4PJ6A

Crystal structure of human insulin regulated aminopeptidase with lysine in active site
Total Genus 296
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
296
sequence length
867
structure length
860
Chain Sequence
KLFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human insulin-regulated aminopeptidase with specificity for cyclic peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Leucyl-cystinyl aminopeptidase
total genus 296
structure length 860
sequence length 867
chains with identical sequence B
ec nomenclature ec 3.4.11.3: Cystinyl aminopeptidase.
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF11838 ERAP1_C ERAP1-like C-terminal domain
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.60 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4pj6A02
1.25.50.20 Mainly Alpha Alpha Horseshoe Zincin-like fold Zincin-like fold 4pj6A04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 4pj6A01
2.60.40.1910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pj6A03
5DLLA 4XO5A 3FULA 4NZ8A 3PUUA 4KX9A 3B3BA 3FU6A 4XMUA 4K5LA 3SE6A 4FKKA 3FTSA 3FH5A 4XMXA 3FUNA 4XMTA 4XN1A 5LDSA 4WZ9A 4E36A 4FKHA 4QIRA 3FH8A 4MKTA 4XNBA 2XPZA 4ZX3A 4PU2A 1GW6A 3B2PA 3FTYA 3FU0A 5CU5A 4F5CA 3B37A 1SQMA 4XMVA 4KX8A 3T8VA 3B34A 4KXAA 3FUFA 4FYSA 4XNAA 2ZXGA 3EBHA 4KXDA 4XN9A 3CIAA 3Q43A 4OU3A 3FU3A 4RVBA 4XN8A 4RSYA 4R5VA 5J5EA 4XO3A 3FUJA 4KXCA 4NAQA 4QMEA 5BPPA 4QHPA 5LHDA 4K5OA 4FKEA 3CHSA 3FTXA 3QNFA 5FWQA 3MDJA 4ZW8A 4K5NA 2XPYA 4ZX5A 4FYRA 3B7SA 2GTQA 3Q44A 2DQMA 3RJOA 2YD0A 4R7LA 3FTVA 4KXBA 3FUIA 3EBIA 4Q4IA 4X2UA 4PW4A 1Z5HA 4QUOA 4XMWA 5LG6A 4Q4EA 3FTUA 4JBSA 4HOMA 3KEDA 4L2LA 4XN4A 4XN7A 5C97A 4FGMA 1H19A 3CHPA 4KX7A 1Z1WA 4Z7IA 4K5PA 4ZX6A 4ZW3A 4R5TA 1HS6A 5DYFA 2DQ6A 4ZX4A 3B7TA 4XMZA 4FYTA 4R5XA 3Q7JA 4K5MA 4MS6A 3U9WA 3FH7A 4PVBA 4PJ6A 2HPOA 2R59A 4XN2A 4FYQA 3FUDA 2HPTA 3FUHA 3FTZA 4GAAA 5AB2A 3CHRA 3FUKA 3QJXA 5AENA 3FUMA 4P8QA 3FTWA 3FU5A 4ZW5A 4QPEA 4XO4A 3EBGA 4ZW7A 4ZW6A 2XQ0A 3FUEA 5K1VA 4DPRA 5J6SA 4J3BA 4XN5A 3CHOA 3B7RL 3FHEA 2VJ8A 4ZQTA 3B2XA 4XNDA 3B7UX 5AB0A 3CHQA
chains in the Genus database with same CATH superfamily
3X1BA 4NZ8A 1AHWA 1R5VA 1FNSL 3MYZA 4WJ5A 4XE5B 4EXPX 6FABL 1K4DB 4KJQC 2XN0A 1A7QL 1M71B 5ICXA 1QI3A 3HI6H 1JWUA 3S36L 4XPTL 4LLUA 3QORC 3IKKA 1KDIA 3NPSB 2VERA 4BZ2A 3O4LD 2OXGA 2BVQB 1PG7W 5DHVA 4XH2B 4W9LC 2WZ6A 5GISL 2IANA 2VH5L 3LRLA 4P57B 5EZIL 2NYYC 3WAJA 5JQ6H 5L4IA 1Q72H 4NQDB 1W0VA 5CBEB 4GKZA 4XZ4A 1T7VA 4P2QD 3CIAA 3VD7A 2X9WA 2LE9A 1ZWIA 2FEDC 3N0PB 4G2AA 2E6QA 4WWKB 2VSMB 3LHPH 1WTLA 4UQEA 1PLGL 2Y5QA 5KSVA 3KS0J 1SYSA 4Z0XB 4YVNA 3T1FB 3H9ZA 3U0TB 4ZZFA 2WJ5A 1TPXB 4GAJH 2QL1A 3QCUL 5EDXA 4KAQL 3MSNA 4L8CA 4IS6B 4N5EC 3ARBC 5DJYB 4CW1A 3FBQA 4Q6IA 4OKDA 5C07E 1YEHL 4WY7H 5DURD 5JYMA 1F18A 1ONQB 5E1AA 2IVFC 4MD4B 4JO2L 3B9KA 1AGCA 2WV3A 3NUKA 4UBDC 5EZLA 1FJOA 2R83A 1MELA 5AALA 3ULUL 1BZEA 3LKSA 1ODUA 3FTVA 3GLEA 2C4XA 2VRQA 4YXLL 2H2SC 5F89B 3T6ZA 5D9SB 5BMFH 3SKMA 1YZZA 4X6DF 3ARSA 5ENWA 5H4YA 4C55A 4Y8AA 5LGKA 4KQ4L 2D3LA 1FZOA 2GJJA 1P2CB 2W9LA 3WN5A 1IGFH 2DYSB 2ENQA 2LAGB 2C1PA 3HPJB 4YL4A 2XPGA 3HE7C 3AU0A 2GC7C 5BO1H 1WIUA 2HTKC 1B88A 1QTYT 1B2WH 3ALWA 4LHJB 1GY1A 2FJHA 1IM9D 4ACPA 4PRBA 3W9EA 1TU2A 5L2KD 3Q7JA 1DZ0A 1RSYA 3QSKB 4PJEE 1A3LH 5ERWA 5HYFA 1QBLH 5CO1A 4GKNA 4PR5A 4ZO8A 1OPGH 1I8IA 3AADB 2ZKXA 4GO8A 1QRKA 4WSKA 4ENED 1ZAGA 2Z7ZA 4N0YL 1TQVA 1MPAL 1NC2A 4X0KA 3QJXA 3TO2B 1XGPA 1UA7A 4ABQA 1AGEB 5HGDA 1ZXKA 2L7UA 3FUEA 3KNBA 1O9WA 3GNML 2VMEA 1MI5A 3FCSA 4WW1B 2FIRT 3ZN6A 1MW2A 4BA0A 4NAJA 1JHLL 4M3JA 1LEIB 1HSBA 1LNUB 3WKYA 2PW1A 3GLAA 4U7SA 5ETUA 3VACA 3KCPB 2R7EB 1QW9A 4QGYA 1SN2A 1PYWB 1WWWX 3MS3A 3CK0L 2WBJD 3O45A 2E86A 3TT1H 2Y7SA 1MCPH 2NTSP 4JO3L 4HIIA 4PLOB 4QHNA 3SGDI 4YSTA 2CRZA 1CFSA 5E56A 2QGDA 2DRUA 3M46A 3MODL 2ITCB 4O2EA 4UV4H 1RULH 4KKQA 2I60H 3QB7C 4M61A 3H3PL 4BEIA 3IPBA 2XETA 1ESOA 2Y7QA 2Z31C 2X4PA 3O81A 3QJHB 4PJFA 5DRZA 2V5RA 3ULAB 1KIRA 4HPYH 3V5KA 2D4DA 5HHPB 4LVNC 4UANA 1ASQA 1DBAH 4IU2B 4F3FA 5FSSA 2VAAA 5BS0B 4P2AA 1VFMA 2AK4A 1UM4L 2Y6TE 4LMQE 5ELIA 3IJSA 2BY2A 4XB7A 1RZGA 1A0QH 3S97C 7PCYA 4MNGB 3OMNB 1W15A 1I85C 3A67H 5IB5A 5HHOE 3KLQA 2W65A 3AUWB 4NN7C 4ZPVA 4KKCC 1Q8MA 1XH3A 4G1MB 3FB7B 1DQQB 3PUCA 1HZHL 4NEHB 4OCMC 5IEKA 1BQSA 2WXJA 2MCPH 3WAKA 3BT2H 4M48L 3ULVL 3G6JB 3B2VL 1T6VN 3QQXA 5FECA 1H5BB 3Q0HA 3FONB 1S5HB 3AM8A 2R69L 4U1SB 2IAMB 4HQQL 5I0ZA 3SDCA 2ESVA 4UM9D 3MROB 5KVFH 3FKUS 3PRZA 4UOW1 1YY9C 3TJEL 1FLRH 2GAZB 3C6SB 4ODTH 5EO9A 3CG8A 2RFXB 5C0FB 2JCCA 2WWMC 4QYOB 2OR9L 2X44D 5T3ZE 1FL3B 2JTYA 4JHVA 3ZL4L 2D4FA 1U8PB 3MLYL 4G7QB 1NCNA 3LZQA 3UCQA 1TEYA 1EAOA 3H7LA 5DMGD 2Q9OA 4GRWB 2CKBB 4DOHE 3WY2A 1TFHA 1HE8A 2V33A 3EGXA 2M83A 4YDKL 1MAML 4F33A 3KS0H 2YMXL 4HETA 1MCQA 2CK0H 1SOSA 1CE1H 1IBZA 5I6XB 5FOBA 2XN9A 3ASNB 4FNLH 1SYVB 4D0DA 1XH1A 1PIFA 2ZG2A 3MLTB 4UQAA 2DTSA 2NY2C 3LN5A 2Q5BA 4IMLB 1RHHA 2FH6A 2YAHA 4IGBB 4NQCE 2DLGA 1U95B 2FWUA 3WXVH 1R17A 4IOIA 5T5FL 1CTOA 4UINH 4OLWL 1OQXA 2HUEA 2F53B 1B0GA 1EBPA 1OP3K 1E8ZA 3C08L 3FMGH 4K15A 4WSGA 4GRLB 4LARL 