4PJBE

Structure of human mr1-5-op-ru in complex with human mait b-f3-c1 tcr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
197
structure length
188
Chain Sequence
QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCASIDSNYQLIWGAGTKLIIKPDIQNPDPAVYQLRSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNDFACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
total genus 36
structure length 188
sequence length 197
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjbE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjbE02
3H3PH 4N8VB 1YC7A 5ITFA 2VN4A 5GQBA 1IEAA 2OJZL 4TPRH 1FZMA 3IDYB 4FQ2L 3TN0A 3U30B 2I5YL 2R0WL 4F2MB 4LHUG 4G42A 2B1AL 3VA2C 3VWJD 1SEBB 4LNRA 1VEOA 5SWSA 1XEDA 3I75A 2IH3A 4ZMAT 5ESQB 3ZT6A 3NIFE 2EEAA 3DXAA 4O51B 4W6YB 1BZ7A 3REWA 5HHOA 3U2SB 4JQVA 4YFEA 5D7SL 3RZCC 3CUPB 3DUSA 1BBDL 2DF3A 3CH1B 2HLAB 4X6CF 1JJUA 4LGRB 1EO8L 3WN5B 2GJZA 2VKWA 3EYQC 5GGRA 4GFTB 1FVEB 3IFOA 2IBZX 1F4YL 4K3GA 1FG2B 3CNKA 1DVFA 2PYEE 3QUZB 1VFBB 2M2DA 4ZFOA 2NXZB 1S9YB 2PXYD 2C1OB 1ZA3A 5MP6L 4AG4L 4UT7L 2CR6A 1D9KB 2ADFH 4OTXH 3SKOA 5C86A 1W72H 4LCWE 2E9WA 3ZKXC 3KYKL 4HBCL 4LSRH 4OZHF 4MVBD 3GGWB 3VRIB 3VXRB 4ZD3H 1EO5A 1FGVL 4S1QL 3BAEL 1I1AD 3HNSL 3BKCH 2JJTA 5DTFB 1NCNA 1J10A 3DURA 3STLA 1KGCE 2VDNL 3QUZA 4M00A 3WD5L 3LQMA 5J13B 1YN6B 4ODTH 4PJDB 2YBRB 3U6RB 1S7XA 4GMSH 5CUSL 4EN3D 1Q1JL 1JPFA 1QBLH 3HR6A 2HJKA 4LPCA 5KSVB 1HSAB 4N1HB 2OJEB 1MRCL 2VWEE 1CDBA 2DAVA 4WV1C 3GSRB 3VGHA 1YMMA 2QL1A 4MNQD 1HXMA 3QEGH 1F4YH 4NQEB 4O58L 2XA8H 5FYLH 4PBXA 1PX3A 3QUKA 4N0FB 4OZFG 3DRQB 3TH3T 3EYOB 4JR9H 3GMPB 4XCYB 3HC0B 3UTQA 1NQBA 4JGMA 4LHJB 1Y0LA 4KRPC 4C4KT 1U58B 5DQJB 1HH9A 2V5MA 4NSKA 1QA9A 4N1EA 5HD8D 1MF2H 3FQNB 5J89A 1YEHL 1AGFB 1LK2A 4POYA 4H25B 4P2QD 4MZ2A 4G9FA 4M61B 4N0CC 5SX5K 3O4LA 5C07A 3NZHL 5FOBB 3TESA 5K9QI 1MFBH 4UDTA 3MZGB 4V2BA 1P2CA 3ZHDA 1F90L 1VACB 4HW6A 1TCRB 4FMFA 3L3GB 3NBNA 1G7QA 5HDBF 5CIPH 3X3FH 3MNZA 3O6FD 5MEOB 3PWJA 4X6FA 5J11C 1CLYH 1KXQE 4PJGA 2BNQD 5CLWA 1MRCH 3L6FB 5TE4L 4FFYL 2X4PB 3VWKD 5CEXA 4ORZC 1OTTD 4QXWA 4ODTL 2DWDB 3GBNH 3GJEB 4FP8H 4G6AC 4NBZB 5E2TL 4N8CH 4GRMB 1LP9F 2YPVL 1UCBH 3H0TB 2Y1VA 2YA0A 4R4NC 4XRCA 4OGAD 5F21B 2PYEB 2J6EH 1A1NB 3ESUF 5T1MA 3O4OB 4P5TB 4OF7A 2P5EA 3LKNA 3BZ4B 3U0WH 1OF2A 1A0QH 3RPIB 1VSCA 4QRTB 1F11B 5EO1A 1QLEL 3RDTD 4I9WE 4I0CC 3K4ZA 3MC0A 5GZND 5DYOB 5CJQH 3TA3A 3EDDA 3ABZA 4RDQG 5I1JH 1HHGA 4HUUB 4D0CA 4GSDL 2EDNA 4EI5C 1T21A 4PRBA 1KPVB 1KB5L 3D3VA 4UV4L 5DUMH 5AD0A 3GJEA 3SGJC 3CLEL 2BOCA 4XGZB 4XNZC 4G9DA 4HCRA 3EYVB 1KIPB 4FQJH 2WQRA 4CADA 3KPRA 1F00I 2PO6D 1U3HB 3OGOE 5D6CA 4DZ8A 1AFVL 2BSTB 1RJYB 1T2QL 2CR3A 3UJIH 4UU9B 3X3FL 2R1WA 3SKOB 5KSUB 4P9HL 4HWBA 1NAMH 2DQHL 1CBVH 4K2UL 4ORGB 2A1WL 1SEQL 1MJJA 1XF5A 1J18A 1S7TB 2VZ3A 4KTDL 3SKNA 4KI5F 3BDYL 3O4LD 4M6OH 1ZT7B 1JGVL 1IQWH 3PUCA 4CUCA 5ENWB 1P6AB 4PRPE 4K3JH 1V8HA 5E94B 1DLHB 1HQRB 1C16B 1MAMH 2DQEH 4ONHB 4XPTH 5JDSB 1EK3A 4NKMB 4UTBL 1R3JB 4LSTL 2V2XB 5IFHH 2ZPKL 1J88A 3VJ6A 4M3JA 4J3XA 1FZOA 3O3DB 3VFUA 3T65B 1BFOA 1MQ8A 4OZ4B 5I8EB 4H8WL 2FH6A 2RFXA 2W0PA 4G3YH 4RFEB 2G5RA 2AJVH 2OR9L 2FGWH 2IEPA 3ECBA 3I2CL 3QDJE 5SWSE 2DQCL 1HINH 1I3GL 3FFDB 4XVTH 5GSVB 5DHYA 2WIMA 4MB3A 5FGRA 2X89D 1BJ1H 2AXHA 2YPLE 2FBJL 1T7WA 2LVCA 2LFGA 1T0PB 1DP0A 5ADOH 2P8LB 3JBG7 1FH5H 3SDXF 1SY6H 5JOFB 5BO1L 3OZ9H 2WK2A 2VXVL 1LO5A 1DZBA 1B9ZA 3GM0A 1MCOH 5FUOL 4U6HA 1Z0MA 2ZKHL 5I15H 3CC5B 3O6FB 2UVFA 4UNUA 4MJIA 3BZFA 2VDQH 4AEIH 3VWJA 4QRPA 1T1WA 1EERB 3NTCL 5GRJL 1ZA3B 4FN0A 1PKQA 3JWDC 1MPAL 4UOJA 4XNQA 1LILA 4MS8C 3RHWK 4PY7A 3CMOH 4YHNB 1T83C 4BA8A 1F3JA 2APTA 4EXKA 3MJGX 4JQXC 5D1ZC 2AAVA 3INUH 1T7YA 2JF1A 4X0KB 3BUYB 3CXDH 1DEEA 5FO8B 2A6DB 3BMWA 3C6LD 1MCQA 5ICYA 5AAWA 2NCMA 1KUMA 3HNVL 3C60D 3MMEA 4IS6B 3TO4C 2OR9H 4HIXL 4G8EB 1FO0B 4M6AA 4ODUA 1IT9H 2QV2A 1SBBA 3VGFA 1YC8A 1CLCA 2DWEA 3AB0B 5IHUH 4NN5C 4U1NA 2E8ZA 3V6ZB 1X5XA 2YRZA 1HXMB 5MI0C 2BOCB 2XFXA 3NPSC 2P45B 1ADQA 4NNYB 5CZXC 4AEIL 2WP3O 3NTCH 4MDJA 5FEBA 3B6SA 1I1AB 1T6VN 4NHUB 4GAJL 5IW6A 5FUOH 1FGVH 4QLRA 3O3EA 4P46C 3ZL4H 4I4WB 3MLXH 5C09B 5T1KD 5DVKA 5J12C 2LAAA 1KLGA 3LDBB 2IANB 1CFTB 1NMBH 3BZDA 1JV5B 4UB0L 4U31A 2Y36H 4YDJA 1NGWA 4R0LC 3MRLB 3SO5A 4BELD 3QDJB 3D39A 5HGGS 4NZRH 1G6RB 4MQTB 1A3RH 1B90A 1BFVL 2A6KA 2EIBA 5HDQH 4AM0B 2VL5B 4D0DA 1I8MB 4YAQA 1X4ZA 1JHTA 2B1HL 4I8DA 3FZUD 5I8KL 3ARZA 1ZT1A 4NQVA 3PGFL 3L6FA 5C3TA 1KB5B 5I17B 1BLNB 1OWRM 3D3VD 1E27B 1B0WA 1WWBX 1F5WA 5I66A 4PJCB 1H3XA 4WO4B 1I7UA 3QFDB 4N0UA 4MA3B 5ALCH 3TYGH 1RURL 3TT3H 1PFCA 4RWYH 3QO0B 5D7LA 3B83A 2AS5M 1FNHA 1CF8L 1IC5L 5GS1A 5HHOB 3FFCB 4FQHA 1QG3A 3B8SA 1T1YB 2MPAH 1UCTA 3RWFB 1YECL 3N0PB 1XF3B 4QWWC 3B5TA 4IOFC 2CO7B 5DLML 4LCIL 43C9B 3SGJA 1FE8H 3MRIA 2WUCH 3MLSL 5GGTL 4QHKJ 4RGMB 4LEXL 4MJ5B 3SE4A 3AS3A 5J6HB 5E8DL 4U33A 5DEGB 5LWYH 4GW1B 1BZ7B 4EVNB 2Z35B 3ORJA 3VXOA 5F6HI 1KJMB 3RX8A 4QRPB 4JFZL 1KG0B 3WIHH 5GS1B 4D3CH 3CDCA 3D87B 3KPOB 1W72A 3FT3A 1SYSB 2CDFB 5TQ0L 4KVCL 3PL6A 4Y19E 