GXUM 4YC2B 5AVQB 3QIBA 3US0A 4OW6A 2CNZA 2EYRB 4R3SB 1V5JA 4L37B 1F58L 4P4KB 1QR4A 3O6ML 2MHAA 3PP4H 1CD8A 2Z31C 5CAYB 5KOVC 2WYZA 1W0WB 3LXBA 3KWUA 3O2DA 4PSRA 1DQKA 1P4IH 1RZPA 4S1RL 4QXVA 4ADIA 4IRZA 5DVOA 3NCYP 3ZZ1A 2PW1A 5HYIA 4I3SL 3WIHH 1K2DA 2PO6C 4JLRA 4PJDA 3ARDD 2X41A 4RWYH 4GRMA 2XWDA 4O4YH 3SJVE 5D70H 4YEFA 3L3DB 4ELKA 3ZU8A 3IMSA 4YSQA 1JWSA 2QL1A 5E1IA 4Z7VE 2JSFA 4MB5A 4UOJA 3HBPA 1U6AH 5D7IA 1Y1UA 2JMRA 2R1XB 2VDQL 1NLBH 4H4NA 4WKXA 4ELMA 4ZTPL 2E7DA 4JFZL 4TSCL 4EI5C 4E9RA 5A1AA 1ZXQA 2E46A 3KW8A 3O6LH 5KG9A 2HMIC 2X5PA 2PO6B 4BQ6A 4XN2A 1B90A 1A7OH 2Y72A 5HGAA 5JIIA 2VXTH 2NY7L 3E8VA 1RK0B 35C8H 3VB9A 1YEKH 4JRXD 4ZFGH 1LEIB 5E1GA 5G5DA 3OWRA 4KZDH 4O9HL 3DXAE 3QK0A 3SE9H 5KVDE 2VERN 4YLQT 3IU4L 1MWAH 2P9RA 3U48A 4P2AA 4JFFE 3QQ3B 4R4BB 1FPTL 4TYUA 1A8ZA 3OQRA 5CCHE 3DMMB 3ZE0F 1TSHA 3QIBB 2H6PB 2BSEA 5AFAA 3NCWA 3S3DB 4L37A 3WFEH 2LLGA 3MKKA 4AX3A 2MHAB 4PM1A 4KZCA 2XA3A 5A2JH 1JCVA 4AYID 4KKBC 3T8XB 2FH8A 1W0WA 1BYNA 3GSQB 2ZP0T 3HE6B 5I18H 5K5YA 4HIIA 1V7ML 3M8OL 3QQDA 4PV9A 3NEXA 1XH0A 2V3EA 3CSYA 5DWUH 5JHBA 2VWEE 2MTAA 3T6VA 1RIUH 1KFAH 3TJHD 2B3RA 3KLQA 1FHNA 1FRGL 5HJ3A 2Z7YA 1KB5H 2G0KA 4PJEB 1JWSB 1ZRUA 1FBIH 1G9HA 1JFQL 1MW1A 2P28B 2XWCA 3PIQB 4ZMTA 5C2BL 5CF3A 1ASQA 2CBMA 4DTGH 2YQ2A 1G1CA 1OLZA 4HZLA 4QGYA 5HI5D 2Z6FA 4HWBL 4O02A 4Q4EA 3CBKB 3P0YH 4NM4L 3M1BA 1P69B 4OZGA 1BEYH 4PJCB 4PJ9D 3EO1A 1DQDH 4NIYE 3KR3H 4R97C 2NXYC 1WF5A 1M7UA 1TYEB 4Y2NA 1T2QL 1G9NL 4LRIC 1JD7A 2YAMA 1IIIA 1N59B 4XOAA 25C8H 1RUPH 4FX5A 3TASA 3SOBH 4F7TB 4YBQD 4F9PC 3UJIH 1JZJA 2FYVA 4Y5VA 2VDLH 2R2EB 5CR1A 5BVPL 4XXWC 