2RTTA 1TTUA 5GZNA 1AGFA 1WGVA 2EADA 2W9DL 3QUZA 1DQLH 2EE2A 4HWBL 4F7TB 3IFOB 3IDNA 3OC8A 2BWDA 3U82B 4AE1A 4QIRA 4O02A 1RP8A 1I1RA 3WO4B 1WGOA 1N26A 2ZZUT 3QEQE 4X6DB 3C5SA 3EJYD 4OF6A 4Y4HC 3LQAL 4MAYC 1IEHA 1QZ1A 4K3GA 4H88L 5A43C 4PWFA 1FYTB 4PTUB 1HNFA 2F54A 4CJ1A 1JYNA 1N7ML 2JK5B 4KXDA 1D7CA 3DSNA 4G8EA 3CXHJ 1DQMH 3KDPB 4KGJA 3UGEA 4J3OH 5E6SB 1I3RA 1YEWA 5J5EA 4YHIA 3HG5A 5JW3L 5F72S 4BH7A 3DK0A 1A9BB 1INQB 2ATKB 5HDQH 1LK2A 3D2UA 3K2UH 2D0GA 1DVSA 1VSCA 4G6MH 4L4TA 4FCHA 4P23A 3VRJA 4NQSA 5HYJA 3JTBA 2WXNA 4EDXB 2PKDA 4ZW8A 4IHBA 5LKNA 3MLUL 2CBQA 3PP3H 3ATAA 1EEQA 3PNRB 1U42A 2CQVA 3QIWB 4FFVC 3BD5A 4FLSA 4KRLB 2CHNA 3NCBB 4UYQA 1OLLA 1GKOA 1D9KD 1L5GA 3EOYG 4W9DC 5GJTH 5C0AA 1T20B 4NZUH 1XF5A 1HVXA 1XZWA 2AEWA 4TULH 4ACTA 3DGGB 4U4BA 2E0PA 4PLJD 4ZUUA 4AW7A 1YDPA 3APMA 1UWFA 4JFFD 4U6YB 3RNKB 3JWNE 4PVNA 4TVPH 4NP9A 4XNUH 1EHAA 2WB7A 5DTFA 3CBKB 2A0LC 3QUXC 4S1QH 2Q0ZX 2QJDA 2VQ1A 1NCBH 4QHKJ 3I6LE 1AE6L 1A4BA 3H54A 4JRXA 4NO0A 3S3SA 5BVJB 2VLKD 1L9SA 3RHWK 5DI8B 4FHKA 4IJ3B 2YUZA 4HJIA 2I69A 1SXNA 5A6LA 3V5DA 4GG6A 2F58H 4R8WH 5E08H 1S9XB 3U36B 4OZGB 1JYVA 4Y9FA 1JCKA 4X5RA 2DQGL 4NPYA 5A2JH 2ZXDA 3BVDB 1Z32X 3D0LA 4TNFA 3X12A 4H7VA 2AKRB 3Q8CA 2LVCA 1G9NH 4EDWL 4Q2ZB 1PE7A 1N5AA 4MDJB 2DJMA 3MOAL 4NERA 2DQIH 1DVZA 1TENA 4XPAH 3TO4D 2NUPB 1WHPA 3VE0B 4HIEA 2VABA 3B3IB 1S5IH 2LLNA 2AS5M 4MGXA 1BA9A 2HFEA 1YNKH 3D39E 5J6GB 4JO4H 2Y5EA 1FFTB 5F1IB 3N43F 3QYNA 4G7YL 1OTTC 4NO3B 2H8PA 5I1LA 1DBKL 1SEBB 1PJWA 5H2BA 3MRIB 3Q2NA 4DGIL 3C8KB 3HNTH 4M7LH 2Y36H 1FO0B 1BVKA 1TR7A 5I8KL 4XCFH 1HH9A 5DWUL 3MUGA 3SGDH 4OQTH 5BQ7A 3VI3B 2Y7OA 2H32A 1HIMH 5KYYB 2XFXA 3EJZC 4AZ8B 4Z0BL 1JFQH 1ZEAH 3GMLB 1OD7A 4KJWD 5IROA 3ZDXB 3TZVA 3P7VE 2WLLB 2AHIA 3OF6A 1WF5A 3UTTB 4M00A 4K73A 3F7QA 4NNYA 3OKYA 4P2YA 2HLAB 4ZAKA 2XV3A 3LKQB 4FA7B 3Q6FB 2MH4A 4ANKA 4HJ0C 3BIKB 1A2YA 5D2LF 4AQ8A 2WJ7A 3RZCC 1BIIB 2QQQA 4HGWB 3RWEB 4ELKB 4QYAA 4AG4H 2VMFA 4CVUA 3WEBA 4AIOA 1LYQA 4GQ9H 5KZCD 4TUKL 1D6EB 4IBTA 3TFBA 3OZKA 2YAQA 1AIZA 2CRMA 5B8CC 3TF4A 3KH3A 5E6UB 1C08B 4PJDF 4HZAA 4ISVA 25C8L 1HWWA 2IDQA 5SWSE 3TCLB 4MA8H 5ANHA 5IQ7L 4AQ8C 1E5CA 1F90L 3OGOE 2YRBA 5F9DC 2CR3A 1MNNA 1JXFA 3TN0A 5HVFB 1J8HD 1KYDA 1EBAA 1UWYA 4UT7L 1JYXA 2EO7A 5DJ0B 1NJ9A 5CJ5A 3EOAB 4A7GA 4FNSA 4QRPA 3PWJA 4LSQH 1M2VA 2ESVD 4M4PA 5K59F 5IG7B 3L4CA 1JGIA 4HKJB 5GQBA 2CA4A 1ES0B 1RK0A 4JK0D 2YAMA 2X87A 1EH9A 2NY3D 4U0QB 3P0YL 4AQ1A 5BO0D 4Q6IB 3QJOA 2W80C 3F6IA 4PJHA 1BEYL 2J8OA 4R97C 3FTZA 1N2RA 4IHQA 3EYOA 2ZXQA 3JV6B 4YLQT 4OD3H 3OKKB 4K94H 2BY3A 4DCQA 3ZHFA 3BE1H 3K6NA 1IM3B 3MXWL 5DQ9B 4MCNA 2B7DT 3MGOA 5T1JA 5HHOA 4Q97A 5F89A 4ZG1A 2VJ8A 4Q9QL 2FEEL 3BVNA 4X6CE 1HHHA 5SWZE 3OBAA 1A14L 1IKOP 1E27A 1CFNB 2HFTA 1Q9KB 1U6AH 4C59B 1DDHB 3T2HE 2FJFB 1VGEH 3HC4L 3M07A 3BWUC 1HINL 5T8IA 3LHPL 3VMNA 4Z3JA 2DAVA 3NRFA 4YFDB 5GS1C 2DMBA 2NY6C 1IFGA 1QFUL 4PRBB 2EH7L 4XNBA 4UAHA 3PWVB 5D8JL 1OGTA 3DBKA 1LP9B 2GB2A 2GJRA 3L3OB 4PPTA 4S1DC 3PL6B 5AW5B 3OMZA 1KUMA 4I48B 2IWGA 12E8L 3Q2WA 4KXZH 2G75A 3TO2A 2CJUH 3ME0B 2IQ9H 2HT4C 4YHZL 1UOVA 3ZVVA 5I5MA 4OLXH 3Q06A 4D0CB 4ZMLA 1ZT1B 1YEEL 3DX2A 1IQWL 1OV8A 3HC0B 2GUOB 2YUVA 5FYLL 1L0PA 5BMFL 2F54E 3P7QE 2F15A 1RURH 1GOGA 1TO5A 1UHVA 4GUPB 1Q0XH 3HZKA 3CU7A 5AKRA 5EN2B 1NGQH 5T3XL 5EFIB 4A1RA 4D0BA 3S4SA 2OMZB 1IBYA 4KHXL 4Y9GA 4AGLA 3TJPA 2BHUA 3BSGA 4P49A 2YEVB 5D2NB 3QUKA 3C5ZB 2FNWA 4QHNB 4QTFA 2X4UA 4KFZC 4MXQD 4P4KA 1AFVH 2CBPA 5FPIA 1GS6X 2OZ4L 3I02B 3DPBB 1LDPH 1CICB 5DFWH 1MHEA 3VQMA 1JHKH 4KVNH 3FO0L 3MLZH 4TUOB 2JKSA 4U33A 4BKTC 1WUZA 4S1SL 1YNTB 4RFNC 1U8QB 4G42B 3AG4B 3EDDA 4Q58C 3BQUC 3HS0B 3N04A 3S5YA 5C71A 1KEGH 4IU2A 4X9HA 2R1YB 4ZQKA 1L9PA 2F53E 2AK4B 1FAIH 1GS7A 4AQEB 3IJSB 3GEWB 3FVPA 5CJXC 1RH8A 1AD9A 1QG3A 1N6VA 4MVBD 3R1GL 3I3BA 2CCWA 4PJ5D 5CJOL 5HGBB 4DH2A 4XC1L 3O9WA 1QLEH 4Z8FH 1E3ZA 5FM5O 1KCKA 2LAAA 1AZRA 2CKBL 4Z7NE 5DEZA 2GKIA 3QUYD 4PJ8C 4M93C 3FUMA 1ZLSH 4GJTB 5ID1A 2G4GA 4GAFB 4DGYL 5CFAA 4QHUA 5IEKB 1DBBH 1GAFL 1NDGA 5KSAB 4WHYH 5D1ZA 5L9DH 2AQQA 3LNGA 1DTUA 4G3YH 3JT0A 1C5DA 1KPUB 5D2LB 4GQPH 5A2KH 1HQRA 4YHKH 3QRBA 3MBEC 1GVIA 4FQXA 5LBSL 4HJGB 1A1OA 3VFNB 4QRSA 1T6WA 1JPEA 4QRRB 3LNFA 2RFXA 4NBZB 4RX4D 1NMAL 2FJGB 1E2WA 4HUXB 3MV7D 3HKZA 1FL3A 4XMXA 4NP4H 3TBVA 4AYBA 1XSKA 2EUZA 3TGXA 3ZZQA 1IVTA 3B7YA 2GSGB 1HDMB 3CXFA 3SE4A 1QPXA 2XTSA 4GG8A 4HWBA 2WMPA 5FYJL 2SODB 2EDQA 4E41D 2PYEA 5BW7A 3ESNA 1LO0H 2QVIA 3GI9L 3LOWA 4HBCH 1CO1A 1F3DH 2HG0A 2YD4A 1UT9A 1UC6A 2YD8A 4JJOA 1C12A 3QUZC 4MNHB 4ABWA 2ZOTA 2KI6A 1NGPL 3M45A 3P3SA 4RFEB 3BKMH 5JW3H 1F1DA 4KJWC 1U95A 3JTTA 3ZHKA 4IOIB 1DR9A 4NHUB 4M43H 1JGDB 1KBWA 4RSVA 1B0GB 3I2CL 4RNRB 1S7XB 2WQVA 3CUPA 1E5BA 1T4KB 4N0FA 5L4MA 1R3HA 1TNNA 4GKLA 3MFGB 5EIIG 1AGFB 1Z7JA 4F7TA 2IBGA 3OMAB 2WI0A 3KHOA 5DFVC 4OVUA 4O02B 3GHBL 5CIPA 4LNRB 4L4TD 4P23D 1KENH 4R7VA 5HYJD 3HJEA 3GS7A 5CKAA 3Q1SH 4LHUA 3BAEH 1MFAH 1FJ3A 2H0PA 5B4MD 2BJMH 3DSNB 3N21A 4G8EB 4ETYA 1BF2A 2EDHA 8PAZA 4MZNE 2AJYL 3NQIA 5JQ6L 4JFHE 1DQJA 4L4JA 3B7TA 2ZJSH 3F62A 1U93A 4CVZB 5D7HA 3CSYB 1ZHKB 6TLIA 3G6JE 2V0AA 4WI5A 3E9TA 1V7NH 2H0JA 4NQSB 