4WFHE 1ZHLB 3VRLE 4QCIB 3SKMB 3SDDB 1XGRA 4RMVA 2AJ3A 1HZHH 4WU7B 3DX9B 4XH2A 4H8WC 3H6JA 4NYLB 2ZCLL 5GGSA 3MUJA 1S3KL 3NCBB 5FO9B 4X6BB 3BP6B 3ARGC 4KI5D 1JBJA 2LVEA 5D7JA 5IBUB 4ZNEE 3DGCR 1DQJA 3DSNA 3KPRD 4I5BB 4F57L 3D3VB 2FJGB 1T5XA 2FR4A 2CXGA 4HC1L 2PUQT 4PJEA 3EJYC 4XX1G 2C7UA 4PGEA 4OCNC 2HWZH 4HUNB 5IB2A 1EBPA 5HHNA 3TLRA 4MNQB 1UM5H 2R2HB 5JHDD 1QP1A 3FQTB 3MRQA 3HE6D 2CKBH 3B9DA 5HHVL 3T2NH 1OHQA 2XQBH 2XRAH 4DGVH 4NRZB 3P9MA 1NGPL 1P5VA 3VXNA 3FTGA 3SGEI 1WV7T 3BIKB 4AIZB 5CEXB 4LPYA 3M45A 3EYSL 3QRFM 5D7LD 2P7TA 4FNLL 2VR9A 1E6OH 1JHLH 4KK6C 3WHE0 3L7FA 4HJJL 1NCTA 2NY0B 5C92A 2XXMB 1B0RA 3QHFH 1TTFA 4U7KA 4G7YL 3SY0B 2A9MH 4XBEH 1GZQB 4PRDA 4L3CA 5JLZB 2QSTA 5IQ9B 4LLYA 1RUAL 2ICEB 2Z91B 3RA7L 3UZEA 1RK1A 4OZHB 3MROB 4PYGA 4EKXA 1H3UA 3QXAB 1RZIB 4K23H 3V6BR 3EO0B 3STZA 1G7JB 1DBML 3RVUC 2HFGL 1N64L 1KF9B 1MHEB 1RJZA 3U1SL 3B5HA 4HS3B 3MRQB 5IR1A 4I3RH 3PXJA 1QLRA 4G43A 5F9JA 4Q74A 1L7IH 1OARH 4G5ZH 5GGQL 4FQHB 2HTLD 4PJFE 2R2CA 3MRDA 1XF2B 4M7JL 2ED8A 3MRGB 4L8BB 1RZKH 4UI2A 4XCFH 2GCYB 1P5UA 4R97B 4LRNL 4MJ6A 2UUDH 2UWEE 1IAKB 4QEGA 4HMEA 1RZFL 4JCLA 1A5FH 3HZMB 5E6ZA 5LAXA 5I8OH 3K46A 2MOVA 4NWTL 3OZ9L 4F33B 3ARFB 1RULL 1IZKA 4OLUH 3RBSA 4MXQD 5D9SB 2FL5A 5EZJB 5D7IE 2ADFL 1P1ZA 5BS0B 2JJWA 5EFIA 5I9QC 5J6HA 5LQBH 4M6MH 2HLFD 1D6VH 4KC3B 2P48B 3L9RA 4V1DB 4P4RB 1FYTA 5CUSH 3O2VH 4PRHE 1NFIB 2WUBL 4MJ2A 5EA0L 4F37K 4HWBH 4JANB 5SWZB 3BKCL 3MRGA 5C0JA 5I0ZA 1GXEA 3SGKC 4E41D 1YNLH 5K59E 1RUMH 2BRRL 4PB9L 3WKNA 4TNWK 2A6DA 4AEHH 4IMKC 3L5HA 1QFOA 1IGML 4FTVD 4QCIA 1H3PH 3JVGA 3UZVB 5MHSD 1RZJC 4HUWA 3VFNB 4YEFA 4HX1A 1NC4D 4JQIL 3I6KA 4OQTL 3T0WA 2ZSVA 3OX8A 4JB9L 4DN4L 1P6FA 4NUGL 3BZEA 1W0YT 1W2KT 1ITBB 2HKHL 4LHUB 1SJHA 4ISVB 2E7BA 1LP9B 4PGDB 2OK0H 3O3UN 2BERA 3RWDA 4UQ2A 3GSXA 4L8DA 5C0AE 2N4IA 4NQTA 3RHWF 1UENA 1ZK9A 2AJSL 1GC1L 4FQIH 5ANMA 5T1LA 4CGTA 5C08D 2W1NA 2VLKA 4P23D 4BQ6A 2OCFD 4H20L 4OIIL 1AGBA 2R2EA 5C9JA 3BOVA 2D3VA 2XKNB 5B8CA 5ESVA 4HIJA 1IC7L 1ZHKB 5GIRA 5E08L 2Z93B 4QRRB 2OP4L 4ZXBD 4XNUL 1S7UB 4JZOA 1QKZH 1C7SA 4GXUN 1JWSB 1OY3B 1MUJB 5J12B 1Z3GL 2DM7A 3MREA 3LS4L 1UZ8B 5IVXE 4NWUL 1RJLB 3KWWA 3RNQA 1FC1A 4RIRB 3CVHL 3K2UH 4TQEH 1QLEH 1CFNB 5JR1H 1CTOA 3A6BH 5BZWA 4KY1H 3RP1A 1NCWH 4CBPA 1B0GB 1GGUA 1GJIA 4NKDB 4JKPH 3M8OH 5E2UL 1ZKAA 2X4OB 1IM9D 2FX8H 1DQDH 1VGKA 3QXAA 3S36L 1BIHA 2Z91A 3LQAH 3WSQL 4NNYA 1CD1B 2ATPB 4ZAKD 2XWJA 2MHAA 2X6MA 5FB8A 2IQAB 2ZUWA 3BISA 4Q6IB 3GHEH 4E5XA 4M3KB 4RGNC 4PJGF 4OZGA 3N9GL 3MRPA 1T4KB 3WS3B 4A2LA 3GRWA 1FAKT 5I30H 4R0LB 3HUJE 4ODUB 3V4UL 4PRIE 43CAB 1FPTH 3QUYA 5CEZL 4ETQA 2VXQL 2E7MA 2MQCA 3NABL 3PABA 3Q48A 4YHZH 4PD4K 2DIAA 5DRWA 1SBSH 5HHME 5I8EA 5TGBA 1FGNL 4EVNA 2HN7A 1ACYH 4MQ7A 4OBRA 1IC7H 3O3BB 4YDLB 1EEQA 5IHBA 4G9DB 4XNYH 3V4VL 5ECJE 5C0CD 5DVLA 3GI8L 3E8UL 4WI9A 2IALA 3ILPA 2ARJA 3MBXL 5AG9A 3C8KB 4DVRH 3D1MC 1NAKL 2VRAA 4S2SA 2B20A 5T3ZD 3TYFA 1B0GA 3SCMC 4Y4KC 3C08H 5H2BB 2YPKA 2B5IB 1MI5A 2H9GB 3EOAA 1FFRA 5IMLA 3OF6D 3SGDI 2H2SD 2RIKA 1MJJB 1WICA 1RMFL 1VEPA 5BS0E 4JANA 1KTDB 3MO1A 5SWZA 5C0JB 1OPGH 4NQEA 3TBWB 2DQEL 4WCYL 4XPTL 1IFHL 3ULSA 1A2YB 4LSVL 3F7QA 4M7LL 1N6QL 1LDSA 2QADC 2B4CL 2FX8L 3TJEH 1FO0L 4KJQD 4V1DE 3IAPA 4ZPVB 4Z7QF 3DROB 5E6YA 5TPWH 2HYMA 3E6FB 4JVPA 5HVGB 1R5VB 4P0DA 4ZOBA 3TZVB 1ZT1B 3O6ML 4NQVB 2FJHA 3V0WH 4JPVH 4LLMB 4X9IA 3EZ8A 3P77A 2MJWA 3CCHA 3GFUA 2VLLB 4QOKE 5D1XA 3VFPA 5BW7C 5J56B 2ADIB 1A14L 2Z0BA 1T0MB 5BV7L 4AENA 1Q72H 4ZUVB 4KI1A 3QG7L 1MLCA 1X5AA 5ALBL 5EOCH 4ODSH 3GSXB 4PP1D 1TFHA 2GAZA 4YHIB 4WI7A 2YEZA 3UYRH 3CIQA 4MXQC 4FFVD 4F7TB 1S5HB 3EFFA 4MD4A 3IDMA 5ETUB 3RZCB 2DL2A 4A6YB 1I9EA 4NN7B 4XBPB 5EIVA 4PJ5E 4YE4H 4NC0B 5IBUG 2OZ4A 4XVSH 1MFAH 1NPUA 2OLDA 1DSFL 2UWEA 4XPFL 1YMME 4KVNL 1FFNB 1VFMA 3L5WA 5C0CE 3MRIB 2Q86B 3KPSB 5H37G 5DRNA 5IHZA 3VD4A 1FVDB 1OOAA 5JQ6H 3MUZ1 3ARTA 4HF5L 4HX1B 5DVOA 5EO0A 3FO1A 2ADGA 2AQ3A 2HMIC 1MRDH 1K3IA 3C5SA 3CH8A 3LEVL 1OM3H 1ZHBB 3CVHB 3ARGB 4YXLL 1FYTD 5DI8A 3HPJB 2DKMA 4L1DA 3Q3GB 5JA8B 3F65A 2XTJB 3GBMH 4UOW0 1S7QB 5F88B 1A3LH 4JFHE 2AERT 2OJEA 1FYTB 4HQQH 3ZDZE 4L4VB 5GJSL 4RRPG 1GOGA 1DVFC 4WUKH 1NLDL 5F97E 4N90E 3QEUA 1CI5A 3VFMB 4BUGA 3UROR 1CICC 1QSEE 32C2A 5ACZB 4JKKA 3L7EA 2XN9D 2H8PB 3C5ZB 2R0KH 2HAZA 4PJGE 3QUMA 3FTGB 1AIFB 1ROWA 3AU1B 5T3XD 3RZCA 3X3GL 4CVXA 1LO2L 1IAKA 4KHTL 3WXVL 2G2RA 2FIKB 3RDTC 3F8UB 2BNUB 4FABL 4KUZH 5HDBE 1RJYA 3HMXL 4WO4C 2EC8A 1CG9A 3KLHD 1XZ0B 1IAII 3QEQE 5IOPA 3H9SD 4XMKH 5KSBF 3BDYH 2HVJA 5I1GL 4NUJA 1U8QB 4LFHG 1IGYA 3MLRH 3PHQA 4NO3A 4N8VG 4WI2A 3VGAB 5D1QA 1FV1B 4YC2B 1EEYA 3GMOA 3O8XC 4RMTA 3RL2A 2DN7A 2V9TA 2BCKB 1MAML 1HSAA 2A6IB 5C0FA 5GGVY 4PBWD 4FQQA 5I9QB 4Q9BA 1EMTH 5TDNB 3RWEB 4YXKH 2E9JA 2Y5EA 3C6LB 3MUGB 3U2SA 2X2YA 1MIML 3EO1A 1BBJB 3ZT5A 2HFFA 1MCNA 3QEUB 2BJMH 4G8GD 3VFMA 4ZFFA 4Z7WB 2YPKB 2R2BB 2ITCB 5FAAA 3IDGA 1V05A 3KS0J 2VXSL 3BDBA 4QY8B 4YGVB 1MY5A 3TV3H 3TT3L 2EEBA 4DWHA 1ZAGA 1UADC 2VLRB 3B4NA 1CDCA 5EBGA 4NRYA 5D2NB 2AV1B 4F7PA 1QBBA 4JB9H 