4PJ9C

Structure of human mr1-5-op-ru in complex with human mait traj20 tcr
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
197
structure length
190
Chain Sequence
QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVRDGDYKLSFGAGTTVTVRANIQNPDPAVYQLRDSKSKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
total genus 42
structure length 190
sequence length 197
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pj9C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pj9C02
1XZ0A 4HJ0C 2ICCA 3TWCH 4D0DA 4V1DA 5TE4L 3TFKD 5L88H 2HWZL 5IK3A 5I1GL 1OWWA 2Q86A 2XRAL 3I6GB 4NRZA 4JR9L 4XNQA 5DJZA 4GAGL 5JORB 1TETL 1YDPA 4QHKJ 2XZCL 3DV6A 1WWBX 1MCKA 3T65B 5F6IC 5C0EB 2WWMD 3VH8B 4GBXB 5LGHL 4PRHB 4S1QH 1MAMH 1WZLA 5FHBL 4XNMA 2H8PB 5JR1L 4NYLB 3CDFA 5E8OA 2PKDA 1X7QB 4TVSa 3SKUD 2CIKA 3TT1L 1TETH 4KKCC 4L1HA 3VDCA 4LCCB 5H35A 4TTDD 1WIOA 1CICC 3QUKB 3W0WE 2MSPA 1JYWA 1JGLH 4YR6A 4F9PC 4MD5B 4PBXA 5D70H 5A2KH 1H5BC 3WKNA 1LVEA 2R0ZH 1VFMA 3KGRA 5TDOA 5SV4A 2V2XB 4TVPE 4LEXL 2YRZA 1RMFL 3CLEL 5GGSY 4O5LL 1JGDB 3BH9B 3ARDD 5BMFH 3F58L 4GRWF 3KYMA 1KXQE 4PJ9A 1MQ8A 1U8QB 4FQCL 4U1HB 2XZZA 3FHQA 4EOWH 3PNWB 3UMTA 1S7WB 3HUJF 4G9FA 1W72L 2BNRB 2XICA 2EYTA 3QDMA 5JXEA 4LEXH 4I3RH 5H8DA 3TESA 4O4YL 1K2DB 2BRRH 1FBIH 5FGCB 4YDIL 2Y5EA 1BEYH 5T3ZD 4QXTB 3AUVA 2HAZA 3G5ZA 1G7QA 2A83B 3MV9E 1YQVH 4FTVB 4RZCB 3RVTD 2VJXA 1HK6A 4JFQA 1ND0A 1FVCB 3HPJB 4V2CB 3BN9D 1ZVHA 1D7FA 5E2UL 4POYA 4WUUA 3VCLB 1BQSA 4M7ZC 4GW4B 1FLRL 4Y5YC 2J8UA 5HHOB 2DYPD 1S7SB 3H6JA 3OXRA 5EU3B 1MJJA 5DK2B 5DRNA 4Z77B 3EKCA 1ETZA 3DX7A 1JGEA 1U8IB 3WYRA 1YEFH 3FB8B 1XCQA 3NACL 4BSVA 5F1IA 2E7LA 4FXGB 4GMSL 5T3ZH 1IAII 5CUSL 4L1DA 4Z95L 3QNZA 3VI4E 2WWKT 1DANU 2ORBH 1NMCC 3DGGB 1ZKAA 4Y5VC 2IH3B 1PD6A 1PJ9A 4XNUH 1AIFA 4PRHD 5I9QB 4KV5F 1AGBB 1BP3B 2NY0C 2A9NH 5EG6C 1GGBL 2FEDC 2VSDA 1U58A 3QFDB 3PQYE 1SY6A 3GSRA 5JPMA 4JPKH 1EO8L 2JK5B 3B9VA 5EOCJ 4F7PB 3MFFA 2EO9A 1A6VL 1OTTD 1JZ7A 4CDGC 3PWNB 4OV5A 5FXCH 5J57B 1CQKA 3E0GA 4YXHH 3D69B 5FO9B 5IFJB 5JNYA 4NZTH 5KG9B 4JFXB 3BYTA 1U8OA 4ELKB 4AT6A 4YHLH 4FQIH 4PJ9B 3MRDA 5C0IA 2UUDK 3IYLW 3O3AA 2DIAA 3VG0L 3LRSA 5E8OB 5CJQL 5HTSA 2Q6WA 2BNRA 1JPFA 4ZNEE 1UCBH 2ZUTA 3NPZB 1KT2A 3ULVD 1YEJL 4I8DA 4KKAC 1IM9B 4KVCL 3MLYL 4K7FB 1NUFA 1WTGT 2I24N 3GI9H 3MJGX 1IAIH 1JGVL 2D7NA 4UOJA 4JFQB 4BQ9A 4ODTL 4HH8A 3QO1B 5KVFH 4MXQC 3FT3A 1RPQA 4JCLA 3REVB 1CICD 3LRHA 3I6LE 1ZAGA 1QLFA 4ZQKB 5DMGD 2NR6C 2NYYC 3DTXB 4Z7QF 4OLEA 4TNWK 5C0RH 3CZFB 5B4MD 3U0WH 3ALXA 3G5VA 1TDQA 3WFHB 3R0MA 4JFFA 2R2BA 3QXDB 3QJFA 1P69B 5DRXB 4JM2C 2FBJL 3SOBL 3NA9L 2KL6A 1QSFA 1CBVL 3IU3B 1X5FA 4NQVA 5C0IB 4JGMA 4MJ2A 5FYKE 5EIIA 1P6FA 5TDPA 4OCLC 5SX4H 4KY1H 2BP3A 5L2KE 5KSAD 1RUPL 4TVPD 5CJBA 3F12B 4G7YL 1U3ZA 4E5XB 1F4YH 3U0WL 3WIHH 2MCPL 5HD8C 1MCWM 1W8OA 4K7PX 4N0UA 2YSSA 5F7UA 1SHMA 3HC3H 3Q2CA 1I85A 4HQQL 4NWUL 5FUCE 3TN0D 4UIMB 5IQ7H 3G9VA 5SWZB 2NY6B 3MRFA 3TYGL 4PV9A 2GJ6E 3H3PH 3DI2B 1S9YA 3IFLH 4HWUA 2Z35B 4UQ2B 1CDCA 4PRPD 2X4TA 4N0FB 1ZT4B 5AD0B 4OUUB 3F5WB 4CMMA 1HZHH 3W11D 2KKQA 4R0LB 4DUXA 2YEZA 2AXHA 2PYFA 1Q72H 4P5TD 4WI3A 5JW4N 4P49A 4F33A 1EBAA 4PJAE 3VGAB 1E28B 4GMTL 4TUJA 1L6XA 2X70B 3U9UA 4HFWB 2XWJB 4HK0A 5IHLB 3F58H 2OM5A 5DUBB 3OR7B 3D18A 3RUGF 4X7TB 2HP4A 1Q1JH 5KAQF 3NAAH 4PRPA 3AREA 2X1PA 2VL5A 2D2OA 1G9ML 3MLSL 3BISA 1UXWA 3S98A 3SE9L 3S35X 5D96C 3LZFH 3DX7B 1YEJH 4X6EB 3KR3H 4BZ1L 1D5MA 5IFJA 1QYGH 3MLWH 4CU6A 5J06A 3VWJC 2WUCL 3D3VE 1NFKA 2FEEL 1KEGL 5FUOL 5CBAA 5HHVL 5J11B 4NQUA 1FFPA 1GHFL 2JIXB 2OL3B 4X6CB 1MWAB 5DUPL 1TQBC 3QUMB 4MCYA 3HI1A 4LAQH 3PQYD 1FNSL 3NN8B 2PETA 2YPVL 1PEWA 2X4QB 3MLXH 1AE6L 4NQEA 3WV0A 3NIDF 1T1YA 1FJ1A 4K8RL 2PTUA 1MPAL 1EK3A 5CD3B 1A4KB 2H8PA 4P5KB 1CTNA 4EKXA 3DBXA 4WU5B 4YNYA 1EXUA 2PTTB 3B9KA 3SJVD 1AR2A 3LKSA 4P9MH 3CNKA 1MFEH 3KPLB 1PAMA 3L3OB 1X9QA 4MJIA 4M6OH 3CMGA 4F15B 4X6FA 4X6EA 1GAFH 2P8MA 1UZ8A 2ICWA 2CLVA 5FYJL 1MH5B 4JFFB 1FDLH 3FQTA 2CXGA 1ZLWH 3L3IB 2HT4C 4QRSA 3KPPB 4NJ9L 3R06A 5FO8A 1ZT4A 2ITDB 4MSWA 2BJML 2G2RA 3G6JE 4XWOC 2P7TB 1OAXH 2DIJA 1T3FB 3LPFA 3UEZA 2XFXB 4M61A 2VR4A 5IW3A 1NFDB 2AK4D 2EDYA 6FABH 3L3GB 1QLRA 1U3HB 1HQ4A 2JCCB 1ACYH 1H8OA 3LRGA 1RUQH 3ZKMD 4NHCL 1G9NL 3SKOA 5JHDD 3TJEH 4TSAH 4FQQB 2IPTH 2NY6D 4XVSH 1ZA6A 1NANH 5EULV 2OTWB 4HIJA 2Q7YB 1WTLA 4NQXA 2XTJB 2EKSA 1I9RH 5D4QA 4M6MH 1FV1B 1I7ZA 1CDUA 4OCRH 1VEOA 5F88B 3TCLB 4PLJC 3ROOB 1P4BL 1JFQH 3HB3C 1V3KA 4OLZL 1NCWH 2P8MB 3HC4L 3VW3H 2J4WL 1EBPA 4FXGA 4NP4H 1KCVL 4PRIA 1FNEB 4HIXH 4ZXBB 1MFAH 4XXCA 5I19H 1B4JH 4NBYB 2CMRH 2M8XA 4GKSA 1HHJA 5CZXD 4OGYH 1RK1A 4FQIL 2NX5B 4J3UA 4F9PA 1MCBA 3MZGB 1S5HB 4KK8C 1G7IB 3RA7H 3JWDC 4X6DE 5IHUL 1IGCL 2A6DB 2WV3A 2AJXH 4CVZB 3E8UH 3ALPA 3MLUH 1DE4A 1KIPA 4MQ7A 3VFOA 5HYSG 2OL3A 4RMSA 1TXKA 3MRQB 3WFZA 3HI5H 4OV5B 3ECBB 2P8LB 3ARBA 4GKZB 3O2VH 3LQAL 3EDDA 1LP9F 4JZOA 5DD3L 1W0WA 3TNNB 2VLMD 3WL9B 1BOGA 2X4QA 3TO4D 2I07B 1LILA 4JDTL 4QRSB 4HV8A 4R96A 2ADFH 2ZUWA 4KC3B 1H8NA 2ADIB 4OFYA 1FN4B 2XZAH 3KVQA 5EIVA 3GSOB 1KENL 4PY7B 5GS0C 1IAIM 4M8QA 1H3TA 