2JNZA 2YPLD 3V4PB 1TCRA 1UZ6E 3WIAA 2XZCH 3VG0H 2BK8A 2OAAA 1JRHI 1XCTB 4UIMB 3W2DH 2HT2D 3VXMB 1JPGA 1OAZH 4KAQH 3ML8A 4PRHE 5E51A 4WEBL 4Y2DB 3OHMB 4NCC1 1XF5B 3WFCL 4YXHH 4BSVA 5HJBA 2VL4A 3SSBA 3B7RL 1AXSA 4F9LA 2C34A 3UP6A 2C1OB 2FH8A 1YN7B 1MCWM 2A6DB 1BQLL 3SPJA 2WQAA 5A3YA 5C0CB 3BP6B 4K7PH 5F88A 3CZFA 3T0EE 1B4LA 4LLMB 4UQIM 3F8UB 1NOFA 3QDMB 2C9PA 2FO8A 5D7JD 5AUMA 4Y4HD 3D2TA 2F7IA 3BH8B 3OLDA 1YPZB 5IVOA 3MRMB 1YNTF 4G8GE 5KSBB 4G6ML 5FM8A 1I9JL 1ERNA 1P84K 1NDMB 4K55A 1WYJA 4RDQG 1GOHA 4UTBA 2QR0B 2DLIA 3HMXA 3D3VB 3UH8A 2HRPH 1IAIH 3DURB 2WQ8A 4YHMH 2R8SL 2IAND 3FQ1A 4TL4A 1ZEAL 2AV7A 3L3IB 2OJZL 2VYRE 4JDEB 4HC1A 3X12B 2OK0H 4ODHL 5DJDA 3FQUB 4W9FC 4X8GA 1TOXA 4OZIB 3RX7A 1NPNA 4I3RL 4YXKL 3WBDA 4K9EH 2J72A 1MJ8H 5JXNE 4Y19A 5EUKB 1SHWA 4F57L 5J06A 4K5OA 3NJLA 2UXGA 2OJEA 2HFEB 1AQMA 5C3LD 2XCMC 1E9QA 4EE2A 4H8QA 4LDCA 3GZKA 5IMOA 1SXBA 2DQFA 5FSJA 3RUGE 1OHQA 5E9AA 2H47C 3ULVC 4LQ1A 5E03A 1FO0A 3BVTA 1HH9B 1I7TB 4DEWA 1L6ZA 4P2RA 2FR4A 5EU5B 4XCYA 5I6OA 3M17B 1G9NL 5MP6H 1OAUH 1BZ7A 3F7VA 5I66A 1AQDB 3X13A 3NK4A 1RFDL 4H2AA 1GKEA 4LMQI 5G5DA 4DGVL 2HJFB 3WJLA 4XP5L 4XAWL 5DEFB 1J8HE 4DO4A 1XEDA 4L8BB 5TJWK 3IDMA 4HJJH 1VEOA 2J1YA 1MJUH 4KKLC 2CG9X 3QNYA 3VRLE 4EUPB 1D6EA 5EZJA 3HC2A 2K4WA 1O6VA 3JT2A 4A2DA 3P77A 1DJGA 2A4CA 1UD5A 2MMXA 5BO1L 1EMTL 5F7AA 3KL5A 2ZP0T 3TVMD 1T7XA 4LOFA 1G7LA 1RUKH 1JVOA 1UZ6F 3OLEA 1ND0A 1U6AL 4ZTOH 1JZ4A 2CNYA 2K45A 3RX5A 3BKCH 1ZV9A 4KDWA 4U05A 5I1GH 5IROD 3NDYE 4R6UA 4WENB 1FO0H 1F4YH 2WN2A 5DJ0A 2J73A 1A66A 2PNDA 1YNLL 2ZOLA 3UTZB 4BFNA 4B53A 4JFEA 4YHNA 2V2TA 4I0PA 5B1JC 4JPSA 1ES0A 1RK0B 3L5XL 2X05A 1F45A 2JELL 3S3PA 4WI4A 2WUCL 4QOKD 1KIPA 1MREH 1JNJA 2FIKB 3H55A 1IZKA 3O0RH 3HIZA 3M88A 4PJHB 4L23A 1XGTB 2BHFA 2DIAA 3NFSL 1MFEH 3EYSL 5E2UL 5EZOL 3OKKA 2XG4B 1OM3H 3UJIL 2BNUA 3AREB 4PV9B 1X7QA 5T33L 2VLMD 3VDCA 4OU3A 1VZGA 1KPRA 4ZPTB 3B6SB 4XO3A 2R27A 5EEYA 1INEL 3VD2A 1JV2B 1OKEA 4HHWA 3TWYA 3ZE2B 3BWUF 1FIGH 5EU7C 1XH2A 2Z91A 5L7XH 2OMTA 3R8BB 2FYYA 4MYWB 4Z76B 5SWQB 1WT5C 3GSOB 4MWFB 5CSZA 5CSBA 5C07A 4U3HA 1VDGA 3BPLC 4M7JH 3RVTC 3C9NA 5DFVD 4CRPA 3NZHH 4MJHA 2A9MH 1JZFA 4OR1A 1QSFB 3PWVA 2RHEA 4KK5C 4NKQB 2YD0A 2WAHA 2FAUA 3VI4E 2P8PA 1DBAL 3QYMA 4Y5YC 4YX2H 5J4MA 3EF7A 4JG0L 5TPWL 1E4WL 2G75B 4ARFA 3LS5L 4EI5B 4B9CA 4LGPB 2VKWA 2BNQB 3N41F 4RISH 4BRJA 3K71A 4DPAX 5J11C 1EGJL 3MI6A 4WI8A 5IOPB 1YPZF 4P3DB 4ZAKD 4PJGA 1OF2A 3VVVA 2GK0B 4NI3A 4KDTA 1HS6A 5GS1B 2BVPA 4MQXC 1N9PA 1DBJH 3RURA 1Q0YL 4LPTA 4XOEA 5ADOH 2MCPL 4PJAE 3OL2A 3S4SB 3U79A 4UTAL 4FLQA 1JHTA 2X5PA 1QKZL 1X9UA 1E6JH 1SM3L 2KERA 3O4LE 5A16A 1VZIA 2BIHA 2I24N 4KO5A 1FGVL 4DGYH 4PLKC 1BYOA 1FH5H 3JWNC 2J56A 2BINA 1OE3A 4HF5L 3SCMC 5IHUH 4M65A 4NRZA 1EO7A 1YY8B 3GSUA 4TUOA 2FJSA 4CA4A 5C0EB 1FL6A 1Q90A 3HNSL 3CHQA 3OSKA 4KVCL 3ZHLA 4PRAB 1BXAA 4TULL 3PV6A 1XIWD 1DUYA 2QQLH 4PV8A 5I19H 3OM3B 4XMUA 4NC1C 3ZUCA 1A6AB 3VFGH 4AQZA 4ZQKB 1LQBC 4P5MA 3IDGA 4FQPA 4RZCA 2YWYA 5SWSB 5DFAA 4MHHG 4RAUB 3DX1A 1R3JB 1ZANH 1IX2A 3CZKA 1T0NA 3ENEA 3JWNH 3QULA 4NC0B 4Z7VB 2FJUB 2GYSA 1AS7A 4A2MA 3UZEC 3NEXA 1VFOA 3QUHA 4JM4H 3VFWB 3N40P 1AFVL 1F86A 4Y1AD 3MRDB 4QHKI 3FQTA 3KVDD 4Y1SA 5HDBE 3C08H 4KO9A 1GYCA 4NPJA 2WVVB 1B90A 4JKLA 5D1ZB 4NUQA 3H9SA 5AW6B 4E9SA 3TEYA 1X6NA 4AM0Q 4R3SB 3I74A 4AIEA 4RVBA 1ZGLM 4JFUA 4XCNB 1GZHC 2ZAGA 5IT2L 4ZTPH 4V33A 5AVQB 4N4EE 4QMEA 4GYBA 2EYTA 5ICYB 1QO3A 1SMOA 5E4EB 5TTRA 4HJGA 3SKOA 4QRRA 2YQGA 2QELA 2OMBA 4R96B 1LE5A 1CE6A 1UUNA 2MSPA 1ZLUH 1W0WA 3FV4A 2HJLB 2VTFA 4UIKL 5AYQA 2Z35B 2GITA 1Q9OA 3SCMD 1A22B 1UWGL 3O9WD 2HX7A 4ADGA 4AGOA 3IGKA 1YMME 1BAGA 4HS6B 4M8QB 1SJHA 3VXME 1D5IL 5J1TC 1SPDA 4NRXB 1LO3L 3ASWA 3CJJA 3OAUH 4I18A 4PJDA 5AL8A 3FU8A 3NSFA 3QQ9D 5D96B 1AO7D 5F0MB 5DZOA 1KB5H 3F5WA 3LNIA 4PJGE 3JTSA 1KNOB 1TZHB 1WA0X 3L54A 4TRPH 4X0NA 4AYEC 2AJ3A 1IAKA 3AMLA 5DF0A 1KWGA 1JGDA 4RNRA 1TDQA 2WYZA 1KBBA 2NXZB 2WLKA 2X4TB 2IFGA 1H0DA 3BD4A 1P7KA 4XN2A 3S48A 2NXZC 1EAPA 5FYKH 1WD8A 1PU0A 4IRSB 4OF5A 2WTRA 3Q8FA 2E76C 4GI6A 1U8LA 3JWOH 2QADC 1S78C 2ITDB 3AXIA 3IGUA 5CZVH 3NT0A 4YBQD 4NN5C 1TKWA 1V27A 3QXUA 5GGRB 4D94A 3T09A 4Z7WA 2WC7A 2E3VA 4H20H 1IQDA 1CK0H 2NNAB 3R4RA 3BO8A 7CGTA 2P8MA 4MA7H 1DL7L 2H0EA 3SOTA 4D9RE 3S7GA 5IR1B 1ZRUA 1U8IB 3D4ZA 3KDMB 4TUUA 2EKJA 5GGTA 2P80D 2XX0A 1OGAE 3HI6L 3S36H 1S7TB 2OS7A 4RFOH 5DZAA 2EO1A 4YO0A 1TJHL 4R97B 3HB3B 3MRLA 2L04A 5JHDD 3O6KH 3ZQ9A 3VXNB 3MJ9H 3QWOB 3VU1A 2H2PC 3OGCA 1LEGA 4P5RA 4W4NA 1ACCA 3LB6D 3GLZA 5TF0A 1AXTH 3FAXA 1JPGB 2BC4A 2WUBH 3CDFA 4DJMA 2PWHA 1RUPH 1MVUA 2EXWC 5KG9B 3UBGA 1FP5A 3VXRE 2FX9L 5B38G 1YECL 3PCYA 3ZR5A 5DO2D 3ERXA 1FSKC 2LGNA 1YN7A 3BE1L 4UDUA 3I9GH 1TEFA 1G7QB 1K4DA 2PR4H 3IRCA 4R26H 3FSAA 4DQOL 5AD0B 2I9LA 3MNZB 2CHZA 5AKVA 5SX5K 3BH8A 3GXTA 2C3GA 5DK3A 4G82A 4PS4L 3EH3B 1VGEL 3HC4H 4G70B 5ALCH 1CFTA 3QA3B 5IVNA 3MLVL 3E6HA 2D7NA 5C0IB 3VG0L 2UYLB 2FQGA 2DWSA 4KTDL 3MRGA 1JUFB 2P5WD 4NQDA 1O9ZA 3T0AA 2BSRA 2AV7B 3L3IA 1UURA 3GXNA 3OAYH 4L9DA 5DJDB 4JN2B 1EUUA 5AVYB 1FNGB 2E59A 2OMUA 2UZXB 2FO4A 4DUVA 2DYPA 1OAYH 5AOMA 1QNZH 3IE9A 1LNDE 5JS3E 1H6UA 5DWUH 