4KK9C 1N5AB 2WQ8A 5FOBA 3VXSD 4BSVB 2BVTA 1YNTB 3HG1B 1DQML 4WDIA 5IEHA 3TYGL 3BE1H 3S35X 1BIIB 1ZA6A 3K8MA 4CDGC 4F37F 1CCZA 5GS2H 2BMKB 1BF8A 2X1QA 3ULVC 2R2BA 3KHQA 5C0RL 4IMLB 3CFJB 1PJ9A 1T80A 4XI5D 4OZGE 2XTJE 4UV7L 1K5NB 4A6YA 4O51A 1QBAA 1TCMA 5FB8B 4NKIH 1KIQA 2FJGA 3EDFA 3IDMB 4G8GE 2HH0H 1MHPH 1IEBB 2JK5B 1JWSA 5ISZE 5BQ7B 5I1IL 3TPKA 4AY0A 1U9KA 5I1AA 1QSEB 1SYVB 2CQVA 2VDML 2NW3B 3GNMH 4JFZH 1AC6A 4FFZH 5GISH 3L5XH 3T0EE 4TULH 5T33L 5A2LH 3MRMA 4YHMH 2O5XH 2I9LB 3U9UB 4LAQH 2D7NA 5IVOA 2IPKA 5LXGH 1OLZA 2FYYA 3QEQD 3MLUH 1XGYH 3P0VH 1BJ8A 4U1SB 2ZCLH 5IP4A 1VKXB 2DI8A 3OKOA 1FZOB 4EOWL 3RZWA 2KUTA 4WIQA 3CPLA 3O4LB 1MI5B 1QSVA 3FO0L 5D1XC 1TZIA 3CFKA 4KKAD 4ALAH 1OW0A 5D7KE 2D7OA 4JRXE 3SJVB 1BJ1J 4WI6A 2JKXA 5J13C 4FQCH 4M7KH 3HNTL 1PKQE 4CVXB 1FFNA 3HNSH 1JYVA 2ERJC 4JY4A 3QUMB 3MA9L 3DMMA 2HLAA 2LU7A 3DRQA 2F5BH 3ULUL 4OLXH 1G9NH 2IBGA 5FFLA 1R5WA 3LKQB 4ISVA 1BQHG 4KKCC 5JHDB 3DHMA 4U1SA 3ARBC 4GXVH 3SGKA 4JVUA 1VFAA 1NAKH 2H3NB 4M93B 5EUOF 5FF6B 4HCRH 2ZSWA 1DVFB 4JRYB 3HB3C 3KJ4C 4M9PA 3QJFA 2BVEA 2ZSVB 1U8OB 3OX8B 4AT6B 5FA4B 2J3SA 5E8OB 3UTZA 4F8QA 4LSUL 4HKBB 3FOMB 3V4PH 4NCC2 4YZFF 5T33H 3OKEB 4EDWH 5C0EB 4JFDA 1BFTA 3LD8B 2XA3A 4XBPA 1UM4H 3H42L 3WFEH 1EUUA 3ARFA 4UQ3B 1AQKL 4QOKB 3LH2H 3N85L 2DBJA 2W65A 2J6EL 3GSQB 5L9DL 5DC0A 4GSDH 3D9AH 4RISH 1U0QA 4Y4FB 2NZ9C 3AMKA 4FZ8L 3CXHK 4KV5E 1IJ9A 4NN7C 4HT1L 4WW2C 3BYYA 5E5RB 1N2RA 4FFWC 5E6IA 1J86A 4N9GA 2KZ1B 2WNGA 3I3EA 5I8CB 1JNHB 3VFSB 1PZUB 4GRMA 1XGPB 2X42A 1ERNA 4DGYH 3GMOB 1RHFA 1JUFA 5EBWA 5DHVA 2DI9A 1DSFH 3N1PC 1DN0B 1DE4A 1QRNA 1YEJL 4Y19D 1KIRA 5D1QD 5HGDB 3T08A 3E3QE 4YPJA 3DV6A 3PDOB 2ZUUA 4GRWE 1D6VL 1S8DA 5D5MF 5H2BA 1FORL 2QQQA 4N5ED 3RTQD 4P5KB 4U1JA 2Q87A 1X44A 1AGDB 2YD3A 5L7XL 5CZVL 1MJ7H 3VRLF 3KPOA 1KPRB 3K4AA 5KS9B 5GS0L 3QPXH 2K1MA 2ZOKA 1UJ3A 3BUYA 4Y4HD 3ROOA 4GG6E 4HAFA 1QBML 3DMMD 4JRXB 1A3LL 3CSGA 1FL5B 2DRUA 3NCFB 5GRXG 2QR0A 5T5NG 3FQNA 3QPQD 4JO2H 3T0ED 1DBBH 4L4VA 3VD7A 1DBKL 4XBGA 5J7CC 1M71B 1R3IL 4QTIL 4UMGA 4ZUWB 1WVZA 4B41A 4PJIF 3RVTC 1FZJB 4PV8B 3ZKMC 5JIKA 3CSYA 1S7TA 4WVRA 3CUPA 2ED9A 2J12B 2AW2A 1V3LA 5E99H 5F9WB 4OCSL 4ORGA 4KDTA 2BSRB 4MJID 3OJMB 3F6IA 3T3ME 3UMTA 3GB7A 1MUJA 2Y5TB 1CGSL 4H1LH 4K3DH 5DGRA 3U82B 3I6GA 1CR9L 2NXYC 4MXWH 5DRXB 2NY6C 1JRHL 1F3DH 3I6KB 3P9LA 5JMRA 3RU8H 2YZ8A 4PJ7F 2Z4QA 1IL1B 1U6AH 4XI5C 5DK3A 5DDHA 2VIRB 1N4XL 3FQRA 1BVLB 3GSUA 3BEWA 4HIEA 5IWLA 4PJBB 5D1ZD 3TPUB 1OQOA 5EBMB 1A6VL 4KWUA 4J23A 4ZNCD 2EKSB 4U1IB 5A2KH 1JCKA 5E08H 1G1YA 4D9LH 2APFA 1MFEH 3DUHA 3I6LE 4U2ZA 5CHNB 4Y8AA 3SKJL 3MV8E 3B9KD 4P3CL 1YEFH 1T6WA 2XTLA 4JHAH 5E4EB 5T3XL 3VDCA 2O93L 5B38A 4HKJA 1B6UA 3C60B 3MRCA 3MNWA 1T04A 1YPZB 3IKCA 1NANH 2BC4B 3IFPA 1J1XH 2APBA 2YUWA 4EN3C 2MKWA 3ZSSA 4QYOB 3VFTB 3GSNA 3MOBL 1RZGA 1FZJA 2DQCH 3MRRB 3QFJA 3L95B 4YDLC 3W0WD 3OXRB 5AZEL 2GK2A 3DETC 4K71C 1AC0A 2OMBA 4JFED 5DSCA 3QWQB 2VDPH 3P11L 4JQXA 5HYJD 1Y18A 1RUKH 4LASL 3ESVF 4L3AA 4X6CA 3DXAE 4J7RA 4ZDHB 3B9KC 4MNHB 4U49A 4EN3A 3P0YL 2QHLA 1MCJA 2VQ1B 3I75B 3X17A 4ONFL 3KPNB 1F2XK 3VGDA 1CGTA 4WWID 3CXHJ 4CU8A 4U4BA 1ORQA 1AGCB 2P8MA 4ODHH 4N0CD 3VE0A 3FN0H 4PLOB 3K4DA 1JK8A 3LAFA 1U8MA 3G04B 1KN4L 2Y9RT 2HT4D 4KJYB 2XWJB 5D96B 3MOAL 2R39A 5D9SA 2PCPB 4P3DB 3VD9A 2VDLH 5C6WH 4YHYC 4XWOC 1PG7H 1S7SB 3D5OF 2BK8A 4Y88A 4PJHA 3FZUC 2CK2A 4XMPL 5ADPL 1G6RA 5I1DB 1ZHNA 1AH1A 2R4RH 3S5LG 3IDUA 1WFUA 2VQUA 3F7PC 4ZXBB 4YHML 4XPGL 3IVKA 4PLJC 3R1GH 4JFHD 2XA8L 2KZWA 3BQUA 4N8CL 4OI9A 5FYLL 1BPVA 4F7MA 1VB9A 1OTUC 4CRPA 1X6LA 2GFBB 1P4IL 1UQSB 5EBLB 2QHRL 4YHIA 4KK8D 4LPXA 1YYMH 4G8FA 4P5TA 1HDMB 5C08B 3LN9A 3QUXA 5L8JB 5MENE 4PJBE 5BZDA 4JFDE 4PTTA 4OFVA 3MBED 5FA3A 1S7WA 4IRJB 5F96H 2C3HA 1HILB 1MFBL 4LKCB 4G9FD 3SDYH 1YMMD 1CFTA 3QDMB 3UAJC 1WBXB 4Y2DA 5HGBB 2X4QB 3GK8L 3QCVH 4ZFGH 2AABL 3TO4A 1EVTC 3QFJD 1T20A 3GIZH 4WTZA 4UQ2B 1AQDB 1TJIH 5L2KD 3W11D 4XHJD 1QQDA 2C1PA 3T3MF 4GW1A 4F7CB 5JHLH 5DDHB 5KTEL 2I25N 4P9HH 3PF2A 3GM8A 2OL3B 1I75A 4J4PA 3U4EB 2NY2B 3WIHL 4CNIA 2DKUA 1CVRA 6CGTA 5T1LD 3BWUC 4UUJA 4X7SH 5D2LF 4OV5A 4KVCH 4JM2F 1BVKA 1T1YA 4MD5A 1U3HC 5DJZB 5JR1L 3DWTA 1XR8A 5IVXF 4DK6A 3FFCA 3MNWB 4X7DC 2VLJB 1I7TA 2BY0A 3IU3A 5DJDA 3PWVB 5IJVB 3WUZA 5J8OA 3GMMA 5C09E 4HQQL 1L0YA 2BHYA 1LD9B 2L0DA 1ETZA 3U4BH 1OB1B 1UB5A 3DX7A 3MLYL 3U0TB 1REIA 3NZHH 4Q6YA 3S7GA 3PGDB 5J0BA 1TQCC 2BNRB 4WW1A 4CN1A 4GRWF 4OM1L 3ROOB 4OFYA 2CMRL 4QGTA 4NO5A 4CMMA 2XN9B 2YRLA 1LE9B 4ODVH 4RMSA 4RRPA 3E1F1 5BQ7A 1W72B 2BFVL 5I6XB 4KROC 4AJ0A 2DICA 4E42B 1QLFB 2I60L 6FABL 4HUUA 4NPYB 5E03A 2AXFA 2NQCA 4Q9CA 3BHBA 2A9NH 2DIJA 3ARGD 4KI5C 4P49A 3KPRE 3T8XB 3U9PL 1XGTA 1XIWA 3O11B 4Q2ZB 1BD2D 2JB5L 3RPKA 3W9EA 2ATKA 1TTGA 4HPYL 1CE6A 3IRPX 1WIUA 3B9VA 2XN9A 2Z8SA 2IADA 1FVEA 3PG2A 5HGAB 5BRZD 1K2DB 1YNTA 4D94A 1MJ7L 1Q9OB 4NQUA 2J88L 3V52H 4MQSB 2PW2B 1KJ2H 3IAGC 1LD9A 2XZAL 4N0UB 1JGLL 2D9CA 4O00A 5I18L 3PHSA 3VXQA 5ERWB 5TPWL 4YXKL 4NCC1 3BN9D 3FCTB 1DFBL 5INDB 4KDWA 1I1FB 4KFZC 5IG7B 5MEND 2HFGH 