4PJ6A

Crystal structure of human insulin regulated aminopeptidase with lysine in active site
Total Genus 296
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
296
sequence length
867
structure length
860
Chain Sequence
KLFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucyl-cystinyl aminopeptidase
publication title Crystal structure of human insulin-regulated aminopeptidase with specificity for cyclic peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 296
structure length 860
sequence length 867
chains with identical sequence B
ec nomenclature ec 3.4.11.3: Cystinyl aminopeptidase.
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF11838 ERAP1_C ERAP1-like C-terminal domain
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.60 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4pj6A02
1.25.50.20 Mainly Alpha Alpha Horseshoe Zincin-like fold Zincin-like fold 4pj6A04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 4pj6A01
2.60.40.1910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pj6A03
5LG6A 3B7SA 3CHRA 4XMWA 3FH5A 4MS6A 4XN1A 3FU0A 3FUFA 4R5TA 4XMTA 2XPYA 3B2XA 5AB2A 4E36A 4KXCA 4R7LA 3CHOA 4R5XA 3CHPA 3EBIA 4K5MA 5K1VA 3RJOA 4L2LA 2GTQA 3FUKA 3FUNA 3T8VA 5AB0A 3FUEA 1Z5HA 4QHPA 4ZX6A 2YD0A 4K5LA 4XNBA 2HPOA 3FTSA 4ZX4A 1HS6A 3Q44A 4KX9A 4ZW7A 1GW6A 4ZX5A 2XQ0A 3B7TA 2VJ8A 4FYQA 2DQMA 4KX8A 4K5PA 4Z7IA 4GAAA 5LHDA 3B34A 3FTYA 4XO3A 4XNAA 3FU6A 4OU3A 4ZW5A 4X2UA 4Q4IA 3B3BA 3B7RL 4KX7A 3EBHA 4FYTA 1SQMA 4ZW3A 5AENA 4XMUA 3FTUA 4XO5A 4XNDA 5BPPA 4FKKA 4PU2A 4KXAA 3FUDA 2XPZA 3FUMA 1Z1WA 5LDSA 3QNFA 4PJ6A 3EBGA 4K5OA 3B7UX 3MDJA 5J5EA 4XN8A 5FWQA 4WZ9A 4K5NA 4XN2A 1H19A 3FULA 4QMEA 4PW4A 4NAQA 4FKEA 3FTWA 4KXBA 4PVBA 2HPTA 4ZW6A 4FYRA 4P8QA 4XO4A 4NZ8A 4XN9A 4XMVA 4FGMA 4JBSA 3U9WA 3CIAA 4RVBA 3KEDA 5DLLA 4R5VA 3B37A 2ZXGA 4XN4A 3FTXA 4ZX3A 4ZW8A 5CU5A 3SE6A 3FU5A 4XMZA 4J3BA 3FH7A 4QPEA 3FH8A 3Q7JA 3CHSA 4DPRA 4XMXA 3FTZA 4Q4EA 4FYSA 3QJXA 4HOMA 3FUJA 3FUIA 4XN7A 3FTVA 4MKTA 4FKHA 3FHEA 3FUHA 4QUOA 4F5CA 4QIRA 5DYFA 5J6SA 3FU3A 4ZQTA 2R59A 3Q43A 3B2PA 3PUUA 4XN5A 3CHQA 4KXDA 5C97A 4RSYA 2DQ6A
chains in the Genus database with same CATH superfamily
4I48B 5F3HB 2QTEA 1L9QA 4R0LA 2FO4A 1PCSA 2ORBH 2ZQKA 4TTGA 2EKSA 4WFFE 4G2AA 3M1OA 2BS8A 1A7QH 8FABB 4O2EB 4I9WD 2BDNH 2WB7A 3ASWA 3VXNA 5I18H 3ZE0B 2DYSB 2H8PA 3T71A 3L3JA 4JG0H 4BZYA 3S4SB 4KKZA 2DLHA 1JPGB 2JI2A 4NENA 3MZTA 3OXRA 4OM1L 3WIIL 2J21A 3MJGX 3QI9D 1D3CA 1NLBL 1W2KT 1HL8A 1X4ZA 4QO1B 5PCYA 2A74C 1S9KC 2R7EB 1CXHA 4UV7L 1GIGH 4U6XB 2XBTA 3PXHA 4CSZA 3QDGB 4NZRH 4DCQA 4K23L 2YZ1A 4MNQA 7PCYA 3L2MA 3RDTC 3MRIB 3UBXB 1Y0LA 2V37A 2WUCL 1M1XB 1LEKB 4YPGB 2EE6A 3E1F1 1B88A 2DIAA 4H1LG 1NDMA 3PWPD 1ORQB 1HHJA 2OSLA 3DIVA 4N66E 3QJOA 3L2NA 2F53E 4X80L 3UTZB 4XBGB 4PJGB 2V0AA 1IARB 2FWUA 3LHPH 1JDAA 2DQEH 3QNXB 5D7IA 1IT9H 4YHOH 5HHOA 1GOFA 5DQ9B 4NBXB 3U1SL 4UQCA 3ZTJH 4LSVH 5GGTH 5DJDA 1HWGB 4GQZA 4RAHA 4YGVB 2P80D 3VE0A 3CFCL 3WTXA 4IRZA 2DM2A 2NUPA 4BUGA 3KDMB 4AEHL 5IWLC 1ZMYA 1U8IA 4JS7A 1JHKH 2D4FA 1HQ4A 4WNQA 4JG5A 3L3IB 4I3RL 1W0VA 4IRJA 4H88L 4F7TB 3REVA 1BQHB 1SHMA 4GXVL 1JXKA 3CZFB 2QKSA 4P06A 4OLUL 2DIEA 3H8NA 1ZGLP 5KAQF 3KPMB 2OMUB 2I5YL 4TSBL 5EOQL 2CHNA 2O6PA 4FXGA 2CIKB 4LF3B 4C4UA 4UNTA 2CJUH 1M7IA 1S7UA 5ANME 4HWZA 5E8DH 3LPGA 3HPLA 2Y36L 2QR0B 2N4IA 3V9CA 1OAKL 3B56A 4DO4A 2CU9A 4ODSL 4XTRC 3P1VA 4LOUD 1E7UA 3MNVB 1AHWB 3SDAD 1A4JB 3OLGA 4ABQA 3U36A 4OJCA 2VABB 1VERA 3UTQA 1PZ5B 5CINH 3F64A 1SXZA 4ZOCA 5B7EA 5DZVA 4QJ4B 3WUWA 1LK3H 4RMRA 3OB0K 3D5OF 3L4XA 1OGAD 4OLVL 1WBXA 1FHNA 4XPAL 2W07A 3ULSA 3MXVH 1JE6A 2FBRA 5KS9E 3FQXB 5EEVA 2FBOJ 1KWKA 1MXGA 4RGOL 4KI1A 4F7EB 3EBIA 5FWRA 2XWTB 5AVUB 3EGXB 3DI3B 4V1DB 2BMKA 2GTQA 4HUWB 3T4YA 3QRLA 4K73A 2RFXA 2XWRA 4F8LA 3WFHB 3FJTA 3O8XD 1W72L 3L6FA 4QHPA 4Q6IA 1T0NB 1BZ7A 5DD0H 3CMOH 4P57B 3L4ZA 5L9DH 1MH5A 2P5EA 1EJOL 3QR0A 4ANWA 5J6GB 2R56L 5AW2B 3VWJA 4EBQL 4HGWB 4OCXH 2WK2A 1LTXA 4AUYA 4AKOA 4BEIA 5KVFE 2XWBA 3AREC 3U2JA 5DS2A 5IHZA 3I3BA 4PGEA 5J11B 4Q8BA 4OZIA 4FFYH 2VR9A 5HDBE 4HC1L 2ZP9A 4BZ2H 3EYUL 1FC1A 3ELQA 3VTMA 4GMSL 1A1OA 2UVFA 1J5OH 3LS5L 1RZKH 3AXLA 4GRLC 4XI5C 2GTWB 4JN1L 2NRDA 2OZ4H 3QULA 4LU5L 1HNFA 4N6RB 2GSGA 1MLCB 4ERSH 5I76A 3S36L 1KBGH 1I1YB 1S7WB 3ZW3A 3CXDL 5DC4B 3MLVH 1J86A 5EBWB 2CMRL 2RJMA 2EEDA 3W2DL 4D0CA 2ZKWA 1U30A 3TEUA 3SPIA 1MFNA 3JTSB 4X6CB 1H3GA 4L18A 5F44A 4UIKL 2QADD 2J4WL 1JUFA 1QA9B 4C4KT 2L7QA 5M7QA 1BZEA 3NQIA 2BP0B 4MFHA 4YUEL 1MPAH 4ELKB 5CZVL 3L3OB 5IKCA 1UWEH 5I2IB 4TMNE 4HAKA 3RWHA 4AW4A 1SEBA 2V9UA 4RIRA 1KJ2A 2YMOA 4I0PD 4ZTEA 3BZEA 4OCYH 4Q0XL 2V17L 1JNHA 4P23B 3ZXAC 4B9KC 3ZZLA 35C8H 4NRZA 4OZFA 1TXKA 1SYSB 4H13C 1IB5A 2KZ1B 3RDJA 4G43B 2DI9A 5B39B 4CU7A 4TTDC 2DL9A 4ECNA 2G9HA 1UB6A 3EOAB 3SODB 2G3NA 3ZE2F 3AS3A 5FV2A 4JDVA 1G9NC 2I26N 3WSQL 1EHLH 3SCMC 4JO2L 4PJIA 1QBML 4L8CB 5FHBH 3AMLA 3MV9A 2FH8A 2IH3B 2OXGB 3CVHA 3CVBA 3GSOB 4H7VA 4K3GA 4UV4H 2LLNA 3MLSL 1S5IL 4AYFB 1EEQA 2J1ZA 3MRBB 3C6LD 5D7JD 3GSNB 2EXYD 3WKYA 1I9RH 1FYTB 5FYJL 1OIOA 5HDBF 2XQYA 4A2EA 1FRGH 3ZHNA 3MRCA 2FIRT 5BZZA 