2JQZA 1WDAA 4PJHB 2WQWA 2F7QA 3UTSA 2GI0A 1DBBH 4TNWK 3RNKA 1J9TA 3GBML 4M6ML 2NY3D 4XAKE 2HT2C 3HE6A 5C07E 1MNUL 1RY7B 1PLCA 4XN5A 4Z3TA 3C5SA 4UQBA 1P7BA 2X0WA 5GZOC 3QQDB 3U46B 3BGFC 4PR5A 3CSYB 3CVDA 3EYSL 1NC2B 3GZKA 2OK0L 4BZ2L 4PP1D 5DZVA 2B39A 5FM4A 1QUPA 3Q2CA 4BFOA 1TQSA 1WIPA 4Y5YC 4P5TC 3SD5A 2KERA 1XMWA 4OFVA 2YKLH 3QQ9D 3QP3A 4FMFA 5C09A 2JCCE 3K4ZA 2R4SL 4JHAH 4OCYL 2WN2A 1EHXA 2Z8VC 4DFIA 3NZ8B 3CIQA 4HZLB 3VFNA 3OLEA 2HJLB 4O02B 2DJUA 3CX2A 3D3VA 3M1BB 4PGDB 1KN4L 4XBGA 3EO1B 4X6DE 1J5IA 4L3ED 4HEPG 4JUSA 4OI8A 1Z3GH 3DTUB 2FZ3B 4FOMA 4YSOA 3MOBH 2IAMA 4TUJA 4W70A 5HVHC 5EEXA 4OLUL 5E4OA 3PDOB 4IHQA 1W6WA 1JF5A 2BVEA 3QS3A 2CGZA 4F7TA 4K23H 1M2VB 1D5ZA 1RFDH 4AK2A 3AABA 4A55A 2VR9A 5I16A 4Y5VB 4IOFC 5F1OB 3GNMH 2FQEA 2YD3A 1YC8A 1ZT7A 2UZYA 4DKEL 4WRLA 1X5LA 2ITCA 1SOSA 3BD4A 2MCMA 3RGVD 3UTSB 3QGOA 1WA2X 5HGBA 4ZK8A 1V7NL 4H8QA 3W11D 2EC8A 4BCZA 2WI0A 4OF3A 1UM4H 4J3VA 5IB2A 4WK0B 2CPCA 3QWQB 4UIKL 2BY2A 2RCSL 4GIOA 4PR5B 1NC2A 2KZBA 2C4FU 5D4JA 4Y5VC 1MHCB 3PQYD 4OZIB 2F53B 3NOIA 4AV0A 4XN1A 3CFDA 3HN8A 4XMLL 4XPGL 3IEAA 3ZYJA 4GBXC 1QFOA 2FCBA 4UM9B 4WI3A 1MW2A 3QEUA 4KTDH 3ARSA 4DGYL 2WVSA 3IJ8A 4NQTA 3V5HA 3ERXA 2BVUA 3QCVH 3VFNB 4GKZA 2AV1A 5GSRB 4NGHL 3D3VB 1JN6A 4XCCH 3L1OH 1G7JA 3O4LD 3MVSA 3ARYA 1OTUC 4CSTA 3WCYA 3Q1SH 2VDNH 4X6DF 5A6LA 4PI2A 3V7MA 1U95B 3THML 5HGHA 3FSAA 4K3EH 3UYOD 4M7LH 5IBUG 3RWGB 2JB5L 5E6IB 1I31A 3SGDI 3I9AA 3B7TA 3IXAA 4PVBA 2UWEB 4LB8A 5IB4B 2NYKA 2PUQT 4F7CB 4PEEA 4JHWL 1ZT7B 2UZYB 2VRKA 3BPNB 2WAQA 4OBSA 2WZPA 4ARFA 1Z9OA 1SVCP 3OJ2C 4Y2OA 3CHSA 3TV3H 5HGBB 4U4IA 5EU6E 2YKKA 5GGUA 