5F1IA 4AQ1B 3QUZC 4MSWB 2CDEA 4KXZI 1JK8B 4R4BA 1P7HL 2FO4B 3LHPH 3AREC 1WEJL 1FSKB 4AIOA 3MV01 2Q20A 4HLZG 1Q9WB 2XACC 1X7QB 3QJFB 1NBZB 1U8HB 4G80A 1EEYB 1GGCL 4PJ9A 4M4RA 2CRMA 4QXGL 2HT4C 4G5ZL 5GGQH 5J1AA 3OL2A 4ZXBA 4HJJH 5F7MC 1KIPA 2UZYB 1JPGB 5EU5B 2X4UA 1JGVH 2DQJL 4P23C 5A3ID 4I2XE 4YFDB 3S97C 1WISA 1S7UA 3CMOL 2P5ED 3U7WH 1N59A 4NQEE 4M1DH 4HPOH 5CEYB 4NO3B 4C55A 2J88H 4YDJB 3JZ7A 4YXLH 5DYOA 3G08B 4NZRL 5D2NE 4P9ML 2W38A 4JFXB 1I8MA 3VWKC 1JNNL 5EZLB 3AGVA 4LLDA 4WWKD 1ZLUH 1T7XA 3GNML 2YD7A 3AVEA 3FQWA 3OKDA 3TBTA 3PP3K 4BH8A 1JYXA 5LJYH 2G75A 5FO7B 4P2OC 5D7SH 1WBYB 3OG4B 3ULUF 2ORBL 5EU6B 3T3PF 3UYOD 5BO1H 5H35B 3ARSA 1WWWX 3QWOA 2X9YA 2YC1B 2ZP0T 4ZQKA 3TBYA 1IGCL 3VWKB 3V0VA 2HT2D 1O7VA 3ECBB 4F58L 4HG4J 3K1DA 1YZZA 1OQXA 2R69L 3EYUH 3MMEB 4M6ML 5C0CA 4GW5A 2ICWJ 3LIZH 3ULUH 4MZ3A 3HZYA 3KLAA 3MV8D 2AEPH 1KTLB 2YS4A 4HPOL 2Q3AA 4PR5B 4FA8A 4IJ3C 1D5ZB 1OCWH 2V7NB 4JLRA 1OD7A 3QP3A 5CEZE 5SWSB 3FQXA 1G7MB 5FKPB 2O5ZL 2IPKB 3JV5A 2FJFA 3GSNB 1KYOK 4PJ8B 3CGTA 2NNAB 3JV6B 3QUXD 5HI4D 1EX0A 2ITDA 2D7TL 4K3HA 1XGQB 4P4KC 4XGZA 3P4MB 1OAQH 2GTZA 2CRYA 1QSEA 1SYVA 1HDMA 4NUGH 3LKRB 4LGSB 1F3JB 1IT9L 1I8KA 4HULB 3TF7C 2VWEC 4X8XA 4QRSB 3MRLA 4APQD 15C8L 1ZTXL 2FCBA 4BSJA 3MACH 1KN2L 4PJ7E 1MF2L 1YUHB 3FRPG 1YEGL 5I76A 3VI3F 2W92A 1WAAE 4BQ9A 5KSBE 1OGAB 2ZCKH 5HYSG 7FABL 2XWTB 3B3IA 2NY4B 5IEHB 5DJ0A 3I50L 4YBLC 5I2IB 1D5IH 1RHHA 5DMIL 25C8H 2P8PB 4NM8L 2H8PA 4I18B 4P99A 1WF5A 2MWCA 5E8OA 1OTSD 4OLZL 2UZIH 5EUKB 3DVNA 1NMCC 4ZUWA 3GSWA 3HI1A 2CPCA 4XNYL 1TPXC 3WDIA 1CDJA 1QSFA 3OB0K 3HCVB 4RAUA 5SWZD 1JFQL 2C3VA 4MA7L 1EIBA 2W9LA 5FKAA 1IZJA 5JHDA 4LPVA 5A3IC 2JCCA 3IKKA 4J12A 2MHAB 4UDUA 2E7CA 4MJ5A 3RUGB 5ICZB 3LQZB 2GT9A 5IT2H 1FIGL 3K7UA 3QDHA 4YUEH 2IH3B 5CILH 3T0DA 1E4WL 2XN9E 3CDGA 4JPKL 4ONGH 4NT6A 1LVEA 4NBYB 3BGMB 4CVUA 4Y19A 5FYKL 1JPTH 1JZ4A 1LDPL 3QAZB 4XAWH 1FG9C 1GHFH 4L8SA 4N8VA 4N0FA 4F15B 2F54D 4DJMA 5F1KC 1D5XA 3F12A 5TF0A 1VKXA 1Q9OA 4GS7B 5DHVB 3LKNB 4UT9H 3OKMA 4NQDB 4LSDA 2BFVH 2PKDA 3JSSA 5I2IA 5EOQL 1UXSA 4QTIH 2EO1A 4LLUB 3CFBB 4ZNEA 3HAEH 2YHGA 4OD3L 2DQUH 2MQ0A 4X6BA 2FZ3A 4PY7B 1L7IL 4ZQKB 3TBYB 2GUOB 2MFNA 5DRZB 5HYIA 3MJ8A 3MRFB 2FX7L 3WLBB 1U3YA 1A6TB 2XG5A 5IV2B 4KZDH 1UJ3C 5B4MD 1R3HA 4YHPB 3T3PE 3ULUE 1YA5A 1HEZB 2C4FT 2CLRB 1XGPA 1S9WA 1AXIB 2VZ1A 4YHOH 2PTTA 2VDKL 4PJ8D 1Y6KR 1NFDA 4YH6A 3V0AC 1MFCL 3QUMH 1M05A 3OKMB 1WJ3A 1ZEAH 5SX4I 3MYJA 4I77L 1ZVSA 3ZLQC 4OF5A 4UIKL 2X4RA 1J87A 5FV1L 4PV8A 3NGBB 5CKGA 5IT2L 4HKBA 5SX5H 1BD2E 2V7HA 5HTSA 2VISA 3OAZK 4ZPTB 1ADQL 4U0RC 3P3YA 1YEFL 5TDPB 2PYEA 4EI6B 4I13B 3JV0A 3PWNB 3OAZH 3CLEH 5FYKH 3QA3B 4JRXA 2OZ4L 1I7ZA 3C2AH 5H8DA 3VXUA 1UVQB 3L3IB 1E6JH 3PQYD 5D2NA 4F7PB 2YN5A 4PRAB 1PSKH 3QIWB 2PW1A 4JDZA 3OJDB 2DQIL 4GW5B 5ALBH 2FBJH 5EZOL 2Z9TA 1J5OL 3FO2B 4WNQA 3QIUC 3BKYL 5DF0A 3U4EA 1QUNA 3KPSA 5IROC 2NX5B 1NH6A 2FX7H 5D8JL 1FDLH 4JKWA 5F89A 4JAMB 4YAQB 4R7DA 1JUFB 5EBWB 3AS2A 4U3HA 1BEYH 5DJ0B 3RDTB 3RWIB 5I1KH 1RIHH 4OAWA 3MYJB 3JXAA 1IBGL 2JK5A 1J1PL 1MFCH 3D69B 2W9EH 1AY1H 1BAFL 3ZTNH 5DK2B 5C07D 1ACZA 1D9KA 1MEXL 3MOAH 3CCHB 2GJJA 4EI5D 5GIRB 4G6JL 3AS1A 3AB0C 4QT5B 2OX5A 1DDHA 1BBDH 5CD5C 1FNEA 4PJCE 5EZJA 4WENB 1N7MH 3L3HB 1KGCD 3PIQB 4HV8A 4XAKD 2DYPB 4A6YH 1N3NB 4C83B 5KVMC 1JPFB 5FKPA 2GJZB 4M5ZH 5HBBA 1MHHB 1F2QA 4R4BB 4Q0XH 1N6UA 1EFXD 1LO0H 5IB5B 5JPMB 1Q0YH 3IFNH 5F96L 1KJ2A 2FECL 4L8SB 5CEZD 1GCFA 3IFLH 2XY1A 3QUYC 1BMGA 3TVMD 5AYQA 2W65B 3QXWA 5GGRY 3ALXA 3MCLL 4EIGB 2QEJA 5EUKA 3IDNB 3RDTA 2EXYC 4H20H 4S11A 3AY4A 3QI9D 3MUGA 5HI5D 5F70A 3GIVB 5DUBB 2ZNXA 1N0XL 1NCDL 3G6JA 4J6RH 3LN4A 4NDMA 1MAJA 4ZFGL 1KFAL 2VXQH 4PRBB 2AVGA 1QR1B 4CU6A 1FVDA 5L6YH 4LVEA 5BV7C 2NR6D 5K9KA 3VXQB 4K3EL 1FNGA 1YNLL 2GI7A 4F9LC 4XP1L 5I6XC 5IHLB 3QDJD 4PJFB 3QH3B 1IM9B 3LN5B 5HHXH 5CJ5A 5ESQA 2G5BB 1AXTL 2R1WB 4ZTOH 1ES0A 3TV3L 4CDHA 4PTUB 2B0SH 2R9HC 4XVUD 2CXKA 1L4IA 3QO1A 1E4KC 1IAOA 3DYMA 4X6DE 4OCYL 2RCSH 3MV11 3MUHL 5A16A 4G6AD 4RBPK 4M62L 3T8XA 2RB8A 4YHKL 4YO0B 3PXHA 3AY4C 3P0YH 5I76B 1JYWA 3OKOB 5J1AB 5F1OB 4MX7B 3TJEL 1HI6A 1IC1A 1G0YR 5FHBL 4GS7C 4P2RB 5L2JB 2X89A 1YY9C 3LQAC 3PWVA 4JG0L 2KBGA 4X8JA 3RFZC 1B4JH 2DQGL 2E9BA 5L6YL 1T0MA 3VFUB 1RZ8B 2WIIA 3MFFA 4O2EA 2N7BA 5EG6C 5IB1B 1Q72L 2DIBA 4NYLA 5GGSB 4S1RL 2NW3A 2X1WL 4O2FB 4ZAKA 3H3PL 5F6IB 3QULA 1GYAA 5C8JB 5I71B 2NX5A 4JZJC 4S0TD 2FJFB 3GI8H 2CLZB 4DFHA 3DX8B 1AO7A 2KQMA 3NH7H 1ZGLM 4YGAB 3VI4E 1ZOXA 4LVNC 1WZKA 5D1QC 2FEDC 4OLWL 4RGOH 4XPAH 5T1LB 2VDOH 2EH8H 5DJDB 3RI5K 4IMKA 4LHQB 4F7CA 5GXBB 1C5DB 1H3GA 1K8IB 4ODXB 2NLJB 1U93A 3VU2A 2XZQL 1XF1A 3F7VA 2IBZY 4G43B 2NYYC 4BQCA 1XCQA 3MLUL 2RBLA 5E24E 1TVBA 1I3UA 4G80B 4LVOC 4QOKD 2XG4A 4NT6B 4DN3H 2C9AA 3VXUD 2O5YH 4Z6AT 2X9WA 3OTTA 4YUEL 5IB3B 2IALB 5IQ7L 1ZSDA 2CLZA 3DJ9A 4LVNB 5D7JC 5FCUL 5H94A 3ARGA 4YWGH 2UY6A 5KSAD 2JE8A 4DKFL 4CMHB 1I7RA 1QVOA 4H8WH 4C54A 3FQUB 3G5ZB 4UT7H 4EUPA 5FHAH 3ZHKA 1BD2A 1MCDA 3GKWL 1AGFA 3JWOH 3OKKA 4Y1AE 4TYUA 5MERA 2X4NB 5I75B 5KN5A 