5TE4H 3MV7B 3W0WD 4H4NA 4M1DH 4OLWH 1MAKA 4ALAC 2XN2A 4A39A 2NX5A 4DGUA 3D18B 4CVUA 3JWDL 3MRQB 4UOW1 2AQNA 4RMBA 4YWGH 3AG2B 4TUJA 2BVUA 5HHNB 5IESL 4A7UA 1ZTXL 2XQ0A 1I9EA 4GAYA 1F3JA 1KFGA 2XVLA 2HWZH 1YUHB 1R5IA 4P2QE 3FU6A 5FO7B 3MMEB 4MBOA 4QHNA 3AGWA 5DR5H 4Y1AE 3UBHA 4M43H 3SBPA 1TVDA 1QBAA 2VIRB 3NGBC 1T1YA 1F58L 2GUYA 4LCIH 3EKCA 3KXFE 1MDTA 3IS0X 4HDIA 3RBSA 1JPFB 3EYSL 2NY7L 5I5IA 4DKFL 3PAVA 4JHBA 1D7DA 3WY4A 4FADA 4L29A 4NKMB 5JXED 1DANU 5DJ6A 1JXJA 3II1A 5KVFL 3ILQC 4CU6A 4MA3B 2CBQA 5ACMA 1FNSH 5C0CD 1QR1A 2AQTA 2ZP8A 3OZLA 2EUWA 2OTWB 5IMOA 5GS1A 1F4WL 1ZLUH 5HI5C 3WNPA 4OW3A 1X5LA 2QT6A 4NUQA 5B1KA 4WI3A 3OKDB 4FQ2H 1CU4L 4KQ3H 3F7KA 5MEQB 4KNSA 1TJGL 3H9HA 5DVKA 2R4SL 2YXWA 4PGCA 5EOTA 5ETUA 4X6BB 2EEFA 1T04A 2E9IA 5KBPA 4GP5B 3TASA 4JFDA 2FGZA 1FGVL 1DBAL 3DJTA 5I73C 4FABH 4K4KA 4Y9CA 1BJMA 3L3HA 4ZS6C 1BQLL 1ORSA 4MNHA 3L9YA 1T66D 3NJHA 2CHWA 5H94A 4XHJC 2MQCA 1A4CA 3DTXA 4W4OC 1OP5K 3U0TB 3PV7A 4YAQA 1FH2A 3NQXA 5DK2A 4JVPA 4JFQA 3AAZB 4U1KB 5TTRA 3IMWA 3DXAA 5LAPA 2MIZA 1A66A 1D5XB 3BKJL 2P8PA 3I9PA 5D5ME 1EXHA 3UG3A 1I7TA 5LNEA 1EHNA 3VD9A 1EAQA 4S2SA 3SYQA 2VDNB 4PP1C 3SJVB 4IHQA 5EZJA 1KTLA 2MNUA 1QSFB 4KRPB 5H2BA 3SGEH 3BC9A 5GS0D 3UPRA 2X4QB 4QY8B 4I2XE 4PJBE 3UTTA 4DP9X 3AU1A 1OTSC 3P73A 1MLBB 2DRUA 3Q3GB 1BG9A 1XDTT 3HN8A 4ZG1A 3US1A 1WBYA 1NCDH 3N9GL 2FEDC 1TF4A 1TZAA 4CC1A 4ZSOA 1DSFH 4K5PA 2Z31C 4MJ6B 4PI2A 5IV2A 1BVOA 5PAZA 3VD5A 3PJSA 5E8PA 3TL5A 4ODXB 4DP1X 5C9JB 2R2BB 1T4WA 4N26A 1KLGA 2HFEA 5DJXB 5IQ9B 4NJAH 3NIFE 4ZI8A 2F54D 1KBWA 4PWHA 3B7RL 1G94A 1EAOA 1SQMA 3SDXA 3RVTD 4JPIB 4XR8C 4YHLH 1U8NB 4UT6L 3BIKB 4J4PA 5LBSH 5AZEL 1DBKL 1N5AB 1G5AA 1E2VA 4G3YL 2NY0C 3F65A 1AD0B 3MUGA 3QJRB 4LGPB 1I1FB 4MLSA 5B4MC 1EJ6A 3VXSA 3GUTB 5CJBA 3OKEA 1YEDB 2WXOA 3EBGA 3A6BL 4XRCB 1OSEA 4AIXA 3PGCB 4G8EA 4IIQC 3SDCC 2NZIA 2Y69B 5MEOB 4YS4A 2RHEA 15C8L 3V6FB 1MJ8H 3GINA 5J8OA 3HC4L 4W9ZA 3BIAX 4DWHA 3X1EA 1AGDA 3WLWC 3BVTA 2VSKB 4GIAA 1YNTA 2E9GA 1MFCH 2R0ZH 2VRQA 1OXYA 3IF1A 3UZEC 2ZXGA 1CFMA 2N7SA 4JANB 5AVSB 1E4WH 3HG1E 4DZ8A 4U1IA 3FB7B 3BJLA 2MWCA 4FG6C 2A6IA 3AY4A 4Y16A 3JWDC 3HNTH 5D5MF 2WHZA 3QCVH 4JLRB 4PGDA 4E42B 5FB8A 2YQ2A 1AQDB 3OGCA 4U4BA 1KXVA 3RBGA 1G9NH 3MBED 3ZTCC 5L88L 1BZ8A 2B14A 3UL4A 1CDGA 4PJBF 1MY5A 3O45A 5C0IB 1ODAA 1LE9A 1HYSD 3E7JA 1Y3GE 3RGBA 4ONHB 4QUOA 4JM0A 3V6OE 2UZPA 1TYJA 2VLJD 1Z5LA 4YLBA 5ISZB 2HTLD 2FWOA 4BHUI 1U8PB 3SIKA 2ADGB 1KN2L 2AK4E 5A7EA 1AI1H 3CFCH 3PP3H 5AG9A 3OC5A 1U4EA 3KNBB 2OM5A 2MTAA 2BSSA 4AEHH 3CC5B 2CO3A 5HYEA 5I1AB 3EZ8A 1TJMA 5HDWA 1G1OA 3LN9A 2XLLA 3RUGA 1XIWA 2VE6A 2OQJB 3L9RB 3P0GB 4NQDB 3V2AR 3KCWA 3K1DA 1J87A 3O4OC 4YC2C 3QPQC 4G6AC 2YFNA 4D9QD 4NRXA 1YYCA 3UOAB 3AMKA 3DJZA 3A4EA 1HSBA 3B5GA 3N1MC 3VI3B 4E41E 4D9RE 1X7SA 1EAPB 2AEQL 1OCOB 2IDSA 2EEBA 1BM3L 4WO4D 3MNMA 3G6JE 3N6YA 4PD4K 4J3UA 1INQA 1MCOL 3SY0A 1OAKH 1EFQA 1FBIH 4MJ5B 6PAZA 4ODSH 5DRWA 1UCBL 2O5XH 2OMBA 3MROA 3HN3A 2BNRA 4G1EB 4JKPL 4TQ8A 3TEZA 2B15A 4NERA 4RX4A 4RNRB 3QQ3B 5HYFA 1CFNA 3W9EA 4Z76B 5CZKA 4NAMA 3OKLA 2VLRD 4P2RE 5D7HA 2W0FA 4ZUWA 1C12A 4OZHB 5C0FA 3VWKC 3ZYOA 4NOFA 1RXLA 2HRGA 2XI9A 3TCLB 1BD2A 2TLXA 3LS7A 4XN2A 3DIDA 3LZNA 1CFTB 2XXCB 4YUEH 4AZ8B 2BHUA 2D9QB 2V2TB 1SEQL 3H4HA 3MTRA 2CGZA 2JJTA 5EPMA 4TLUA 1HYRC 4WUUB 1BM7A 5KBNC 3EOTL 5CBAA 4MSWA 5T1LD 2A9BA 2BSRB 2VN7A 4Z7QB 1LNAE 3KWVA 4LLUA 1P5UB 4N4YB 1P1VA 3MLTA 2QADB 3S34L 3LKQB 5IB5B 5TH2B 5JZ7C 3EDJA 2A3TA 4XXDA 3NZUA 2W5PA 1NGZA 2XUWA 4EBQH 2XA3A 1RFDH 2R0KL 1MEXL 1Z9SA 2AV7B 2KZBA 4N2FA 3VFPA 4AJ0A 4EIGB 3UTSB 1HZKA 2W60A 1Y6KR 4FAAB 4IJ3B 4HAFA 3BT0A 4UNIA 2C3GA 4LCUB 2JI3A 4D7PA 1G7LB 3PWJB 3FKUS 3F6LA 3NCCB 1JJUA 2Y2WA 3L5WA 4IKNA 1SBBA 2IH1B 4JN1H 3F5WA 2CDFB 1UOLA 4LU5H 4HIXL 4IHOA 1K6QH 1DDHB 2CO7B 2RBLA 4LVOB 4L9LB 3S36H 2ZUVA 4WJ5A 3NPSB 4ZMAT 5F3BA 1TEGA 1DUZA 3UJJH 4R4BA 3UTOA 2DV6A 4CN1A 4Y8DC 2GJJA 3IFOA 4YDLB 1JGIA 4WV1C 5EEXA 1X6LA 1S7QA 3W2DH 4D7BA 5C0EA 4XVOA 5I6XC 4LOFA 1FNLA 3RWJA 5FO9B 3KPSB 5D7KD 2E59A 4XE5B 4HHWA 4LSUL 4Z1PA 4UIKH 1GMEA 4LDLB 4ZXBA 2XICA 4HQQH 3DYOA 1QFWI 4B27A 3QQ4B 3Q2WA 2A6KB 2FJGA 4TUKL 5CZVH 1QRKA 3KPRA 4NXKA 3QDJD 4OH2A 5EN2B 2ADJA 2DWSA 5MEPA 5ES4B 3RVVC 1H6FA 5JYMA 4Q0XH 2G60L 1K8DB 2DIJA 5I0YA 4S1DC 1SRDA 5MI0B 1OTTD 3BZFB 1F4YL 4X6EB 4V33A 1V27A 4EQ2A 5C0DB 3KH4A 2C3HA 1QLEH 2FNBA 1DQJB 5JIKA 1CXFA 2OS7A 2QSCL 4MWPE 3O0RL 3R8QA 3T65A 1ULVA 1X5MA 2Z35A 4ARFA 3WSQH 2PCPB 1DQIA 4L05A 2K6YA 3D48R 1PLCA 5GS2D 3CFJA 4JFFE 3TA3A 3QIWD 3TWCH 2JELL 1MSPA 1XGTA 1S5IH 2G2PA 4KY2A 1NBQA 4JGMA 5E4IA 1QEWB 3E0GA 3DPDA 3BD3A 3O3DA 2Q2EB 5FUOL 1TZGL 1TLMA 2VW4A 5C2BH 1SXAA 3QUXC 2J73A 2XQYG 3H7LA 1M7DB 2X44D 5FFGA 4S1QL 5FKAB 2DF3A 2IFGA 3D3VB 4H0GA 2CGYA 3KPTA 3B9KD 3JWDH 3AFLA 3VFMB 1JZDC 4ZMVA 5IESH 4NLHA 3ZGHA 2I9TA 3TIDA 3UZQA 3OKKB 1P4BH 4YIQB 2BSED 2B5IC 4K7PX 5F93C 1UA3A 2XZQL 3FTGB 2N7BA 3GXMA 5HHXL 3B2UD 2VDPL 4FJZA 4PRAB 1ZHLB 3PREA 1D9KC 5CUSH 4C56D 4FA6A 5IMKA 3E1ZA 1TYRA 4JX0A 2X3AA 4I18B 5DVNA 2W9DL 4A6YB 2CRIA 3JSSA 5I9QB 3VYOA 4LLWB 1J8HB 1JRHL 1XF4B 2ZUYA 2UUDH 3WS3A 2D7TL 2ED9A 2GSMB 3KPNB 4WI4A 4RMVA 2F1EA 