1OPGH 2QGBA 5HDQH 1ZE3C 1H8LA 4QRPB 1MWAL 4NPKA 1DJHA 4QO1B 5B8CC 3KEHA 3B9KB 2B1AH 3BZDA 2FWLB 2IGTA 4PTUA 5DFWH 1MHCA 1HIML 2WW8A 2VT0A 2ZYHA 5T5FA 5E99H 3S35X 2QSCL 2AKRB 2ENSA 4NBYB 1EJFA 2OZ4A 3SCMC 1LWRA 5I1HL 5AWNL 4UM9A 3RDTA 2NDGA 3QWOB 3QEUB 2NQ3A 3ML9A 5DCCA 3VXSB 1SXCA 1IEBB 4JJOA 1PGRB 3O9WC 1JPFB 1LNUB 4M5SA 3NEOA 3NIDE 5F3FA 2H0PA 4GKZB 3TIDB 4F5CA 1UWEL 1TPXC 5F72S 2P8PA 2ILLA 2EXYC 5CEZE 1F6AA 3FQWA 4UDUB 1QFWM 2P8MB 4GIAA 3FHEA 1BQHG 1DBML 4XC1H 4ZFFA 4LP4A 1HVXA 1HEJC 4LQFL 3GSOA 2RBLA 4R2GB 3V95A 1HWGB 2N56A 5TE7L 3DOHA 5D71L 3F84A 2TRYA 5DJ8A 3RWGA 4W4NA 2WXQA 1JPSL 4M7JL 3B34A 3W5NA 1OW0C 3P3TA 1H3UA 1YPZF 3E1ZA 3BAIA 1KXQE 3PUCA 3KDMB 3BWUF 3F2PA 3UP6A 3UGEA 5IB4A 2ADJB 3ZDZE 4HJUA 3V8CA 1F6FB 3AITA 1CMOA 2WCPA 1TZIA 1A02N 1RHFA 2W9EH 3BGMB 5AW0B 4FFVD 3D09A 4FFWC 4FQJH 1J8HB 1U3HD 3CG8A 1LNDE 1RUPL 1A2YB 2A99A 2VR8A 5AUMB 3CQQA 1GIGL 3DKHA 4DFHA 3B9KA 3OB0K 2CGYA 5I28A 2LE9A 1FAIL 4E41A 3GSXB 1O6TA 4J4PD 5KSVB 4G80A 4LRNH 2GPZA 1CGYA 2BW5A 4WV1C 1YZZA 4FG4A 3QWOA 2WHVA 1FYTE 2WXFA 1A14H 4JNXA 3VXSA 2CLZA 3WNJA 2WXLA 4GKOA 1LNUA 5G55A 1MCQA 4OI9A 2H9GB 5C08A 3VRIB 3WXWH 4DEUA 2IOIA 2IDQA 4LP5A 1F6AB 3FQWB 3PJLA 3WKYA 5GZOA 2VABA 4HUVA 3CSBA 2HN7A 2LABA 4AUYA 2P24A 3VA6A 3D07A 3UYPB 1ZSHA 4LPCA 5HVGB 5H37G 1T2XA 4OCXH 2XFXA 1JZGA 1P6WA 3C5ZD 3HHSB 2DM2A 3E3QE 5DJ8B 5KUKA 5DUBB 3ASWA 4GI6A 1KJ2H 5ESAA 5B1CA 3GZPA 5E1QA 4KI5C 1TKWB 1JGEB 3QNXA 2Q7YB 5D7IE 4DN4H 4G42B 3FXIC 4I3RL 3U7WH 4UTBL 3ZUCA 1FFRA 2AXGB 1PAMA 5LGHL 1HDMB 3DX8B 1LO2L 1OT2A 1IT9H 2ESVB 3KLAA 5C97A 1SBSH 1J8HA 4PJ8A 1H6EA 1E2VA 4I18B 1E5UI 