4AV5A 1ZLVK 4Y19B 5EUKA 2E6PA 3DRTB 4PS3A 1NCIA 2Z93A 1QBLL 4ZNEE 3GKWL 5CGMA 4ZMZA 2D2CC 2VDOL 2BS8A 1NBVL 3KPSE 1A6VL 4I9XA 4MD4A 4AYID 4DO5A 1OT2A 3FTWA 4NQVA 4WFED 5EZLB 3GBMH 3EBGA 4TV3A 2YA2A 5DD5H 4PJEB 1GW0A 3I3DA 4ZOEA 1K5NA 1ASPA 4J6RH 2XWTB 5CEZH 4FTVA 1ETB1 3RFZB 4WWPA 1PE5A 1I7TA 1MCOL 4TSAH 3RVVC 2NX5A 3ARYA 4TUKH 5KJ7E 1FZOB 1ORSA 2OK0L 2MHAB 3RUGA 4KO7A 1P2CA 1AKJD 1M6OB 3C5XA 4UAOC 1AI1L 1ASOA 1W6LA 3L2MA 4MDRA 5H37H 4P5TA 3F7VB 4P4RA 2EVGA 4HCRL 5I66B 3R18A 2NY7L 3J7HA 4NXKA 3O8XD 2XXGA 4FJYA 1CXKA 4K7PX 4N68A 3S35X 1NKRA 2DJSA 5I82A 5ACZA 1NZRA 3D25B 1F90H 3IU3B 3KR3L 5DEFA 2JELH 4ELDA 2GG1A 2F5BH 4H8WC 5GRXG 1U8CB 4P2OA 1I8IB 4DFIA 2FX8H 3WJMA 3CDYA 4L8DB 1QQDA 2O93L 4X0KB 4RBPK 5EZJB 1OM3L 4C8XA 5L2JA 1J87A 1AGEA 1YA5A 2YGVA 3PAYA 3TO4C 3UBXB 1I1AD 3MLPA 4LBEA 2ITEA 2AJVL 1NMBL 1INEH 2V5MA 4YGAB 1GGYA 1NANI 2CKBH 5AG9A 1HT6A 1DQDL 1LNUA 2JLLA 1SVCP 5T3XE 1FI8C 2OA9A 3BWSA 4R4NC 5F6HI 1F8TL 1BCIA 3SE8L 4IK7A 2Y06L 4OSUH 3WNJA 1FZKA 5FYLE 3E2HC 4G6JH 4XVSH 2ZCKH 4Z7UB 5HDOA 4JCLA 3X14B 5A1AA 1MHPH 4HIIB 1JS4A 1RI8A 4Q9QH 2EDRA 4X9IA 5KAQG 5BZZA 2APBA 5CCKL 1R4XA 4IKNA 4IBQA 5FM5M 4M1DH 1MCFA 5GIRB 3EFOA 3ARDC 2FIKA 3UJJL 4CDGC 4G7VH 3T4YB 4LSVH 2P7TB 2VW4A 3NACH 1RURL 4JG0H 4GP4B 3QJHA 5BRZD 4BKLB 3DGCR 2E9WA 2ZYRA 1F1GA 2ZD0A 1DANU 5HHPA 2RQEA 3K0WA 3K91A 2QPDB 3IGAB 2XQYK 5EORL 1JERA 4HBCL 2I9TB 4GO6B 1KROA 1JWMB 3MLYH 2VWEC 2R56H 1PD6A 35C8L 3SQRA 5KBLA 5L41E 3GM8A 2R59A 4MAYB 4LCWB 2O5ZL 4F2EA 2GBUA 1X9QA 2CDGB 2YMTA 4RGND 1WSST 2Y2WA 2F7PA 4EI6A 1PQZB 3QXDB 4JFFA 3B9AA 3LKNA 5DPEE 5TH2B 3TU6A 2BO0A 1FLTX 2XKNB 3HI5H 3L3KA 4U1SA 5EBLA 3QIUD 4XNDA 4PCSA 4RMTA 5KOMC 3QRLA 1LQSR 1IC4H 4M03A 2UVFA 4PRNB 4WVRA 1OAXH 1XSOA 3V4VB 4EO5A 1CURA 3C8HA 2FEJA 3RWCB 3KE0A 3GSVB 2JCCB 5ICUA 4FFZA 3VG9B 4LOVA 3BAKA 4TLSA 1E42A 4ZMWA 2EVFA 3C2AL 3SEPA 5I9QB 4TOYH 3P02A 1H6FA 1F42A 5ACMA 1IJNA 3QDGE 2IGFL 3S37L 4QRTA 4PGBB 5F9OH 2FL5A 1ULVA 1N3NA 3OJDB 3HHSB 3PJNA 1S9VA 5GRVL 5DA4A 1NLDL 4P9MH 2HKAA 5ANMB 4K90A 1JZ2A 2X0WA 2YFOA 1HYTA 4IGBA 3HBPA 4YQXH 4LPVA 1KN2L 5PCYA 3QISA 2W07A 5MERB 2DS4A 3WHE0 2BLFA 3ETBJ 3R8QA 3MJ6A 5C0BA 1AJ7L 2IMMA 3NJMA 1RZJL 1WCBA 1BMGA 5K69A 4GFXA 2HTLD 1EO8H 4ZK8A 4RH4A 1HHJA 2BMKA 4GRLA 4H8UA 2C9QA 5B38B 1BREA 4JQXA 4Y2DC 4PJEF 4BDVA 2X1WL 1DBJL 1GGIH 4WTWA 4ZBJA 4M9PA 5J57B 3DBSA 3MJ7B 1SUHA 1BVNT 1O6SB 5KYUA 3TIEA 3TWCL 2EE3A 3RZCA 5I1HH 3C5SB 1ODAA 3ZYZA 2OMYA 1WEJL 4BZ1A 4R90H 4GSDH 2D2OA 2BCKB 1TCMA 3BN9C 3CDCA 5FGBC 5DHVH 2O61B 2OX5B 2RB8A 5GGSY 3RVXC 4EVNA 4KUZH 1K2DB 4UQ2B 3S6CA 4JM0A 4LEOA 1FNHA 3U9PL 2UY6A 4BH7B 3RGVD 4PG9B 3BCFA 3DMMD 2MQ3A 3RTQC 1P9MA 1A9BA 2X2HA 4XXCC 4EKJA 3QZBA 4A38A 4YIQA 3ZT5A 1RMFH 1WG3A 4NNXA 5CU9A 3QAQA 4R96A 1SVZA 5BRZE 1LE5B 5AB2A 3QIWA 4UU9A 5DJAA 5LGHH 4JDZA 3IBOA 5ITFA 1X5YA 1Z3GL 2Y3AA 4YNYA 1B6UA 5C0AB 4ZS6C 1T04B 1BQ5A 3ISRA 5EH1A 2HJKA 1HH6B 4HS6A 4M8QA 4H57A 3D6GA 4JCMA 5GZOA 4N2IA 4X5PA 1RZ8A 4Y2LA 2OV0A 2Y25A 4Z7UF 3TV3L 3ZI6A 5BZDB 4MQXD 5D1XD 5DTFB 3IMSA 4C4UA 1JPTL 5I1AA 2ATPA 1QUNA 1VENA 3BLPX 3JTSB 1AR1B 1RUML 1IAKB 3EXJA 4J8RB 4XCCH 1P4BL 3KYMA 4JM2B 5FA3A 2DLHA 4GG6B 1L4IA 1V3MA 2H4EA 3EJYC 2VC2L 5FKAA 4IRZA 5DT1H 2GFBB 3KPSA 3ZTEA 3L5WA 4JDTL 2VXQL 3RIFF 2QSCH 1I4FA 3B5TA 3EYUH 1RK7A 1U8LB 3Q43A 2A0LD 5ID0A 3MRQA 4KY1H 2NZ9C 1QFPA 3EOTL 3QEHA 5IW1B 1N5AB 4MDJA 3HOGA 4GIAA 1CR9H 2NUPA 3VE0A 3DX0A 1N59B 4FA8A 3FB0A 3X1NA 3Q01A 5TLIA 3B3IA 2P8MB 1T80A 3VFRB 5FUOL 2XTJD 4AUUA 1U8IA 4JRYB 1LTXA 4LCVA 4CILA 1NANH 3PGDB 3KDMA 3CBRA 1GPOL 1NBQA 4OAWA 5IWLA 4S11A 5L0QB 2H8PB 2HRPL 1XB6A 2AJSH 3A23A 3J07A 2IQ9L 3PJSB 3BKCL 3RDJA 4YUEL 1KACB 4KXBA 1CG9B 4HCRA 2WZAA 4PJXF 3VXNA 1MRFL 1A1NA 1PE8A 4X6BB 3OGCB 3BPLB 4U7KA 3WMSA 3EO1B 1CVSC 5BQ7B 4KRPB 4UT9L 4FA6A 2JCCF 5I23A 4AZ8A 3O6LH 2XWBA 3VSVA 4EOWL 5C97A 5ALBH 5HGHA 2LHAA 2IANE 1OAYL 2XWJA 4OQ1A 1ZHLB 5IMKB 1A7OL 4M93B 1Z0NA 1F0LA 2IDSA 5KWYC 3EIMA 3OQ3B 5LQBL 4YOKA 3WIFA 3OWRA 3LZFH 5I1IL 1G7JB 1JHKL 2PO6C 3FUHA 3CHXA 1NEZG 1A1MB 2VLLA 2A9NL 4M7LT 3UDWA 3P9WB 4JKMA 3RNQB 3B9KD 4IEFA 1B0IA 4W4OA 3HW7A 5D7JB 5F71A 2ICEC 3DYPA 1J5DA 5EU3B 4K07A 1D6VH 5BRQA 3ABGA 5EU6A 4ISVB 5CS7A 5DMKB 3TCLA 2WXRA 4XXDA 2HT3D 4KKZA 4PJ9D 3H0TB 3B9DA 4P9HL 5FGCE 2CPUA 2GY7B 4UTBH 4W9KC 3ZO9A 5AAMA 2P46B 1J05B 2P48B 1NFDF 4JN2A 5IKCB 4DP7X 1IBHA 4JGNA 3FTSA 3DOSA 4NBXB 1M2VB 1JNLL 2R0ZL 4X6CB 5EG6C 1QACA 2CH8A 4HKJA 3ARBD 5KS9B 4FQCL 2VSCA 1EGJH 1UGNA 4G5ZH 2Z93B 4LSTH 5D8JH 1G9MC 4AQ1B 3JBG7 1DFBH 1ZE3H 4FG6D 4ZMOA 4NQDE 4AR1A 1S7UA 1IEAB 1AMYA 1RJYB 2IAMD 5DD3H 2YGOA 3AITA 4B52A 2DH3A 2XTJC 5D1QA 4D7PA 5CUSH 4LL4A 5I1GL 5C09D 3A6CH 4OLXL 2EH8H 4FNRA 3ARDD 4OGYH 5D4JA 5DMGC 5DZNA 3QUMH 3WY1A 3ZDYE 1FO0L 5C2UB 2APVA 3RFZA 1XL6A 2OTWA 4XBMA 5BPPA 5B3JF 2MHAA 3RUGB 3WFZA 1RJZB 2YR3A 5AFAA 5EIIA 4N8VA 1YJDC 1ZSDB 2BXZA 3NZUA 1OGPA 2NTFB 4JFWA 5DHYB 4DUXA 4I2XB 1A6ZB 1MHPL 1TVHA 1U3YA 3R0NA 3CQQA 2W0FB 1NBZA 2GSIB 2NY6B 1IIKA 4NGHL 3D25A 5IVXA 5JIIA 4MA3B 4MCYB 1OGTB 4PW9A 2D0FA 3AMKA 3GB7A 5A2AA 1QA9A 2CLVA 2AJZA 3L3OA 1QASA 3MBXL 4LP8A 4XWOD 3S8GB 4JZNB 3NJXA 1RZPA 6TMNE 