3WO3B 3WGVB 4XWGL 1AO7B 2BVQB 1AXIB 5F1IB 3S3JA 5AZUA 3U0PB 4PJ8C 5KVFH 4NCC2 1Q90A 5IGXL 5JW5A 1F4AA 2H2SD 4MS8C 2RD0A 1IGYB 2FBJL 2WOYA 4Z95L 4FNRA 4PUBL 2ZAHA 3FBOA 5LQBL 4N3UA 2IALA 4PG2A 2DLTA 1GS8A 3CMGA 4KNQA 2Y2TA 4PJHF 3T0EE 3QUYC 3T87A 1DQDH 2MHAA 2UYLB 5KSBA 2VDML 4XNBA 4WDIA 2JTYA 1QOKA 4W9LC 1NKOA 1H8SA 1EBAA 4GQQA 5IHHA 3MNDA 2EIZA 3EZJB 4L4TB 2E3VA 5TQ0H 3VMOA 5J1AA 1D5BA 4PS3A 1ED3B 3PABA 2R4SH 2IAMB 1E9QB 1HZHH 5AYUL 1FZJB 32C2B 5MHSE 4XH2B 1AS7A 2DLEA 1MG3C 1XGZA 2Q87A 3K3QA 4P5KA 5ALBL 2NY5L 4F92B 4N2CA 1FGVH 2K9FB 2F8OA 3J27A 3EXLA 2D2CC 3NCFB 2YKKA 1E90A 1O7VA 1FZOB 2V3EA 1MWAL 4W68A 4AW7A 4LO9A 4Q7DA 1ZEAL 2BS9A 2IXQA 4NIYE 1Z1WA 3MJ9A 1F8TH 2E5EA 4CSPA 5HDRA 1XGRB 2CJTA 2DEWX 2FJSA 3MA9L 2K7PA 4OUOA 3WENA 3IPFA 5JW4R 3BD4A 4QT5A 5FXCH 4MYWB 4XNQB 3HAEH 3STBA 2QQNH 2R83A 2MCPL 2WY3B 4LSRL 5F9OL 1ML0A 3N55A 4UTBL 3QXDB 3OB8A 2L8AA 5DJ2A 5IJBC 2NZ9C 3O41A 3AQXA 3APNA 1MZZA 4YDJA 4DQOH 1QD0A 5E2WL 4ZDHB 2VMJA 2K70A 2K6WA 4AIEA 2G3ZA 2JTDA 4BE5A 3KHOA 5IMLB 2RCSL 4LKXB 2FGWH 1ES0A 4G7VH 4XPHH 43CAB 4YVNA 5ESQA 3V6OC 5I1EL 4IQHA 5HGBB 2N59A 4X42A 2E4TA 1G6RA 3T8XA 4FMVA 4S1SL 2N0MA 2NR6D 3WIHA 1A9VA 2OMWA 1L9RA 4YDNA 4YR6B 5CEZD 1BVLB 2Y06L 4PTTB 1T1WB 4AY0A 5FSSA 5IVXE 1MXDA 1Q9WA 4FF9A 2V7HB 3FOLA 4TNFA 4OV5A 4QD2E 1B4JH 5DUBA 3UBFA 1Q94A 2YC1B 3D8MA 4URTB 5KW9L 1U58B 2EYSB 1HDMB 2QPUA 3LD8C 1OF0A 5J6SA 2HRLA 3GJFH 4NKOA 4IRSA 3BWSA 5FO8A 1XGUA 4P4KD 2GBUA 4RSYA 1JZ8A 2WKOF 5LG6A 3MRJA 3ZDWA 1DQLL 4GRWE 1A3LH 15C8H 1NGPL 3HCVB 2VKXA 3HC4H 1A7RL 5AB2A 4NPYB 2C3VA 3GMNB 4G1MB 1I1AD 4IGBC 1BXUA 1MHEA 3FCTA 7CGTA 4I3SH 3WE6B 3GLEA 5B3JF 2YPVL 5EFIA 1U3HB 2OMYB 2JIXA 4X5XB 3US9A 4A38A 1ZVNA 3ARZA 1BJ1H 3QWOB 1UJ3C 4KI5E 2NCMA 3MZGB 1XBDA 5KG9B 3DBSA 1W8EA 1QHOA 4U1NB 4WO4B 3AREA 3NJJA 4H8WC 4EO5A 5B8CB 3C5JA 4ISVA 4OCLC 3NCYS 3VH8A 4KXZH 4M6OL 5F9JA 3MX0A 1NFIA 2BERA 3H53A 4NN6C 3A21A 4OCRL 2FB4H 1VEMA 3G5VA 1OTUC 2I85A 4PG9A 5DJYA 2UZXA 4AQOA 4GRLA 4X8GA 3NSDA 4Z3FA 5AAWC 3SDDC 3V4UH 4HVBA 2GUOA 5DHVB 4CSSA 4NLAA 1EXUB 2OBGA 1CICC 1AE6H 4NWUH 5DMJB 2ICWI 1H9DA 1LWHA 3GDBA 4NGHH 4PMEA 5BS0A 1NJ9A 4IMLB 1II4E 1U6AH 2YLKA 4YXLH 5HYIA 4WO0A 5J6HA 4MKMA 3ARDB 1T21A 4FG2A 1N59A 2YXVA 4Y5VC 3WELA 43C9A 1ADQH 5IVXF 5KN5A 4A7GF 3VI4E 4NI6A 1LJMA 2XZCL 4YSAA 3VU1A 3X11B 3LOWA 1UWFA 3BQUD 4GYBA 4EN3B 1BIIA 1THCA 5F9WB 4S0SD 2AEQH 1IGML 1SUJA 1YEHL 2HLAB 3UXFA 2O6CA 5K9JL 4Z7VA 3APCA 4E5XB 4GRWF 1JNLL 1CG9A 4KY1H 4AH2A 1UXMA 2OXHA 3GMRB 1ONQB 3U30C 1ZE3H 1NOFA 3FQRA 1INEL 1UCBH 3V4VL 1EEUA 3LX9A 2HTKC 2HH0H 4QXTB 3VXRE 2H1PL 2HLFC 2LTQC 3NP3A 1HXKA 4S10A 3RGVA 1A9BA 1RV6X 2BVOB 1XSOA 4ZUVB 2NY5C 2WBJB 2UWEA 3EAKA 2QTVA 3EJYD 1CF1A 1DVFB 4AQ8C 4KI5F 4ODVL 3C8DA 3DVGA 2E86A 3F00A 1AMXA 3LKRB 2AXWA 2BOLA 2YO3A 3Q43A 5CZXC 3PUUA 3KPQB 4IKIA 1E28B 2PNDA 3BWAB 5C07A 5D6DA 2M2DA 2D7PA 5DFVC 2AEIT 1NCNA 4M6NL 3NEXA 4AYEC 1U9KA 3RL2A 1ROWA 3RVUD 4NFBA 1I8MB 3OMNB 4Y88A 3BHBB 5DFWH 2RAMA 4XVSL 1PSKL 1ZDQA 3PWVB 4HMDA 1G6VK 4LDEB 2A83B 1LO4H 4GIOA 1A7BA 2IGLA 5CIPB 1NCCL 3JTBA 2E0PA 1U8MA 4OBRA 4GJTB 4W9CC 3TBWB 4MZIA 1MEXH 5E99L 4HAGA 1KJMA 1BOGA 4YXKH 4JN2B 5CNHA 2ESVD 1N3NA 2B20A 4P4RA 2KYIA 3H3BC 5LGKA 1JZ4A 2Z0BA 4PRIB 3VI4F 4IOFC 3A5VA 4TNWK 2VLKE 5ESVB 4AQAA 3Q05A 1EEZA 3DGCR 2PW1A 1T6BX 4LGSB 3QFJB 4A2FA 1TTBA 4MQXC 4WWPA 3RZWA 1N5YL 3RU8H 1UURA 2W0PA 2JJUA 1AXSA 5H35B 4N8VA 4XBPB 2PTTA 3CDZB 5H4ZA 4MNGE 3F2LA 1XF3A 5AVTB 3PNWA 4H1LB 4OZGE 4NWTH 1CE6A 4PJ6A 1TCRA 2BSBA 8CGTA 1WIOA 2B3RA 2FEEI 3MRHA 4RFNB 1BVKB 3WEXB 3WS6C 4CJ1A 1ETB1 2AJVL 2PN5A 3QFDA 1VACA 4HJ1A 5AQ0A 1I31A 2GCYB 4WSJA 2P8MA 5H37A 1MREL 5BO1L 1UM6H 4N2NA 1AQHA 1E9PA 1MJ7L 4IMKA 4EUPH 1NUFA 1VPOL 4KKLC 5F7DA 2WO2B 2WQRA 4JRXD 5ACLA 4X6CF 5D1ZC 3WMSA 4BCZA 3IMBA 3T8GA 4HIHA 4ABUA 4KZCA 4WFHE 3B9KB 4PJCB 4EI6B 5I1CH 3HPJB 5L2KB 4ALAH 5E2UL 5EZLB 1YDPB 1KTDB 4HOXA 1KJVB 1S7RA 1M53A 1CVRA 1W72A 2P7TA 3L5XL 1BFSA 2XFXB 3MACL 1E4KC 4HIJB 1F4YH 2BRRL 1FO0L 2CHZA 3WTSA 3GMQB 5ACZA 2AANA 1CQYA 5HYSA 3O6ML 1GGUA 3TBSB 4L8BB 2QSCH 1SLXA 3B9EA 3LZPA 5CGTA 4YHMH 3WKML 4APXB 4CBPA 3BDXA 5CXPA 1YMMA 3EFFB 2VW6A 5IEHB 5JHLH 4OGAD 3RZCA 3K6IA 3FQTA 5E70A 4QHLA 4UDUA 3ZE1E 4MNQD 4B0MM 1MCSA 3FHEA 4W4OA 4EKJA 4HC1A 3LKOB 3MRKA 1A7OL 5INDA 2HSIA 5I16B 2CUMA 3OZ9H 4FJ6A 2FLBT 2R9HD 2BH0A 4K3JL 1CD9B 3MKKA 1QAWA 2ZYSA 5F8RC 3T0EC 3UZVB 1FFNB 1A64A 1KBPA 1O5DT 2QBWA 1QTPA 2B59A 1I3VA 3WTVA 3VGGA 3CVIH 3PL6A 3T0WA 4X5PA 3SQRA 1ZOXA 3PGDB 4LZKA 4AQ1B 4QRRB 5MP6H 1ZAGA 5HHOD 9PCYA 2DZEA 2WV3A 2Z1KA 4BIKA 4NQCB 1U41A 3KLLA 5I30L 4I4WA 1YY8B 3SE3A 4Z3IA 1OGTA 4OZGF 3C75A 1R3JB 3U6RA 5F7AA 3I6SA 1HI6B 2JKWA 3N50A 4H8WH 1U42A 3S7GA 1ZT7B 2HVKA 3RILA 1CWVA 1IQDA 1DJIA 1TSHA 2EDTA 2X4PA 4PYHA 2GW5A 5CLXA 4YX2H 2Z31A 3N40F 4IRJD 6CGTA 2VDPH 2JB6A 5FK9B 2JK5B 3WO4C 4L4VE 1QBLL 1VFAA 2IQ9L 5DDHB 5CJOH 2F1AA 1FE8L 4FL4B 1EJFA 1VSCA 1NCAL 5KYXA 4JQIL 1E4XH 1UD8A 3ILEA 2C9AA 5F7HA 4KROC 4ZPVA 4I9WE 1RH8A 1B0RB 5DLHA 2ZT9C 4RDBA 1MW1A 2XV3A 2B3IA 3GSXB 4X9YA 2D03H 2P26A 4P5TC 4ZMQA 3QUZC 3REWB 4J3OF 4XN8A 1S7TA 1UFGA 5I71B 3BAXA 2EZ0C 3IRCA 3SDCA 5IGXH 5L0QB 