3QDJE 4EDWH 3LKOB 3T2PA 3EFOB 2Y1VA 4XN7A 1E3ZA 5KVFL 2WOYA 5E8OB 3SDXE 2XQYG 5F9AC 1CLZL 3S36H 3FL7A 4Y4KC 3S3JA 5DQ9A 3EO0B 2RQEA 4E41B 5JTWA 1ZLUK 4ERSL 4JCWA 4XZ4A 4K3DL 4E68A 3GB7B 3OGCB 1VCBC 1YPZA 5TF1L 4PGBB 3SGEI 5MEQA 3DV6A 3EGSB 1BZ7B 2PPAA 2H32A 5FECA 2A0LC 5L9DH 2CLZB 4N2DA 3SBWA 4K2UL 1QSZA 3HNSH 3DRTA 1URZA 3II3A 3AU1B 3S5LA 5FGBA 4FFVC 2VABB 2A6KA 1MHEA 4XN8A 2HWZL 4NQCE 2X1QA 2HN7B 1VAHA 5CBAA 5EPMA 3EIFA 2P24B 5E23A 5ADOL 3OSKA 1BVLA 3QJXA 1CXFA 2YOAA 3BPLC 4DGYH 4NWUH 2NQDA 3T8VA 3HHSA 4H57A 5DUBA 2BIMA 3CSGA 1MJUH 3C09B 1JGEA 1RUML 2Q7YA 3QNXB 4POYA 4G42A 4FQHA 4KJPD 1T2JA 5CNHA 5C0JB 4HVBA 1MREH 1PZAA 1GGIL 2CR3A 1NBVL 3C9NA 4GSDL 4IBYA 2Q3ZA 4P2QA 1VENA 3DX8A 5E4EB 1J5OL 1NMCB 2WIIB 3P30H 5L3UE 4WWKD 5LNGA 3H4FA 4EUPH 3MBEB 4WUKH 1HS6A 2IGFH 1R5VA 4JG0L 3PLYA 1U3JA 4J6RL 5AKVA 4I18A 1D5RA 2J1XA 5KJRH 1JF6A 1FORL 4IJ3B 3F12B 4PFEA 5CU5A 3QORA 5IQ9B 4GAJL 4LBAA 4A7UA 3OKYA 3I9IA 4QR7A 1K4CA 3EO0A 1BF5A 1KCUH 5E4EC 5AB1A 3SEPA 2H41A 4XPAH 1MIEL 4AXWA 4LEXH 3TH3T 3OGCA 2NUPA 4PGBA 2WP3O 5MEQB 2ENJA 4RMTA 1JPST 4I9WE 5IB1A 5C07A 1L9NA 4HAFA 2ATPB 2R4RH 4N2CA 4Y16A 1P1ZA 2JNZA 5DD3L 1EHAA 5K69A 4BUHA 2XA8L 5TLNA 4BRJA 4A04A 2A6KB 2Q76A 2QHLA 5I1HH 5EUOE 2PP8A 1FVCA 2CHWA 2GBTA 1YEEH 4XNMA 1AHWA 4IK7A 4BSWA 4Z95L 4F5CE 1CURA 5C09E 1Z0NA 2F19L 1B6UA 3D6GA 4XNXL 3ARDB 1J8HD 5SX5H 3LZOA 3LDBC 3MKGA 1YEIH 3IFOB 1VRSA 3WG7B 5C0JA 3CDCA 4M03A 1Z6JT 2WIIA 4ZG1A 1LQSR 2ZKMX 3ZQXA 4PB9L 3AXLA 1R5VB 5I2IA 2XVLA 4X83A 2MSPA 1MWOA 4K94L 4E9YA 4TV3A 3T2NH 4A7VA 1NINA 1SQMA 1T04B 4MD4A 1NMAH 2YPLA 3KJ4B 1EZVX 5DZ9A 2WO4A 4W9CC 