4JN2B 4NNPH 5DGQA 1IGIH 4Y88A 2DMKA 3WEXA 4KI5F 4KHTL 3UAJD 4G8IA 4LVNC 5T3XD 1NGPH 3OJMB 1S9VA 4HUXA 3QHTC 4ZUVA 2BC4B 3MRNA 5E99H 1JPGB 4IRZL 1GCFA 4UQ3B 4KMQA 4QHNB 3I9GH 4ZYKB 4UTBH 4EIGB 5F1OB 2R15A 1MCJA 1ZVYA 4M7JL 3RHWF 2AGJH 4XBGA 3MLUL 4L29A 4O2EA 5IMOB 5T5NG 1CDIA 1HSAA 3RY4A 3UTPD 5B21A 1FRGH 4Y5VA 4M6NH 5TGBA 3VXMA 5J11C 1Q94A 3T3PE 5CSZA 1KACB 3P4MB 2FO4A 3MGTA 1ERNA 3RY5A 4WW2B 4YK4C 5IVZA 2VDPL 2E8ZA 3D39B 4DUVA 4YHIB 4ZUTA 1FZOB 2CJUL 2GY7B 1G84A 3FRPG 4FS0A 3BWAB 4Y4HA 1JPST 1J1PH 4P2QA 4PV8B 4NIKB 4G5ZH 3IS1X 4BH7B 3MA7B 1OP3K 3NFNA 4G8FA 5BMFL 3N0PB 3R06B 3DX6B 3WJLC 1T6WA 5FO8B 1AY1H 1KB9K 2UZIH 4S1SL 4OF3A 5F7NC 4WWKC 5JIKA 2E8YA 4M43H 1WT5A 3KR3L 2YD5A 4A6YH 2AJUH 3SGJA 4I18C 3PDDA 4XCNA 3GIVB 3QO0B 3VD4A 1J1OH 1L9MA 3ZHKA 3PG2A 3GI8H 4NN5B 5F21B 3R0NA 4D0CA 2QJDA 2CKNA 1J12A 3FFCD 1EO7A 4I3SH 1HKLH 4PJFF 1JIBA 4KUCD 3P9MB 4HK0B 5FV2A 5TGBB 3KYOA 5GGUB 4BQ8A 3SCMC 1F3DH 2PTVA 1BZQK 2P5EB 2GEEA 4YAQB 3O9WB 2VLJA 3U7AA 4OQTL 4GAGH 1FV1A 5DS8A 1IRAY 1ACZA 5I2IB 1T1XB 4YGVA 4Y5XA 5JUEH 2DTSA 1DBBH 1IEBA 4I9WE 5KSBE 1MAJA 5CCKH 3TBWA 5IV2B 1JPGA 3WE6A 4DJMA 3BGMA 5F7EL 4J6RL 2VN7A 2PXYB 3STLB 4K3EH 3BPLC 3W11C 1P7HL 4HKJB 4PJ7A 3S36X 2NY4C 5E2TL 2B4CL 2VLKD 5JXAH 3MR9B 1RURL 4WTZA 5F1NA 1NDGA 1UB6B 3MV7A 2BNUB 3QFJA 2EDEA 1K8DB 1CQYA 2IH1A 3LKOA 4XP6L 5LXGL 1X5KA 4Z0XB 1FC2D 2DKMA 4WW2A 5BO1H 3VFRA 3KXFB 3QEUB 3SDDB 1CL7L 4LEOB 1A5FL 4K94L 4PJEA 5ITBL 4Z7NF 2YD6A 2X9XA 3PGCB 2WLZA 4ENED 3T08A 3X12A 3MCLL 1D5IH 3QDME 2R2EA 1FBIL 2OSLA 5I1IH 5CGMA 3OKNA 3SKNA 3IFNL 3DROB 1T2JA 3S5LG 3MREB 4AEIH 4GSDH 5TPWL 5MEOB 2L4OA 2YXMA 3MJ7B 2E9JA 3WS6C 2DQTH 4PJ7F 5E03A 4ACPA 2RQ8A 1FZOA 2ED7A 4D0BA 1Y6KR 1RJYA 3BP7B 4PR5B 5BQ7B 3CSGA 3FQUB 4TNVK 3TM6A 1RZJL 4MJIE 4X5XA 4KKNA 1J0KA 1TENA 4OTXL 5F7WC 5IHZB 3SDCA 3R8BB 5CZKA 5E2VH 1A7RH 3ORJA 1KLGA 3VXOB 4YHPA 3KXFA 3U4AA 2IPKA 2DQGH 2C3XA 1P2CB 4OGXL 2ADGA 5JW4M 3QIWA 1MFDH 2WWMC 2X05A 1CYGA 3CC5A 1CF8L 4WUUD 5DO2D 4PJ8A 5GGQL 1RUML 3TBVB 3HG1B 1VACA 3VFPB 4C4KT 2YA0A 4R7NA 3W9EA 5IVZB 5JW3H 4B41A 2EDTA 4KAQL 1U36A 2ADJB 5AG9A 1IAMA 3TYFB 4YK4B 4W68A 4LPTA 4IRJD 1G9EA 2VZUA 3EFFA 3QDHA 3BYYA 4Z7OF 2DAVA 2AXJA 1RUAH 3MOQA 3RWEA 1AH1A 4TVPL 3I50L 3BVNB 3RWGA 1AQKH 1HCVA 2XXCB 1OP9A 3HE6C 2PXYC 4N68A 5FYLH 1UXSA 4L8SC 4UIKH 4KI5D 3LSOB 3TGXA 1LK3L 1EJOL 4ZDHA 3KPSA 2O26U 2YZ1A 3GSQB 5IM7B 1I9RL 2EDXA 5J13B 3IFLL 4PP1D 3W39B 3PGCA 1UZ6F 4OT1L 3ARBD 4QXUL 2AJVL 3HC0B 3BZFA 2IAMB 5ACMA 4UIKL 3CK0L 4FXKA 3IXAB 4WI9A 5DMYA 1VGEL 3GKWL 2IH1B 2YK1H 4CW1B 1CFNB 4Y4KB 3WKML 12E8H 5GQBA 3VXRE 4XMKL 1A6UH 3IJSA 2BVQB 4MXVE 4P9HL 4U31A 5CP3A 3P9LB 2PO6A 1EHXA 1PSKH 3T0XA 4X7SL 3VE0A 4J2XA 3MCLH 5BV7H 4P48A 3QQ3A 5GRUH 2JJSA 4J1UA 5E8PA 1B0RB 3GSUB 2VB5A 1J11A 4NQCD 1AJ7L 1PVHA 3HZKA 3QNYA 2DQIL 2WBJC 1VPOH 3KYNA 2FGWH 2PYED 3QXUA 1FE8L 1JUFB 5B38B 2DLTA 3RWHB 2HTLD 2ERJB 1EEZB 5B39G 2ARJQ 1AXTL 4UB0H 3ZT6A 5F89A 4OCMC 1HHJB 1F6FB 4ODWB 2Y36H 3TT1H 2O93L 4JO4H 4QO1A 2PW1A 2BOCA 5F9DC 4IMLB 3UX9B 3MLXL 4JRYE 35C8L 4NZUH 2XTLA 4D9QE 2P5WB 3EFDL 5E9DA 3T1WA 3K8KA 4GAJL 2OQJA 3NVQA 5C6PB 3P4MA 4RMTA 3RDTD 3ZDYE 3WHXA 4NQCA 1LE9A 3K81A 4HUMB 2GHWB 5HGBA 4UINH 3QIWB 4LHQB 1WITA 2ICEB 4X7SH 3MJ9L 1NGZA 5T3ZL 4U1LA 1MAML 4N1EA 4X4YA 4WDIB 4P2RA 3OKLB 4M7JH 4U3HA 2NXYD 3AAZA 3BKCH 3L3HB 5IFHH 4LOUD 4Z7WA 3RL2A 3LKNA 3N85L 5D9SA 2VH5H 4OKDA 1FN4A 3S35L 4RNRB 1QLEL 5FYKU 5B3NA 4HJ0D 1E27A 4U0RC 3HC0A 4YE4H 4ZODA 1A6AA 3GMNB 3QIWD 2VC2H 2VIRB 4JFEB 4QF1B 1WBYA 1DVFA 5KSBF 4OLUH 2X41A 4G8GD 3ME0A 3B2VL 4PJEE 4XMPL 5KJRH 4E41B 4JY4B 1UVQB 4AMKH 3HNTH 4JPIB 1O7VA 4UU9A 5D1XB 5F6HJ 5E5MB 2NY4B 1JE6A 4U1NA 2LVEA 2J6EH 4M1GL 5MERB 3DO3A 3O9WA 4WEMB 3KLHD 2JJUA 3T4AB 5FO7B 2R2CA 1CD0A 1AI1L 4P2RE 3UYOD 2BDNL 3LAFA 3OKKA 1B0RA 3X11A 1DANT 5KVFL 5IEHB 5DD0H 1N0LA 5D71L 5IMLA 2QSCH 5KSUB 3SBWA 2FGWL 1BIIB 2NTSP 4HGWA 5HBBA 2FO4B 2AXFB 3MGTB 5FDWA 2V5TA 5C0EA 4OD1L 1BQLL 4RA3A 5IBLD 1N4XL 5EZLA 4HUNB 3RKDC 4YX2L 4WRLA 4ONOA 4M7KL 4MXWL 3HB3D 4ODWA 1UQSB 3C08H 4U6XA 4M6OL 4Y4FA 2CLRB 4HJJH 3MUY1 3NA9H 5EBMB 3GJFA 3PWUA 3OJ2C 4NRXA 5JR1H 3VD9A 4LCWA 3GMNA 2ZUQC 4PJXB 3P11L 1U9KA 3GSUA 4NJAL 4EJ1C 1CGSL 4Y1AD 1A4JA 2OL3L 1HHKB 4XAKE 3MV8A 3V5DB 2LQRA 1H5BB 4M4PA 3V4VL 5HI4C 1NL0L 4C83B 4LGSB 1I9IL 4H26A 4EI6B 2YPVH 4O2FB 3GMPB 2NY5C 1WGOA 4Q58C 4PPTA 5CILL 5L2KD 4LLWB 4DEPB 1FG9C 4PYGA 1G7JA 1D9KA 4PREB 5BXFB 2YMXH 1OD7A 4HS6A 5D2NE 4Z7WE 2B2XL 1PZUB 1NC2A 3LB6C 1QKZH 3FCTA 1K85A 5F6HI 4H88H 2IPTL 4NO0D 2GQHA 3GRWL 3U2SB 4ZMAT 1RFDH 1U8MA 3EZJB 4ZOEA 2WK2A 3UDWA 4WFFE 2ZPKL 1ZHNA 5HGHB 3U0PB 3H7BA 3G5ZB 4O02L 1F4XH 1S7XA 4M48H 3QDGE 4CVXA 4DK3A 3C9NA 1UQSA 4HIEB 3WKMH 3WE6B 3JV0A 4R3SA 4X7FC 5I1JH 1PX4A 3WIFA 2I60L 3ULUD 4XPAL 3X17A 2E7CA 3SDXF 4ZFOA 4KZDH 3QEHA 4JFOA 3EJZC 3VG9B 2F53D 3I75B 1RZKC 3CU7A 3ULVC 5EZOH 3MRIA 4P3DA 5T1LA 1WICA 5F96H 2VOTA 4S1RH 4JFEA 4DAGL 3WO3B 2W07A 4JQVA 4ZOAA 4Z0XA 1OM3L 3LKPB 2AW2A 1OT2A 3HNTL 4HGMA 3HNVL 3VGHA 4KDTA 4ZUWA 2FO1A 2HT3D 3NZ8B 2YRLA 3JV4B 4MVBD 1WSST 2XA8L 