4J3SA 4NZDA 4OFIA 5F93C 1NLDH 3RVTD 4P23A 3KYKH 4MJIE 1EHXA 3EUUA 3PL6C 4DUVA 1G7PB 3QIWD 3ZHLA 4HIHA 4XP9L 3C87A 5J06A 3HMWL 5GS3A 2VDOL 5L2KB 1INQB 1F3DJ 3GSRA 1A7BA 1CD8A 4GW4B 5EORL 3WNNA 1U8JA 1MWAA 5D96C 5JUEH 4MGXA 4U6VL 4Z78B 3WO4C 2QLVB 2HG5B 4P9HC 4TTDC 2YUZA 4OD1L 2WM0A 1FAIL 4EZMA 1P4LA 5ACMA 4WGVB 3GI9H 5FO9A 4UZGA 4NZJA 4TTGA 2HRPH 5IGXL 5K9OA 4ZO7A 3VH8G 3KYNA 4OKDA 3QH3A 4LMQE 4WCYH 1BQSA 4K7PH 3QXDB 3QQ4A 5DMGC 2F54E 4LDEB 5JPNB 5C6PB 5KVDH 2ICES 2V17H 4L8DB 4XBGB 1F8TL 1TCRA 1R24B 2QQKL 1A6UL 4QHLB 3BFOA 1MIMH 2Y4SA 3VXMA 3HE6C 5KN5B 4HT1H 2EDFA 3NGBC 5EZOH 3IXTA 1PEWA 3TGXA 3V6OC 2AK4A 5HI3D 4XP9H 3SDXE 3U0TA 5HY9B 5B8CC 1NGPH 1B2WL 1MELA 5D7LB 1NDMB 1E4XL 2WV3A 2G60L 3LS5H 2WWMC 5EN2B 2Q7YA 2D7MA 2ZUQB 5BVPH 3REVA 2EH7L 3O41B 4M1CC 4PRHA 4WEMB 5C0BA 2IQ9H 4U3CA 4U3XA 5JW3L 4X6DB 2QSQA 1YY9D 2UYLA 4NPYA 4RA0C 4OJFH 9CGTA 1J8HD 1A1OA 3OHXA 5EORH 1AY1L 1MLBA 1MQKL 1NUFA 1KCUH 2MQ3A 4HKXA 1IQDB 2W0FA 2HJKB 3BGFC 1MLCB 4NRZA 2EDOA 3EBAA 3VXNB 1RIHL 3QWOB 4OLYL 1AO7B 2PYED 4Q2ZA 2BX5A 1EGJA 3OF6A 4UB0H 1ZGLP 4OGYH 1MIEL 3GO1L 4ZPTA 1JHKH 4HDIB 4ERSL 3BN3B 1CGWA 2BC4A 5J6GB 4P2OA 3MCG1 2IANA 5BV7B 2NY5H 1N59B 5E56A 4RDQF 1CDIA 2NY6D 2YUVA 4HIXH 2VN7A 2DTSA 3EDEA 5CJXC 2HTLC 1BWMA 5DC9B 4LLMA 3EKCA 4M5ZL 3DTXA 1GIGH 2VO5A 1OP5K 1TQCB 5L0QB 3P0VL 4XP6L 5DD0L 5DWUL 3OR6A 1G7JA 2AKRB 3LOWA 3QDGE 4QHMB 5FYLD 4K7PX 1IGJA 4EOWH 1T83A 1QFUH 3K3QA 4MWFB 2DTML 5DQ9A 5GGUA 3GSNL 4I3GA 1C12B 3SQBA 1QQDB 2YUXA 1AKJA 4U1MA 4Y5VB 2QADB 4LAJH 3QQ9D 1TZHB 1KCUL 3DMMB 4R90H 5LBSL 2OQJA 3QHTC 4XTRC 5DO2C 4Y2DC 2NY7H 3WNPA 5F3HA 1JFQH 1MJ8H 4P4KA 4HSQA 1A3QA 35C8L 2EXWC 3AREA 2ILLA 4EN3B 1JTPA 4ZFZA 4JFEE 1FL5A 3NCJL 2E9IA 4H1LB 5GJTH 4D3CL 4U0RB 1JHTB 3SCMD 1HHJA 4YZFE 4LCCB 3I02A 3G5VA 1Q1JH 4LOUD 3BH9B 3NCMA 4C56B 1QNZH 3DVNB 2IGFH 1YYLH 4GRWH 5D7JD 1HZHL 5CSZB 1Z0NA 1QSFB 5KSAC 3BQUC 1B3JA 4XPGH 2K9UA 3HE7D 1HEZA 2X7LB 4Z7VF 5J1SC 2FECI 4XPBL 4NZTH 1K8IA 4Y4FA 3QIUB 2KQNA 1P9MC 3B2VL 1T22A 1UWGL 3QUZD 4H1LG 1V3JA 1MREL 5E9DE 5D7JB 5T1KB 3UO1H 4OD3H 5KVGH 4HS8L 1MWAB 3WHXA 4N9GB 5C0RH 2D0FA 4L3CB 5DS8A 3MRDB 1XIWC 2VH5L 4HIEB 3S36X 3MRNA 4OLXL 1N6VA 3C9NA 1JI2A 1RIUH 4YPGB 4F33A 2X70A 2EYRB 4J3UA 3SDXB 3CX2A 3GUTB 1GGIL 2O5ZH 1NLBH 2CRZA 4FXGA 1DLHA 4R97C 3MZTA 4ZSOA 4KZDL 1G0XA 4OF6A 4YDVA 1TJIL 5CBAB 1NCWL 4JR9L 4MD0B 4ODXA 5ESVB 2I07B 3NAAL 1BVKB 3QZWA 4MD5B 3TP4A 4YHYB 4O9HH 8CGTA 1EHAA 5F1NB 4MB4A 5C07B 4YHOL 1DBAL 3AM8A 1S3KH 5ACZA 4KPHH 4U1NB 4X99A 1U91A 1FFPA 2W0LA 1RZKC 4ODWA 2A9ML 4PY8I 2H6PB 4AH2A 2QR0B 5CP7B 3S96A 2W07A 3RVVD 1EJ6A 1FN4A 2CSPA 3LB6D 4WV1B 1N5YL 3EO9L 3N9GH 4HZLA 3SJVD 3UTPD 3ARVA 3IXAA 4BYHA 3WIHA 3LKOA 5BXFA 1QO3A 3PHOB 4P2YA 3U1SH 3HLAA 2NTSP 2H32A 3IGAA 3SE4C 3A67H 4IHOA 4FHBD 5TDOA 3MA7A 2LU4A 2WINB 1CVSC 3WE6A 3PJSB 3GMRA 4EEEA 5C8JA 5ILTH 5FO7A 1NSNH 4PRPD 4WJ5A 3HE7A 4Y4KB 3MV9A 4WI3A 1XF4B 4D0DB 1ND0A 3W81A 3DUUA 5F7HA 5I1KL 5EC2A 3MRKA 1T5WB 4KDVA 3RU8L 2ESVA 2A73A 1AR1C 1H5BB 5IIEB 2BVQA 1FDLL 2JJUA 1OSPL 4OBSA 4XPHL 3MXVL 1RK0A 4ZUVA 3QDMA 4OZ4A 1UWXH 4MNGE 3TPUA 3TNMB 4UBDD 5DJ6B 3WEXA 4O2FA 4ZAKB 1J0ZA 1KOAA 1YEIH 2VITA 2MCPL 3EO9H 2OSLA 3D39E 3EW3B 1ED3B 1P7QB 3JTSA 4HWBL 5C08A 4PJGB 3QUXC 5HI4C 4HUVA 5IW6B 4KROD 4N68A 3MLYH 3MJ7A 1EFQA 3E3QC 4RISL 3U36A 1CFVL 5CCKL 1MRDL 5IKCA 5C71A 4U1LB 1X6NA 3DUSB 1KCVL 4NUJB 1LWRA 5D7IB 1RUPL 3WNOA 5ANME 3ZKXB 1EAJA 5F9WC 2CJUL 1FNGB 3L3JA 2DQDL 3Q5TA 3FN9A 2SEBA 1LO0L 1KJVA 1W0VB 4DEPB 3BGFB 3SE8L 4UILH 1K6QL 5BMFL 3LKQA 3LRGA 3QQNA 1QSFE 5E9DD 4EUPH 4EJ1C 3TC9A 4PB0H 2B8OT 2W9DL 1DANT 1CFQA 2JCCF 4H25A 2DMBA 2Y7QA 4RAVA 3QNXA 1T0NB 3W5MA 1AGCA 3VMPA 1BWWA 1U8OA 4Z0BH 5TJWK 3MGTB 2OR7A 2K7PA 1A4KB 3DECA 5CLTA 4MX7A 1U3HA 5CAYB 5CP3H 3ARUA 3VWJB 3AROA 4I18A 5DQ9B 5HGDA 2DDQH 5HHXL 1TMCB 4XMLL 3D0VA 3RKDC 4CJ1A 4G8IA 3R1GL 2AI0L 4ODBD 1I9JL 3INUL 3OJ2C 1XCTB 1A6ZB 3PWLB 5J3HC 1T89A 3WO4B 4JFEA 4BK5A 2VL4A 1FV1A 3CFCH 3LKPA 1RFDL 1JIBA 3DGGB 3K1KC 1PG7W 2M1KA 3OMZA 3MGOA 4HH8A 5GS1C 5KZCB 1UM6L 3HUJA 4XVJH 1U42A 4QRTA 4IDLA 3VWJC 1UZ8A 2CIKA 3O3EB 2F53B 1MHHA 2ZKHH 1ZWIB 4HK3J 5DT1H 1UG9A 1DQMH 2H3NA 3G5YA 4OF0A 4DKEH 1AGEA 1GZPB 1KCKA 2GY5A 3T65A 2DQGH 1YEEL 3SDYL 1F58H 3KYAA 4L5FH 5FYLE 4Z18A 2OR8A 1FRGH 3OPZL 4QHUA 4X0KA 1DJSA 3BYTA 3ZDYE 5HPMA 3I9GH 5FDWA 4I3SL 1KPUB 1P9MA 1FIEA 2DDQL 1TITA 1INEH 2D0HA 4PJCF 2R56L 4Y4FC 3HCVA 3QHFL 3V6FA 3CXDL 2VAAA 4R0LA 1YJDL 1WFOA 4RMUA 1U8LA 4R96A 5DVNA 3HFMH 3LS4H 3KPSD 3PWPD 2AI0H 2X1PA 1KELH 1KENL 4OD2B 2J7LA 4OKVA 4ELMB 4LCWD 4O58H 4WFFD 2NY1C 4KJWC 4NN5B 4WV1A 3HC3L 1MHPL 3QFDA 3BP5A 3NPZB 1CS6A 1AHWB 1EUTA 2ADGB 4QKXB 1H0DB 2PTTB 2A6IA 1MHCB 5INCB 1VPOL 4FMKA 1UWEL 1JTOA 2YPLD 5TQ2L 2GHWB 2VSDA 4WTWA 1GAFL 4HH9A 1KB9K 5I71C 2EIEA 4YXHL 1NCBL 1YY8B 1RI8A 4XCCL 4BFEA 2NY3C 5IESL 2P24A 4B7IA 1BQLH 5K33A 5TF1L 1G6VK 3VGBA 3HI6H 3S88H 1KPVA 4RWHA 3H9SE 5DT1L 4WW2B 3K74B 2GK0B 5HYSB 3NA4A 3D39B 4U7SA 5E00A 5I30L 2H2SC 2RFXB 4RFEA 1NEZA 1OSZA 2WWMD 3B2VH 5KW9H 5ID0A 