5DYOA 4LGSB 1ZT4B 5FUZH 2QDWA 3VO0A 1K4CB 2BRRH 4GG8A 4JMNA 3JWDH 2WKOA 3DUSA 3V4PH 3BUIA 1BBJB 3OZ9H 2F54D 3IDMA 2WBJA 4EKJA 3BN9D 4UV4L 4LVNC 1BBDH 5HSFA 5I6XB 3HPLA 3DGDA 1Q38A 1AXIB 3FTXA 1QRNB 3BW9B 1ZTXL 4NQXA 4Y16B 3MA9H 3HI5H 3QEQD 3IDIA 1XIWD 2I27N 2GI7A 2VLLA 1CT8B 3B9EA 4KJYA 2I07B 1UUNA 5KBKA 3A5VA 1FVCB 4L0ZA 5IBTL 3Q1EA 1HHJB 3WLBB 3QW9A 4U6TA 1IIKA 2EACA 3ARDA 3P77A 3EH2A 4Z18A 2IDTA 3RVVD 3SPIA 1FL3A 2BVPA 3N42B 5EA0L 4L4VB 1A1OB 1IX2A 2CU9A 2EH8H 3PAYA 3VNZA 3AS1A 2Y3NA 1MFBL 3LPOA 3WD5H 2EINB 1JFHA 3AXLB 1M42A 1KJ2L 4JR9L 5I2IB 1L5GB 5ACZA 3G6JF 4AJWA 1OIOA 3VVVA 3EYFA 5D8JH 3QDGE 1YQVL 1BLNB 4ATTA 4WEMB 4B41A 4UNVA 4OVVA 2V33A 2K3HA 4MD4B 4L3EA 2AJXL 1AJ7L 3EHBC 4BFNA 1SYSB 3N9GL 1N10A 5DYOB 4ANUA 2LTQC 4AL8H 4QAMB 1T4KB 4LSSL 3LQZA 5E9DA 3ZDZB 3AJ7A 1NGWB 1VB9A 3DUSB 1R5WA 3WLWD 4B7LA 3K0YA 1KCVL 3MJ7B 1HNGA 1A65A 1O5DT 4B9GA 4CL7A 3HJEA 2BINA 5F1KC 4QRSB 4QTFA 3HPLB 5J13C 2KS0A 5AG9A 1IL1B 2QSTA 2ARJA 3D06A 2AJYL 7CGTA 2VC2L 2R0WH 4HAKA 2OI9C 3LKPB 1MRFL 3P9LA 4QCIB 3MSAA 4Y1AD 4ZTOH 1ACZA 1CBJA 1CFSA 1RZIA 5ITBL 5AAWA 1HQ4B 4YHLL 1FJ1A 2XWEA 2CJUH 2NY3B 1ZANH 3FPXA 4KJYB 5D72H 1B4RA 2I07A 4WEUD 1MFMA 5B3NA 3FT1A 3T3MB 1A47A 5GGSY 1TT6A 2IDSA 2DAVA 2CM5A 4MCYA 4UT9L 4D0CA 2WXJA 1JZ2A 4HIPA 3BOVA 4FQ1L 3RAJH 3HOGA 2C3XA 5TDOA 4F8NA 1FL3B 2BVPB 2PKDA 5DEFA 1G7QB 3FS9A 1J8KA 4FTDA 3F7QA 4MCNA 4PGJA 1BVNP 3P4MA 4NXKA 3UTPE 1HEHC 1EERB 4OCNC 4NWUL 2X4TA 1ADQA 2Z9TA 3AM8A 3DBKA 4HC1A 4LSDA 4XMKL 4JUTA 3HFML 1P1VA 5ACZB 4LMQI 3WO4B 2EABA 2ZXCA 4F8PA 2NY0B 3EYFB 4HMDA 4OU3A 4U4BA 1S7QB 3BAKA 4LCVA 5EU6B 3MX0A 3L9YA 