3RFZC 1U93B 1AE6H 1JK8A 1CDJA 2RBLA 3RU8L 1RZFH 1MHHB 3JTTA 4X4YB 1HILB 3GFUA 5GS2D 3B6SA 1INDL 1H3VA 4X0KB 1QACA 1F13A 3OKNB 2OR8A 3WFCH 3PXJA 4GW1A 5TE7H 2CR3A 2OL3H 3KDMA 4LLMA 4CMHB 3T0EC 5JDSA 4F8TA 4P0DA 1WIUA 1OAUH 1HDMB 4XNXL 4AYFA 1J1OL 4U6XB 3IDJA 4JKKA 4WHTA 4GBXD 1AHWA 5JOPE 2R1WA 4UBDD 4N8VB 1S5HA 2HRPL 4PIRF 2I5YL 3FQWB 1OCWH 2HKHL 1IZKA 4JQIL 4FQXA 3ZDZF 2HH0H 1NMAL 5CEYA 2F19L 3RWFA 1QTYT 2OX5A 2OTUA 2X4NA 4PD4K 1Q9OB 1ZVSB 5JQ6H 4YEEA 5FA3B 3S3JA 3ULUH 2H2SC 5AWNH 3VI3E 5CEZD 4G6JL 1QA9A 1K4DA 1EVTC 1F3JB 1FNFA 3EYUH 3ARGA 4Z7UF 2FR4B 1TQBB 4WI5A 2MCG1 1HYSC 5C3TA 2NLJA 1U8LB 2ZOKA 1HILA 4RISL 3TP4A 5CZXC 5E08H 5J1AB 3V0WH 1IGYB 5KSAC 1J0HA 1KPRB 2XPGA 4HH9A 2VDPH 1M7IA 5CKAA 1U42A 2PUQT 1R3LA 3I75A 2ZG3A 4NN7B 3TN0C 5JHDE 4WUKL 1BFTA 1LHZA 1UACL 1XGTB 4IRSB 5I1EH 1KBGL 2ZJSH 3B9KC 4R26L 4LHUG 4XCFL 2Q8AL 2V2TA 4LHJB 3MODH 5MP6H 4NNYA 2C3WA 5AEAA 1HHKA 1YEEL 3N50A 4HX1A 3VXQB 4ZDHB 4RAVA 3HLAA 4RQQB 2J5LC 5C09D 3FTGB 3LHPH 2DLGA 5EO1A 4XBGB 4HJJL 3ARSA 2DTMH 2Q6WB 5IMOA 5DHYB 1DLHB 1C5DA 1JMXA 1IGCH 4NC1E 4MNGA 1WIPA 2IG2H 4HS6B 1WAAF 1N7MH 1D5XA 2H9GB 1UKSA 3BP6B 3CX5J 2ORBL 4RFNC 5KSBA 4WY7L 4MNQD 5D93B 5DZOA 3CMOH 5IVXE 1UJTA 4HIXL 1FL3A 1JV5B 3QCVL 4M62L 2APWA 5IB1B 1INQA 3O8XB 3QXAB 2P24A 1S7VA 3MPCA 1I9IH 1HDMA 1I9EA 2BDNH 5C9JA 1WEJL 3QEQA 4I0PD 4XCYA 5E4IA 4GKNB 5HI3D 4Z9KB 3H9HA 4RGMC 1M05B 3FB6A 3T2QA 1HSBB 3DSFH 1NMBL 3ZHDA 4XNYL 1H3XA 3MODL 1GH7A 4D3CH 2F53E 2VWEC 3PP4L 2IQ9H 3BDBA 4KQ4L 4JVPA 2G75A 4JFDD 5DJAA 4NQEE 1X5IA 3TZVC 1F3JA 4WW1B 3AS3A 3LEVL 4E42A 4UUJA 3VD5A 2WUCH 1I3RA 3VWJB 1DBAL 1NCBH 2CIIA 1RUQL 3HCVB 4R2GD 1HOCA 3QDMB 5IW6B 3T0EE 4P2RD 4UTBL 3V0WL 4YC2C 3X11B 4DUWA 2P47B 1D5XB 1OSPH 3Q5OA 3I3BA 4LIQL 4G43B 1FL5A 4LCCC 3QUML 2FJGB 3IJYA 4X6CF 4JKWA 2OQJB 1P1ZB 1MWAL 4J23A 3QDGB 5HHXH 2CIKB 5C9KA 5ID1B 5FA3A 1NGPL 2EDQA 3NIFF 3FQXB 1G1YA 4NJ9H 2Z35A 3GJFH 2D31B 3VFUB 5HGBB 4DEPC 3FONB 2IGFH 4QYOA 4CUCA 3T2OA 4PB9H 3VMPA 4X5WA 1Z3GL 1KTDB 4MAYD 3VI4F 3ZE2F 5K9QI 5HHME 4R8WH 4XHQA 3SCMD 4Y1AB 4JANB 4ESKA 3BDYL 3H3KA 3S97C 5CS7A 3Q1SH 3L9RB 2X89D 1CFSB 3ZDZE 1MIEL 1DVFD 2R23B 3MRBB 5K9OA 4LQFL 4YDLC 4OKVB 2DLEA 3I6KA 5DLML 3PGDB 3BP6A 1DDHB 3OKOA 5CLWA 2F8VA 1E4KA 3CVHB 4YDKH 2C7UA 1I1AA 3EDEA 4QRUB 1NBZB 4NKMA 1A5FH 4K94H 3EOBA 2AABL 4K71C 3IF1A 1A2YB 2APBA 1PYWB 5CINH 1S7RB 4KRLB 3DX8B 1ES0A 4KK9C 1U95A 3S3SA 4AG4H 3S5LB 2DDQH 1R3HB 1HQ4B 2JCCA 2BSSB 3QT2A 1RU9H 4K23L 3P11H 5I1AA 1JGUH 2XN9E 4HPYL 5BCAA 1NMCB 1Z0NA 1MFAL 4Y2DD 5DHVA 4UTAH 2C26A 2SEBB 2O5YL 3GIZH 3FB8A 1H3UA 2EKSB 3EO1A 5GRZA 3JWDH 2ESVD 3VI3F 4R3SB 4XP9H 1C08B 3UTOA 3JVGC 5CSGA 3JV6B 2QSTA 2HT2C 4ZNCD 5F9OH 5DK3A 1QHPA 1QFHA 3U6RA 5I9QC 2QHRH 4QGYA 3GMRB 5I1CH 4FFYL 1FNEA 1TMCB 4Z78B 5ESQA 4MLIA 5DRNB 3U9PH 1X5LA 5DMGC 4KK6D 4YZFE 4BFIB 1P7KB 1ZT1A 4YHML 1IAKB 1CGVA 1MY5A 3QNXB 5IR1B 4BSVB 5BS0E 1SM3H 2V5SA 1MRFH 3DVFA 2AJYL 3H3BC 4WNQA 5GISL 1RU9L 4D8PB 5JW5A 3VXTA 1U93A 5I8KH 1T1WB 3SCMB 3ZE1F 2YK1L 4KKAD 3A6BL 1OARH 5GGSA 4APQB 1F97A 1YMHB 5DD1L 3UTSA 4D0DB 5L88L 1VHPA 2YBRA 1XGRA 5C0AE 2XY1A 4PJFE 4OLVH 4P5MB 4QRRD 1P4LB 1F58H 3N1GC 3BH8B 4JFFD 2NY5H 1A1NA 3MJ9A 3HFML 3B2UD 2JK5A 4X7EC 4LQFH 5JO5B 1KT2B 2UWEA 3UJTL 5ID0A 1LO3H 4UDUA 5BVPL 3FONA 1LK3H 4NYLA 4C56D 5FM5O 1BLNB 1XEDA 2YKLL 4JFPA 5SX4I 4OM0L 3U9PL 4XNZC 5C70A 2BC4A 2EH8L 1IAKA 5A16B 5TH2A 1RMFH 3WLBA 4EDXA 4DTGL 2AJSL 3NFSL 4L4TD 2OK0L 4KMLB 4HSQA 1XGPA 5KBNC 1X5ZA 3BP5A 4Z6AT 5LVEA 3S9DB 5HGDB 5J56B 5DJDB 3QPQD 4DOHE 1P7QA 2DWDB 4OD3H 4YGAB 3QR2A 4PRNB 4X7CC 4HBCL 2AI0H 2ENYA 1J88A 3CPLA 4MNGE 1G7IA 1HSAB 2JELL 3UTZB 2XQBL 1CBVH 4WWKD 3EDKA 4PLJD 4NO5B 1F90H 1L6ZA 4HCRA 3IAGC 1I7UA 3O3DA 3TH2T 4NUGL 3MNVA 4PS4H 3SGKA 4KKLC 4AJ0A 5FKAB 5FV1L 1VKXB 1UWXK 4OTXH 4J1UB 3D2UA 3IJHB 3C5JB 3WD5L 3PWPB 1EHLH 4WUUE 1C16B 1M6OB 2EXYD 2VXUL 4OCWH 5I1LB 2E7BA 4HS8L 5F9WC 2MKWA 3P0YH 2VDMH 1SYSA 4M3JA 1BD2A 1FLTX 4P57B 5D7IE 1ADQH 1B90A 1QSFB 4Z77A 2VQ1B 1N59A 5JW5B 5C09E 3BE1H 1K3IA 1KELH 4Z7VE 4G9DB 3GSOA 1A6WL 4QGTA 2DBLL 4FNLH 3VFWB 3HE6B 2APFA 4QRTB 5D8JH 1DVFC 4HK3N 2CK2A 1CG9B 1QPPA 3ZT5A 3O2WH 4LK4A 2YSSB 4OT1H 4MD5A 1XAUA 2VMFA 3F62A 5JW4Q 5TE6L 1A14H 3MRGB 4K23H 2WIIB 2XN9D 1IKNC 3PWPE 4NNXA 5IESL 2ZUXA 4IDLA 4MXQD 4TUOB 4YPGB 4FQLL 3MNVB 2AJZA 3WHE1 4OD2A 4K55A 1WFUA 2QSCL 2BY1A 3SO3B 1IILE 5GSVA 3P73A 5C7XL 1M7IB 4IRJC 5KN5A 1MRDL 2X89A 4FMKA 3WJLA 4JG1L 5JW3L 1U8OB 1C5BL 1G7HA 5D7SH 2BSRA 1MJ7L 5IWLC 4OZGE 4J6RH 2G2RB 3ZDYF 4AMKL 3L1OL 1GC1H 1EAPA 3BRGC 3BPLB 4ELMA 3MR9A 1AC6A 1NBVL 4HHAA 5BV7L 3NFNB 3TCXA 3PQYB 1S8DA 5C07B 4AL8H 5C6TH 3OQ3B 3TVMC 1B2WH 1L0XA 5J1TC 3DVGA 4M03A 4JDZB 1A3RL 1ED3A 5I8EB 1DLHA 4HXBL 4KUZH 4QHMA 1XGPB 4GH7B 2NXYB 5DJDA 4XZUB 3P9WB 2GT9A 5HHOE 2XKNA 5D5MB 4JO3H 1VSCA 5I1HL 1NH6A 5TDNA 1U8HA 3QUZD 1CK0H 5GSRB 4L3EA 1E4XL 1C7SA 3VXME 1YEHH 4NGHH 1VGKB 4QEGA 2IPUK 4C58B 4G9DA 5E24E 4C56E 5DT1H 3MLRH 1GJIA 4GAJH 5D8JL 3OAYK 3P30L 1Q9KA 4KFZC 2W0FB 4X99B 1MJJB 5DK2A 3LKRB 3O2WL 1F4WL 2AQ1A 3C5SB 4QHKI 1SJEA 5T3XL 4XPFL 1FFNB 