3U7YH 3BKJL 3GDBA 5E9NA 1TTCA 2V9QA 1KFGA 1P84J 4JR9H 4PCTA 2WPGA 3UBXA 1I1FB 1WDAA 3FN0H 3TNMA 4L9LB 2A9DA 5EORH 4JM2F 2J57A 1K8IA 2UWEB 4R7XA 4F9PA 7TAAA 4Y5XC 1ETA1 3NFSH 4UOQA 2GCYA 4GUPA 3ZTCC 3EJCA 1SDAB 1XX9C 4MCZB 3PS6A 2HFGH 2XIIA 4KI5E 3IU4H 1FZKB 5KBKA 2QGEA 2QPEB 2CHXA 2YPVL 4Z7UA 1WV7T 3F28A 2BZ7A 5LIFE 2D03H 4UBDD 5TMNE 3U2JA 2PXYD 4PBDA 1CICA 4FZEH 2Y5TB 2BJML 1N8ZB 2ZE0A 2MPVA 2AXGA 5GIRA 4G7SB 4N5PE 4ZMNA 2EIMB 2P7TA 3KPPB 4OIIL 4ODUB 2G2NA 1L9OA 2VLJD 3FF8A 3OHXA 3P11L 4PRIB 1XBRA 2V2WA 2EXYC 3L1FA 1NGXB 2AF2A 1X6LA 4Q9BA 4M5YH 5E9DD 4DERA 5I6NA 3HS0A 4L5FL 1NFAA 3D39A 1NOLA 2R1YA 5GZOD 1EHLL 1MEXH 3F58L 1YMHA 2H6UA 1JWMA 2VDMH 4LGSB 4ODSH 1R0AH 3OAUL 1UD4A 5CGYD 4A67A 3FH8A 2G0KA 1OAZL 1ILUA 4LVNB 5FW7A 5KAQF 5A2CA 4KH2A 1MRCH 4L3CB 1HHKB 5HGBA 2HVBA 4WK4B 2NSXA 2JQZA 3ARPA 5IWLC 1S7VB 2LU5A 1A8ZA 2A6JA 2I25N 4XMKH 3DDGA 1GL4B 3S2AA 5I0XA 2CRYA 4K7PL 1MHCA 4ALAC 4DP0X 2NZ1A 4HV8A 3WI9A 1NM4A 1TTBA 3A3YB 3D05A 2W8CA 4UV7H 3TP4A 2ZOKB 2VB5A 3FQYA 1NL0H 3BYTA 3NABL 5GS2H 5IQLA 3HR5B 3LRGA 5FFLA 3VI4B 5TQ2L 3BSZH 1K4CA 2GJZA 1AH1A 1VLXA 2LTQB 3FCUB 32C2A 2DQEL 2WINA 2W60A 3CPUA 3DTXB 1TETL 3RWCA 4NUJA 3WHE1 2XPYA 1EFXB 3VXTB 1GGIL 2LR4A 4EN3D 3QI9A 4MXQC 4NQED 3TBVB 4IGBC 4LLWB 4KK9D 5F2FA 1YQVL 2XA8H 5LWYL 4OCSH 2ERJC 4OCYL 1HDMA 2YPKA 3NDZE 4FFWD 3QFJB 4AUJA 2E46A 5GXBB 1VACB 2PYEB 2X70B 4QRTB 3V2AR 2XA3A 3NCEB 3LIZL 2R2HB 3OJDA 4Q4EA 1NFDB 1S9VB 1ZV5A 2G3NA 1A4JA 1YEDA 3K5SA 3PPSA 4CNIB 4HALA 3T73A 1MUJA 2AV1A 3M86A 3BQUA 4BZ1L 3AXHA 2R4SH 1PZAA 7FABL 1AQHA 2BW4A 1DBMH 5F96H 4U6VH 5C0BB 1MIEH 3UERA 1KS7A 2BDNH 1P7QB 1JGUH 2BMKB 4FI7A 1SJEA 4OIAA 4IRJA 4YPJA 1DEEA 3IDYB 2DB8A 3QJTB 5AW1B 2CIKB 2IADA 2O4EA 3WJLC 4TYUA 5IHLB 4RLDA 1CYGA 3MJ7A 5D7LB 4WHYG 4BA8A 2RALA 4WEBH 2IH3B 3KYKH 4TRPL 4HYTB 1LNCE 1MH5A 5JHAA 4XHJD 4GBXA 2ADGA 4B41A 2OX5A 2EXYD 2QV4A 4JFQA 4M5ZH 4BHUA 4B9KC 4GUCA 1SHMA 1FZMA 1KN2H 3CFKA 3X3FL 3DETD 4PIRF 1DQJB 1OSPL 5DO2C 4QNPF 5GS0D 3X3GL 3WFEH 2Z8SA 1U93B 3O6FA 1RUAL 1ZHKA 1KCBA 2ZOUA 4GXVL 4U7MA 4UOW0 2DQJL 1GW6A 3DX6A 4QWWC 3V0WL 5CZVL 4NNXB 1FVCA 1UFUA 1K3ZA 4L1BA 1QNZL 4FXLA 1ED3B 2B2XL 1Q9LA 1NIAA 4XPGL 2J7LA 2EUVA 1BZOA 4YNYB 3NA9H 4X4ME 3BISA 3DROA 4F91B 2V2XB 5L8LB 5ECGA 4BSVB 2G0LA 1HOCA 3B1TA 3UPRA 4J27A 1A21A 4AEFA 4L1TA 4N2LA 3L4UA 4AZUA 4CVXA 1U33A 4EQ3A 3LSOA 5DD5L 3GSQB 4YN3A 3O6KL 3L5XH 1RSFA 3NCJL 3PWPD 3WTWA 3TA3D 2QT6A 1A8JH 2FQFA 1E8WA 1RZFH 5B22A 3VJ6B 3MJGX 2HKHH 2OXGB 5LUMA 3MRMA 2RACA 1DL7H 3WNPA 1NCTA 2XZAH 3M1BB 2YGNA 2UWEE 4NLHA 5LGHL 1WK0A 2QR0A 4KK5D 3L5WB 2AEQH 3RJDA 1BZDA 3BZEA 4BIKA 1LO2H 2Q2EB 4FL4C 1Z66A 2FX8L 3QRGH 2J4WL 4WWKA 4XCEA 2EACA 2O5XL 4DW2H 2Q86B 3QEHB 3X1GA 1U3HA 4OZIA 2BHZA 4WU7B 2UX7A 3L9RB 3UC0L 2A9ML 2WLJA 2XN2A 4XAWH 4BZYA 2Z6FA 4F20A 4L8CB 4JRYA 5D1QD 3QXTA 5F7WC 5KOVC 2EDNA 1XL4A 5I0DA 4AJYV 3DYOA 5IHWA 2ICWA 3LXUX 4G80A 1BXVA 5L6YL 1J8HB 1WJ3A 3LKSB 5LB1A 4PCYA 2C3WA 1A1NB 4GOSA 3N40F 4OCWH 1G4MA 1S6NA 4X6BA 2EINB 3LVTA 5ESQB 4BXVA 4DQOH 1KEIA 1Q72L 4P2RB 3RZWA 4LEBA 3WDIA 4L3EE 2Y72A 1T0OA 4XVTH 2Q7YA 4PS4H 3NVQA 4WJG3 1SOKA 4UTAH 3LZLA 1WC7A 2WAQA 3BPCB 2WLZA 1SBSH 2E7LC 2RH0A 2J1XA 4D9WA 2YZ1A 4IQHA 4B5ZA 1O7SA 1TU2B 2BRQA 2VN3A 1HCVA 5ERWB 1OCWL 2JIXB 2XPZA 5IJBC 3K8LA 1DVYA 3ALPA 4P2QA 2ZX6A 3IDMB 3ZHDA 2BSTB 2X3AA 2YHGA 1NC2B 1IGIL 2VN5A 3F64A 3P40A 5E00A 4OV6F 4GT0A 3BAYA 4ZMVA 1TZOA 1Q94B 3IJ9A 5CAYB 3ARZA 1XMWA 3DOIA 3I6LD 1Z5YD 4LSPL 2E7BA 3C6LD 4YEEA 1YCSA 3NQXA 4M7KL 1SUJA 4N9OB 1SXSA 5EU6B 2HAZA 2P43B 3RA7L 4QXTB 1W8NA 4S0SD 1G7LB 4KKAD 3LEYL 4KFMA 3S4SG 1IKNC 3V6OC 1ND0B 1JI2A 2F1AA 5IB2A 4YAQA 1T66D 2E4FA 3RAJH 1J9SA 3O45B 3VWKB 4DO6A 4AIXA 2BSSA 2NY0C 4QF1A 1QLRA 4LT7A 5FV2A 2XBZA 5F1SA 4RMQA 4EBQL 2VDPL 5IJVB 4YHNB 1TZGL 1B0RA 4I0PB 1J8KA 3IDJA 5KS9A 3BYYA 4L0PB 3ARTA 2HB0A 4FNQA 5KVGL 4E68A 1IC7L 5IMMB 1Z5HA 4LOEA 3DVGA 3CLFL 4GH7B 4ONOA 3SOBL 3ARVA 3QBTB 3WCYA 4X5WA 3GZPA 4JPVH 3CSGA 1X7QB 3A24A 1SGKA 1H19A 2SEBA 4NC2B 5I5IA 1KPRB 2XV0A 2YLHA 5J12B 5ACLA 2G9KA 3H4FA 3FTGB 3DYMA 5D55A 3IDXL 4JVUA 4MASA 1IMHC 1N0LB 4PJXA 2OTWB 3QIUC 5EEVA 4P9ML 3DHJA 3SY6A 4B0MM 4HJ1A 4WI2A 1OP4A 1QSEA 1RJZA 2OMTB 3KPNA 1PKQE 1T4WA 1MCPL 1WFTA 4ZFZB 2VUKA 2YPVH 4URTB 1QYGH 3LHAA 2W65B 2A74B 4GINA 1UCBH 1TG8A 5IM7B 5C07B 1A6ZA 1P9MC 4K8RC 5CNHA 1ECYA 5AEAA 3OZLA 4Y4HA 5MENE 4HIHB 2YD5A 3WIIH 1EQWA 4F9PC 4KV5F 1J1XL 1WFUA 1KEML 3EBAA 3PFUA 4MCYA 4ZMQA 2XQ0A 3LDBB 5EOCJ 3TEXA 3PJLA 1H5BA 4J3OG 2WBJA 5IHUL 2BP3A 3UAJD 2IDTA 3D2UD 3KPOB 1OGSA 4OIIH 3MBEB 2DWEA 2A77L 2CO7A 2X9ZA 4BH8A 3TA3A 4UQ9A 5KVFE 2HRHA 5CIPH 3MROA 3A6CL 3LN4B 1I1FA 1KTRL 3JWDC 3TNMB 4L9LA 4HMEA 5DJXB 5C92A 4PJGB 1K8IB 2BFVH 2UWEA 2HWZL 5C0FA 4PS7A 4QYOA 1VADA 5AW0B 1MEXL 3NACL 5DMIH 3ET9F 3FXIC 3PAVA 5D1XC 2PMZA 4XN1A 1IKFH 1F4AA 3KLHD 2CKBA 3AS2A 4DETA 1OAKH 3K2KA 4POZD 3EGXB 4TTGA 4FN0A 7TLNA 2DQHH 1AZBA 4KHTL 3HG2A 5F93C 1JZGA 4JN1L 3HG1A 3A0OA 3NIFE 5FOBB 4QRUB 2J2ZA 3QPKA 3LN5B 2VDKL 1YY8A 2O5ZH 1I3GH 4I0PD 3I6KA 3MTXA 1DVUA 1OP5H 2AC0A 1XT5A 4GB9A 4LCIH 4ODUA 2Y7LA 5CD5C 3VD0A 1ITBB 3NABH 1OARL 5DURB 1KCRH 3MLSH 2AAAA 