3HUJF 3ISWA 1KTDA 3MO1B 2DS4A 3RVXD 1A6PA 4JFXA 2CMRH 3OPZH 4PJBA 2E6QA 5J11B 3IDIB 1S9KC 5JOPD 1PQZB 3T4YA 1D5IL 1CICB 1MJUL 5T3XE 4FQXB 2EDEA 3P9LB 4PTTB 5CWSB 3IF1B 2W59A 3HI5H 5KOMC 3QNYA 5KS9E 3HLAB 4EI5A 4N90D 2XZCL 4HGKC 1QOKA 4LQFL 2BRRH 5CBEA 3PHQB 3KPPB 4MQXD 4U1KA 4JN1H 1TZGH 2RAMA 3GHBH 5HYQA 2WWKO 3EOAB 4L4TD 1W0WA 3WO3B 1FYTE 3NA9L 4HMCA 1PD6A 5LVEA 1BHGA 3RX7A 1NFKA 4OLVL 4EI6A 3X12B 2VDRL 4KJPD 4I1NB 5KVDL 1JF5A 1F8TH 3RNKB 3TIEA 4GAFB 3C09B 3P4NB 4BFIA 3HC4L 2J8OA 3U79A 4JY5H 5IESH 2G9HA 2I27N 2FIRT 2J8HA 1T1XA 4RNRB 3WXWL 5D5ME 5IG7A 3O8XA 2IPTL 5C6TH 4LEXH 4YDIL 4XNMA 2AJSH 2BZDA 3LS5L 5IBLC 1YPZF 2R4SH 5DMIH 5F3HB 1H15A 2GEEA 4GAYB 2CIKB 5JW5A 1B4JL 3M07A 1EDQA 3QEQB 2VXUH 4HHAA 3EO1B 4GXVL 1BBJA 2YOCA 3IT8D 1G9MH 4NQSB 4YHLH 3ARXA 1L7TH 3QEHA 5DMJB 4YX2L 1N8ZA 5JNYA 4GG6B 1MFAL 4WHCA 5CBAA 1NAML 3GHBL 3HMXH 3NN8B 3FB7B 4HPYH 3AU1A 4PGCA 2EE2A 1RZGB 1KPUA 4PJ7B 4PLNC 1X5GA 3OV6A 4JM2A 3SE9L 5E7BA 1OW0C 2I26N 4R26H 3U46A 3RJDA 2W60B 2I9TA 2XZQH 3KS0H 4QRRD 5B3JE 3FMGH 3HR5A 3TCLB 4RX4D 5I1AB 2V5TA 3L3DB 2GJ6E 4XC1L 4HC1H 3VW3H 5ANMB 2MCG1 5B22A 3AAZB 1LDPH 5LGKA 5T1KA 3ULSB 5D2NC 5C6TL 2P5WD 4P2QE 4MS8D 5T3ZE 2I9LA 5FECA 5GGVL 1ZHKA 3MLVL 4XC3L 3D39D 4HDIA 1I9RH 4JM2B 3HS0A 1I7RB 4JO4L 4LEOB 4XWGL 4DGYL 3GMRB 4PG2C 4P4KB 5AEAA 3MNZB 3U48A 1F4AA 3MQIA 3ZMRA 3KJ6H 4WW2A 4X9FA 4YHZL 4Q9QH 4YLQT 3S35L 2GQHA 3TT1H 1PAMA 2HT3C 2QSCH 2EE3A 1SJEA 1CU4H 3REWB 4LCCA 3VCLA 4N5EC 3K0WA 3MGAA 4U1HB 1U3HD 2UVEA 4PJ5B 1NGYB 1FZKA 4MXWL 2X4SB 3MA7B 4MAUL 1H0DA 4DFIA 4FQXA 3D48R 3HG1A 1K9TA 2F53D 4OF3A 5T1DL 3T4AA 4XP5L 3QT2A 4XMLH 4JFPB 5HHQA 5EFIB 5L0QC 1XF5B 1EBAA 3BP7A 4W4NA 4CKVX 1NCUA 1SQ2N 4LSVH 4QRQB 2IJ0C 1HQ4A 5F8RC 5IKCB 5M94B 5I18H 2YPLA 4B50A 4ETQB 3WDHA 3SKJH 1UEYA 3R8BB 2ICWI 2ADIA 3OR6B 3WCYA 4YPGA 5IVNA 1RIVH 1XGQA 3DGGA 2AGJL 4NKOA 3QB7C 2VR4A 5I17A 5JPMA 4WJ5B 4TTDD 2BY2A 3ZKND 5BS0A 3QI9A 4PREB 4PJIB 4M8VA 1CIDA 1KNOA 3N06B 5CMAA 1XGYL 3UDWC 4KMTH 4OQTH 4A6YL 3UJIL 1UWGH 2AEQL 4C4KO 1ZGLB 4LCYA 3ZE0E 4WY7H 5CWSA 1AIFA 2EICA 1Z9OA 1WWCA 5AWNL 1OP5H 4AMKH 3P73A 4JDVB 4BZ1L 5DD3H 5E6IB 4DKEL 5AUMA 4M1GH 5TGBB 3KPLB 5E70A 5D71L 4Y7MA 4HHAB 4LHUA 3O2DH 5T1DH 1KBGL 2ZJSH 5JXEA 3NZ8A 4KVNH 1PG7X 3DI3B 3UTTB 2JTDA 4F80A 4HBCH 4LSRL 1RY7B 5K9KB 3L5IA 3Q3GA 1INDL 4LIQL 1IQDA 3VXPB 2R1XA 1HHHA 2Y36L 2JJTC 1C8PA 1Q9LA 4G6KH 2NY0D 3CU7A 5I75C 2IAMB 2Q1EA 1A7QH 5BOZG 5B3NA 1KXVC 5FKAB 3V6ZA 3B2UD 1VGKB 1OAQL 1JGEB 2C3VB 2WINA 4IIQC 4NO0D 5KS9A 3L3JB 1I3VA 3WLWC 3SDXA 1KCSH 2FSEA 3EDJA 2EXYD 4ELKB 3NAAH 4LF3B 4EDWL 2H41A 3H9HB 3VI4F 2B39A 3BKJL 1H5BC 4NWUH 3HZKB 5F72S 4CU7A 4DQOL 4ONOA 3I02B 3PDOA 3GEWB 4LKXB 4R8WL 2CDEB 5JA9A 1NMAL 4KY1L 4M7LT 4M93C 4X98A 2NXYB 4OSUL 5D70L 1FJ1A 1I1FA 1LP9E 3QQ9C 4NQCB 4NP4H 3Q0HA 2CK0H 12E8H 4V2CB 2P44B 3RY6C 1QRNE 3DPBA 1NCDH 1OVZA 4J6RL 5ESAA 4PS4L 4PD4J 5GRYA 3UTSD 1Z6JT 1U3ZA 4TUJB 3C2SA 1QBLL 3KWWB 3RNQB 4R3SA 4H5SB 2OS7A 1T1WB 4PJXB 4PRPB 1C12A 2GJ6D 2A77L 5GGTH 4RFOL 2OYPA 3QIWC 2PTVA 3C6SB 2R9HD 4XVUC 3W2DL 1I8IB 4HUXA 4LQFH 1S78D 2J8UB 1T2JA 4QRRE 3QEGL 4BZYA 1TVHB 1MNUH 3D18B 2FWOB 5IMKA 5KTEH 1YEJH 4XNUH 4EQ3A 1SJHB 4JKMA 1OAKH 1CLOL 5HYFA 4NRXA 1CBVL 4K8RH 4WW1B 3WFDH 1SEQH 1CT8A 1CZ8L 1BX2A 3CZJA 1IGTB 2W91A 4J3VA 2B0SL 4N0UE 1VGEL 3EYFB 5DJYA 5BCAA 3HNVH 3FT4A 1UZ6E 1X5KA 4Y4HA 2FLRT 2VLKB 1G7MA 3MBEC 3VMOA 2VXSH 3R0NA 4CW1B 1QO3B 5A2IH 4YHKH 1DN2A 4JY5L 4OM0L 1S7RB 3C6SA 5K93A 5EOTA 3MUY1 2A74A 3P0GB 2X41A 4L4TB 4UNVA 2DQFA 5FCUH 2EDQA 3BMVA 2H6PA 4AH2B 3ULUD 5ESAB 3VWKA 5FYKD 1CLYL 3SCMA 1RJZB 1SVZA 2FEDD 4F7EA 4HS8H 3JTSB 5JDSA 5C7XL 4JFYB 5BJTA 4RGNE 3FT4B 2LE9A 1D3CA 2AV7B 1EAPB 4QYOA 3QJHA 3RWHB 1A02N 5GRVL 4MLSA 3S6CA 2NLJA 1SBSL 1E6OL 5EOTB 4GJTB 1J8HE 1DTUA 2AJZA 3HZMA 2IMMA 4PJ5D 3FB6A 4LLQB 3IETB 2E27L 1L6XA 3EYSH 4ZXBC 3UTTA 3DV4B 1UGNA 1DQJB 2I60H 4JRYE 6FABH 3V2AR 5E1HB 3NZ8B 5BRZE 1NCCH 4E5XB 4Y4HB 4K8RL 3ULVH 5TDNA 2WBJC 1EXUA 5KVEL 4PFEA 4JCMA 2VUYA 3VXMD 5IBTL 1ETZB 3V5KA 4LL9A 5JUEL 3BSZH 1HHHB 4LLWA 1UWXK 2ARJQ 3FMGL 3S34L 4O02L 3WJLC 2QKIA 4L3ED 3CLFL 3L3OB 1UQSA 5DHVH 3SBWA 3RIFF 1XR8B 1DBJL 2VZUA 1OARL 1FN4B 1YEDB 1RPQA 1QFHA 3H9HA 4GG8A 3UYRL 1L0XA 1ZHNB 2NY1B 4Y16D 4NM4L 4LCIH 4A2MA 5FUZL 1R3JA 2Q7YB 4HFUH 3LEXB 3QNXB 2HG5A 2CUIA 2AJXL 4N1CA 4HWZA 1K8DB 4JM2C 2XFXB 32C2B 2G9HB 4OB5H 5C09D 3WIFA 4ZSOE 4DAGL 2DMKA 2DB8A 5ITBH 5JXAL 4WHTA 3FCTA 3UTZB 3FN3A 3PQYA 1N0LA 2DLFH 2WBWB 3FOMA 3WIIH 3X3GH 2Z31C 4HF5H 5DHYB 1G0DA 4LPTA 3MXVH 5DEFB 1NC2A 3KPSE 4W70A 1QR1A 4LKCA 2WSKA 4MXVF 1IAIM 2X4NA 4OCXL 4OJFL 1WC7B 1DLFH 5KZCD 3TZVC 1U8MB 1M7XA 2QKIB 3WFEL 5GJSH 1I3GH 4XVTL 5EU6E 4ZUUA 3REVB 1Q94B 3QNZA 4AM0A 2QADD 4OLYH 1UT9A 4TSAH 4KJQC 3OXRA 5E8EA 4JM4L 3EYFA 2R0KL 4EDXB 5L2KE 2YSSB 3GRWH 4JFFB 1RUKL 4LASH 3KPQA 1HHGB 4TRPH 5DVMA 5JORA 1P4IH 2X05A 4JDTH 5MP6H 2X4RB 3TJHD 2NY5C 1BF2A 1HOCA 2X4TB 3OAYH 4WY7L 5IF0A 4BQ8A 4Z8FL 1BQLL 3S88L 1UWEH 1RQ5A 3BPLB 2X5PA 4MA3A 2EIZA 1J11A 3FB8B 1U8KB 4HFUL 5TH2B 