3SKNA 4L3EB 1KPRB 1NBVH 3UP1A 4XWOD 4FMVA 1NGQH 4F2FA 4TTDD 4DPAX 3QPXH 1T4KA 3LQZB 2P5EB 1DUZA 3RKPA 1OOAA 3F04A 5DWPA 5CEYA 4I0PB 5ANMB 4Q89A 1KZYA 2PYEE 1XGQA 5FYKD 1GZPB 3DBSA 4DSYA 4BK8A 5IP4A 4TXVB 2P1YA 4KVNH 1IL1A 4PRHE 4LSUH 1L4IA 1MN4A 5JUEH 5LJYH 3P9LB 2YR3A 4FDWA 4ODHL 4QCIA 4D8PB 5GGRB 1T0NB 4Z7UE 1HQ4A 4ZW3A 5FUOL 1FJ1B 3D51A 4FXGA 4S10A 1W80A 2IPKA 4AZUA 2RA1A 1I1YB 1RCYA 3MLUL 3ZE2F 1QSEA 3F58L 4YE0A 4YNYB 1TEGA 4P49A 4ONGH 1RHHA 1PX3A 3DVGB 4DKDC 1T66C 1SJEA 5I15L 2CHNA 2ODHA 2ED8A 3L9BA 5DEFB 2ZCZA 4S1RH 5C3LD 2Y7QA 5J11C 2X4RB 4ODXA 1KIQB 1YVLA 5F6HJ 1I9RH 1MCBA 3P4MB 3QH5A 2GAZA 1FNSH 3NSJA 2X4TB 1CZ8H 1IEAA 2IOMA 2PPEA 3C08H 1DEEB 2AVFA 4HFUL 4M1DH 1F90H 5F9OH 1O9ZA 3FTSA 4HCGA 4UUJA 2MWCA 1IAOB 1IM9B 1UB5A 5EU6A 2YD0A 3DO4A 1GOHA 3B3IB 4TVPD 2OSWA 3S37H 4A2DA 1A9BB 3CMGA 3SPVA 3SKNB 3UMTA 3MZTA 5AW8B 3APFA 4MMXB 1MCNA 4N0YH 1DQLL 4Y4FD 4YDJB 3TO4C 3ZHFA 3CZNA 2L7JA 4MNQD 5D1ZB 1DQTA 3TCLB 1CFNB 1QATA 3B9DA 4WO4D 4XVTH 3UBXB 5CFHA 3V6BR 1JNLH 1IKFH 1JHTB 4M5ZH 3MRPB 3U2IA 2ATKB 3GJFK 2ADGA 3CFIC 5IW6A 2LQRA 2WZ6A 4U2ZA 2A7GE 3L5HA 3FT9A 5F3HB 1TFHA 2MNWA 1DJIA 5F7FA 2AHIA 1SOXA 3MV8E 4HAGA 1T0NA 2OXHA 4XNZC 3OZ9L 5EH1A 3BVXA 1BZOA 3HAEB 5FO8B 2XVGA 4RFOL 2XQYK 5SWZD 4AM0Q 1DVFD 2VJ8A 1UYWL 3ARBC 3KPNB 3QWNA 5HHMD 1YPZE 1VGEL 1IGTB 3QIWD 2X28A 3NSCA 4JFDE 3ZE2E 1RHHB 5L8JB 3DVGA 4Y8DC 1NGXB 3DTXB 1CPUA 5HHNB 2CMRH 2VC2B 2YFOA 5TPWL 1TZGH 4FP8L 1PFCA 3TYFB 1LO5A 4XCFL 2V17H 2JCCB 4N87A 4OZHF 2DKUA 3V10A 4IRJA 4IOIB 4NRXA 1SLWA 4XNDA 3QJFB 5TGBB 1FYTB 3FRPA 4RFNB 1E28B 5CJOL 4EIBA 3UACA 5CD5D 3EFFB 4BWUA 1IAOA 3BDBA 