3KJ6H 3T8XA 1JZ5A 3UZVB 3D69A 5FO9A 5ERWA 1S7RA 1UCTA 3AY4C 4HXAH 2G60H 1BD2B 5IIEB 5T1KA 1U8NA 3OAUL 4XGZB 1ITCA 4I2XB 2IAMC 2QL1A 2V2WA 1BJ1J 5DQJA 1JGLL 4GUPA 3QXVA 4POZD 4XRCB 3BEVB 3HZMB 4L4VA 3D1MC 2QQLH 2WQRA 5GHWL 4D9RE 2JJTC 3K8MA 1EMTL 2CKBL 4YE4L 1X5XA 3AGVA 5FHBH 3H9YA 3NGBC 1DEEB 3C6LC 4YBLB 4ZXBC 1GXEA 4OZFG 1EZVX 4PRIB 1YNTA 5B39B 3E6FB 1CD1B 4CN6A 4KK5C 4DCQA 4YFDB 4GXVH 4H20H 2Y06L 5KVEL 1NCCL 1O7SA 3FT3B 5CGTA 5J3HD 2FYYB 3TH3T 3X13B 5FIEA 3IDXL 15C8L 1KN2L 3BGAA 1FG2A 2HLAA 1Z9OA 1ZOXA 3L95A 1L7TL 4XPGH 5FUZH 3PHQA 4MHHG 2V7HA 1T22B 4PRID 2X1QA 2YUVA 3H0TB 2YKLH 6CGTA 4Y5YA 2OYPA 3MNZB 4WI7A 4NRZB 4OM0H 5DJZB 2Q86B 5E9DD 3LPGA 5EU5B 2BNRE 4CNIB 4XNZB 1D6VH 2QKIB 4I3GA 1FFPB 2EXWC 4OZIA 4L5FL 3SGDH 1IZJA 3MRCA 3DX8A 1ADQL 4H8WC 4I4WA 5IB4B 5C07A 1J0JA 3C8DA 3NN8A 1OHQA 1X7QA 3KNBA 5DD6B 1MCPL 1A7NH 1Q8MA 3UYPA 2KQMA 3KPRE 2ED9A 2R69H 5JHDA 4ZQKA 4WV1B 1I8MA 1TZIB 4UDUB 1ZGLM 1EEYA 3IVKB 3BQUA 2I9TA 4FQJL 2ZUVA 3CFDB 1S9XB 2X2YA 2C9AA 3FN0L 1RULL 3C6LB 3FMGH 2ADJA 2RFXB 2FBOJ 3AMLA 1F2XK 5EO9B 4XBPB 4H5SB 4Z8FH 3ABZA 4JGJA 1MEXL 3MRLB 2C4FT 1OLLA 5H35B 4Y0GA 5TQ2L 5J12C 4YHOH 3VXMB 5L7XL 2AAVA 1EEQA 4IOSD 3KHQA 4RX4D 4XXDB 3V6ZB 1U3YA 1U0QA 2VLRE 1GIGL 2OTUB 4H0IA 2PW1B 2YWYA 1N0XL 1WBXA 5GIRA 3PL6D 1WLHA 3LEXA 4YBQC 2Z31A 4L4TB 4JO2H 4RGNE 1CDBA 3ET9F 3BAEL 5TQ2H 1YYLL 2P5EA 4R4ND 2IPUG 5FM8A 4MNQB 3RIFK 2V2WB 4I2XA 2J8UE 1OL0A 3I2CL 1Q72L 3IGAB 3W9DB 4EXKA 3M45A 4YXKL 3DVIA 3QCVH 3VXMD 3UTSB 5ECJE 4HS3A 4LARL 2DD8H 3BT2L 3EYFA 3HE7C 5AZEH 4ORZC 4QOKB 4MWFA 3E3QC 4GLRH 3VXNA 1HKFA 2DMCA 1I7ZB 3BSZH 5KZCB 3QUXD 1HINL 4A6YL 1BGXL 4L8BB 1MQKL 4OSUL 3S88L 4WW2C 2CDEB 4LPYA 1I8LA 3C60C 4PJ7B 2C4XA 1FL6A 2EECA 5C7XH 3CSPA 4WENB 3S35H 3V5KA 3BKYH 3VXQA 4M48L 4JHWH 3FO9A 4JPKL 4AQOA 1F4HA 2GJZA 4UT9H 2IFFL 1QR1A 1A9EA 2YPLE 3QUXA 3RPKA 4IHOB 1WT5C 1U8IA 5TQ0L 5FOJA 3DX9A 1QFWL 1UB5A 4C57C 1X6NA 3K4AA 1FP5A 2OJEB 3CMOL 3HAEA 2OXHA 4TOYL 5MERA 1A0QL 3CVHH 2XWTA 3FRPA 5JOPD 3V5HA 1DBKL 1MCFA 4JB9L 5IEHA 4Z0BH 4KMTL 5CD3A 2JB6A 1QBMH 5KVGL 5KSUA 4EUPA 4KKBC 3BXNA 1DQJB 3QI9D 3MJ7A 1URLA 2HTKC 1XF5A 1QUNA 5IT2L 3VRLF 4OFVA 4B7LA 2BCKA 4Y2DB 2WZPD 2HMIC 1NCDH 3A6CL 3V6ZA 4Q6IA 4Y4FB 4XI5C 2IJ0C 1PY9A 1UACH 1SBSL 2MOVA 5AAMA 4WO4D 2A1WH 2LABA 4P57A 1I4FA 4X5XB 1PFCA 1KIRA 1HHIB 2W91A 3QWQB 3L3KB 1RIUL 4HZLB 4Y7MA 5FCUH 4QRPA 2AVGA 2EICA 1CXKA 2P43B 1H5BA 5FUCC 4F15C 5E4EC 4D3CL 1JHTA 3FOMA 3DTXA 2B0SH 2HRLA 4GKOA 1HHGA 3MX0A 3NCFB 4K8RC 1X5YA 2NXZB 5IGXL 4I4WB 2G60L 1K8DA 3TBVA 4PJFB 3MXWH 4HC1L 4PBVC 3UC0L 4R2GB 4R4BB 43C9A 5D6CA 4QT5A 1BZ9A 1H0DB 1MHEB 1A7OL 5D1XA 3MUJA 1G6RH 1LD9B 4M3KB 2OTWA 2A6DA 3DRTA 4RAUB 4ZFGH 5KSAB 3HI6H 4LFHD 4DZBB 3LH2L 4OD2B 3OB8A 3OKMB 1JNHA 3GBML 1R0AL 3JWDL 1MI5A 4ZUTB 3C2AL 3U1SL 2GITB 3NCCB 1QQDA 4RMVA 3QULB 1KJ2L 2VUOA 3DXAA 4NBXB 2XYCA 2X44D 5FB8B 2BHUA 4JAMB 4L4VB 5DDHB 5ANMA 4Y2DC 1AD9A 3QH3A 4OCRL 2XXMB 4YHLL 3ZKNC 1YQVL 2GJZB 1JYNA 4PY8I 1OQOA 1QSEB 3FT4A 3RWDA 4CW1A 2BSSA 3ZE1E 4JHAH 4IRSC 1K5NB 3AXLB 3SPVA 2BXZA 3FAWA 4O2CA 2W65B 1I85C 1IGJB 3C60D 4WCYH 5DFVD 4LRIA 4MA8L 2EEDA 4OCNC 5F7KC 5HYFA 1MHHA 3JTTB 2OXGA 1VACB 3VFPA 5DD3H 3VXUE 1NCAL 5IBLC 3FB5A 5HVHB 2NCMA 5BXFA 3DIFA 3NMEA 1I4FB 5SWSD 4YH6A 1CFBA 4YGVB 5T1KD 3CSYA 1H9VA 4QNPE 1KCKA 1SBBA 4XHJD 3RY6A 1FAIH 4L8DA 1T03L 3BP4A 5I76A 1Q0YH 2ICES 4UT7H 2NXZD 4UINL 4KUCF 4CVXB 1JNNH 3MCKA 3VXUA 1XR9B 3MRNB 4XP1H 4ZSOB 4MQSB 1C12A 1J10A 2VLKE 2DOCA 5BJTA 2J88L 4U49A 2F9BT 3RBGA 5EOTA 2DRUA 3QHFL 5E4EB 1U2CA 2MHAB 4MA1B 4U1KB 5IFAH 4ZD3L 5CGYD 2Q3AA 2QTEA 3BPCA 3PWJA 3QAZB 4QHUB 1M71A 4OD3L 3WUZA 1JHTB 4LEOA 1EV2E 3GBNH 1KBGH 2ZJSL 4PJIA 1Q1JL 1IGFL 4R26H 1LEKA 5M94B 5L2JB 3RU8H 3QNYB 5FYKD 2FRGP 3OKDB 2HLFD 4PJFA 3OJDA 4X83A 4X80L 3IU4H 5GGVL 3FO2A 4G6ML 3BGMB 4YZFF 4DN3H 3CFEB 5IMKB 3BDXA 3RTQD 3E6FA 3RL2B 1PEZA 1S7QB 4M1GH 4O51A 4JPWL 2H6PA 5IROC 4JFHD 4UV4L 1S7UA 2A9NL 3HZYB 3MV01 2P8PB 1YEFL 3TPUB 2QSVA 5E94B 5D7LA 3QFJB 4G6MH 5HHQB 1AHWC 1T0NA 2A6IB 2E27H 4HUUB 3ZTNH 1JF1B 1CN4A 4PJAF 5ILTL 5I1CL 3PHQB 2VLRD 2PYEE 1RJYB 4PR5A 4O00A 3M17B 4L3EE 1BFOB 3T04D 1BQLH 1IGJA 3HLAB 1DBML 3SDYL 5CZVH 3OKEB 3QUZA 1PX3A 4I0PB 3UTSD 1ULVA 4MMXC 2R1WB 2B7DT 3FB5B 3AAZB 1T1YB 1OVZA 3CLFH 1N5YL 3V9FA 1AKJD 1KJMB 5D1XC 2V5MA 3S3PA 2B4CC 3QG7L 5TF0A 1WC7A 1I8MB 4MD0B 3D3VD 3IJHA 5K9JL 1DFBL 4YHNB 4OZGA 4HQQH 3QRGL 4LP5A 1SEBA 1OTTC 2Q8BH 5D70L 3L3HA 2GW5A 1KCUL 3ARYA 2A77L 2ZCKL 4YHYC 3HE7D 1P4IH 4JFFE 4ZD3H 1DE4B 5DDHA 3LQZB 3OG4B 5CP7B 1V7MH 4PJ5A 3P0YL 2RB8A 1TVHB 5JA9A 5EU6A 5IMLB 4QWWC 1HYRC 5ESVB 5JPNB 3RVWD 4NKIH 3JUYA 4JHAL 3SPVB 2HRPH 3IFPA 4KJYB 3WXWH 2WIIA 3KYKH 2X4OB 2MJWA 2FX9L 4U1GB 4KRMB 4Q9RH 5GIRB 1YN7A 4XVTH 1W2KT 4WWKA 2QR0B 3SE9H 1ZE3C 2JB6B 4LIQE 2B8OT 1RJLA 1EGJL 4OGAC 4WIQA 1M71B 4G7VH 2D03H 3DXAD 5ALCH 4IOIA 4HJGA 4C54A 1JRHL 3DMMA 5SWSE 3DIFB 3DO7B 1LP9B 1N3NA 5JIPA 1J0IA 3C9NB 4BQ6A 4IRZH 1T7XA 3DROA 5AYQA 3NBNA 2VXQL 4ODVH 2UY7A 4OCSL 4S2SA 1N64L 1I3GL 2HFTA 3K4ZA 3QJHB 1F11B 4EBQH 5HDLA 5EC2A 2I07A 3NIFE 