5KVFL 4PRIA 2DD8L 1G9EA 2H0FA 3HLAB 4X4XA 3NIGB 5E6IC 2ZSWA 3RPBA 3PV6B 3CIQA 1K85A 1DUYB 4PV8B 2XXCB 3MQIA 5F1KC 1J1PH 2YD1A 3D08A 3JVGC 1DE4B 4LVOC 2C3HA 5F6IB 3CMGA 3MHZA 5JLZA 1Q1PA 2PCYA 3ZOAA 4XOAA 5IV2B 1KWKA 5JXED 1FNSH 3DKHA 4L3CA 4HEPG 1A6WL 1MQKL 2CE6A 3JZYA 4J12A 4M3HA 3VMPA 5KW9L 1KXTB 1Y18B 5IVZA 4WU5B 1XF3A 2ZUTA 1I1YB 1T0MB 4GEJA 3LMJL 2VZSA 3DLQR 3S34H 3VFWA 2F54B 5AG8A 2CHWA 1P4BH 4OT1L 4XXWA 4PGZA 2HTLC 3CHPA 3LIZA 3LQZB 3IXTA 1DVXA 4HV8B 4P5SA 1I3RB 4UUJB 4ZW3A 3VGAC 4S0HA 1KB5L 4U1NA 4W70A 2NUTB 3ULVD 3OKOB 5IOKA 5I1DA 3GO1L 1T1WB 5JHMA 1QO3B 2QSCL 3EYUL 4PN6A 4CJ0A 1LK2B 3D2UB 4Y2NA 5AAMC 3VXOA 1UA6H 1AOZA 4L4TB 3NK3A 4P23B 3SKOB 4POZC 4ANWA 5HYJB 4P59H 32C2B 1DQLL 4FFZL 4EI0A 1JPFB 3ZL2A 4Z7NB 5GS0C 3EG9A 5KVGE 3QI9B 1XR9B 3IDUA 2AEPL 4J3VA 4NSKB 4PLKD 2HJLA 2AVGA 1RZIB 3UBXI 1BMWA 4YSCA 2FZ3B 3RJQB 3BFWA 3WD5L 3VXSA 1RZJH 3MV9D 4ZW7A 3T6WA 3NFNB 2R1WA 4N8PA 1YEHH 3UP1A 3QIBB 4N4YB 4ZUUB 4KNSA 1YDPB 4U6YA 1NFDA 4NRXA 1YEDB 1KJ3L 1ZMYA 1FZJA 4I18B 4PJDB 3Q3GA 5GRUL 3WKML 4ZFGL 4QRRE 4UQ3A 3CX5K 4ZAKC 1AP2A 2YQ3A 3GKWH 3WUZA 5BVJA 1J0HA 3POHA 3ZDWA 3VM5A 3GSXA 4LQFH 1QW8A 4LLDA 2GEEA 5HJDA 2X6CA 1K72A 4RGNC 4XX1E 4NM4H 4UF7C 3AAZB 1JZ3A 1TF4A 2X4TA 5EEWA 3BIAX 5E6YA 1XTMA 3BP7B 3GMPB 2AITA 1B4JH 4HX1A 4BBWA 4I5BA 2E6JA 3GPSA 4HSCX 3GJFK 5GGRY 1IM9B 1DQIA 4GI8A 4OCSL 3W9DB 3UMNA 3P54A 3D0LB 6PCYA 5MEQA 5D7LA 3ORJA 3HE7D 3CCHB 3MLRL 3LZFL 1LO5B 3O6FC 5I16A 3DVIA 3OPUA 1JD7A 4F7MA 2H5UA 2IBZY 2B4CH 1NBYA 1KF9B 1QATA 1IQDB 4U1MA 1D5MA 1TQUA 3QG7H 4MA1B 4JFQB 4WO4C 4G6AD 5FLUA 4HS3B 4RGMB 3S8WA 1KN4H 3BRGC 4UOJA 1FRGH 1NCCL 3GXFA 1UT2A 1R3LB 1U2YA 5SWZD 4JANA 2VXUH 4GLRI 3ETTA 3N1QC 4PYGA 4YC2C 4YO0B 5CHNA 3IDYC 1I8LA 2XZQH 4D8OA 2QGBA 1XQ4A 3HMXL 4Z3IA 3AQYA 2ZNWA 3T3MB 2JIXD 1Y1UA 4QUOA 2VR8A 1ZVHA 5JXAL 1DQDH 1RPUA 2H32B 2VLKA 2XFXB 4MJ5A 3KPRB 4JPIB 1SRDA 2DW5A 1OOWA 2QZ5A 3SDDD 2R0LL 2OXHB 3H3PH 3AW5A 5E5LA 3TZVB 4A2GA 2O6CA 2WIIB 4Q14A 2VXVH 4KZDH 5HVHB 5F0PB 4NNYB 2HLAA 3OHXC 4CVXB 2XU9A 1J9CT 1BJ8A 4HT1H 5JIQA 4U49A 5CCKH 2NR6C 3OB8A 3RLSA 1GGCL 4KY1L 4HPOL 4Z7UE 3SE3C 3S9DB 2VAJA 1S7WB 2R23B 4N0CC 2I9LB 3MNZA 1G7HB 4JFZL 5GHWL 3VI3E 3P4LA 4M02A 1VRSA 1W6WA 5JPNA 2X1PA 2CMRH 1AR1D 3NQZB 1IC0A 4CADA 3U4KA 4PJCE 3E6HB 4GKSA 2UYLA 3CHOA 4QHLB 4CVWA 1VFAB 2IWKA 3ARFA 1JUFA 4PGEA 4KVPA 5B4MC 1HILA 3SO3C 4XVTL 2BSRB 4RBPH 4TLUA 4ZD3L 1KGIA 4P46D 1OOAA 2VR7A 2WXIA 3FS9A 2Q86A 3I75B 1MPAH 2FO4B 1MHHA 5GJSH 1P4UA 4OCXH 3EOAA 1NFKA 1QWNA 1OL0A 1DN2A 2FWOA 3VFTA 5GGVL 3J8F7 1QSFD 3MV11 2CUAA 1T1ZB 3G6DH 1QWUA 1OT1A 1KGYE 3ZJAA 4DKFL 5FYKE 4Z6AT 4FQJL 1N2RB 5HVGB 3EH5B 3KCWA 1B2WL 5JQIB 2HKHL 3CPLB 3D51A 4BHUI 1QRND 3PDGA 5DZ9A 4TF4A 4YSOA 3SDXE 2E8YA 1AYRA 2K9FB 1TVBB 2F6AA 3J27A 1K5NB 5FO7A 1T7WA 3R7RA 1IEBB 4YDKH 3B9VA 4JO3H 4ZUTA 5HHOB 3L95B 3FO2A 4FD0A 5DUPH 1UZ8B 5ESAB 5FC9A 4AL8L 3BVNB 4XPHL 5IQNA 2ZQKA 1HXMA 1X3DA 1E4XH 1EJFA 4L3AA 3D5OF 1Q9KA 3MO1B 1XIWA 2Q7YB 2WWKO 3T4AB 2DI9A 3EJRA 3W57A 4P5TB 3ZRFC 2CALA 2WIMA 3MU3A 5E1QA 3MJ8A 3N42B 4ILDA 1JGVL 2KQMA 2XQBL 2FYVA 4UTAA 3B9KC 3P11H 5CUSL 3ZE0B 4IKIA 3SGKC 2XKUA 2FECI 2DQCL 3D3VE 3IU3A 3I84A 4JQIH 3N2JA 3EW3B 3KGSA 3NAAH 2VDLL 3WJMB 4I8DA 1ZLDA 4M8UA 1ORQA 3KWUA 3IPFA 1CXIA 2YKLH 2MNJB 3BSZA 1OW0A 5HI3C 5AVVB 1U8KA 1Q94A 3ME0A 4HIJA 4X4YB 5L6YH 4CAGA 5IJCC 2G4EA 1GJIA 3T2IE 3MXWH 3HA0A 1ZT1A 4J28A 3O2WL 1NUDA 3ARRA 4JFPA 2I7SA 2QKIC 2Q8BH 3CFCH 3LCYA 4JVPA 4AQOA 5SX4I 3FO9B 5JW4M 1EHKB 5CLWA 2JV6A 1D3CA 4D0BB 3VWKA 3KEHA 2VR3A 2EH8L 2BSSB 1XGUB 1QLRB 4XC3H 1O7DC 1HSAB 5HI5C 4RGNB 4KK6C 2DDQH 4CL7A 4XVUC 5CXPA 3PAUA 5E5MB 3QXVA 4Y4FD 3NH7H 4NYLA 2X4SB 5DRWB 4WQOA 5IREA 1OSZB 3WGUB 3EFOB 4ZT1A 2EICA 2Y6SC 2DQEH 3TBBA 3A67L 5IMMA 1C5BL 5AW2B 3DVGB 3DXAB 4WHDA 5JO5A 5CLZA 4GAYA 1XTLA 2IJ0C 2CXGA 3KBFA 4NS0A 2G3XA 3MCLH 3OV6A 4FXKC 4LSPH 4JQIA 1IGJB 1U2HA 3L81A 3FT4B 3V4UH 1OAXL 2OCFD 1Z9GE 2CK0L 2H9GB 1VFUA 1BFOA 3ZY7A 1C7TA 4KO6A 2GT9A 3QIWD 1FN4B 4AQEA 1J10A 1FDLH 3B2UD 3LH9A 1NOAA 1OF0A 1QSEB 3QR0A 4TQPA 3VNZA 4MJ6B 1KB5A 3ZW3A 2KLRA 3RVTD 4FNTA 2JH2A 1CF1A 3KJ4C 2DPKA 3D85D 4XMLL 4JFFB 5ID1B 2ZXAA 1AQ8A 3FW6A 3N85L 3HN8A 2BDNL 4QHUB 5LXGH 5JW4N 4TXVB 2BSEA 4KZEH 2ZYSA 5K7TA 4H2CA 3FQWA 3SPGA 3L3KB 3MV01 4JLRA 2VCOA 1CXLA 2N3JA 2OMVA 1KY6A 1R0AL 5EBLB 1PSKL 1PPIA 3TYFA 3AVEA 3CX5J 4KUCF 3UX9B 4JL2A 2B77A 4IHOA 1SDDB 1A1OB 4FXKB 3VFNA 1MI5E 4QEGA 3CHSA 2EYSB 5DJXA 1E4KC 4KK8D 3ZL1A 5I8CB 3GSVA 4NKDB 2A83A 4R83A 4YMPA 4F7PA 1MCDA 2DJUA 3FB5A 3MC0A 4XMKL 4OLWH 3VM7A 3WD5H 3F7YB 5I75B 4JDTH 2JI1A 3S5LA 4C56B 4U6XB 1LEKA 3W0WB 4UOZA 3FUIA 2E7HA 1QYGL 4XODA 4KTEH 4KI1A 5LLIC 2C9SA 4NZRH 4UV7L 5E6IA 5LG6A 4CC4A 1N3NB 1WEJH 4U2ZA 1ZLWH 2EP6A 3GXPA 3UTSB 4A39A 1XSJA 4AIZA 1CGTA 5ANMA 3OAYK 4MXJE 3HNTL 4M7LL 3V0WH 4OFVA 2HN7A 2PXYB 1C1EH 3JTTB 4X9BA 3LJ3A 3V0EA 4XPGH 1N70A 1XF1A 4KWUA 4NHUA 1R24B 5K9JL 4X8XA 4HJTA 4BE6A 4IGBD 1GGBL 4AEEA 2W0KA 4X4XB 2G30A 1PDKA 3DRQA 3RG1C 5JOEA 1QRNA 2DQDH 4LKXA 2VLJB 5BUAA 1MRFH 4U2YA 5DMIL 2IPTL 4WI0A 1DE4A 5ESVB 4TVPL 3DC0A 5IV2A 4F92B 1Z3GH 5GGVY 4C58B 5CIPB 1IU1A 2MCAA 3KMDA 1NCBL 