4ZXBC 1UB5B 4PLNC 2X1PA 2Q6WA 1A7NH 4KITB 1A9BA 2A9BA 1U8NB 2HA1A 3UZEA 4MMXA 2JIXB 4WU5B 4D0BA 2R2BB 4YDJA 1A6TA 3JZ7A 4NFCA 3LVTA 4PJBB 1KCRL 5D1ZA 1N26A 2DH3A 5F3BA 3IDXL 3VU1A 4BZYA 1JHTA 1LO3H 2XDHA 3MRPA 2AS5M 2ATKA 4FFYH 4XI5C 4S1DC 2E3VA 1BHGA 2JB6B 2WKLA 2D9QB 5I6KA 4ZXBB 4N2BA 1F02I 1NM9A 3IKKA 2W1NA 1KT2B 2RJMA 3LNGA 3P73A 3OC5A 2G9KA 2YA0A 1D7DA 2LAGB 5IKCA 3FZUC 4CA4A 2OLDA 2YAFA 2IAND 3S7GA 3KPNA 4X6BA 1IGTA 1AAJA 3EFDL 2EO9A 3SDXB 3U9UA 1UOWA 1RZ7L 3HNVH 3LNHA 2FX7L 4UNUA 2RMNA 2D3JA 5HHNA 2X05A 3UGXA 4Q56A 3PP4L 4LCIH 1KCKA 4N2EA 1WC7B 3BH9B 2WVUA 4OLZH 4P9HH 2AK4A 5KOMC 2JCCA 5T5NG 1HKLH 4CN4A 2AQQA 2DQIL 3MLVH 5J6GB 4IOIA 1SLXA 2L7UA 4NRXB 5FGBC 2N7AA 3UYRL 1D5MA 4HHGA 3FRPB 3PWNB 5KYUA 1EV2E 3HG2A 2C9SA 2PXYB 3AT8A 3HRZC 3GSNL 3DPDA 3ECVA 3L3HB 2A4EA 4JPKL 1B4JL 2A9NL 4R90H 4F7PA 5C0EA 2WMPA 1OF2A 3QZLA 3EJQA 3EFFA 4O4YL 1WCBA 3B6SA 2I26N 4JO1H 2WBWB 4MNGB 3ELAT 1OAUH 1UGKA 1U8NA 3E1F1 5E6UB 3UCRA 3VFUB 5JIDA 3MLYH 4QXTA 2RR3A 1A6TB 4PJBA 5C8JA 4OLXH 4PJ5D 3GD1C 1D5BB 3Q2WA 5JDSA 1FLRH 3QAQA 1X7TA 3FQYA 4P9MH 5JIMA 5A2CA 4D9QE 4KH2A 3N55A 2PTVA 3OHXB 4KPHH 5KAQG 3AXHA 2JB6A 5EBLA 1P6AB 3A22A 1CFTB 4TUOA 3G5VA 3EDJA 4ZW7A 3W9DB 1X5YA 1TQVA 1I75A 4JB9H 1WZAA 4PJAE 2GJ6B 1NEUA 3CHXA 5E6ZA 3P0YL 4NM4H 3S97C 4TLIA 1E27A 1R75A 1YG9A 4XP4H 8TLNE 4PMFA 4YZWA 3K3QA 5IW3A 3GDCA 4PJFF 1T20A 3GXNA 2B14A 1DBAL 3J7HA 1HJCA 1F4XL 2P49B 1NFAA 4OLVL 3U9UB 3R8BB 4LEOA 4NBXB 2F61A 4Y7MA 1CGUA 2FE0A 3CSTA 4ZMYA 1Y1DA 25C8L 2FNWA 3D2TA 4YSUA 1VDGA 2G5BB 2AJ3A 1ITBB 1NC4A 2FIKB 5CKGA 5DC4B 4R8WH 1I9EA 4H8WC 1AYOA 1UM4L 4RZCB 2IDUA