2J8UE 4OF7A 4TRPH 2YS4A 2FBJH 1MIMH 3UPAA 4ENEC 3DHMA 4Z95H 4GSDL 3RHWK 4PJXA 4Q9RL 2EXSA 2XACC 4FDWA 1QF1A 1RI8A 3PWPE 2AKRA 4QNPE 4XBEH 3ZDZE 4LP8A 1MAML 4MJIB 2ZJSL 3C2SA 5L8KB 1A4KA 5JPMA 4Z8FH 2J88H 1KG0B 3WYRA 2D3NA 3MHZA 2YSSA 4GLRH 5AW7B 2XQYK 4JHZA 4BSWB 5EZIH 4AGQA 1UZ6E 3FH8A 3V7MA 1QSVA 3BKYL 2HMID 2VDLL 1VGKB 2OFQA 3VGDA 1E65A 1SFHA 2P5ED 3VWJD 1UGNA 3H2QA 5KS9A 4JM2A 4UB0H 2DLFL 2Q3AA 1O6TA 2EYTB 4II7A 1F00I 2WXKA 4U6YA 2OK0L 2IFFL 4NX0A 3BFOA 1KDJA 2H45A 4N2KA 4NN7C 3WHE1 5KBDA 3AW5A 1W16A 3S98A 4KXDA 3T77A 1FNEB 5SX4H 1ECYA 1RJYA 2CH8A 4KWUA 1PLGH 4XGZB 1T1XB 3VTAA 1XGQA 3HUJB 4PJ9C 4KI5C 4PJ5B 1HXYB 2AQQA 1AGEB 1RIHL 2YXMA 1ASQA 3DOIA 5T1MB 2VDKL 5FW7A 3U4BL 4XPTH 1DJZA 2G3XA 3V0WH 4Y4FB 4GY4A 4KK5C 2MCMA 2DM3A 1NANI 3DDFA 4LSQL 4XNZC 3O9WA 1DQVA 3CSYA 4A2GA 1LEGB 2H1XA 5EU4B 3EYVA 3VXQB 4QLRA 1U8CB 3HG5A 1XR9A 2ARJB 4OF3A 1GSMA 4H0LC 4JY6B 3SGDH 4BK5A 3GLDA 4CW1A 3MRLA 5KUKA 2EIBA 2GC4C 4NP4L 1MCIA 1E6JH 1X5IA 2GITB 1OGAE 4ONGL 4Z3HA 1IZJA 4LKCB 2CBTA 4UM8B 1O6VA 1KEGL 3RI5F 1SDDA 4FERA 4FC3E 4APQB 4N5ED 4RMTA 3FU7A 3OAWA 3TO2B 5TE6L 3W81A 3VFRA 1RJCA 3A6CL 4N8CL 5E2VH 4MDIA 4YEEA 2BP8A 3WHE0 4PJDE 1G9ML 1NWPA 3RIFF 2A1WH 2TRYA 1PZBA 1T7WA 4HT1L 4YDKL 2ZUQB 3L54A 3FULA 5J7CC 1PVHA 1T22B 1LO3H 4WI0B 3TF4A 1ROCA 1THLA 1YN6B 2BZ7A 3VNZA 3HI5L 5SWZB 3S5YA 1N8ZA 4J3VA 3MVSA 3MV9D 3G5ZA 4XN9A 1U3NA 4Y2LA 3FB6A 2IPKA 3NVQA 3NZ8B 1UOWA 3SN6N 2YPVH 1N6QH 1HESA 4ODWB 4DT2A 3KPOA 1S9VB 5TQ2H 3GMMB 3G5YA 3K1KC 2Q1EA 2YPKA 5JIHA 5ITBH 1TQCB 4MWFA 1W8OA 5TFSL 4ZPTA 5KSUA 4QF1B 1QKZH 3F7LA 4U3SB 2NX5D 3VQ1C 1T5XB 1AVAA 4JMXA 3I2CH 3HZYB 4M6OH 5JDJA 4HPYL 3VH8G 4OCRH 4YHPB 2DB8A 1AC6A 3FUJA 3GHEH 2BY0A 3V4PB 5EU5A 5L4JA 1UUNA 1SJEB 1L7IL 2MPVA 1ZHNA 2UY6A 3INUH 5CZRA 3LJ3A 4K71C 4UT6A 3V10A 4M03A 4F80A 1D2OA 2YMXL 5L7XH 4ZQKB 2OTUA 2AXFB 1KBBA 4ODTH 3GLAA 2XWJA 3QUGA 5IUCA 4LPCA 2XN0A 4OI9A 1NTDA 2YOAA 5LAXB 3EOBA 4KAQH 5SWSA 1XCQA 4X98A 4P2OB 2XZCH 3A6OA 1T3FB 5CN3A 1LD9A 3IMVA 1ZJAA 1S9WA 2E74C 4PLNC 3D34A 4FN0A 3MLXL 1DP0A 2X9XA 3ARQA 4L8DB 3WL9B 2KERA 4DP5X 4X4YB 2I25N 4NM4L 1YEHH 1QSEA 3E9TA 5EEWA 3TLRA 2HUEA 2NY3D 2HPOA 1ZSDB 1JNLH 2HG5B 2PLTA 4Y5YC 3ROLB 3ZKXC 4GAJH 1KIPB 4HJJL 4PN6A 5EN3A 1U3YA 2N1KA 5L6YL 2CBOA 4H44C 3FGDA 3KXFA 5TLIA 1G7JA 1HHIA 3S8WA 1SXSA 1TTRA 3ARPA 3HN5A 4GBXB 2EYRA 4FQCL 2ED8A 3FO0L 4MA8H 4N68A 5LCVA 3IE9A 3KJ6L 3KGSA 2J7LA 5ENWB 1F1AA 2BNQB 3QIUC 5DEFA 5EO9A 3EBHA 4PJEA 1JWUB 2A9NL 1VFBB 4LEXL 4PCTA 5C0JB 3CFIC 3ECWA 2PO6A 4PHZA 4GW4A 2BWQA 5C92A 4JKWA 2ED6A 4ODVH 3W0WE 2G2RB 4AYMC 4RQQA 3D69B 2AJZB 3N1GC 2BP5M 2WINA 2ZWNA 4G6JL 1JVKA 4F7KA 5HGHB 4OZHF 2O6EA 4R4ND 1TKWB 2FNWA 4JFDD 4B0MB 4PCKA 2DQFA 2DY2A 1Q1JL 2DQIL 5E9DB 5J06A 5F89B 3VFGL 1WAPA 3X1GA 1IE4A 3VRJB 1UKQA 2NY6D 1PSKH 4N2IA 5EB9A 4XX1E 3QISA 4WGVB 1IAIH 1KFAL 1TQVA 3QR1A 3ABGA 1CLZL 1WBZA 3EFDH 2TSBA 4P46C 1QUNB 4JG1L 3ZQXA 1CLOL 1NCCH 3DXAD 4MGXA 4GW1B 5I5JA 3I6KB 5DJZA 3FMGL 1U8QA 2AQ3A 2V7NB 5E99H 3BSZA 4MMZB 4EZKA 1CI5A 5FAAA 3X3GH 4O58H 3N85L 1PE5A 1DVUA 3TBBA 1JZFA 4XP9L 5IEKB 3VXNB 4JAMB 4GRWH 1DE4A 4ADIA 3L3JB 5LGHH 4NENB 3EIMA 2DQDH 4FQXA 3UTTD 2Y1VA 4NUPA 4K3DH 3MODH 1JCKA 3FU8A 2PMZA 3BP4A 3N1FC 4HJ0D 5E7FA 5C0CE 4CKQA 5JXNE 4UMGA 1D2PA 5I6MA 1TVBA 2ZWYA 4N8VG 4HWEL 3T3PB 3QQ9C 2NY1B 2PP7A 4WNSA 4BFIA 2UZIL 1BEYL 1L7TL 1SM3L 4K0OA 4Q2ZB 2AJVH 1V7NL 1HHJB 2ICWB 2OSLB 1CBVL 3WBDA 1HWHB 1PZ3A 2ITEA 5KJ7E 4J4PD 4R2GB 5BO1H 1NAKL 3QE5A 5KEZA 2EE0A 3VXSD 3NJNA 5H37G 2R0LL 3G08B 2XWZA 3MGTA 5D7IB 3MJ7A 5E1IA 4ZUUB 3A24A 3EH2A 5K1VA 3MLUL 4H25A 1KCRL 3W3BA 1LNCE 5CS7A 3STLB 2D0FA 2X1OA 4Z0XA 3ZQ9A 2PPAA 2Y7SA 1AYRA 2NUPB 4MB4A 1AGCB 3J8F7 3D9AL 4G9FB 5D96C 1AR2A 2ZX7A 1FAKT 3IXAB 3MACH 4L1LA 2CPUA 1U8IB 3GHBH 5JA9A 2EDXA 3VAEA 1YZZA 3KBFA 4WNQB 4XB3A 4F7PB 5JDSA 1Q9KA 1FJVA 1I85C 3P69A 1Z6JT 3O6MH 4BK4A 1YRKA 1CDUA 4J6RH 1E2ZA 1ZHKB 3QI9C 4WQOA 2C4FU 2X1WL 3WKMH 1ZVHA 5HYSG 4MA1C 3WKPA 3DPBA 2GAZA 1MFEH 4F15C 3OKNB 1I3UA 4HZ1A 5ICZA 4U0RC 4DVBA 4Y16D 4WF7A 3NIGB 4FTVA 3WDJA 5EZOL 2XXMB 1S7UB 4LHUA 1A7OH 3AQYA 1CF8H 1B6UA 2P5WA 4BV1A 4QOKA 4K3JH 1LWJA 1NCWL 5DRNB 3S35H 4PWKA 5I0XA 2G0KA 9CGTA 3RWGB 5EMYA 4P2AA 3CLFL 5HVHC 3EJPA 5HY9A 4HWBL 2HRHA 4LOEA 1N12A 4A7QA 4LCCA 3FVPA 5GIRB 4YBHA 3GI8H 1MFAH 2X41A 2I69A 4G9DB 2DQUH 3U36B 4GXUN 4XP4H 3UJIL 4ZD3H 1GOHA 5TLNA 2DJSA 3UTQB 4YFDB 3GTNA 1M05B 3PWNA 2J71A 2ENYA 2F54E 2MTPA 5T33L 4FQHB 3TNMB 1AR1B 1R3KB 4NO2A 2WYHA 3DO7B 4OUUB 5TGBA 1KXQE 4Y4KC 3HR5B 4XC3H 2YQBA 1A5FL 1XIWD 1KROA 4DIXA 1I7RB 1RUMH 1UVQA 1QBLH 2CXGA 3DX1A 4GG6A 1YEWA 3ECQA 3B6SA 1TEYA 5B1JC 4F2ME 3QCUH 2W9EL 2HYMA 4ZS7L 1NCAH 3UDWC 4MXVE 4QYAA 4Q6IB 4JO3H 1DQTA 1NCUA 4ES9A 2QDWA 5KYUB 2J5LB 4B9YA 1MH5B 2P5EB 4MHHG 4WK2B 4LQFL 3BISA 1E9OA 1KACB 3AUVA 3NRFA 4GOSA 4GS7C 1EANA 1KY7A 1JXGA 3NSXA 2AJSL 2P49B 2XPGA 5FKPB 2XWBB 4OBSA 4LLDB 5IHZB 2HAZA 2O61A 3T4AB 2BNRD 1T0OA 4ORGB 4PGEB 5GZOA 1NBVL 2NTSP 4LOUC 5CU9A 3LDBB 3Q9PA 4RX4D 2GK0A 3SDAC 4E41A 4CC4A 4GSDH 3QJUB 5I1GL 3P7UE 1P69B 4HX1A 1A1OB 4X7SH 3AXLB 3X1FA 3QULB 1QF2A 1VZGA 4RWHA 3BPNB 4G71B 3VFVA 4NB7A 1Z0MA 1BD2D 