2ED6A 2PO6D 3VSQA 3GS0A 4KRNA 1L0XA 3G5ZB 3VSTA 1OK8A 2HCZX 5ISZE 3IAGC 3DWTA 5C0ND 2GI0A 1BYPA 2OMYB 2YMOA 1QF1A 1YEJH 3B2MA 1NDTA 4QXUL 4DN4L 3N42F 2H6OA 5AB0A 5F1NA 1HWGB 2V7NA 4OCYH 4OLVH 2F58L 1JZEA 2C3VA 3LQZA 4FG2A 4OM0H 5DRXA 5DZPA 5FGBA 4E0RB 4UUJA 2EECA 5DD6A 1R5IB 3A6OA 3EJZD 4YSPA 1TT6A 3SKNB 5A3ID 4DKTA 4QJ5B 5I0VA 4RMSA 2J4WH 4EN2A 3KYKL 2QSVA 2APWA 3FTYA 4YVUA 1TCRB 5EEXA 2CGZA 2A6KA 2AABL 1CUOA 2NY4C 1MY7A 2R4SL 1UADC 2YJQA 3DV4A 1XCTA 4NDMB 4UIMA 2I5YL 4L37B 2IDCA 5ITFB 1X4YA 2FT8A 2H7WA 1AR1C 4QGTA 2J5LC 3LKRA 3HE7B 3PGCB 5E9DA 4XN8A 2EE6A 3LEXA 3KLDA 3QJUB 3SE9L 3EXLA 4JRXD 4NO0D 1RUAH 1I8UA 1TJIH 1KGCD 3ECWA 4FG0A 5F88B 4WJ5B 3H3KA 5JXEC 1WIPA 5FHBH 4G9DA 3GSXB 5A7EA 1I8KA 3KXFA 4PWIA 5DD3L 1HEZB 4AY0A 5DHVB 5KSBA 2N0KA 3AAZA 4A7VA 3C09C 2NY0B 1FJQA 3JV5A 3ARBB 4TM9A 3MBWA 1G7IB 5KYNA 4TSBL 2DEYX 1KELH 4AMKH 1GY2A 1ZIAA 3F84A 1UB5A 5C08D 3WELA 3CZJA 2GFBA 3KPSB 4Q9RL 1KTOA 3D3VA 2YXFA 1J48A 2VDRH 3KM1A 1TQBC 5C0CE 3N50A 4FGMA 4AMWA 3P9MB 5IJKC 3CCHA 1VPOL 3O3DB 4H4NA 4I1PA 3LQAC 3S3DB 1WBZB 2VN4A 3V9CA 1SMDA 4Z0XA 2WYTA 3E7JA 3M1CA 3L5JA 3K4ZA 4KOCA 2OJEB 1E9QB 1CWVA 4JHZA 1Y6NR 5CJQH 4AENB 4YDVB 1R3LA 3W39A 1H15A 1A7QH 1F4XH 1MIMH 3LEYH 1HE7A 2AEQL 3G3LA 3B9KB 1PTZA 3ILQD 5T3XH 3PJSA 3RAJL 1T89C 4L3FA 4MCMA 4JR9L 2RJMA 2X7LB 4R4ND 2Y3NA 4YDIL 1CG9A 1B4JL 4D9RD 5GISH 3IJEB 4QRQB 2LV4A 1LHZA 4E9WA 5JTWA 5M94B 4XCYB 3M17A 3RVXD 4P9HH 4MA1C 2NY3B 3FO1A 1D5XA 3HPJA 2C1PB 2Z65C 4P46B 2ZWNA 4O51A 4N5ED 4R0LB 5TE4L 1XGRA 4E9QA 2EDBA 4FI6A 1AQDA 1CZ8L 2XWJB 1YUHB 4NUPA 4X98A 4XVOA 4KKAC 3V9FA 5G5DB 4HLJA 2OSYA 5DYOB 4F57H 1S7QA 1E4KA 5JA9A 1N19A 2R2BB 3FFOA 4AKPA 2XIBA 3RE0A 1D5BB 1S7WA 1MRDH 2R23A 5L2KB 1FJWA 1ZPUA 4WSJA 5IHZB 1XGPB 5FF6A 4PJ9C 5GGQL 4FEIA 2NDFA 4I9WE 1M6UA 3WIHA 2E4TA 3MLWH 1NWOA 4LKCA 2J25A 1MI5B 1XGQB 1LEIA 4IBYA 3T04D 4JS7A 5DMKA 3T0DA 1ZT7A 3FQRA 4GXUN 4XXDB 3VGEA 2PW1B 2XWRA 5DJ8A 5IGXL 3D0AA 5GRJH 3H0TA 4HOZA 4ODSL 1KEMH 2Y0SA 2NY1C 4NZTL 5HPMA 2PP8A 2TSAA 3M7FB 4BWWA 3QNFA 3ZYOA 1ETZA 4OCWL 3X1EA 3SE4C 1B2YA 4LU5H 4X6CA 1A14H 3M8OL 4JQIL 5D7SL 2ITCA 4NGHH 1FC2D 2TLIA 1YO4A 2N7AA 1BD2B 3BAXA 3IXAB 3C5JA 1NC4D 2FBOJ 4Q4IA 2UY7A 3ECBA 3KWVA 4LASH 2CCVA 5IBTL 3QI9C 5AB1A 2NYYD 4YJZL 3US9A 1XGTA 1XIWC 3LS4L 5CN1A 4WUKH 1IC5L 2JE8A 5IQ9A 4ZFFA 1R75A 1T66C 3QE5A 1LO0L 3MUY1 3P7TE 2VDMB 5IESH 3MGAA 3FO2B 5CP3A 3KVQA 4K2UH 1LNAE 3QHFL 4PB0H 3P30H 2FSDA 1HXMB 3W5MA 3MO1A 2Z91B 4K5MA 1RZGB 3ARGD 2Z7YA 4N8VB 4X7DC 3T4AA 1ZHNA 3TV8A 5DHYA 4PBVC 3BVWA 4P48A 5IB3B 1IIIA 2P5EE 5C7ZA 3EGSA 4CGTA 1XF2B 3S98A 4S0TD 1N0XH 2V3EA 1IILE 1HESA 4L4VE 3MUJA 5GGVH 1CQYA 1NBCA 3EFDH 1QSFA 4JKPH 4LPCA 4OFPA 4TVPE 3TZVC 1FNAA 5KUKA 2P8PB 1QA9B 4APQB 1RQ5A 2AJZB 1NCWH 4WFHE 3RVVD 7FABH 2ORBH 1VEMA 3SDCB 43C9B 2ZPKL 3HE6B 1UG9A 2VDPH 3K71B 2IH8A 4HULB 4AGPA 4PMEA 1A47A 2MOQA 3VYOA 1PG7L 4L5FH 1T2XA 1G9NC 2UV3A 3LMJH 3FO0H 3MLZL 5GS1A 2GCYB 2CIIB 3EHBB 1E4XL 4MCZA 3SDAC 3LKPB 4JO1L 5E6ZA 3HPLA 2DLTA 3WNKA 3RBGA 2OW6A 5D5MF 1QSEE 2ZAHA 1KFAH 4I13B 5D2NE 1OWWA 1P7QD 1TZ8A 2MPAH 5DLHA 3JYCA 2Z31D 1NPCA 4OD1L 2EAEA 1I8MB 4YK4B 5FAAA 3W11C 5DO8A 4X4KA 2XN9B 1ZLWK 1HAWA 3QDGD 2AEOA 2VQ4A 4ZNEA 4NRZB 5KVMC 2BFVL 4RSYA 3DX8B 4N8CH 4QRPE 2A38A 2VM4A 3DXAA 4YBQC 3X3FH 2R69H 5JO5B 7TLIA 2WZ5A 4GAYB 4HH9A 2B0SH 5E8EB 1AVAA 5D7IF 1OAKL 3FXPA 2EKSB 2R0WL 5FXNA 2EDOA 2YGPA 1SJMA 2YUWA 3C60C 3G04B 3HUJE 2HTKD 4G3YL 4B6ZA 4YR6A 1BFOB 3IDGB 4RZCB 1YMHB 5SWSA 2GT9B 4N2CA 5GGSB 5J3HC 3PG2A 1XGYH 1R3JA 1OO2A 2A9BA 5GRUH 4XGZA 4ZFGH 3QFJD 1HHKA 4ENEC 4KTEL 4A66A 4XC3L 3DJTA 4N22A 3F6JA 4K89A 4WFEE 1MAMH 1FYTA 2EIKB 2MWCA 2AFNA 5J13C 3MRDA 4YDMA 1BSIA 3DIFB 3U1PA 4PHZA 1FVDA 2WVVA 1P4LA 4XNUL 5ITBH 2J12B 3L9EA 4R3SA 3U0WH 1CB4A 5C2BH 3MOBH 2HT2C 5D93B 3S0PA 1E9PB 2F1BA 4AGQA 2BVOA 1NGYB 5BQDA 2CJSA 4IBSA 1INQA 2HH0L 4JZJC 1SDDA 5FUZL 4K3DH 3UGXA 3V4UL 5I8CA 3ZXAC 1RAMA 3IBEA 1SZNA 3IRPX 3CFBA 4OCLC 4TUJA 2A83B 4AW4A 1CE6B 3I9PA 3I9AA 5I18H 2BVUA 1QTSA 1W0WB 2NXYD 5IFHL 3T08A 1CFQA 2XWDA 5KYXB 4MXWH 4ZW5A 3QG7L 1F2XK 2QKSA 4XO4A 3KXFE 1VB9A 4C56A 4Z23A 1EEYB 3OR6B 3SPVB 1VACA 1OT4A 4DGWC 4F80A 2ARJQ 4N6RA 3V4VL 2XJKA 5T5NG 5E6IB 1SJHB 2XYCA 3T0XA 1FA4A 2V8MA 5J56B 4CNIA 1LDSA 1MUJB 1TJXA 2AV1B 3N3EA 3BVVA 4FE9A 4C4KO 3OJMB 1CLZH 3F5WB 1GC1C 5B3NA 3NIFF 3CSBA 3IMVA 3GI8H 3K0YA 2NLJA 5E2WL 1MFVA 4NT6B 3GBNH 4WEUD 4ONFH 1SXZA 3FN9A 4GXVH 3DRQB 4QCIA 3ZRCC 1ANUA 1H0DB 1OAUL 1SJEB 4OF3A 4IRJB 2VXVL 3MPCA 4KZDL 3G9AB 2AJYH 1JI1A 2K3HA 4NPYB 1CC3A 4IRSA 3JV4B 1NSNL 3N0AA 3CXHK 4NQUA 1RIVH 3V8OA 1S7SA 3FU9A 2ITFA 3M7OA 2FQEA 4IIQC 3SGEH 2C9UA 3BUQA 1JFQL 2ITDA 1V05A 4HJJL 3NBNA 3PNWB 3HVDA 2CDEA 2A9CA 3P4NB 3APCA 5K9OB 4CKQA 2EVHA 4W9EC 1XEUA 3UC2A 3HAEH 4GBXB 1UJTA 2ADGB 2WP3T 1IGML 5IIEA 2YBRA 5LCVL 2OTPA 1BXUA 2L3BA 1CCZA 5C0GB 2WKLA 4JPWL 2OMXB 4IW4C 4E0RA 4TN9A 5DD6B 4B7LA 4Z9KB 3SKNA 1U2CA 1PFOA 3QCTH 3UGUA 5I1LB 2WLMA 5H2BB 3GZQA 4WFGD 3D50A 3WKMH 1KBPA 1F00I 3FT0A 3KYNA 4HK0A 4JY4B 2QV2A 2XZAL 2A6KB 4L5FE 5FR3A 4BFGA 4FOMA 4L37A 4A2EA 5KS9E 4F8PA 3K6IA 3DROB 3GMLA 5GZNC 1ML0A 2AP2A 2X2JA 1Z3RA 2ZG1A 