5JW3H 5AYUH 4XZUA 1LO2H 4KHTH 3F58H 1G6RL 3LEYL 3CK0L 1L9NA 4LARH 3QCVL 4RFNB 4HH9B 4IRSC 5C0IA 3GSNH 3TZVA 2ZUYA 3C5ZC 3MFFB 5IB1A 4X8JB 2OQJB 1RU9L 1YQ2A 4NQCA 2F15A 1JHKL 1NMCB 2WUCL 1AE6H 2GK0A 5IF0B 4Y5VC 1KLUA 1FNSL 5C08E 1T1XB 4LSPH 1QEWA 1G7HB 4WI4A 1YNKH 2HVKB 2XTJC 5F89B 3FRUA 1OP9A 4NQXB 5FGCB 4S1DC 3BQUD 1A7RH 3CSYB 1J0HA 4RAHA 1QFWM 5C09A 1CGYA 1U41A 43C9A 3TYFB 5C2UB 2OL3L 1RZIA 5KSBA 2V9QA 3U7YL 1DQDL 2OXHA 3MRRA 3QFJB 3RGVB 1UB6A 2Y5TA 2VISB 5K59F 3WHE1 3D85A 3OHXB 3E2HC 3STBA 1QRNB 1JWMB 2P5EE 5C0AA 4GG6A 1I9IH 2VMFA 3OJDA 2IWGA 2IF7A 4DN3L 4GAJH 1IGCH 2ADJA 2IH1B 4G6MH 3MBEB 2JB6B 3J8F7 1KIUA 1NMAH 1I7ZB 4MA1B 1CL7L 3VDBA 4PJXE 5BVJA 4NC2B 3SBWC 1MOEA 3BWAB 1D5MB 4RWYL 3KPNA 4OLUL 3SE3C 5EU4B 1G9NC 3MJ9A 1J8KA 3MLPA 4WHDA 5LGHH 1WAAF 4ODVL 4I0PD 3CU1A 1K8DA 3VI3E 5CBEB 4Y5XA 4QF1A 3M1BB 4LVHC 1R3LB 3UTTD 3O9WB 3WBDA 5IVXA 4LDOB 4UV7H 5IMKB 4RQQA 4G8GB 5B4MC 2XRAL 1BJMA 4DGVL 3V5KB 4KTYA 1KTKE 4GW4A 3V5DB 1JPGA 4GG6F 1OGTB 1A3RL 1EJOL 4L8CB 4AEHL 4QT5A 4NKOB 5DJ2A 2EZ0D 3O2DA 1RIUL 3W39B 1IAIH 3LMJH 3ZE1E 1QLFA 3JWOC 5DK2A 1HKLH 4O9HL 1O5DT 3O45B 1I3RB 1TENA 2R23A 5KSAB 4JRYA 1OP3H 3WKML 3MGTA 4LRIC 5IGXH 1JGDA 1FIGH 3O8XB 2YMXH 3RTQC 2OI9C 1WITA 4PBVC 3DVIA 3VFVB 4KHXH 3BRGC 4UAOC 1I9IL 1MCHA 2XZAH 4KRNA 5FYJE 3SDCD 1UB5B 5EU6D 4WFGD 3R8QA 2FD6L 4JY6B 4NQSA 1RVFH 5TE6L 1X5FA 1KB5H 5EU4A 3FO0H 3FHAA 5B39A 2NZIA 4OCWH 5HYJB 2VH5H 3NIDE 4GKNB 5EH1A 3RI5F 4F2MA 3O6MH 4Z7UA 3D6GA 1JPTL 4RMQA 1NFDE 4M7KL 2DM2A 3KXFE 5F44A 4LKXA 2DQUL 4PJ9C 1WLHA 2UY7A 3LV3A 4Z5RB 4JFFE 4P57A 4NJ9H 3OKEA 3O41A 4PRHB 2CKBL 2Z31D 1QFWI 4GMSL 2A83A 1HKFA 5DURD 4Z0XB 1NC2D 4XCNB 5E5MB 1QKZL 1TJHH 1JN6B 4MCZA 5SWQB 3ARPA 2XWTA 3B3IB 4YBLB 5I8CA 4K2UH 1BGXL 1XIWB 2GTWB 5HGHA 3HC0A 1Y0LB 1IKFH 1UYWH 4XVSL 2F58H 2VYRE 3G5XB 2XKSA 3S5LB 3H7LA 3QIWA 3WEXB 4I77H 3B43A 4BK4A 2EDTA 2VL5A 2E6JA 4EQ2A 5GGTA 3CC5A 3O6FA 5JQ6L 2FATL 1ZLVK 1G7LA 3T1FB 2J8UA 4I9WD 4JY4B 3THMH 1XR9A 4FS0A 4P5KA 4U1JB 1YN7B 4M48L 3Q1SL 1KIQB 3SO3C 1BM3L 3LKSB 4OGXL 1AQKH 1IM3B 4L3EE 5GS0H 3QHZH 1C08A 1DQLH 2VOTA 3MV9B 5F7FA 3V7AE 4ENEC 1OB1A 2Q8BH 3RX5A 4TUKL 4CAGA 2IPTH 4KKAC 5DRZA 1IEHA 5IM7B 4URTB 3MRBB 1MHCA 2PXYB 4PGBA 3DVGB 3MRJB 2AGJH 2R29L 4PJ5A 3T2NL 2YPLB 4HBQA 1H5BA 5IIEA 4DVBB 1ONQA 3CH1A 3T1FA 4DAGH 5JOEA 4R2GC 3TZVD 1D5XB 3F12B 2ZWLT 3S98A 2HKHH 5J9PA 1FL3A 1YQVH 1K6QH 1CYGA 5BMFH 4HS3A 5EIQA 1UA6L 3VG9B 4TVPH 3SDCA 4OV5B 3H8NA 4LRNH 2DQJH 3S96B 2AK4D 1P69B 1NKRA 4DVRL 1C5CL 1DQTA 1V5JA 2XXCB 5E94A 3WS6A 4I0PC 2B4CC 3C8KA 4Y4KD 2YC1A 5HY9A 2X40A 3QULB 5D8JH 4MAYB 3WL9B 4U1GB 2R1YB 3LKOB 4JE4B 5BXFB 3BT2H 4NJAL 3QHZL 3EJZD 1N64H 3KYOB 4LLVA 2A2QT 1HIMH 4QRUA 5FV2A 3G6DL 1GGBL 4YR6B 3RA7H 4S1SH 1VFUA 2EXWD 1I3RA 4JDTL 3UXFA 3RIFK 1HNFA 5CFHA 4KAQH 2PR4H 3MRMB 4IRSD 1P4BH 5FA3B 1WFTA 3GIVA 3VH8A 1CGVA 1OGAE 1CGSH 4K3DL 1K4DA 4JO4H 4XWGH 5DJ8B 4L9LB 1TJGL 5E8NB 3WUWB 2BSSA 1RULH 5DWUH 2GSIB 1A7OH 1HHIA 5J57B 4QO1A 1JZ2A 1FNEB 2PO6C 3ZL4L 2YD9A 4POZC 3SDCB 4WWKA 3ARDB 2BVOB 1EA9C 1NGQL 1MCBA 4HS6B 2K3TA 1F11A 1YEDA 4P59L 1JPSH 1YUHA 3VFRB 3PWPA 5DJAB 2D4FA 4WO4D 3MJ8B 3MRFA 3W5NA 4XNMB 5EZIL 1XCTA 3ZDXF 2FIKA 3U4AA 2ZUSA 4TPRL 3TNNA 4MCZB 1I4FB 4LSTH 1P2CB 4IRZL 3RWGB 5B3JF 5CD5D 1MY7A 1OAYH 1UJTA 4YO0A 3KDMB 4RFOH 3NIGE 4ZUTB 5TE4H 5ISZD 4PJ8A 4P2QA 3H3KA 5HGHB 2WBKA 4X5LA 1LO3H 3NOIA 4LCCC 2LTQC 3QUYB 1ZANL 5EPMA 4FFZL 2XY2A 2VERN 3GJFA 4QXTA 1U91B 5IVZB 2OK0L 2YD5A 2YD2A 3QUYD 3U7YH 1CDYA 4P4KD 3MODL 3UJJH 1NBVH 4IMLA 4NNXB 4P46A 2XOTA 4YK4C 3TIDA 1GAFH 1WEJH 4DUWA 1U92A 5D4QA 1PLGL 1HYRC 3NCYP 3OGCA 4XCCH 2JCCB 2BDNL 2DYPA 3V6FB 2B4CH 2XQYG 1N5YH 2NXYD 3DHJA 1K85A 4WEBH 3P4OB 4XNQB 4X4YA 5I15L 1GGCH 5LGHL 1RZ7H 3LQZA 2YXMA 1X5LA 1FL6A 4Q6IC 8FABB 2HVJB 4UT9L 4X4XB 1AXSA 4KTEL 3WJJC 3MLRL 1I4FA 1KCRH 5GPRA 3BAEH 3RIAF 4OLZH 4JN2A 2C7UB 4KRMB 5DZLA 1WK0A 2GAZB 1MJUH 3HFML 3TA3D 3WN5C 2EDKA 4Y0GA 4P5TD 5EZLA 1T22B 4WI8A 1YY8A 4DEPC 4WHYG 5F6IC 5GJTL 5T3ZL 2DQTL 4UNTA 1C1EH 3WLBA 4HCRL 1AP2B 3BP4A 1OAXL 4XXDA 5A1AA 2MSPA 4NC1E 2GUOA 4JO3H 1BOYA 4G8IB 5KS9F 1VHPA 4TOYL 2IFFL 3PP4H 1BQHA 4LSUH 2YEZB 3RWJA 4R2GB 2FDBP 4ZYKB 5FGBA 5CINL 3IETA 2XV6B 1OP3K 4JQVC 1DDHB 3KXFD 1EHLH 2CLRA 3HMXA 3IDIA 3J7HA 2FX9L 4RMRA 3TA3C 1XF2A 1KCLA 1S7VA 2F8OA 3KXFB 1X4XA 3MV7E 3QDAA 2NY6B 1N6QH 1G7IA 3IB4A 3HRZB 4LSQH 1J0YA 3P40A 3ES6B 4S2SB 5B39B 1U8IA 5HYJA 5KSBB 1MVFA 4BM7A 2AJVL 4C56A 3RRQA 3KYMB 2BSSB 4QTHA 2R0LH 1RZ7L 4K71B 2EDYA 5F9DC 3M1BA 5JHLL 1FPTL 3VD5A 3FRPA 2NR6C 1I1YA 4P57B 5LG1A 1VCAA 2ZZUT 3FT2B 4M1CD 2P1YA 3EAKA 5AZ2L 3X13B 1H8NA 4R7NB 1ZLSH 5MEOA 3X12A 2VAAB 1Q0XH 3K2MC 5CJ8A 1LGVA 4GO6B 4X5XB 3O6KL 2IPUK 3GMPA 5I1EH 1IEAB 4WUUB 2NW2B 4FQLH 3QPXL 1OPGL 3H7BB 3S37L 4XBEL 2F74B 5GRJH 3THML 1FCCA 3MV9E 2FX9H 1A64A 3ILQD 3BI9X 1CL7I 2BCKA 3RVWC 4FFVC 3MV9D 4H88H 4JO2L 1JP5A 2FGZA 4K9EC 3CFDA 1OAZL 4JPIB 4P5MA 4X7TA 5GSRB 2AK1L 4OZFB 2YBRA 3U6RA 4DKAA 2APWA 1P84J 2P5WE 1GOFA 1CICA 4NKDA 1IC5H 2NPLX 4PUBL 3CPLB 2WP3T 