3N42F 4MMXA 1MAMH 4MCMA 2YQ3A 1IEBB 2ZJSH 3S37X 3VM7A 4C4BA 2HT2D 4IDJL 2GY5A 4KU1A 2UXGA 4KH2A 2VLJE 1RPKA 5JQ6H 3O3AA 4Y4HB 3ZO9A 4DNLA 3OJDB 1JDDA 3O8XC 6FABL 4XNAA 8PAZA 2QL1A 1JUFB 3MSNA 2VDLH 3ZZSA 5FIEA 4XCNB 1I53A 3Q2LA 3MNWB 1SY6H 2WLLA 4M7ZB 4JJOA 1V3MA 2R1XA 5JUEL 4C55A 2V5TA 4CMMA 4KQ0A 2TMNE 3C5SA 2OK0H 3FB5B 2IFFH 3GWJA 3FT3B 2OV0A 4D9QE 1KB9J 3N21A 3QQDA 1XF1A 3QNFA 1SMAA 4PRHE 2EVIA 5BVJB 2HUHA 2KLTA 1C9SA 2XQBL 4GPVA 4J3OH 2EDMA 4PSPA 4WZ9A 3ZQWA 1LNUB 2G9HB 3M17B 3FONB 3FT4A 2YLHA 3R1GL 3TYGL 4BFRA 5FECB 4W9HC 4XHQA 1CL7L 1RIVH 3U4BH 1JHTB 3JQOB 2VN6A 4HYTB 4Q52A 2DTML 1Y18A 3I3DA 5EG6C 3GSWA 4LSQH 2ZKMX 5FF6B 4KPHL 2FL5A 2J3SA 4LQ1A 5GPRA 5BXFA 3BPOC 5JYLA 3QUHA 2EAEA 1ZJBA 3A4DA 3BAEH 1LEIA 4JO1L 1HINL 4J39A 3OAUL 1ZXKA 5TDNB 2HX8A 3IFLL 3O3EA 4M5ZH 2VLRE 2B4CL 3VGEA 3IMUA 5EIIA 3RWFB 4ZXBD 3ISRA 3H0TA 5DHYA 4BDVA 2C7UA 1FNFA 3BO8B 4AE1A 3KPRD 2QHLA 4DEPC 3Q5OA 5BCAA 1SHXA 2AVGA 2FJHA 1RMFL 4K2UL 3RFZA 1AP2A 3BVXA 4HOMA 3OHXA 5BRPA 4I0PC 3FTVA 2WWMD 2F7OA 2E7LC 1J1XH 4FXKA 4OJDH 4W9JC 1YMHB 4AJVA 2H3NB 4YQXL 3QDMB 1MWAA 3FFCB 4DERA 5F9DC 3KM1A 3EF7A 2CDGA 4FFZL 3U7WL 2XYBA 4FMFA 5HTSA 3CC1A 4AMXA 3RG1C 1C7SA 2MEJB 5BVPL 4BH8B 3M7FB 4JGUA 3TM6A 1GW0A 1HOEA 1JFQL 1MVUB 4LVOC 2XPYA 2ENSA 3TA3D 4EEEA 1BREA 2VR7A 5A2KH 5E08L 3AGVA 3WFZA 1NM4A 4IOSA 4A7SA 4KDTC 3VXUB 1WA0X 4UTBA 5KSAA 3C6LC 4G6ML 3MR9A 5D7JC 2EXYC 3W39B 6TMNE 1YEGL 3R7QA 5DJ6B 5IG7B 3QG7L 2NY3B 4Z23A 5TFSH 4YHYB 2BC4A 3AB0C 1KB3A 4DGYH 3MV8A 3BP7B 2ZOWA 4L1DA 3DGDA 4DKAA 2APXA 4HV8A 1J8RA 3W82A 4L3CA 4P59H 2C9QA 1JHLH 4PJFE 4Q4IA 1A7PL 3EH4B 3SGEI 5INCB 2PYFA 4EOWH 2HJKB 5D7KE 5DEGA 3C9NA 3EJJX 1VFOA 2K78A 1FL3A 3OC8A 5CO1A 4AT6B 1E3XA 3ME0B 4NZUL 5ETUB 1UXSB 4AMKL 5DUML 3KWTA 5MENA 2CLZB 5GGQH 3VB8A 1HN1A 3P4NA 1FFPA 2YD7A 4NOBA 2OMXA 3QNZB 4JFDB 3EJUA 3QDJE 4XAKD 3KWUA 3WAKA 3ULUD 4OI8A 4OD3L 5KSVB 4RRPG 4JVWA 1T6VN 1G1KA 1E4JA 4NQEB 1ORSB 2ZP0T 1KJOA 5KVMC 4BFOA 3HRZA 5D2LE 3MLXH 3PV6A 1AKJA 2ADYA 3TOPA 4Z78B 4JFQB 4TQEL 1KT2A 4NM4H 5JXEC 1A0QH 1MFDH 1YPZA 4V2CB 3DXAB 1R3IL 4ZO6A 3FRUB 2NNXA 2P8PB 2OTPA 4IBWA 3IAQA 3DBXB 5L6YH 3FHQA 1CK0L 5D4JA 4W70A 1MHPH 2A38A 2D0HA 1T0MB 4P48A 2NUTA 1BXXA 2I07B 1BBJA 3OTTA 5C3TA 5IMMA 3N0AA 2J20A 3LQZA 3X12A 1OAUL 3B1UA 2R69L 1SYVB 5DHDA 3AU1B 4LEXH 3IGLA 1NMAH 4J2QA 4XN7A 2CO1A 3IDYC 1FH5L 1EDQA 1NC4A 1X7TA 5IV2B 3VUAA 1UZ8A 2NQ3A 3OR6B 3PJSB 4G6JH 4PVNA 2VN3A 4TLSA 4X0KA 4FJYA 5FR3A 1KLGB 1HEZB 4JFYA 4KKRA 3EHBD 4OZ4A 3STZA 3UC0H 1A6WL 2AQ2A 4CVZA 1T66C 1EH9A 1TJIL 3I9GL 4PS8A 4F57L 7TLIA 1MCJA 1KFAH 1CLZH 1JZEA 1OWWA 4LARL 3M6DA 2V5RA 5F0LB 2AMUA 4C56E 3WXVL 4LPUA 4A37A 1N7ML 4NYLB 1MIEL 4G8EB 4PJ7A 3VW3L 2KC0A 1P4LA 4IU2A 2CA4A 4M7JL 4QRTA 5I8EA 1AKPA 3E8UH 3ETSA 5D1XA 2N7AA 1IJNA 4LSPL 5GS0C 3EFOA 5IBTL 5ADPH 1AGDB 2AERT 3GMLB 4IKLA 1KMGA 1IGJA 2YAFA 3A0OA 5GRUH 5IW1A 2ICEC 5SWQB 4XPBH 3MSPA 5D2LF 5I8OL 2O5NA 1NM9A 1E5AA 2B4CC 3IF1B 5DVPA 2BINA 3SB3A 2CKBB 3MLRH 4RWYH 5DUPH 2X2UA 5B3NA 4DZ8B 4U1IB 3HE6A 2JKTM 3V4VA 2IC2A 1XXDC 2Y7MA 4ELME 4YHZL 5LIFE 3FQWB 3LPPA 1X3DA 4UT9H 5DF0A 4P5TA 3M1BB 4OLZL 2UZIH 1SM3H 1L7TH 2P1YA 3DX8B 4G6KH 3V8CA 5I24A 1SNRA 3QAQA 2BS71 3QRGH 1ZGLM 3RVTC 4WGKA 4X6DA 1JMXA 3O45B 1RK1A 1NFDA 1LE9B 4DGWC 1EX0A 5F7FA 5C7XH 4OM0H 3OF6A 1M57B 5I8CA 3JBG7 1C1EH 4XVUD 1IGIH 4NQVB 4L5FL 5C9KA 1FJUA 2BNUB 1KPUA 1Z5LB 4IRSD 4LSDA 5SV4A 3WIFB 4PRDA 2QQQA 3CJJA 4HGKC 5D2NE 2X42A 3KH3A 5JPNB 4LMQI 1N9PA 3GD1C 3K71B 1I8IA 3DSFL 4PJCF 5IFAH 1EUUA 1RULL 5EF2A 3T2LA 4JRYB 5CBEB 4WI6A 4BXSV 2VE6B 2ZPKH 3JV4A 1LGVA 3P2TA 1J9TA 2FSEA 4FQPA 4KOCA 1X5YA 1Q8MA 2Q3XA 3C09C 2ITCA 4KTDH 4M5TA 1E50A 2JIXD 3O6FB 3PP3K 2ZCLL 4LL9A 3PP4L 3HZVB 4MB1A 1BFOA 3T1FB 3TZVC 3U2SA 3TN0B 1Z66A 3FCQA 5F6IB 4BKLA 3KLAA 3B8YA 3NPZB 3V79C 3S37L 3K8LA 4ZMYA 2H0JA 1BCIA 2NXYD 2JVUA 3ARED 3NABL 1KIRA 2E4FA 3MBEC 4LHUG 2CRYA 4M3KB 3CNKA 4OJYA 1ZS2A 2BOBB 4O2CA 5DRWB 1J1OH 4TF4A 5D7LA 1HYSC 1W8NA 1LP9E 1BEXA 1F42A 4HS3A 2O5YL 4YHIA 1NC2B 3W9EB 2F18A 4GRLD 1ZWIA 3WMQA 4GMTL 5E8OA 3BPLC 3TO4B 3OKLB 4XMTA 1NWOA 3BYTA 4X50A 2HTLC 1RK0A 4KXCA 2DWDA 2I60H 5J9PB 2XG4A 3Q01A 1XB3A 4P99A 3VXPA 1CI3M 3FUKA 2Z92A 2Y25A 5CN1A 4DPAX 3QBTB 5BS0D 1EVTC 4ZUSA 5JLZB 4X4XB 1A5FH 4PY8J 3FO2A 1W91A 2FVNA 3CBKB 1MCKA 5AW5B 1UD5A 5EPMB 2CK2A 4KJYB 2O93L 1SXNA 1SN5A 3DOSA 5HGAA 2XBZA 3BUYB 4JFEB 3INOA 5I66A 5BRZB 4L2YA 4ZTOL 2FO8A 3RL1A 1PPIA 1PLAA 1FO0A 1MHCB 3CFBA 3D39A 2OYPA 1LE5B 1NLDH 1SOKA 3BFWA 5HVFB 3BAWA 1A6TA 1I9JH 1Z9SB 1QLRA 3CN4A 4WO4C 1E8XA 5ILTL 3UC2A 1OM3H 1NOAA 2AJSH 2C1PA 1RIUH 4F9PA 2D2OA 4PV9A 3MCYA 5GRZA 3OMZA 5HHQA 3B7UX 4L0ZA 2KI6A 4FXTA 5GGSB 4OFIA 4MHHI 4KGJA 1PKOA 3QEQA 1MRCL 4TTDD 1XWVA 1IAKB 3RGVD 5KYYA 5EUOE 1DN0A 5F96L 3L5WB 3TIEA 5IR1B 4JPWL 3F5WB 4DAGH 2VL5A 4XCYB 1TITA 4IHOB 2JJSC 5TF1L 2W8CA 5F1NA 1K4CA 2AI0L 4KNTA 5AVYB 4GRMB 2XVBA 4OD1H 5C07D 4BJLA 3ARVA 3RWCA 2VDQB 4PLOB 3WN5B 3EYFA 3F8UB 5L8PE 2HXAA 3BH8B 2MMXA 4IDJH 1LP9F 3BT2L 1V05A 4LFHG 2A77L 3RWJB 5FYLD 4E9VA 3EDKA 1YECH 1EFXD 2Y5QA 3QEHB 3DUSA 4HUNB 3N91A 3HEIB 6FABH 1JZ3A 4AGLA 2WLIB 4CDHA 1GTFA 1JGEA 2XIIA 3I6LD 