4YSUA 5DMYA 2J71A 2XBDA 1J88A 1BZQK 1UM5L 1IBDA 4GO9A 2D31A 3GSQA 3ILPA 4FL4B 1W2KT 5E94A 5I0WA 2VO5A 3BIKA 4AI7A 3QDME 3RB7A 3IDIA 1FF5A 3RWEA 3DNZA 4K9JA 4LHUD 3VWJD 1PL3A 1WISA 2HT4D 1A7RL 4R4BA 1HEZA 4AXWB 2W91A 3ECQA 4ZO7A 4B7IA 1KGUA 2CGRL 4FFYH 5A2LH 1CFTB 2YXMA 3QA3A 4WWOA 1DN0B 4KK6D 2Y36L 3NYKA 3HVNA 2X1QA 1DQKA 2XY1A 4XCFL 4DGVH 4WFHD 4DPCX 3J2PA 3BZEB 3FT2A 4K8RH 4HGKC 4DQAA 5E0QA 1T03L 2IF7A 4IBWA 1PAZA 4N66E 1XXFC 3P9MA 4KRMB 1S2EA 3O3DA 1Y0LB 1FNGA 2FGZA 3K4DA 4LE8A 4BUHA 5IUSA 3QARA 4E9TA 1CLYH 2DYPB 4L4VD 1M9SA 3WTSA 3T74A 4WU7A 4OF7A 5CLYA 1FJTA 5IG7A 3HLKA 5EC2B 4TQ8A 4EQ2A 3WN5C 5HJ3B 5HXMA 1TYRA 3MKGA 3SDYH 3CV5A 3O2WH 4G8GB 1CF8H 3RU8H 2BS71 3W39B 2YAFA 4JHWL 4UZUA 2VZOA 3AG3B 3EYOB 1U8OB 2ZF8A 3ZZLA 2PWDA 3D18A 3UYRL 4WTQA 4G80B 3ZE2E 4ZD3H 1BQUA 1J8HA 1WAEA 1IM3A 5DQ9A 1U9KA 3VXPA 1A25A 4NFCA 1GGCH 3UG5A 1N6QH 1VCBC 4C4KT 4FTVB 2X4OB 2XVLA 5JW4R 4QRQA 4N8VG 2VDRL 4OZFG 1IKFL 4JY5L 2KPNA 4QHPA 4HF5H 2YD9A 2WUCH 5D4HA 1VHPA 2OR7A 4UILL 1X5LA 1IAOB 3L45A 5DGQA 5IW6A 3BPCA 4YDLB 2G9HB 3SCMB 3BW9A 4ZYKB 3TPUB 2K70A 2P49B 2ZUQB 1RLWA 3NJVA 3GTNA 5BUGA 1DJYA 2VOTA 2DQMA 3V8CA 1R46A 3E1ZA 5DGRA 5TK2A 4GRLD 3WY4A 3EJTA 5KUMA 1LP9A 5JDJA 2BSTA 4NQCB 4FF9A 4TVUA 5HPOA 5HI4D 1N18A 4I48A 5LXVA 1JK9A 3UDWC 1U8MB 4YL9A 3NIFB 5L2JB 3NPZB 1X4XA 1GSKA 3MLSL 2IV9A 3FB8A 4O9HH 4X8CA 5SV4A 4LKCB 3GGWB 1XGQA 3BKYH 2NR6D 2IBZX 2GUOA 3CC5A 1ZT7B 3B56A 3QDHA 2G60L 4EEEA 3P30L 2X10A 3QUYB 2G5UA 2N1KA 3TBSA 5LXGL 3P0GB 2O30A 5EZOH 4YHOL 2WQSA 4MS6A 5HPMB 2HG5A 4FABL 5JPMB 2HPOA 3QZOA 1XAUA 3BZDA 1R3IL 4JM2D 2VUOA 3EYVA 3X14A 3QO0B 1E4WH 2JVUA 1KCLA 5HJGA 5JYLA 4CDHA 4NWUH 5FFOA 3MV7E 5IJVA 3UZEA 3EFDL 4JKPL 1W72H 3F7RA 3IDJB 3VXUA 4L4VB 2CA3A 3HRZC 4FFWC 4XNZB 1BD2A 1AY1H 4U1HA 1YYLL 3ECBB 3ZYJA 1PX4A 1E40A 3T4YA 5BVPH 5TQ0L 3TVMC 5J1AB 1U8QA 5CSGA 2Y2YA 4HOWA 5IQ9B 1HJCA 1B3JA 2UXVA 5FCSH 4JUSA 2ZNXA 3T2JE 2OZ4A 3PUUA 3GJFA 1INDL 3O3EA 4JFXA 1DSYA 3CMOH 4YHLH 3ZGIA 4NZRL 4Z7WF 2PWGA 2YEZB 5IFJA 5IGXH 2JSFA 2YN5A 4XOBA 4MXVE 1RUQH 4G9FA 4MBOA 5E95B 4L05A 4LSRL 5KJRH 1EXGA 1ZGLB 3DA0A 1V3KA 3IRZA 3SJVD 1YVLA 2KQNA 4L8SA 1T2QL 3O9WB 5DDHA 4KKCD 2ZCKL 4ZFZA 2A74A 2Q8BL 1XF2A 1E7VA 2GI7A 2OULB 2DQHL 3QWQB 5F7YC 2OM5A 2MIZA 1KCUL 5D7SH 3LKNB 2WTOA 3T0EB 1QNIA 4N2NA 4RRPG 4RQQA 2XKNA 4N8CL 3LS4H 3B5HA 3KPOA 5EUOE 1KPUA 2DWEB 4HIXH 5D2LA 3APFA 1YPZE 1K6QH 2AANA 2YA0A 3DARA 4HKXB 4M43L 4BH8B 1WLHA 1KTKE 1M3IA 2VGLM 5E1IA 4Z3GA 4PRNA 3V4VA 3LX9A 4U4IA 5I30L 3Q5OA 3HUJB 4PLJC 4QXUH 3V0GA 1RPKA 4BCXA 2BIMA 3HPLB 8FABA 3D9AL 2PWEA 5K5YA 1DVQA 2W5PA 4PGBA 4PJ8B 5E4AA 2FL5B 3OB0H 4ZTPL 2HUHA 2XV2A 3HHSA 1MWAH 4L2LA 3FN3A 1MFMA 1I8MA 3D87B 4Y16B 2AGJL 4A7GF 3F05A 3MRFB 4KX7A 2JMRA 4GMTL 5FYKU 3I6KB 1JVKA 4PMFA 3U25A 4F8LA 2ED8A 1AXTL 2W07B 4UQBA 4ZX4A 5MERA 4XNMB 3PGFH 4HH9B 5DQDL 4XP9H 4BWTA 1KIQB 1AO7A 4OI8A 3IT8D 4RWYH 3KHQA 4FP8L 3DOHA 5HDLA 5F21B 4V1DE 1EJ8A 3UG3A 2AK1H 5LVEA 1AHMA 1BAFL 1TJGL 4TQIA 3RY4A 2Z0UA 2ZKYA 4PJBF 4CU6A 2AEPH 3E8UH 4XGZB 4OTXH 4ZW6A 4DOHB 2X3BA 2R0LH 3LPPA 1KR6A 1MFCL 1N4XL 3DO3A 1Y18A 1KJMB 5IVZB 4AEIL 2Q6WB 1DJZA 4XN5A 1I1YA 1T0MA 1WVZA 2EZ0C 4MJID 4N26A 4AGMA 4ZQTA 3FBKA 3OX8B 3LD8C 3DIFA 3KPLB 2I27N 1OAJA 4PRPE 4UQ2A 1K2DA 2FX7H 5HHNB 2B39A 2YRZA 1MAKA 2WWMD 1M1XB 3ARFC 3VGBA 1E9PA 1JPSH 3DIDA 1JL8A 5DA0B 2NUTA 1F3JA 5C70A 2V5YA 3OF6D 4AOFA 4CVZA 1LO3H 3WEXA 3V52L 4MD0A 3RL1B 2E56A 3II3A 4FQ1H 2DKMA 3IETB 3DX3A 4UNIA 5F7LB 4DVBA 1QMUA 4RIRB 4KX8A 2MQCA 4HC1L 1ZVYA 1BG1A 1KCVL 1KJOA 1NSNH 1EEUA 1XR9A 4JJ5B 3PE9A 2P3YA 5KYXA 3FSZA 2DN7A 5E23A 3RWGB 4EZLA 4YWGH 1HI6A 3AUVA 3OR6A 3Q48A 3SPVA 4F27A 2R1WB 1REIA 1GZPA 3UIYA 4R5VA 1S3KL 2PPDA 4NFDA 4UYPA 2CLZA 5FV1L 1CYXA 4RDQF 3FBOA 1P7BA 1JNHA 5BZDA 1MFAL 4DZ8A 3Q3GB 2QVFB 1RP9A 3BZ5A 4WDIB 1OWRM 4UQCA 3CZFB 1MCCA 4J6RL 4GQZA 1E30A 3C6LC 2VZUA 3BAWA 3ISWA 2NQ3A 2NX5E 3BI9X 4LLDB 3II2A 1YEJL 4NT6A 3VXSE 4J8RA 4H20L 5FEBA 5E8NB 3KYMB 4TNVK 1IO4C 3E2HB 4UNUA 5D7KD 2L7QA 5FKAB 3GMPA 4HX1B 1NDMA 4BFBD 4GW1A 5E4OA 5DHMC 1WE5A 5EEUA 3O8XB 3ZK0A 3Q2CA 5CJ8A 4XN4A 2IWFA 3W9DA 2OL3L 2ILLA 2ICWI 1U3HD 1JMZA 4ODVH 3DO7A 2ZCLH 1GS8A 5ID0B 3MRQB 3PNWA 4Y4KD 3U1SL 2CDEB 3P4NA 2ZUVA 3T3ME 5H4ZA 4MB1A 4PREB 2DQ6A 3G08B 3W56A 3KLAB 2R15A 2AXHA 4ETQB 2CR0A 3GM0A 1NIEA 3EGDB 3GWJA 2IOOA 1D5MB 5IIEB 1THAA 3CN0A 2N56A 4GG6E 1JPTH 3GXUB 4J3XA 4OFDA 2OMXA 1A4AA 2ZKHL 3PGDA 1NEPA 3K1DA 1MJUL 4W6XB 1YECH 4P4KD 3H42H 2DQFB 4QLWA 5D71L 3HN5A 3IJ8A 2HVKA 5CHNB 3CZEA 3KYNB 4HK0B 3T2QA 4UAOB 3VA2C 4J3BA 5DWPA 1I9RL 1OAQH 1P53A 4CMMB 4ICXA 4Z7OB 4F93B 4PW3A 3EH2A 4P05A 5KTEH 1BZ8A 1TO4A 2GJ6A 2J8HA 5JHLH 5F7NC 1BZ7B 2QADB 4I87A 3WNLA 4A2FA 2JWYA 1GYAA 1NBVH 3POCA 4TS6A 5BUPA 1WQVT 1YNLH 4RA3A 4V1DD 3NH7L 5J6HB 4U3XA 1VPOH 4LBAA 1NCOA 4B0MB 1GPOH 4BQ8A 1A1MA 2VLLB 3O4OC 4HP5A 3B2UC 4Q0XL 5HP5A 4XNAA 3D30A 2YXWA 3HG1E 4AXWA 5D7JA 4XN9A 2XLLA 3MCLL 4XP4L 2QSQA 4BJLA 1SN5A 3HFML 3SBRA 2WGXA 1DN0A 3SQOL 5D96C 1L0QA 2NY7H 3OAWA 3C75A 5F9WC 4UM9B 3ARFB 5I15H 1ZJAA 3C60B 1HILB 2F5BL 2GJ6D 3TCXA 5HYQB 1ZT4A 1J05A 1Y0LA 5IKCA 5TDPB 2EABA 5TGBA 2EIEA 3AS3A 1RXLA