4ONFL 3U7WH 1MOEA 1IEAA 2MPAH 2LU3A 3V6OA 3HZKB 2ATPA 3ARPA 5K9KA 4PY7A 1JGUL 4Z95H 1G7JB 1TIUA 2VKWA 1I8LC 3C60A 5GGTA 1SVCP 2GAZA 4OCYH 3EJJX 4EBQL 2FIKA 3WFEH 2HFGL 1YNLL 4HHAB 1B0WA 4Z7NE 3O45B 3RWIA 4P59L 4UZGA 3IDYC 4PGBA 2Z8SA 3VH8G 3EAKA 2EDOA 3MC0A 2NY2D 5C0AB 4U1JA 4PJ7E 1DZBA 1RJLB 4KJWC 2C3VA 5E8DH 2GT9B 4XP1L 3EBAA 3IDMB 1CR9L 1GPOL 3JBG7 1RIUH 4BKLA 4NQCB 3SHSA 1EX0A 3U36B 1MI5B 1VESA 4JCMA 4KDWA 5F9AC 5CKGA 3PGFH 2R4RL 3G5XA 2WINB 3EJZD 4MX7B 1BFVH 1CLCA 1CFNA 2J8HA 2O5XH 4RGNC 3CXHK 3GMMB 2XG5A 4WI8A 2AEWA 3ZKSD 2FH6A 2JF1A 4Y4KC 4F7MB 4WHYG 4XP5H 1Q9KB 1K4CA 3BX7C 4F7EB 2JCCF 3T0WA 3LS4H 3OTTA 4G6KL 1W0YT 1P4BH 3IDJB 4WHTB 3BWAA 1HZHL 5BO1L 3OSKA 4FFWC 3WFEL 1FAIL 2FIKB 4HPOH 2F54A 3SDXB 1HHIA 1C1EL 2DQIH 4HIIB 5HYQA 5JLZB 1FE8H 3GSWA 1AP2A 1UT9A 5I8OL 1HE7A 1FGNL 4LKXB 1D5ZA 3QFJE 3MV7E 4D8PA 2I27N 1CR9H 1GPOH 4F2MB 1NDMA 1I3GH 4QOKE 5DQ9B 3RHWK 1EDQA 4IM8A 4NUGH 2VISB 3EYSH 1OWRM 3RX7A 4XNYH 2BVQA 1G1CA 4OF5A 3OKYA 5HPOA 2H2SD 3BUYA 4OSUH 1FVEA 2G5RA 4CBPA 5C0GB 5BZDB 1HXYB 5DS8B 1CVSC 1XGYL 2K7PA 4RWHA 3ZHLA 2CD0A 2AXGB 3CK0H 1IFHL 2DJSA 2X4SA 4DKDC 2R8SH 1TZHB 4OFYD 3HS0B 3S34H 1KENH 1UM5H 2DQUH 4O9HL 1I1RA 1GGIH 5EOTB 1VEPA 3BMWA 2Q20A 1MIEH 5C0NC 4BA8A 1CLYH 4CN1A 3LOWA 3OAYH 3TJHD 4QRPE 2Z31D 4LSTL 5LGHH 3PL6A 4KJYA 4J8RB 3QWRD 3V4UH 2QQNH 5D1ZA 3W0WD 4PP2B 2QLVB 2PR4L 2UZIL 4RMWA 1XH3A 3O6LL 5JMRA 1ZVSA 4M8VA 4NM8L 3VFRB 4O2CB 4OFIA 4XB7A 4ELME 3QI9C 5I1EL 1N3NB 4PJDE 4CVWA 5A2FA 3FO0L 3O41B 2EXWD 5CHNB 2Y5TA 1F00I 1LO4H 2AJYH 2P8PA 4ONHB 5DLMH 2IBZX 1MCLA 5CEZH 1RJZB 2BRQA 5FDYA 1W72H 5K9KB 4P46B 1ZK9A 1CT8B 2PW2A 5KW9L 1ORSB 4PLKD 5T3ZE 3HR5A 3VRJB 2NXYC 3O4LB 1TZGH 1AGCA 1V7NH 5T33L 4F7MA 5IEKA 2H9GA 4PJ5D 3OR6B 3TN0B 4K3GA 1ZWIA 3QEHB 4JFOB 4S1DC 1DQML 4HF5L 2J3SA 4NZDA 4LLYB 4OBSA 4ZSOA 2BVEA 4OB5L 3UJJH 3PWUB 3BKMH 4JFDB 4G80B 2EDKA 1INEH 3UCRA 1TZGL 3HMWH 2JJSC 4I9WD 4H25A 1G6RA 2OMNA 2EZ0C 3GSVA 4DGVL 1P84K 4XHJC 5C6WH 4Q9QL 4OM1H 4TN9A 3KPMA 5EDXA 3OKKB 1H15B 5BVJA 1T4KB 4PGEA 3PJSB 3R4DA 3WDIA 2F5BL 2OTPA 3OJDB 5KG9A 1KF9B 5DQ9A 4X4ME 4ZPVB 4IRJB 5CINL 3STZA 4PREA 1OTUD 5GZOC 2A0LC 2DJUA 3VFNA 3W5MA 3ULVH 2QQQA 3KLDA 5D7KD 5E6IB 4P2OC 2XY2A 1OTUC 1R3IH 5GZOD 5I16B 5KZCD 1L7IL 1OGAA 2BVPA 3QEQB 4JHWL 4KTYA 1J8HE 5IVOA 3KPQB 1F8TH 4NN5C 1IC4H 4HKXA 3E8UL 1JNJA 2F54B 3RGVB 1S7XB 4KK9D 4JDVA 4FQHA 3D25A 4PG2C 5I17A 4KVNL 1ZGLP 3QDMD 4YHPB 4ODSL 3SY0A 2EZ0D 2HJKB 1DBJL 1FGVL 1NAMB 5D7LD 1FGNH 4GRLD 4LKXA 2DLFL 3S37X 4PJ9D 1DN2A 1N0XH 3ZTJG 1Z3GH 3SO5A 2CDGB 3ARGD 2ZKHL 3V5HB 5INCB 2VDKH 4ZO8A 3PV6B 2JJWA 2NY2C 4NSKA 1JF6A 3IJYB 4RMUA 1A7QH 1CL7I 4OQ1A 5TDNB 1DUYA 4OZHA 43CAA 3MNWA 3EYOB 2DIBA 5DGRA 1B3JA 1GIGH 3IDUA 3OXSA 1F4XL 2OLDA 4XNMB 5TDPB 3KPNA 4QXWA 5TF1H 1W0VA 4QRQA 4GO6B 2DQEL 4LCWD 3QIBB 5C07E 3LN5A 3RZCC 5H2BA 4JFDA 3QUYB 1G7MB 1U95B 2P5WD 1NC4B 4Y4FD 2B2XH 3K8LA 4GG8B 1SMAA 1N4XH 5DYOB 4APQC 3O45A 3RWIB 3KXFD 4NZTL 2VQTA 1BPVA 1IKFH 1TVBB 4JJ5B 4CVUA 3GSNH 1E4KC 1OQXA 1U8NB 4RAVB 4OLXL 1G7PA 1T7ZA 1UYWH 4OGAD 1PDKA 2ZSVB 3U48A 5JPNA 4WDIA 5I8CA 2VDKL 2F58L 1J5OH 5IHBA 3ARUA 4LDEB 2M26A 1S7TB 5IJKA 3VFNB 3L7FB 4WCYL 2EH8H 2F19H 4W4OA 1RIHH 2XA8H 3O41A 4GRLC 3HG1D 1ZLSH 1Q0XH 2GJ6D 4LBEA 4Z78A 4GFTB 5F93C 1D5BA 5KTEH 4N0YL 3X3GH 4N0CC 3OXSB 4V1DB 5DUML 1YJDC 3KPNB 3FMGL 4JRXB 2GITA 2GTZB 1CIDA 2OJZL 3EO0B 2LVCA 3FHAA 4WI6A 3C6SA 2W9EL 4XCEA 4NKQB 5C09B 2R1XB 3X14B 1AI1H 1IC7H 2V7HB 2HVKA 3G08B 3TV3L 3INUH 2CDGA 5IW1B 2NY7H 4G9FB 3M07A 4WUKH 1MWAA 3A6BH 2VRAA 1HI6A 3QFJD 3GNML 4LSVH 1LK2A 2VDOH 3WNPA 2JCCE 4P2QE 1REIA 5DWUH 5GGVY 3S6CA 3FB7A 4JO1L 4N5EC 1FCCA 3HCVA 1NUNB 3O2DL 3OWEA 4FG6C 4NFBA 1AO7D 1CFTB 1E4WL 2OP4L 1OF2B 4YNYB 3BUYB 4LAJH 2IWGA 1LNUA 1EO8H 1U8QA 4K3EL 2CO7B 3ELAT 3LN5B 4X4ZA 1UWEH 1RZ7L 1CZ8L 4P2RB 5GZND 2DM7A 3UJJL 3VXRA 4LF3A 1NC4A 2D31A 2XPGB 3F7YA 2VXVL 1UM6H 4KJWD 4QRRE 3EGSA 5DXWA 3GMOA 5HJ3A 5GS1C 5I16A 1Y18B 1JTPA 2H26B 1BQUA 1KN2H 1ADQA 3KAAA 4Y1AA 1XIWD 4M7LL 4LLQB 3T2NH 2GI7A 3BUTA 3V4PH 1AGFA 3QDAA 4TSBL 5EA0L 2R23A 3MRBA 3CZJA 4P23D 3CVIL 4QRPD 2DQEH 4XCYB 1T89C 1F5WA 5J1SC 4OI8A 2AV7A 1NGQL 2F74B 3PWVA 4X98A 3D0VB 3VJ6B 4LSSL 2EH7H 3GI8L 4UNUA 5DYOA 2Y25A 3GSRB 4DVRH 2WLYA 1E4XH 3QIWC 5HDBF 5C1MB 2H3NB 3T4YB 2AV1B 2Z0BA 3DI3B 1EAJA 4NO0A 5EBWB 4HLZG 3M8OL 4FZEL 4JJHA 1A9BA 3PIQB 2A9ML 1JZ4A 1INDH 1C16A 4O2FA 3GMQB 1XF2A 4WV1C 5DEFB 1QFPA 4N1CA 3QWOB 5IJVA 2AEIT 4KRPC 5IVXB 5MEND 3B8SA 3MO1B 3F7QA 5IG7A 5IW6A 3ULUF 5LAXA 3O4LE 4YXKH 3HKFA 4G8GE 1SYVB 1Y18A 3QHZH 1U8MB 3QJFB 4LCWE 2W59A 1MCRA 5H94A 2I25N 5DJ0A 3OL2A 4CAGA 2CSPA 5HYSB 1FO0H 4WO4B 5JZ7D 2C7UB 1LK2B 2Y4SA 1IGML 2X4SB 2UVFA 1RD6A 1SJXA 4AH2B 4CJ1A 3IDXH 4NQSB 3C09C 5LBSL 4L4JA 3MRRA 1K9TA 4ODXA 1IC7L 1PG7H 1KIUA 2IBZY 3O6KL 4KTEH 32C2B 1FPTL 4Z5RA 5IQ9B 5C92A 1DTUA 4ZXBD 4CMMB 3L7FA 1TJGH 1KCVH 2A73A 1C8PA 1P1ZA 3F6LA 4WW2F 5AZ2L 2FD6L 4UNVA 5DEGA 4HFWA 4ZUWB 2YPKA 3BKML 4PTTB 4HLZH 5HI5C 2KDGA 3BH8A 5CILH 3VD3A 3RI5K 4FZ8L 2EYRA 2WNGA 1CXFA 1J5OL 3KPQA 5LWYH 3QUKA 4HEME 1OW0C 2D7MA 2DWEB 