4LIQH 3DX6B 3MOQA 4ZYKB 5KZCD 1MRFL 1I8KB 2TAAA 4AYID 2FJGB 2HRPH 4J3XA 2Z93A 3SHSA 5JUEH 5AW6B 3GB7A 3TESA 2X2YA 2Z4QA 3O4LA 2CO6A 4N0RA 5MEPB 4Q4EA 2PETA 5DVMA 3CBRA 2F58H 4GAGL 1IIKA 2JCCE 3EYOA 4D3CL 4YFEA 1UA6H 4JQIA 4N0YH 1KEMH 1USZA 3D0LB 3SPVA 4HF5L 1AG0A 3PRZA 3QXAA 2DD8H 1A4AA 3TYGH 3T65B 2CWRA 4KKBD 2X2HA 1N0LB 3RGHA 1CL7H 2Z35B 3HUJF 2ZWSA 4LDCA 5AEAA 3IETB 4F58L 1TLKA 2I24N 5HD8D 2DTMH 1DSWA 1JPTL 2AMGA 5EUKA 3NSCA 1OB1B 3WJLA 3TBTB 4Z18A 5ELIA 3P3UA 5T3ZD 3FB8A 4UOQA 1LM8V 5GS0H 2XJKA 3FUNA 4UAOC 3LEXA 4AENB 4AG4L 4F2FA 3ILQD 1HINH 3O3DB 2B1HL 3DK0A 3SPCA 3C8KB 3IFLH 3Q8AA 3MRDB 3D0AA 1IVTA 4NM8H 1ASOA 2B4CH 3FXSA 2Z91A 3VSQA 4ZNEE 4F8TA 1I8LC 3CFEA 1TPXB 5BV7L 2FQFA 3GNML 3V0EA 5EIIG 1ND0B 4R96A 1I4FA 5TF0A 1B0GA 2L0DA 2FD6H 1ZSHA 3L3DA 2BIMA 1F3DJ 2RMNA 2XA8H 2I9TB 1F3RB 4U1GC 1ET7A 1G4RA 1IBBA 2XN9B 3NIDB 2DH2A 1OTTC 4YQXH 2V5MA 3RY4A 3U9UA 4DQAA 1FFTB 2G5UA 4FFVD 1TQBB 2H32H 2EXWD 4WSKA 2G3MA 3V5HB 2VQ1B 3PE9A 7PAZA 5L2JA 1K3IA 1YMMD 4KKAD 1SOQA 3TBYA 3RZCD 4O51A 3VRIB 3JWNG 3NOIA 3RWEA 3BN3B 4JQVA 1UOKA 2Q6WA 4BK8A 5BVPH 3AY2A 1QI3A 2ESVE 4XHJD 4P3CL 2FR4B 4DFIA 4JFWA 2A0LD 2ZZUT 3ZMNA 3QIWC 4I87A 5DI8B 1QNZL 4XO4A 3B8SA 4ETQA 3NTCH 1G7HA 4H26A 2IO5A 5FGBA 3SCMB 5D71L 1PBYA 1Z5YD 3ARFC 4OF5A 4FQLL 1AY1L 4XNMB 1YEGH 1C5BL 2TLIA 4OKVA 1NBZA 3PL6D 3QG7H 5IBLD 3DVNA 5LKNA 1D7CA 4LESA 5IFJB 2IIJA 4ABVA 1FJOA 4ZZKA 2VUKA 1A21A 5FSJA 2R23A 3P77A 3SKJL 1ZPLA 4N2GA 1A6VH 4CBZA 1E27A 4UT7L 4YHKH 2GVYA 1VKXB 2X4UB 5F6HI 4U1HA 3ATBA 2MHAB 1DLHB 3TJEL 2A74B 4XPFL 1HE7A 5T1JA 2XHNA 4WDIB 2WTRB 2O1AA 1RJZB 2VR3A 4DKTA 2Z31D 3C5ZA 5GXBB 2ETWA 4NO5A 2WVTA 1YYMH 3Q6GL 3B2UC 4JRXE 3TVMA 4JVUA 5DUMH 1GZQB 2IJ0C 5J89A 1RZ8A 4P5KB 4NCC1 1NINA 1YJDL 5K1NA 3BEWA 1SXBA 5IIEA 5JIIA 4MCZA 2IQAB 2XIDA 2J2ZA 3VD0A 3IN0A 3HMXH 4FQJL 4RISL 3QS3A 4K15A 4PR5A 4WU7A 1MCCA 3GK8L 3RJOA 1TMNE 1K8IA 5CJQL 3SDCD 3MPCA 4HIIA 3T0BA 3ZL4L 4MXQD 1QW8A 4MBRA 4MNQE 3DARA 4AQ1C 5HYQA 1FNGB 1OAYL 2QSQA 3DX9A 4MQTB 3TH2T 4CJ0A 1R5VA 5LWYL 5DJ2B 5I8KH 4G42B 4Y5XA 3O41B 3WLWD 1OANA 1D6VH 2IOIA 4UQAA 5FYJD 3UYPB 4BFBD 3ZT7A 4HS8L 1IE5A 1AZZC 2DL2A 4D94A 1B9KA 4M65A 2ZF8A 4Y19A 1QX1A 3KYKH 3QIBD 5JHDB 4M4RB 1FL6B 3QJFA 1BX2A 3FQ4A 5HHOE 3M8OH 1E67A 1TQSA 3FK3A 3ZBMA 3WHXB 3T8XB 1KLUA 3U4AA 3WEOA 5D2NC 2EICA 3C60A 1ICTA 1CXEA 5GGVL 3BPCB 3QH3A 2BHYA 3HNSL 3ESMA 5DJ0B 3KEHA 3ML9A 3VGBA 3VRLE 1U95A 2XVKA 2OSXA 2XNAA 3OXSB 3I9GH 4JM2D 1CMOA 3KGTA 4AVIA 4GUPA 5DUBB 5T5NF 4GSUA 3AG1B 4KXZI 1SJMA 3ISYA 4HALA 3WY1A 1KC5H 4DPCX 3WXVH 1MOEA 1N7MH 1S2EA 4TYUA 1MIEH 5FO8B 5TMNE 2B1AH 5L0QC 1FJQA 4H8UA 2VXSH 5AZ2L 1OW0A 3VO0A 4Y4KA 3EYQC 3IDIB 5IB1B 1RZGB 4LSPH 3CD4A 5GQBA 1K72A 4YDVA 1OZUA 2R1WA 1BQUA 2L7EA 5GJSL 3ZKMD 1U8KB 3R0NA 3HS8A 5IM7A 3GJFK 3HBZA 3O9WD 4LBEB 3GRWH 3V0GA 3ZMRA 5I8OH 3NA9L 5D1QA 3DGGB 1JWSB 2X1XR 4JZNA 3S3PA 2F8IA 5BV7C 4TXVB 2DMHA 1B0WA 2VISA 3D4ZA 2XZZA 5D93B 3VYNA 5DWUH 3L1EA 2Q76A 4J8QA 4YHZH 4OIFA 4MASA 1R24A 4OLZH 1P1ZB 1BZ9A 4F93B 2NR6C 1NIEA 2P52A 4HUUB 1QO3A 3AREB 1RUQL 2QGDA 4K8RL 4WU5A 3GS7A 4WWKC 4ODBD 3V5DB 3VH8B 2G4EA 1INDL 1JTOA 1BHGA 1NAML 4N6QA 3L4CA 5J57B 1NEUA 5K5YA 2X4NA 1SVBA 2Q9OA 4U1MA 4Y2OA 2MOQA 3GSRB 4GRLB 3FU0A 1WUNT 2Q86B 5KVDE 1FG2B 2KBGA 2GUOB 5D7IF 2QLYA 4EZLA 1L6XA 3WFBL 4P4KC 3WJMB 2ZUSA 1KELH 2KH2B 4F7CB 1OOAA 1SHSA 3MS3A 3QEUA 4AL8C 1WHPA 1RULH 2KL6A 2AJ3A 4OJFL 1IC5L 1NJ9B 1TVHB 1JZIA 1T21B 5KVEL 1QNIA 3VRLF 1AXTL 2WXNA 1UADC 1I1AC 3BGFC 43C9B 1DJYA 4BXVA 4CADA 5KN5B 3ULVF 3QORA 4G7SB 4TNWF 2HKFL 4J3WA 1FVCA 4MLIA 4PJDA 1OVZA 1J12A 2ADIA 5CJXA 2Y1ZA 4OZIE 4XNUH 4HJIA 3VFSB 4WWOA 3PP4H 3IMRA 3TC9A 1KXTB 1CFVL 1F18A 2R39A 4U1SB 3LQAC 2ZD0A 4R90L 2E7CA 5E2JA 1R5WB 1M9WA 5CEXB 4FFTA 2YAPA 3NABH 2IANB 4QRSB 4W81A 5DD6B 1L3WA 2FH6A 3UJTL 4O4YL 4AQEB 4ZFGL 3UACA 5GGSY 2QHRH 5GS2H 5GSRB 3OJVC 4O9HL 2J12B 5FUZH 4L8SC 3P7QE 2VOTA 4TNVF 2XXGA 2FECL 4YXHH 3LN4A 2Y22A 3VXMA 1Z9NA 4R3SB 4FQIH 5EWIL 3KL5A 4JB9L 2J5WA 4O02L 3GIVA 3DJ9A 3ZIMA 2K4WA 3CLWA 5I6PA 4PGBB 1RERA 4FA8A 3DRTA 3UG4A 5K9QG 1M71A 1QR4A 3FFDA 3IJSB 4AMWA 1JGUH 2BLFA 1VAHA 3LY6A 1EBPA 1O75A 3AZUA 3VQ2C 2P8LA 5SWSD 4S1RL 4EZMA 2G9KA 1R3LA 2ARWA 2JQZA 4MYPA 4QRUA 1WAAE 1UWXK 4TPRH 3B3IA 3DNKA 1NEZB 5DQDL 4F24A 2Y07H 2OL3A 3BQUC 2WN2A 4M62H 1VENA 1LO2H 3UGEA 3CUPA 1BWWA 3VFNA 2XV6B 5C08E 3IKCA 1QSED 3BP6A 2LGNA 5JW4M 1KBVA 1LO5A 1XL6A 1KJMB 4OT1H 5ILTH 3VVWA 4QRPA 1IV8A 3DETD 4PJIE 2VZUA 3MV9E 3LZQA 1O9WA 2WJ5A 3KXFD 5HHVL 2H6OA 4P4RB 5DC9B 2X9YA 4OGQC 3O6KL 4L0YA 1L9NA 3NN7A 1U21A 1I9IH 3IM1A 4M3JA 5GJTL 1I7ZA 1MRCH 1NGXA 1XEDA 1EV2E 3MRMA 5EO0A 2Y3AA 1AZBA 1F90H 3JV6B 3QCTH 4AQAB 4OZIF 1QFUL 2VMCA 4XP6L 2XRAH 2PO6D 3VMNA 1UTDA 3RE0A 4OCSH 1AXSB 2GTZB 4FQQB 4DGIH 1CFQA 3EJYC 3NGBB 4H5SA 4F33B 2X05A 4R97C 4JY5L 4JY4B 3PGFH 4HWBA 2AXGA 4WHTB 2NX5E 1M4KA 2VXQL 3GSNL 1HZLA 5JNYA 2NCEA 5CCGE 3IK2A 3QFDB 1VACB 2PR4L 5D7SL 3WV0A 3BMVA 5FA4A 3RVUC 4K89A 3DJSA 4RAUB 2W65B 3U83A 4K9EL 3L4VA 4FYQA 3NCBB 2ITFA 3HHRB 4UTCA 1J48A 1FFOB 3QO0B 1QVOA 1J9QA 1ZLDA 3L7EA 3CFKA 1TG8A 3BGMA 4EXKA 1KJ3L 1JYNA 4XCEA 1S7RB 4Y0GA 3QHFL 1FA4A 2P7TB 2WYIA 3OG6B 4HBCL 5ADOL 3DA0A 1LMIA 4MZ3A 4HUXA 4R84A 2CXKA 1W80A 4FQXD 1PIGA 2RALA 3G9VA 1NMBL 1UUSA 3NN8B 1S7VB 3HS9A 3KPLA 1JNJA 2VN5A 4N0FA 5DQJA 1KIQB 5L4IA 1A3ZA 1JYVA 3I02B 5IHBA 1HK6A 5I73B 3RHWF 3FQTB 1FCGA 2R29H 4K8RC 3K7UA 4PQXA 4R4FL 4UDUB 3X14A 4FKEA 1GHFH 5IW6A 4GW5A 4KH9A 4PVBA 1AIZA 2FJUB 2Q7YB 1TSRA 3CLEH 4PJIF 1CQKA 4Q9BA 1NDGB 1JRHI 3GHPA 3E2HC 1JK8B 1IC4H 2NNAA 1I75A 5C6TH 3X3FH 4AG4H 5E5LA 2B59B 2UX6A 2CNYA 2Z6FA 5HDQH 1QFWH 4TLNA 4TQHA 2NW3B 3ETBJ 4OFYA 1PE7A 2SEBB 2W88A 3JTTA 3IGAA 2GFBA 5ID0B 1DEDA 3EGDA 3GNMH 5DTFB 1UXWB 3NJGA 3FO9B 4R0LC 3TEWA 3QB7C 4HXAH 4MAYA 1OGTB 4P07A 4ZO7A 5E94B 5LO7A 1JD7A 3AITA 2Z64C 4ODUA 3A67L 4Q97A 5KVGL 1CDYA 1HHHA 5CEZH 4RA0C 5K39B 1Q9LA 3UPCA 2X4TA 5D70L 3WE1A 2Z31B 1A2YA 4GEJA 5BNXD 5J1SC 1N64H 2JB6B 1KR6A 2MCAA 4NO3A 3WTTA 4JDZB 4B9JA 3DHPA 4OGAC 4GLRI 4U6VL 4AIOA 1PZSA 1CGYA 4FTVD 3NG5A 4P3CH 4ZOAA 4AL8H 1JPSH 4C8XA 1QZ1A 3OKMA 4LHUD 4DUWA 2NY0B 3PIQB 3GGWB 3APMA 1QNZH 2P5WD 4QOKD 2A6DA 2R9HC 5D71H 5A2FA 4B7IA 3LKNA 3UTTE 1SLWA 3PHQA 4FQLH 3RPIA 1FHGA 1S7TB 4L2LA 4IIQB 2EH8H 3SDCB 3ES6A 3CVHL 2LE9A 1IM3A 4ZFZA 4ZK8A 4ZSOE 1KGYE 3SKJH 2X7LA 4KJQD 2PPEA 5ANMB 4ODHL 1BW8A 3LQAH 3A23A 2NLJB 1IL1A 2YOCA 3PDOB 4GAAA 5M94B 4DUXA 1BMWA 5FXNA 2CIIB 2VXTH 4XPFH 3SDXE 3V0FA 4YGAB 3VXTA 5D72L 3Q8FA 3F7VA 1A4KB 1Q72L 3VXSE 4IRJC 4XMUA 3LEVL 3DVIA 3D09A 3TS8A 3U4EA 2YSSB 1GCFA 3LRHA 5C0RH 5ICYB 1UT2A 2LQRA 1SOSA 3V6ZB 4XCCL 5JORA 4XC1L 4NP9A 3ILPB 2ADFH 1JGVH 4UDTA 3K91A 3NJLA 4FXGC 1ZA6A 2KKQA 2ZXQA 2FZ3A 3LH2L 1SMDA 3FT0A 5F72S 5KS9B 1TZHB 4FFZA 2OLDA 4RISH 4YLCA 3Q8BA 2WVVB 1O6SB 1YQVL 3GK8H 2QZQA 4JO5A 2J1YA 5CJQH 1PQZB 2CLRA 4L1BA 5GZOD 4LP5A 1RJYB 4E41D 4HBQA 3S5LA 1OAYH 2F74A 1TU2A 4P3WA 5LWYH 1X6NA 5CILH 3I6GA 2CDEA 3E6FB 4GKZA 4J28A 3O4OB 4JZJA 4YC2B 5EO1B 4MRCA 3ZRCC 4HS8H 4CGUB 4K9EC 1PKQA 4JE0A 4OLYL 3WFDH 3P30L 1BLNB 1JERA 5HDBB 3EYVB 3N06B 2EEAA 4LFHD 3TZVA 3IFNL 4KK6D 1WZ1L 3GSUA 2OYMA 1P6AB 2AQRA 4OCMC 4WJG3 4HGMA 5BRQA 2A6JA 4BQ8A 5E9AA 2YWZA 4YSOA 4ANKA 2YRBA 5CR1A 2CK0H 1UACL 1OY3B 3GJEB 1EMTH 4BSVA 5GGVH 2V5YA 3M46A 2WYZA 4IW4C 3K6SA 3HNSH 1S7XA 4XAWL 2HMIC 4ZUTA 2ZAIA 3WJJA 3VWJC 3SDXF 3M45A 2WQUA 3RUGE 1IQWL 1QHPA 3D85B 1XZ0B 3FU7B 2PR9A 4I77L 4AEIH 4N8PA 5CSGA 1RQ5A 4QTHA 4WTXA 2NOYA 5HSFA 3VWKB 5K1JA 1IIIA 1KL6A 1X9LA 2VGLM 1EZMA 4M9PA 4AR9A 4PHXA 5D9SA 4IOIB 3WNLA 3P4MA 3BGAA 4HHAB 2WAHA 2QGBA 1N8ZB 1T4KB 2Z8RA 3O11B 1LNDE 2H1LM 2IPKB 3HZMA 3U0WL 4NBZB 3NA9H 3P11L 4NNPL 4PRHA 2BNRE 2OX5A 2AEWA 3DROA 1OT4A 3ARRA 2OJEA 3LNFA 4HCRH 2TSAA 3P4OB 1ECZA 2RQ8A 3ZY7A 2OJZL 1DJWA 4KV5E 5AL0A 2R69A 5T3XE 5F97E 2Y7QB 4MWFB 1BQSA 1UH2A 4ZPTB 4PB9H 3LRSA 2R51A 3SQOL 1KIUA 3P0VL 4LSTH 3M1CA 1BD2E 1OKEA 2EIEA 1KB5H 1Z7JA 2FLMA 5LN4A 1B0IA 1DBMH 4N5EC 1J0YA 3L5JA 1FJ1A 1VEPA 1BDYA 2V3DA 5GGRA 5AOMA 1XF2B 5EF3A 1ZHNB 4PBDA 1NSNL 3EGSB 3WFBH 2ITDA 3IJHA 1PW3A 3DUHA 3L5IA 3ZYZA 5GHWL 4ZODA 2OTUB 1N8OE 1WC7B 3ESUF 4N90D 2DWYA 1K5NB 1ZVSA 3DJRA 4WV1B 4ZMTA 1YN7B 4WUKL 3GJFB 1RU9L 5I6XB 1M2OA 2APSA 1XCQB 3RUGF 3UMNA 4YMPA 3MA7A 5HPMB 1IU1A 1LD9B 1PE8A 2EDQA 3POCA 1YEFL 4FLOA 4IOSD 4J3TA 1FSKC 1IAOA 3T3ME 4J3BA 5KSAD 1HL5A 3F05A 1CFVH 3NDZE 4PY7B 5IVOA 3OG4B 2GABA 3FYIB 1QSEB 4N9GB 4Y1AB 2J72A 4R90H 3GSVA 1PAMA 3QEGL 4KTEH 1IJ9A 4OVVA 1IEAB 2WXMA 1OSPH 4Y2DA 3T2NH 1AGFA 3MV8D 5E2TH 4AWJC 3KXFB 4MTWE 4HSAC 1VGEL 5DS8A 4G82A 4HKXA 1NGYB 4IOFD 5F7YC 1CGSL 4H0IA 4WIQA 1FPTH 5AVZB 3WAJA 4WTWA 1HXMB 2OPCA 2ZONA 4PJEB 2AJYL 4ELDA 2GJ6A 3QPXH 5FS5A 4KJWD 4E9WA 1CLVA 1L3FE 1IGTA 4O02H 5E51A 1K4DB 3ARTA 4UINH 5ECGA 1DUYA 5JHAA 5MEND 1BAFH 4KV5F 2OR9L 5IT2L 5I6LA 1PG7H 1BZDA 3EUDA 4POYA 3KPRE 1JBJA 2ZCZA 1Z0NA 4NQXA 4OCWL 3L17A 3U9PL 4BH7A 1WK0A 4UU9A 5HHME 2KLRA 1P2CA 4IRZH 3VJ6A 3QUXB 3CZEA 2G75A 4KKLD 4ZW7A 5DQDH 2A9MH 2PF6A 1AJ7L 4HXBL 4KK9D 1UD3A 5E5RB 5K9QI 1WBZB 4UBDD 3O6LH 3BX7C 1AKJD 5IB2B 4J7RA 4ZJ9A 5DK0A 1SN0A 3NQZB 5F0PB 3W37A 4J27A 3UEQA 1U8QB 2NW2B 1NGWB 1OSZA 5EC2A 4B97A 3F7PC 4YFLI 4HLEA 2NT0A 3NT0A 3RWDA 3TFBA 2LVCA 2W92A 2I27N 2B5IB 1U8OA 1OHQA 4JPQA 3PQYE 3BEVA 4C83A 4WI8A 2F7IA 4UQ3A 1D9KB 5GS1C 1GVIA 5IJKA 3TH4T 3HB3D 3ZN6A 2WCPA 3CH1B 5FLVA 5E00A 5D5MB 3WMPA 1RKRA 3EJQA 2IMNA 4QMEA 2H6UA 1NC4D 1CD0A 3H9SA 4MRBA 5E6IA 3KYNA 4KXBA 4X99A 4KZDH 1QMUA 4JJHA 2ZWLT 4NZ8A 2VLLA 3LPOA 4R4NC 5GRVL 1BF2A 3DOHA 4AVKA 4I2XB 4FI6A 5DLML 3ARFA 3ARBA 4PJBB 1QQDB 5T3XL 4GKLA 2CUHA 2PR4H 4XZUA 4PJ8B 1RSYA 1OHZA 1JGDA 3CPLA 4XVJH 1CS6A 5CP7A 4WY7L 2J44A 5JW3L 4K9EH 2NY6C 3CFDB 1PG7W 5IB4B 1ZT4A 3CSTA 1DHKA 3C2AH 1AYOA 4PCYA 2OMTA 1BP3B 3ZHLA 5F7UA 4HKBA 1DVXA 1MAJA 2YKLH 4NUJA 3NIFB 3U79A 5KVDH 4XAKE 4OCNC 3QUYB 4X9IA 1XCXA 1KBKA 4HUKB 4EI5A 1MI5A 5BZXA 3S2CA 3CHXA 4G83A 2FIKB 2W91A 5D1XD 3SKUD 4HBCH 5ADOH 2JJWA 4G8GA 1MF2L 1NMBH 1FNHA 4XX1G 3HNVL 1UQSB 4A6YL 4XOBA 1J05A 1WHOA 3FOMB 5FA3A 4KQ4H 1J5DA 3RWIB 3HE6D 4HJ0C 1BFTA 2ZSVB 3QJQB 4MXWL 3T8CA 3BH9B 3CVDA 4LLMA 4JGNA 4EAEA 1KNOB 1V3LA 5A7BA 3WD5L 1C08B 2MQ0A 4LHUB 4LCWA 4P5TD 3VM5A 2O6FA 3PFQA 5KSBE 3NRQA 3QJVB 4Q6KA 1EZSA 1YEEL 4F37F 3TPUB 4DTGH 4X6FA 2YD1A 3LS4L 5ID1A 2UXVA 3HG1B 