2FWOA 3I02B 3S37L 4AEFA 1T66C 5GRWA 3RWCA 1KJ2A 1MUJA 1QEWB 4CN4A 4K9EH 5SWZA 1AXTH 4UB0L 1WBZA 3MLWL 5CP7A 2QADB 5CJOL 4JRWA 1KCLA 1IL1A 5EA0H 5HI4D 3ARGB 3ARFA 4XMKH 4LSVL 2ENSA 4L4TE 4UT7L 2YD8A 1CK0L 4TUJB 1AO7E 3BZ4B 1P53A 4FQ1H 5CZVL 2IADA 2XA3A 4WFHD 3NZ8A 3VJ6A 3ARXA 4P23A 3EW3B 4NT6A 3QO1A 4LL9A 3C09B 4MA7H 4QTHA 4S1DD 5JXEC 5KANI 1G6RB 4KJQC 3LD8B 1BVKB 1DUZB 5CBEB 2VDRL 3T4YA 3FKUS 1A21A 5DEGB 1ED3B 5DVLA 5E2UH 3UPRA 2SEBA 1FH5H 3DRTB 3VMNA 5DMKB 5HYEA 2O5YH 3GIZL 3REWA 1KUMA 1OAZH 3AS2A 2A74A 1DQQB 8FABA 4XNUL 3DECA 3QIUA 1GGIL 3KPSD 4N90D 3FTGA 3TZVD 1AGEB 4S0SD 5A16A 3CX2A 3V0VB 4IJ3B 4U0QB 4XRCA 1RK0B 4KRPD 4HULB 2QQKL 1OY3B 3QZWB 4OLUL 5CUSH 2EYTB 3WIHL 1SY6L 3K2UH 5BZWA 3IRZA 2V2TB 4FABL 4OCXH 1FFNA 4AH2A 1R5IA 3BH9A 4ZAKA 5JA8B 4YXLL 3WJJC 1AD0B 3QAZC 1HEZA 3G6DL 4U1IB 3L3JA 4XWGL 3VCLA 1S9KC 2FX8L 4BYHA 3MUZ1 2O61A 4PJ8D 32C2A 3UP1A 3PWPD 4NNXB 5GRVL 3PWNA 2FWOB 3I02A 3U36A 3V79C 2JIXD 1IEBB 3O4LD 4KDTC 1K2DA 2YRPA 4JRXA 1FNHA 4JM4H 1L0YA 2M2DA 3FOLB 3GI9L 4PRAB 1SM3L 5EU6E 3TF7C 1MHEA 3UTZA 3MNZA 1MVFA 1V7NL 1N64H 4HAFA 1NFDF 3P4NB 4Z7VF 1SJVA 5GS1A 3UTQB 4ZXBA 2R39A 1NLDL 2B1HL 4NCC2 4GKSB 4RCAA 4OLVL 3ESUF 2ZP0T 1XCQB 5TH2B 3WLBB 2N7BA 5D2NA 5CBAB 4R7DB 5EBLA 1PW3A 3MMEA 5HY9B 5J9PB 1T66D 3JUZA 4UMGA 4POZC 4NQDE 5KOMC 5CLTA 1TNMA 4M43L 1RUPH 2NW3A 4Z76A 4W4NA 4J4PC 2UZXB 4FQ2H 3VXRB 2G5BA 4M7ZB 1X4XA 5I6XC 3LD8C 1OAXL 1NFDE 4D9LL 3PL6C 4TUKL 5IB4A 1MCCA 4J3WA 3FT4B 2DQFA 1RK0A 3H2WA 2HWZH 1L7IH 1G7HB 4JG0H 5E8NA 3KPRD 4FFYH 2BHYA 5DQDH 3BW9B 5L9DH 3OAZK 5CMAA 4BJLA 4ZFFB 2QADC 1JNLH 1C5CH 1E6OL 3EYQC 1F02I 2B1HH 1OD9A 2FHCA 3N1MC 3BPNC 5DQDL 1U8PB 3VXSA 4WFGD 1LO3L 4YDVB 4JG1H 5M95B 1A6WH 5C08E 4LHUD 3ARTA 3HAEH 5HY9A 3DYPA 1C5CL 3I9GL 4ZFOL 3S34L 4WFHE 5D1ZB 4GKZA 2IFGA 4ZFGL 4TSCH 1MCSA 3E2HC 3I6GA 4XNQB 1A1OA 4FQXD 4R0LA 3QUZB 4NO3B 2ZG1A 5F9JA 1CICB 3FO1B 4DZ8A 1NBYA 1DBMH 3M1BA 4P3CH 4Y5XC 1OP3H 2PXYD 4GBXA 4WHDA 3MRHB 1LNUB 3PDGA 5L8JB 3DVGB 2VL5B 2BRRL 4J3XA 5GGRB 5GRXG 4KZEH 5KVDL 1C1EH 3QQ9C 3SDAA 3BO8B 2BCKB 2VAJA 1T21B 1OOAA 3EHBD 3GDBA 3MRDB 5CJXC 2YPLB 2DN7A 3T8XB 2VLKA 4G6JH 3HC4H 1FIGL 3VW3L 3R1GL 3QB7C 3OZ9H 1QNZL 4PTUA 3U7YH 3TNMA 5I1DA 3NCMA 3C8KB 5GGVH 2PYEB 2H32H 2XACC 3F5WA 4KHXL 2Q8BL 1AO7A 2Z4QB 1NAML 2O5XL 3G6AB 2BFVL 1E6JH 3L1OH 4OZHF 3BJLA 4KWUA 1EFXB 1FIGH 2VLJE 5D7LB 4CJ0A 4NDMB 1FRGL 5IHUH 2R4SH 7FABH 4KMTH 5E9DE 3RNKB 8CGTA 4K3DH 4UOW0 1IARB 2BNQD 5T1LD 2A0LD 1HKLL 3M17A 3IFNH 1DBAH 1NCBL 2YUWA 4KI1A 4QHMB 4Y19E 5JO5A 4DCQB 3BZEA 3WFDH 1TJIL 4XP4L 2Z92A 2R4SL 5E7FA 3K0WA 1FZJA 4RFOH 5EPMB 5EO0A 5MEPA 3WNOA 3MA7A 2OZ4L 4AZ8A 3VA2C 2HLAB 2BNQA 4PJGB 1WISA 1JGEB 1B0GA 5DZLA 5L8KB 1I7TB 4YC2B 1FDLL 2ZCHH 1UFUA 2OR9H 3HE7A 4L3AA 2M1KA 5GRVK 5H94B 5I30L 1A3RH 1BJMA 1T5XB 3B43A 4G6AD 1WJ3A 3D39A 3L5XH 4N0UB 3H9SA 1GVIA 4PJXE 2EDWA 3O4OB 1AO7B 2Z4QA 4OZGB 4FQHB 1IQWH 3EYVB 1QRNE 1JHKL 1D5MB 1CE1L 1WZKA 2FX7H 2XFXA 3QWRA 3W81A 1NGYA 1V05A 4HKZA 2QQKH 4IJ3C 4IMKC 4MJ5A 4LCIH 4X80H 4NQCE 1RIVL 3CXHJ 1UENA 5LWYL 1U58B 4HMEA 3EHBC 4YDVA 2QHRL 4PJHB 3BIAX 5ELIA 3QEGH 4OCWL 3O3EA 4YHZH 4RGND 2Z91A 4PJ5E 4TRPH 2AK4B 5DMJB 4JRYA 5I71C 1NGZB 4G6KH 3HMXA 3JXAA 1P7QB 3JWOL 1MH5A 4NOBA 4LLDA 3ZT7A 4Y2OA 4IBLT 4K3JL 4X6CE 3IFPB 1HN1A 2F15A 2B39A 5D93C 3FFCA 4K3HA 1MCHA 3NCJH 5HVGB 3VRIB 1D6EA 1WWAX 1KLUB 1G6VK 4OFPA 4CL7A 2GYSA 3WNLA 2Z8VC 2VLJB 4BZ1H 2ED8A 3UYRH 4EIZC 1KIQB 3RDTB 2X1XR 1A14L 3DO7A 1YN6B 1TZIA 2BVOA 2CDEA 3L95B 1KEML 4OD1H 4I3RL 1AY1L 3PDOA 3QBTB 2MNUA 2W65A 1ZHLA 1JHLL 5DD5L 4EQ2A 5E56A 3STLA 5FB8A 4Y4HD 3QO0A 3V4UL 2CO6B 1BECA 3T0VA 4C4KO 3RZCD 5JOFB 1IQDB 3X12B 1K8IB 3MZTA 2GSGB 3M1BB 4MD4B 4IDJL 5CSBA 5FGSA 1LO0L 1P9MA 4E41E 4FTVD 2D0GA 1QLRB 1A0QH 5T1MB 1HHHB 3U83A 1P6AB 2HTKD 3WS6A 1W0WB 4MWFB 3TNNA 1FQ9C 4GXUN 5MEOA 1EJOH 1QP1A 4GMSH 1F2QA 2YWZA 3S4SB 4Q0XH 1CU4L 4F9LC 4WTZG 3SDYH 5D7LE 4K7PH 4QXGH 3WUWG 4JHZA 4ETQB 4OQTA 2CMRL 1QRNA 4Z7OE 1C12B 2DICA 4TVPH 3HUJB 3EO0A 4ELKA 4ZS7H 4NPYA 5C08B 4FRWA 3P73B 1MRFL 1NCWL 3GKWH 3JWOC 1A22B 4K7PL 4QXGL 1BX2A 1QZ1A 3H9SE 3IETB 4JPVL 4UT6H 2X4RB 1GGCL 1U3HC 2WBJD 1OP5K 1N6QL 3HAEB 5TE6H 2VKXA 4OIIH 4MAUL 4PJXF 3IU4L 5I66A 5C07D 4MD4A 4X9GA 3SKOB 3QEUA 3SDDA 1F45A 3ILPB 4I77L 2ADFL 4F7TA 2C1OA 4K71B 4Y19A 3GZKA 1OT1A 3O6FB 3BE1L 3CUPB 3TO4B 1CFQB 2DBLH 4XAKD 5I18L 3SQOH 2IALB 3MRKB 1KXVC 1BFSA 3B3IB 2VH5L 2P5EE 5D5MF 1H3PH 1QHOA 1UA6H 4Z7WF 1UCBL 2YR3A 3AROA 1T5WB 4G42A 2AK4A 4IIQA 5J6GB 3GSNL 2WAHA 3OAUH 1VEMA 3G5VB 1H8SA 3VXNB 5EWIL 2X4PB 2FX9H 2XV6B 5ITFA 5JZ7C 4E0RA 1VGKA 4N0RA 3LEYL 1D9KC 1UWGL 4NBZB 3TYFA 2GCYB 3NABL 4EEEA 4D0BB 3QXWA 4LSSH 1KPUB 1LGVA 4OGYL 2VXSL 4LVNB 2YA2A 2WSKA 4Q9QH 5MEQA 1Y6NR 4KTDH 5D1QB 5EZJB 5HHQA 3QDGD 4EDWH 1Q94B 1A1OB 5KAQG 1MVUB 1VGEH 3IDNB 4JFYB 4JO4L 1QPXA 2UWEE 1CFVL 4LLYA 1BZ7A 5I71B 4DKFH 2PF6A 4JFZH 1VB9A 1AXSB 1LD9A 5JIIA 4PB0H 5E6ID 3WIIH 4L4VD 1GZPB 3EIFA 4J3VA 5D2LB 3QQ4B 4O2EB 4P5TA 1TCRA 3DETD 5K33A 3MRKA 3HPLB 5D96B 4PLNC 2BY0A 5GS0L 3W9EB 3KPMB 4R90L 3GUTA 1MRCH 1T21A 3QHZL 