3LIZL 1FGNL 1CT8B 1WO2A 3OF6D 5FFLA 3GPEA 3BKCL 5HYJE 2KMWA 5T1KA 4ELMA 3WLBA 3BXNA 2WXPA 4P3DA 5I74C 1HHGA 3PWNB 1ET5A 3PHAA 4TSCH 5DLMH 5LXGL 3ETTA 2WW8A 4NO2B 12E8L 3GKWH 3DV6B 2ZG2A 2NNCA 2NYYD 5D70H 3ATFA 4N4EE 2JLPA 4GQ9L 4M8QB 4PJAA 3RP1A 3UX9B 3PJLA 1T1ZA 4PV1C 5J0BA 3Q48A 2AF2A 1DO6A 4UQ2A 5CLWA 4E0RA 1KJ2H 1AHMA 2WN3A 2Z3FA 1TTGA 1QRNA 1KPVB 3EDDA 2XPZA 2YAQA 5DHXB 3IXTB 3RNQB 5I0DA 1K2DA 4U6VH 4OZFH 3ZGIA 4WWID 3LNEA 1WD8A 2PWEA 3D0VA 4Y16C 2WNXA 3ULUF 2UV3A 1RZ7L 4R8WL 4C58B 2Y1YA 4NCDA 3IFPB 1KXVC 3TYFA 3LD8B 3I74A 3SOBL 1KKKA 1RZPA 4YBQD 1F4XL 5D7LD 3CVHH 4HCGA 2VJXA 5F7BA 4L37A 4E41B 3UBGA 2CHXA 2L7JA 4IK7A 3GS4A 1GTNA 4JKKA 1UWGL 3FNKA 2EILB 2J6EL 4UMSA 3G6JB 4IGBB 1Y6NR 4HH9A 1F13A 1IAIM 4NQSA 4FNUA 1DQQA 3SKOB 3V4LA 5JIMA 4KUCD 4RMQA 4B7LA 3SKNB 4BFKA 4UIMA 2QQKL 4PJHA 1AMYA 4IBUA 5D72H 1SGKA 4WHYG 2NPLX 1JN6A 1HOCA 1XIWC 1UJ3B 3OWRA 5LB1A 1CO1A 3LEVH 5GGUB 3OAYK 4K94L 2RR3A 3PS6A 3EW3B 1UH4A 2UZYA 3MOAH 3O3AB 4P2RB 3MLZL 5E5MA 5AKTA 3OVUB 5I6NA 2BCKA 4WWKA 1C5DA 1F1GA 5FM8A 3D39D 1UCTA 1U92B 3VFTA 3LH2H 2R1XB 2VDPB 2XVGA 1RUKL 4NN6B 2IVFC 2HFGH 4N0CD 2Y5TB 3SDDB 1WZKA 2AABL 1NMCC 2MKWA 4LNRA 1B2WL 1H5BA 4NZTL 3CHOA 1FLRL 1CICB 1FFQA 2I7OA 4AUUA 1DBBL 3QEQD 5F0JB 1UB5A 4DN4L 2NDGA 1MJUH 2EIKB 3HBQA 3TV8A 3S5LG 4LEOA 4M61A 4Y5VB 3CSFA 4RDQG 5E7BA 5EBMA 1GZPB 1CGTA 2R2CA 4OQTL 1YG9A 1CXIA 4WEMB 4QYOB 5CEYA 4IU3B 4OLYH 2FL5B 4HU2A 1X5JA 4AGMA 4XVTL 3JUZA 3MJ8A 2R4RL 3IFNH 5EUOA 4A2MA 4QXGL 1UEMA 2JJTC 1HH6A 2HT2C 4HUCA 1E30A 1GGCH 4I7ZC 5CLZA 1GZHA 2CALA 1M2VA 3UH8A 1CYWA 1HEHC 3U30B 1BXVA 3IDNA 1DSYA 1AH1A 3NACH 5TDOA 1ID5I 4IBVA 4BDVB 1MFVA 5BS0E 2VTFA 2DBLH 1MCRA 4L8SA 3O4LD 1MCEA 2LTQB 2FJHB 5FWQA 1JL8A 1Q9OA 3BWUF 3ETBF 1FV1A 1BVNP 1SF5A 5EOCL 5IQ7L 3MREA 1FF5A 3KR3L 5JW4N 5GISH 3K4AA 2FYVA 4NPKA 5FYKU 1MWAB 1KV7A 2DQHH 3ZPDA 3L81A 3SO3C 5DFTA 4JR9L 2VITA 2Y2YA 3JWOL 3QWRA 5F3HA 4UUJA 4Z7VE 3N5AA 4JBSA 3CIAA 3Q5TA 1PY4A 3H42H 4JHWL 4UM9B 2VC2L 8FABA 5I1KL 3CK0H 1WYJA 3U0WH 4ZW8A 2P44B 1PAZA 5IB3B 4NNPH 3ALPA 5ABAA 3S4SA 3W1ZA 1JPGA 2VERN 3DV4B 2FJFA 3JVGA 3QRBA 2AK1L 3LNHA 2R7EA 2UWEE 2VB5A 1ZV9A 4U6XA 1A9EA 3QDGA 4Y9GA 4WENB 2XN1A 4ZXBC 4JFFB 2ENPA 4CUCA 3MRIA 5DZNA 2EDOA 5C07E 4M48L 2PXYC 1M1XA 1LEKA 1U36A 4JFZL 1QG3A 2OP4H 1ORQA 5DZPA 1WZLA 1KGCD 5E0QA 2WWMC 1M42A 3WFEL 2OMVA 5FYLE 5DEGB 4K07A 1T0PB 3UTZA 4PJGA 3NZHL 2MKLC 4PPTA 1FL3B 1NSNH 3I75A 3LHAA 5KTEL 4ZNEA 2VDRH 1KPRB 3QNXA 5DZOA 1ZT1B 1IM9B 3I6LE 4IEFB 4OGXL 1JZJA 5DQ9A 1U2CA 3AS2A 3LRKA 3FSZA 1MCFA 3TT3L 4YGVA 1OALA 1F3DH 1HH9B 3KDMA 3DX4A 3RI5K 3PXJA 3SBWA 3QUML 2EDBA 4NZDA 2WLYA 4NNYB 3TA3C 2CUAA 3TA4D 3P2BA 4HULB 5L3UE 4A7GA 2QDVA 3L3IA 5D1ZB 3ALXA 4HS6B 5BW7A 3CZFA 3D2UB 2RA1A 1T03L 1I3GL 3KPMA 2OMUA 1LNBE 4Q9QL 5ALCL 3SGKC 4Z7VF 2ZX8A 4YPJA 4LF3A 2V2WA 1BPLB 1VGEH 1XAKA 2D31B 3AVEA 5IVZB 3TFKD 2DEYX 1BBJB 3QZWB 5T3ZE 5IMMB 4K94C 2IADB 3NUKA 3LKPB 1Z9LA 3D87B 2QR0A 3X12B 3F01A 1DL7H 2XBDA 4WTQA 5DGRA 3BE1L 4G5ZL 1EO8H 1HL4A 3FO1B 3C5ZD 3MNVA 1AHWA 3U46A 1A4JA 3NFSH 5HJ3B 3K5RA 5TE7H 4W9FC 3V0HA 1G7QB 3TVMD 1NAMA 1UD6A 5IT2H 1SQ2N 2VABA 2ZX6A 4Z3TA 5FUCE 4H0HB 4X0KB 1PZ5A 2H26B 3FCUB 4JFYB 2EH7L 4OCWH 2CJ3A 2PWHA 3P0YH 2QVMA 4HZLA 3KJ4C 3B2MA 4JM4L 4AC2A 2Y1AA 3DWTA 1NBCA 3N2JA 4NC1E 1BYPA 1HNYA 3WFCL 2X2IA 4GSQA 1NFAA 3MLWL 3FQXA 2VAAB 3HZKA 5E6SB 2AJXH 2XWTA 4HJUA 2WUBL 1TJHL 1XGYL 3EGXA 4V1DA 3IWUA 4HUWA 1YMME 3LH8A 3SE8H 2ZYRA 4GKNA 3GQFA 2E9WA 1P4LB 2VZOA 4KVNH 3KWWB 1L5GA 1RURH 5E4OA 4PVMA 3HMWL 4U7KA 3S3CB 5J6GA 3QJXA 4PG2C 1NKGA 1F45A 4QCIB 2IGFH 3EFOB 4GUCA 3WO4B 4HGWA 1O0VA 1OZTG 1V8HA 4HJGB 1LMKA 4YBLC 3KCPB 1KENH 1NL0H 2XWDA 5IW1B 5IFHL 5FDWB 4O2FB 5EC1A 1PEWA 1KZQA 5I15H 5JR1L 4Y19D 3FYEB 4KROB 3HE6B 2APTA 3LRMA 1GCYA 3G6DL 1SVCP 3GM0A 1OARL 2MNJB 3MRRA 1TETH 3L7FA 3US0A 2GTWA 4P5TB 2A73A 1SJHB 3QC5X 4DN3H 2UY7A 2VH5L 1D5IL 3C60D 3D25B 3E80A 1MLCA 4N6RA 2JXMA 1BQBA 3EHBC 3QUZB 4YSDA 3S3SA 2N0KA 1A1MB 3EG9A 5D6CA 1IKFL 4FQ1L 1S7WA 4O02A 4AGNA 3BVNB 4NRYB 1RK1B 3FF8A 2ODIA 5EBWA 1BOYA 2NXZD 5A16B 4G8FB 5I0VA 5CLYA 5DD1H 3HS0A 1S8DB 1OGPA 4FZEL 4MA7L 1KPUB 3BKMH 5B38B 3W38A 1ZLVH 3JTSA 2WCGA 4XOCA 5FYLL 1NUGA 1R1CA 5AAMA 2IBZY 3TNNA 1QA9A 3B2VH 2WNWA 2BP0A 2DI7A 4Y4KD 4A7TA 5IVXB 1KCSH 4NN5C 2P47B 3L3OA 5I2IA 2WWOA 1UGKA 1DR9A 1MF2H 1RZQA 1FORL 1JVLA 4ZMXA 3IDXH 4P23A 1G7IB 4N86A 5HVGB 1JSYA 5D1QD 3QA3B 4LLQA 3KHQA 1KTRL 1PG7X 3GXNA 1SYSA 4GRWB 4TOYL 3T04D 1L6ZA 2XTJD 4G43A 2YAMA 3ZZQA 5B39A 1WZMA 1YEJL 4JG9A 3EOAA 5ITFB 3KLAB 4PJXE 1LNEE 3D6GA 4XT1C 1SMOA 3BH4A 5E8NB 5FYJE 1KIRB 4L8CA 4PIRF 3IS1X 4NN7B 1YEEH 4N1EA 2OXGA 2IH3A 2TRHA 3MAWA 5DRZB 4O2CB 5EA0L 3BWUC 4TL4A 2YR3A 3KM2A 4R7NB 4AYFA 1IC7L 2B08A 1FGNH 2VDQH 4FZ8L 4Z7OE 5T3ZL 1OD7A 2WZPA 4XVUC 2VXQA 3GSNA 4PJ9B 1FYTA 1H6EA 3LZFL 4YN3A 1ZWIB 2IOOA 4XMPL 4XN4A 2IBGA 5E8OB 2ROYA 1ZTXE 4IRSC 1RK0B 3QO1B 3IJ7A 4RSVA 5LXGH 4XNZB 1EXGA 4ZMZA 3CFTA 3FSWA 3BOVA 4KO9A 1J5CA 2PWGA 3O81A 1W15A 3D18A 3MRQA 3HR6A 2IOMA 3WNOA 4GQ9H 5EEZA 3RIKA 5HHNA 2D9CA 3AADB 1ERNA 1S3RA 4YDIH 1A7NH 4Z3GA 2DJUA 3QORD 3GIZL 5CFHA 1YUHA 2ARJQ 5EBLA 3B7YA 4QKTA 3DOSB