3FAXA 1FFOA 1YUHA 2LU4A 4AEHH 3LN4B 3U0TA 1F11A 1OLZA 3LN9A 3ZE0E 1BHGA 4M8QB 9CGTA 5E8NB 4FOMA 3H3PL 3O6FC 4JVWA 1RUAL 4XTRD 1J0ZA 1NJ9A 3N85H 1VENA 3P9LA 4HBCH 5C2UB 3LKNB 4WO4A 4YEFA 1MFBL 4O5LH 5FK9A 1A7PL 3UBXB 2D4FA 3D5OF 3QG6A 3BN3B 2IH3A 3RJQB 4YUEL 4S10A 4R4FL 3ILPA 1AGBA 5T1KB 1A7NL 3KYMB 5D71H 1OARL 3IDNA 1KTLA 4LSUH 1KJVB 4LSQL 1FO0L 3W0WA 3O4OC 4GJTB 4I0CC 1WVZA 2LFGA 3MJ6A 1RFDL 1DN0A 4J7RA 4ZTOH 3UTTD 3MBXH 4HAGA 4LLUA 3P0VL 3PWJB 1AQKL 5EPMA 3B5GA 1FJ1B 5GZNC 1N5AB 4HH9B 1F42A 2YD9A 3SKNB 4LDOB 1VADA 4HKJA 3PE9A 4F3FA 4DVBA 2OI9C 4GW4A 35C8H 3AXLA 3B9KB 4CDHA 2GAZB 3RJDA 5T5FL 2HH0L 1F4YL 1IM3A 3CAFA 4LDLB 4DVRL 5HSFA 1UYWL 5GGQH 4RGOH 4GW5B 2VLKB 5DF0A 3ZZ1A 5CJOH 3NCEB 3TPUA 1WBXB 4DAGH 5E5MA 1YEGH 3V52L 3LY6A 3MRPB 2BSED 1QD0A 1B6UA 4Y16C 4M7LH 4U3XA 3AS0A 5I74C 4PJ8C 1VFAB 5DI8A 5F1NB 3TA3C 2WP3T 3ARED 3ARDC 1G0XA 2PN5A 4IEFB 1A7BA 4HWEL 1DQDH 2RIKA 1HINH 4XP6H 3KPRB 3VXUB 2EIEA 3DUSB 5DMIL 5DVNA 3E2HB 4PYHA 1N2RB 4LPCA 2P5ED 5MENA 2ZSWB 5DA0B 3BZEB 1EEYB 4ODSH 4DVBB 1P9MC 2ZPKH 3QZWG 4LSTH 1GGBH 4WEUD 1D6VL 3FZUD 3IXTA 3TIEA 4PRIE 1FYTB 2O5ZL 3HRZB 2A74B 2X09A 5F96L 5HHNA 4XVUC 1PG7L 3O6KH 3QUXB 5IHZA 1KTLB 2HG5B 2CRMA 4OB5H 3LEYH 1T20A 4M5ZH 3DETC 3RBSA 5D2LE 4XBPA 4HGWB 5C0DA 1FZMA 4WJ5A 1RHHA 3KPSB 1NANI 4PRHE 1TPXB 4G8EB 4NKOB 1ORQB 4KRPB 15C8H 1F6AB 5JOFA 4UAOB 5EUKA 1J1XL 3C8HA 2GJJA 4CU8A 5AYUL 1KJ2H 1I1FA 1X5HA 1RULH 5C2BL 2YUZA 1T0NB 1PQZA 5HGAA 2D4DA 1QSEE 4RWYL 5JLZA 1DQJA 4DQOL 1KLGB 3VXOA 4LSPL 2MWCA 1JF5A 4XC1H 3ULVF 5GS0H 4Y89A 3V6BR 4NN7C 3ZE2E 1VCAA 4C83A 4YHIA 4R90H 1EJ6A 3EYFB 4I18A 2Y07L 4PJ8B 3OG6B 4OI7A 1QRNB 2EDDA 3ZE0F 1MI5D 2R2BB 3QXDA 3FO2B 4HMCA 1L0QA 3MCG1 5DK0B 2L0DA 4QKXB 1L4IA 5KS9B 1B9ZA 4YFLF 3TA3D 1KIRB 1A1MA 1A6TA 1HQRA 1SJHA 2R0KL 3BIKB 3KPOA 3MRJA 4DGIL 5ACLA 3BXNB 4EN3C 3CLEH 4MB4A 4ZG1A 2AXGA 5MI0B 1T80A 4AY0A 1ONQB 3KPRA 1XH3B 1P5UA 2W0KA 5T1DH 1GOFA 4LSQH 3I6LD 4HLJA 5FOBB 2I5YH 4YWGH 5HHMD 3VXPA 1YN7B 2XRAH 5MENB 5JMOC 1T1ZB 5CJ8A 2R29L 3O0RH 1UJ3C 1YC8A 4Y19B 1ITBB 3GO1H 3SDDC 3VE0B 3MRMA 1CF8H 1Q38A 2XNAB 3FQRB 4PRBA 3BRFA 2Q76A 3B3IA 4TUKH 1CGYA 4PJDF 1EUUA 2DQHH 3HMXL 4U1JB 2ESVB 4IIQB 1HI6B 1JCKA 1BQHG 1HHHA 2XQYK 1YDPB 1UWEL 2VITB 3J8F7 4XPTH 3TA3B 5TE4H 4GRMB 2NLJB 3BGFC 4PRPB 1RHHB 4M1DL 5CIPB 1PY4A 4HIHA 4NM4H 1M4KA 3WXVL 4MD0A 3D9AH 3NCYS 2ATPB 3H7LA 1E6OH 3LCYA 1DFBH 4PJHE 2Y5TB 1NAKH 4M61B 3CX5K 5J6HB 1CDYA 4TNWF 5ENWB 5TPWH 4FA8A 4HJGB 4PRPE 2D7QA 2VLLB 3T0BA 2I60H 5HGAB 1TJGL 5GJSH 1JZ2A 3BAEH 4E41A 1DQLH 2ESVE 2NY2B 5IFAL 5C0DB 3O4LA 4P9HC 1HXMA 1U92B 3MLTB 1QA9B 4UAOC 4OV6F 5DURD 4HWEH 3B5TA 5FM4A 5DC9B 3T77B 2R0LL 4KJPD 1NBYB 1JYVA 4D0CB 43C9B 5DVMA 5ALBH 1EIBA 2H32A 1I1AC 4BH8A 3WXWL 2A1WL 1UKQA 1ZANL 1QBLL 4U7KA 2XZAL 4KV5E 4DZBA 3X3FL 1FZKB 4LLVB 4MDJA 1TTFA 1FYTD 3VFGL 3MYZA 2OI9B 1IC1A 5FF6A 3MBEC 4PJBE 5I0DA 3UBXA 4X6FB 4JG0L 1JFQL 3CXDH 3QIBA 2HJKA 5I73B 3FFDB 5B8CC 3Q48A 2LAAA 3BZDA 5D7IB 4NKOA 4PGDA 4HIIA 5E6IA 2ZNXA 4ODUB 3JTSB 3GO1L 3O2DH 4JAMA 1R3JB 5DHXB 3BPCB 1QR4A 3CVHL 5F7DA 4FFZH 4LLAA 2YUXA 4DK6A 5F8QC 3FQWA 3MV7B 2IG2L 3QIBC 2AQ2A 1ZT7B 3LS4L 1ONQA 3TJEL 1MVUA 1QSED 3MBEA 3PABA 2V2XA 4U33A 2FL5B 1QFOA 5BJTB 1OSZA 4P23B 4PP2A 3P40A 4UILH 2K1MA 1FL5B 2R0WL 4MXWH 4PJBA 2DI7A 1ZHNB 2NNAA 5LBSH 5C08D 1TCRB 3T3PF 4DWHA 4EZMA 3HUJE 5DHYA 5INCA 5C0BE 3K2UL 1R3KA 1IVLA 5SWSB 4DTGH 1LE5A 1UH4A 2E9BA 5I1KH 4HCRH 4YBQD 1QBAA 4N8PA 2HKFH 2VDLL 5FYKL 5IMKA 3WXVH 3P0VH 1IQWL 1V7ML 1W72A 3FT2B 1P5VA 3TC9A 4JPWH 3O3UN 3MCKB 2FJHA 1G7LA 4HWBL 4XH2B 3T1FA 3DRQB 3EYVA 1CD9B 2F5AH 4ONGH 5EZOL 1MRDH 4HPYH 4NC2B 1VFAA 3WFBL 2CUIA 4S1RL 5T1LB 5BVPH 4MAYA 4OLWL 3FCTB 1L9NA 4LMQI 3AMKA 3RZCB 2A6IA 4HUUA 3SGJC 2XQYG 3V95A 2MPAL 1KNOB 3PABB 5C0BB 2XNAA 3FQRA 1FZKA 4LLVA 4LKCB 4QHUA 1Y6MR 2AJ3B 4LCUA 1XF3B 3SKJL 2ADGB 3O6ML 4GS7C 3UDWC 3W2DH 1D5ZB 4YPGA 1CLOL 3RVVC 4RGMB 1I8IB 2Y1VA 1KB5A 1ZA3A 2EEBA 1S5IH 4YLQT 1BIIA 2B1AL 5FYJH 4OM1L 3C6SB 4XCEB 4L9LC 5C09A 4R2GC 2EH7L 3G04A 5D7IA 1NMAH 3T0EA 4JM2B 2AI0L 3KDMB 1B6DA 3C08L 4C59B 7FABL 5IP4A 1BJ1H 3CD4A 3EJYD 4NKIL 2X7LA 5D7KE 5F89B 1UXSB 1T2QL 1VERA 2CRZA 1LDPH 4WWKB 1I8KB 2VTFA 4UQ3A 1IM9D 1N6VA 1NL0H 1NFIA 4KKBD 4R6UA 3U46A 3RZCA 4Y8DC 4JM2D 4PJBB 2J2ZA 1EHNA 1O0VA 5IGXH 1UADC 5K9OB 4KJQD 2RCSH 1ORSA 5F7DB 1JN6B 5IKCA 2PNDA 2HMID 3D87B 2WQ8A 3IRPX 3RGVD 3TYGH 5AD0A 3GMLA 4GOSA 4FMFA 5JHLH 5I30H 3EYQD 4JFHE 1YMME 4NKMB 4DN4L 5EIQA 5I1KL 5IVXA 1LP9E 2DLHA 3LV3A 5CGYC 3EDFA 3QCTL 1A2YA 3LZFL 4ALAL 2XZQH 3O9WC 2ARJA 5FF6B 1OF2A 5EU4B 5I19L 2AJSH 1E27B 4L3ED 4X6BA 1Z9SA 3QCUL 3R8QA 4P59H 1B2WL 3BW9A 3RP1A 5IF0A 3TIDA 4WFEE 4OJFL 3Q1SL 5HHOD 5C3LD 4HT1H 3QJHA 1AQDB 5C0AA 1NLBL 4PJEF 4GG8A 2F53B 4IRSD 3QCUH 3CVHA 1XGUB 1KB5B 2R4RH 2Q76B 3PUCA 5D7SL 4E5XA 3LQMA 4RX4A 5E08L 3ULSB 2IGFL 4NHCH 3ROLB 1SEQL 3P9MA 3V4VH 2FIRT 3O11B 4NO2B 1X5JA 4WWID 4PGBB 5HPMA 4X6DB 3ULUL 4MNHA 3QUZC 4YBHA 4JFED 5HYSA 1RQ5A 4L8CA 2AJXL 2Z8RA 2G9HB 4U1LB 4S2SB 3T2PA 3QUYD 4Z76B 4BM7A 1UWGH 4K2UL 5C0RL 3NH7H 5KS9A 3LPWA 1Q0YL 5TFSL 3P4OA 3L6FB 1A4JB 2EYSA 2VABB 1Z6JT 1G7LB 2C3HA 2EC8A 3AREB 4XH2A 3VDAA 1HXMB 1U92A 1M7DA 1MAKA 2AEQL 3P77A 5KSBB 1Z9LA 4LHUA 1TTGA 1KCUH 3OMZA 1T3FA 3QDJD 3O8XA 4MGXA 2D7TL 4QNPF 1LO5B 2HA1A 5IBUB 5AAWA 2VZTA 5K9JH 3ZYZA 3ZDXF 2CDFB 5EO1B 4YHOL 5L2KA 3DMMD 2MQCA 1S5IL 5DJ6A 1YNKH 3DSNA 1AP2B 2R2EB 1YPZF 5GJTH 4JREB 4FQQA 2R8SL 3BVNA 3RWGB 2OBGA 1SVZA 5J0BA 5HGDA 4U1MB 5LGJB 2WUBL 3LN4A 2CPCA 4NCC1 1PKOA 4AIZA 2KZ1B 2UWEB 1B0GB 3I50H 3SQBA 1A3LH 4ERSL 5EU7E 5F6IB 4V2BA 4DW2L 5D1QD 2YC1A 3EZ8A 3MOBL 1RZIA 4CADB 1M05A 3FB6B 3BHBB 5DJXB 4CRPA 5A3IC 3CDGA 1JWUB 2YD1A 1NUGA 5I8KL 1J05A 4EN3B 5L0QB 3RWCB 1P84J 2YN3A 1WZMA 4KQ4H 3LKPA 3RVWC 2DL9A 1S3KL 4X6DA 2J5LB 4PG9A 3D0VA 4DGVH 3ARFC 2Z31B 4L4TA 3QNZB 5GGTL 3RAJH 2X42A 2HN7B 1CLYL 2X9WA 4OZIF 5EZIL 1OAZL 3AVEA 4JDZA 1ZTXH 2GIYA 4AQ1B 3QIUB 5DMIH 1EFXA 1CI5A 1N5AA 2BFVH 4JRYB 5SX5K 1FNGA 4G43A 2W0PA 4M6ML 4QTHB 1AXIB 2R1YA 2XKNB 5D5MA 1X3DA 2J8UF 1DUZA 5J89A 2R2HA 4HUWA 4LNRA 3FOLA 4TOYH 4ODHH 4MNHB 2DLIA 3WNKA 2GTWA 1KC5H 3P77B 3C5JA 3GM8A 4WFED 4EI5A 1OAKL 3PV7A 4WTWA 3EOBB 3DRQA 3GMRA 4DGYH 4FQ2L 3WEXB 5EOCL 2Z93A 4WHCA 3TO4C 3DLQR 4YHKL 4YHMH 3L3JB 3OF6D 5CEYB 3VFSA 4MJ6A 1XGUA 4WGWB 2GK0A 1DL7L 4MB3A 4QOKD 5CWSB 1MLCB 3A67H 2P1YA 4K07A 2OJEA 4OLZH 4JY5L 4U6HB 3WUWB 2VNCA 3O6LH 5LGJA 5DD5H 3BSZL 5DQJB 3SO3C 1A6ZB 4PUBH 5HYIA 5D1QC 2XKUA 5GGSB 1KG0A 1MJ8L 5HDBE 3A67L 2XWBA 4QHLB 5D6DA 3S5LA 3J7HA 3T0EB 1GC1C 4EQ3A 2A73B 5AUMA 1DEEA 1G9NH 2WBWB 1MREL 4LSDA 3TV3H 1BMGA 5TF1L 3L7EA 2EDBA 1X5GA 3MA9L 3UTQA 3NCJL 1XR8A 1GOGA 5FAAA 3ZTJH 4LF3B 1FVDB 1NKOA 4MCZB 4G8GA 3DGCR 4BFIA 5IK3B 1F6LL 3KYAA 4OIIL 5A2JH 1LE5B 5I6XB 5D5ME 3SY0B 4WEBL 4ETYA 5GSRA 1FG2B 4BQCA 3ULVL 3FFCB 4L8SA 3WSQL 1JMZA 2LV4A 4F80A 1U8PA 1AGFB 4HZLA 3UXFA 1E4XI 3KYKL 4Q9RL 5EIIB 4APQD 4GRWB 3K7UA 4ZAKD 5LXGH 2CK0L 3EYSL 2PO6D 1AFVH 3CDGB 2VZ3A 4MXVF 3ZMRA 1I1AD 4HG4K 1ZMYA 3Q6FB 1KNOA 4QT5B 3LV3B 3ZL4H 3LEVH 5E5UB 3DUHA 1UEYA 3WHXB 3KWWB 4QHLA 5IIEA 2ZCHL 1LDPL 3TT3H 5DVKA 3TZVA 5L9DL 3GMQA 5EORH 2OR9L 4GUPB 1DQMH 4HF5H 2W9DL 1II4E 2GSGA 4NRXB 3RPIB 1R3IL 2FDBP 3MO1A 2X70A 3U9UB 1OCWL 2HKHH 2DKUA 2DQTL 1ZSDA 2NYYD 4JREC 4WVRA 3BIKA 1R3LB 1OGAB 2BVPB 3DXAB 1SMOA 5DJ0B 3BP5B 1OTSD 4D9QD 1VPOL 4ZO7A 5CEZL 1FVCA 4FQLH 2H2PC 5F9JB 2WUBH 1KSRA 3DPBA 2BMKA 3NZHL 4ENEC 3BZ4A 4LASL 5SV3A 3I3DA 3OV6A 1IE5A 5IB3A 3I84A 1KTKE 2HN7A 3QSKB 3QIUC 5I15L 3H8NA 3NTCL 4U6VH 4MS8D 3NFSH 1R5IB 4N5UA 4MDIA 4XCCL 3UZQA 5IB5A 4JN1L 2DL2A 3THML 2FLRT 4YDLB 1UWXH 3F6IA 4NUJA 5DJ2B 3ARFB 3WIHA 1JHKH 5MP6L 2ZZUT 5D7JB 3AM8A 2B0SL 2J6EL 1J8HD 5EO0B 5MEPB 1ZEAH 1JI2A 3C6LA 5C0CD 4F7TB 5FYKH 1YA5A 1LMKA 3IKCB 3WJJA 2OS7A 4U2ZA 4HFUL 4PD4J 1G9MC 3BP4B 5I76B 2EKJA 1UG9A 2VDOL 4YO0A 3QPQC 2F5AL 4ONGL 5CJXA 2BSRB 4WV1A 2DMBA 3TVMA 5I2IA 4H1LG 1ZEAL 1TLKA 3VWKC 4M4RA 4XXDA 4S1QL 2ICWB 3REWB 2E6QA 3MLYH 4XB8A 3IF1B 5E70A 3RTQC 1DL7H 1I9JH 4DW2H 3FQTB 5FGRA 3KS0J 3QISA 4ZO9A 5CCKL 5AWNL 4P5TC 5IB2B 3O6FD 2QQNL 3GJEB 4U1SA 5SWQB 2DWDA 3O81A 2AKRA 2AJZB 5CJQH 5DT1L 3IGAA 3W9DA 1CU4H 5I8CB 2FJFB 3ULSA 5ISZE 1NCCH 4Y16B 3HI6L 1ZS8B 2P42B 1CDHA 5AZEL 1CXEA 1Y0LB 2DF3A 2DM2A 4UILL 2Z31C 4AEEA 1IM9A 2CLZB 4F33B 1YEIH 1K3ZA 3GM0A 2DQCH 1EHAA 3U0PA 3FQXA 4D94A 2P5WE 5F9WB 4BK4A 5HYJA 3AC0A 3ZKXC 3MFGB 4TQEH 3UO1H 3C87A 4JFZL 4M1DH 3KXFE 2NY1C 4ELMB 1AHWB 3HR6A 4JRXD 1DR9A 2QQLL 1T2QH 2VDML 3RPIA 4LVEA 4MJ5B 3QP3A 1JWUA 4Y2DA 4L8SB 3VFGH 1G0DA 1V5JA 4MA7L 5ESAA 5KN5B 3JTSA 5LG1A 4JM4L 1IBGH 2D9CA 4L5FH 3VG0H 2DM3A 3HE6A 2E6PA 4QCIA 2P45B 3SE3A 1MEXH 3Q6GH 1MFCL 3CXDL 1MJ7H 2CJUH 4WFGE 2ZOLA 5CIPH 4YHKH 3ZLQC 4YXHL 3QUXC 1NGQH 3RGHA 1LO5A 3VGDA 5GS2H 4TSCL 5ETUB 1LO4L 3KLAA 3JV4A 4X9BA 3ZDXE 2BSTB 1YYLH 3SDCB 5HYJE 1KJVA 3ZKND 2KBGA 1MCIA 1TVDA 1RZJH 5L2KB 2IAMD 1OAYL 3BEWA 5EUOF 1KIPB 5INDA 2O61B 5GJSL 1G9MH 4X4XB 4P2CG 4P2OD 3VA6A 2W0FA 4X99A 3MJ8B 2Z91B 4LVOB 5KVEH 3QIUD 3OHXB 2EIZB 3QPXL 2DS4A 3MLZH 5CAYB 5A2LH 4JQXA 5D6DC 3HG1A 1NC4D 2XWTB 4L9DA 1RIHL 1S7SA 4P9ML 5HDQH 1U8KA 2GJ6B 1KB5H 2VR5A 2J6EA 4ODXB 3GSXA 1Z5LB 4XWGH 1K8IA 4DQOH 1SYVA 4F57H 3RL1A 3DARA 3ESVF 2VXQH 4ODVL 3C5ZC 5CD5D 1FCGA 2YMXL 1J05B 2CH8A 1SJEB 5IBTL 3OGCB 2P7TA 3PDOB 1HNGA 1S9WA 3O6MH 3W2DL 2NY3C 5IB1A 4R4FH 5C8JB 4HXAL 2H3NA 3NOIA 3LSOA 2AJ3A 4M5YL 4C55A 1I1FB 5HXMA 3BD3A 4NO5A 2J8OA 4GXVL 5B8CA 2CUMA 2DYPA 5LKNA 3RI5F 5IFHL 3EOTH 4ISVA 4NN6C 5DJ8A 4JHBA 3L3OA 3KPLA 3WFDL 2V7NA 5LQBH 4P46D 2Z92B 1NGXB 5C71A 3WHE0 4P4KC 3Q3GA 4K8RH 4OIBA 2GJ6A 4OZFA 1J0YA 2VXTL 1MPAH 2UWEF 1KFAH 4XT1C 1FORH 4G9FD 2ZUQB 3LRSB 4BZ2L 1BLNA 4QRTA 1FYTA 2DLFH 5C0BD 1WBYB 1IGTA 3MBXL 2BSTA 3RVVD 3TO4A 1BVKA 1MFNA 1BAFH 4QRPB 4FP8L 1WK0A 4F7CB 5B38A 1LQSR 1N5YH 3V52H 5KJRL 3C8KA 3TBTB 2NR6D 4PRDA 3JSSA 4NQXB 5I73C 4Q2ZA 3LKQB 4X5WB 5B38G 2ZUUA 3SKMB 4GG6A 3UPAA 3CFDA 1DLFL 1BM3L 5IQ7L 3VFOB 4EI5D 4RRPA 2EDHA 3GSNA 3O3BB 2Q87A 2MQ3A 4RBPH 1WFNA 3RY6C 1Z5LA 2YPKB 1KJ3H 4MB5A 4RRPG 4YAQA 1MCPH 3V7AG 3CFKB 4P9HH 2FBJH 3SOBH 3SDCD 5JTWA 4YHYB 3E3QE 3UZEA 3IU3A 1MFEL 4GMTH 4XPBH 1KGCE 4ZTOL 5BW7A 2YPLA