5JIPA 4IM8A 1T03L 1JV5A 1X5JA 2AXFB 4K23L 4GBXA 2Q7NA 2CLVA 2XKUA 1DQLL 4PJEF 2DQIH 4WFEE 3RKPA 5DK0A 3ZDXE 1NBZA 3SQOH 2IMNA 2OTUA 4L1HA 1V7ML 5CIPB 4LFHD 4UQ3A 3WHXB 3S8WA 2VXTH 3GSQA 4JFOA 1G1CA 4O4YL 3QRGL 5E2JA 3MGOB 1PQZA 3BXNA 3T4YB 5FIEA 5DFWH 5F7LB 5GZNC 4OFDA 3RVUD 2JB5H 4JRXD 5TE7H 2AV7A 1WAAA 4LU5H 2BSED 5FM4A 3SDDA 5I8OL 4DZBA 2DWEB 2A9NL 5TQ0H 2Z8VC 1G7PA 4JN2B 1U8PB 2KL6A 1X7QA 2BNQE 2IG2L 2W9EL 4LSSH 4XPHH 3L3GA 3BH9A 3QIBC 3BPOB 3EOBA 5LQBL 1CE1L 4ZS7H 4OQTA 1OTTC 3VRJB 3D25A 5D2LA 4N8PA 1UZ6F 3O2VL 3LB6C 3KPQB 3BW9B 5JORB 3CVIL 1HQRA 3LH2L 3N85H 5BW7A 4QHMA 1KJ2L 2D03H 4Z7OE 1U36A 4O5LL 4RAVB 1R6VA 2DLHA 3PDGA 2ZPKH 4FOMA 2AJUH 2EYTB 3ME0A 4Q0XL 4EXPX 4IRSB 1Q0YL 2XI9A 1NGZB 4LQ1A 2I24N 3OWEA 2WLYA 5FUCE 1VPOH 4L4JA 3CX5J 2WBJD 3C5JB 3IDXH 5I16A 4GG8B 2AJXH 2HFFB 3B8YA 1CIUA 2VXVH 4UTAL 3P77B 2CD0A 3FN0L 5EUOB 2AQ2A 2PW2A 4DZBB 4Y4KA 2C3XA 1BLNA 4JEGB 2NX5E 5FM8A 2P8PA 2VAJA 4PB0L 1VFOA 3R06B 5KANI 5E4IA 4WU7A 4N5UA 1CE1H 4ZS7L 4JFEB 2CIIB 4MD0A 1YPZA 2QSVA 2ESVD 2KH2B 3I9GL 5A16B 4I0PB 4JZJA 3DIFA 4X9HA 5ID1B 1AQDA 3UTSB 3TNNB 5I74C 1A9BA 2GCYA 1QFUL 4MJ4A 1AO7D 3DUUB 3QFJE 3RL1B 3HR5B 3NCYS 2AEPL 3TCLA 1XH3A 5C9KA 4JREB 4MNQA 4EUPG 3BEWB 2P5EB 5IR1B 1P1ZB 4DW2H 5LBSH 3QXTA 1AXTH 1H8SA 1S5IL 4OFKA 4LLQA 1A7QL 4X6CE 1DBKH 2GKIA 4UT6H 4TSAL 2GITB 5IVXB 2DLTA 4XB8A 4X7TB 5GSRA 1K4DB 4I0PA 5ENWA 3LQAL 4I3RL 4MJ6B 4Y1AA 4L9LA 3O0RL 5EO9A 4OCSH 4DCQB 1EXUB 4NO0B 4LK4A 4IIQB 4UBDC 3GSOB 4C56D 4MDIB 4XCFL 2EDRA 2NY2C 4U2YA 2QBWA 4YR6A 5FM5M 2GY7B 3SCMB 1B0RB 4OFYD 1W72L 5HJ3A 3WS3A 1TVBB 2X1XR 5DZOA 3PQYE 3L9RB 4V1DA 4XP4H 3F58L 3T2OA 3G5VB 3G08A 4Y16C 3ZE0F 1J7VR 3KYNB 1JWUB 4KXZH 2ZUTA 1YEGH 4PGZA 1S78C 1HSBA 4WEBL 3MV7A 1FLTX 4LLYB 3V6OE 4ZDHA 1WTGT 3Q5OA 4NO2A 3WDJA 1A7NL 2AABH 3ALPA 3OSKA 3FAWA 5FYJU 1R24A 2AKRA 2NY4C 2R0WH 3KLSA 5E6ID 1QSED 2D7QA 3UTQB 1UH2A 5JZ7C 3QYCA 1HH9B 3SHSA 2ID5A 3BVNA 5EU6A 2X09A 3FQTA 3QI9B 5K9JL 3BHBB 4RMWA 4OUOA 1TZIB 2C3WA 1YNKL 3QCTL 1YDPB 2YA1A 2L4OA 4IRJA 4WFED 4F7TA 1TNMA 1GSMA 4TSBL 5DS8B 1KCSL 5JW4N 4BKLB 5CINH 2DBLL 4Y1AB 2VB5A 4OIBA 2J5LC 1SYSA 4OZIE 3LRHA 4ZYKA 1HHIB 4P2OB 4PTUA 1AJ7H 2ENSA 2B1HH 1RMFH 1RJCA 1JZ8A 3BKML 2PN5A 2FATH 1LHZA 3BXNB 5DR5H 5CGYC 3MLZH 3UC0H 5L88H 5JW4M 5ERWA 2VLRD 3NCEB 3I50H 1GC1H 4G8FB 1T2XA 1EO7A 3HPJA 1KT2B 3AC0A 5CSGA 4PRIB 4ZUSB 2VZOA 3MRHA 4ZD3L 4IJ3B 1VERA 4Z7VE 4WUUE 3FT2A 2PCPA 4P3DA 4WTXA 2DD8H 2JJSA 1R5IA 3MA9H 3G04A 5JO5A 2FSEB 3L3KB 1QZ1A 2BMKA 3GKZA 4FP8L 5E2TH 2W0KA 3DRTB 1KB9J 4HUWB 1WT5C 1M71A 3O9WD 1EEZB 1AKJD 4ZFOL 4PLJD 3N1FC 1ZLVH 3GI9L 3RY5A 1UA6H 4V1DD 2DQFB 4OZFH 5I1EL 1HCFX 1KJ2B 1IAIL 2A74B 2BSRA 5ACLA 3H9SB 2P46B 4JKPL 4W68A 3BKMH 3MNVA 3MV7D 1KEML 5CP7A 3WJJA 2UZXB 4QY8A 4YGVA 1Y6NR 1PGRB 4KKNA 4P2OD 4PJDE 4BJLA 1SEBA 5KJRH 3TN0B 4APQB 2YD4A 5D7LE 1C5BH 3QNYB 3D85D 3BT2L 1S8DB 4M62H 5D2LE 5D6CB 1HILA 1S9VB 4HKZA 4MCYA 3FQRB 1AP2A 4XXDB 4GQPH 2V2TB 2OTWA 1TIUA 5IV2A 2BHUA 4XNZB 3D25B 4Z7NE 5D72H 3VG0H 5IJVA 1OSZB 1T2QH 1MI5D 4NBXB 3SE3A 1P53A 5E2VH 1KG0A 2X44D 5EULV 4YIQA 2DQHH 3QCUL 4KK6D 3TT1L 4R3SB 3RWIA 3LN5A 3IKCB 1CU4L 5F9JB 1FORH 1M6OB 1R3KB 3VJ6B 4HIHB 4YEEA 1HN1A 4I4WA 4MQXC 4CVZB 1KTRL 5DC4B 3R0MA 1A8JH 3MJ6A 4YBHA 1V7NH 4HJGA 3BKYH 5TE7L 3IU4H 5GS0D 1T7ZA 5EU7C 2VSCA 4XRCB 4HKXB 2GSIA 1JN6A 1JPSL 3JTTB 4TVPE 5IBTH 1M7DB 4KJYA 2ERJB 4WHYH 4QXUH 4BSWB 5EZIH 1RUQL 1IILE 1ZSDB 4XC1H 2EDLA 1FO0H 3ES6A 5E4EC 1ZVHA 1TXKA 2BHZA 4Z95L 1E6JL 1T66C 1NBYB 1A6WL 2H26A 1X3DA 4MXVE 2LAGB 2CRIA 1JWMA 4OCXH 4Y2DD 3JWOL 3BZFB 3VGEA 4NM4H 5DD5L 5GHWL 4AIZA 3T0EA 3K8KA 3BN9C 4LMQI 2C26A 3C8DA 3V8OA 1UM6H 2CDGB 4HV8B 3WFBL 4YHNA 5DQJA 5I1LA 4GMTL 2L7UA 3VFTA 1OTSC 1XF3A 5IFAH 3BP4B 1DANU 1A5FL 5GRZA 4Y5YA 1VFAB 3TH4T 4GOSA 1YMHB 3X14A 4MLIA 2HJFB 5HPOA 4MWFA 1F6LL 2J1KA 2EO9A 2MKLC 1A9EB 4LARL 3AS0A 5GRUH 2C4XA 3BRDA 1RZFH 1Z5LA 3HPLA 5C0FB 4Z7QE 4D8PA 1AD0A 3F5WB 2WBJB 3EYQD 5CMAB 2I9TB 3WMSA 4NQED 3ZT7A 5GISL 4BH7B 1AE6L 2VKXA 1FL6B 1Q38A 5MHSE 2FJHB 4K94C 4HIJB 4FTVE 1D6EB 3ZKQD 1NUDA 1MVUA 3MJ9H 3UBXG 1ORQB 1IAOB 2NY3B 4LPWA 1OGAD 2FWOA 3V95A 4JM4H 2R56H 3GRWL 5JDJA 5C0DB 1WZMA 1RZJL 4GRLC 1ZLWK 3TVMA 2IGFL 4E41E 3FB8A 5AZEH 3H9SA 1NGZA 4X9GA 3C08L 3HAEA 4PGJA 4LBEB 4GMTH 5ICZA 4PJFA 1FLRL 2F19H 5HHQB 1AHWC 4XPBH 5AG8A 1LO4L 4GH7B 4TOYH 3ARED 4LGPB 1JF1B 1U8LB 1T3FA 5GZOC 3ULVE 3FFCD 1UXWA 5C3LD 4S0SD 2F54A 5IFJA 1J12A 5DD6A 2FB4H 3LRSB 5F3BA 1URLA 1RK1B 3QIUD 4OCYH 1CL7H 2R0LL 3HS0B 5FYJL 3BP5B 1WC7A 5I74B 1AHWA 1A7NH 3F7YB 4OV6F 3T1WA 4AG4H 5KW9L 4U1KB 2AK4E 4W4OA 2Q8AH 1K5NA 2HT2C 3QBTB 2VLRA 1MPAH 1JZ5A 3BPLC 1JL8A 3HZKA 1QYGL 3S3PA 3L3IA 4WI5A 4Z7UF 4APQC 2ZOLB 5CGMA 5F7NC 2EC9T 4Y2OA 1VENA 1Z2KA 1NC2B 2HJLA 3DVGA 3QQ3A 4MNGA 43CAA 1F6AB 2BSTA 3L3DA 4FQPA 4KRPB 2DM4A 1G9NL 5FF6A 4IRZH 3ZYIA 1KB5A 4UINH 4ZFFB 2YD6A 4Z7VA 1SJXA 3OQ3B 4TNWF 5D1XB 1HYSD 4QGYA 3QSKB 1PEZA 1LE5A 4PJIE 5K9OB 4WU5B 3RWGA 2CUHA 5FECB 1JNNH 1LO3L 2GIYA 4XPFH 3IDNA 3NCCB 3RIAK 2A6JA 1M05B 1MAKA 2PYFA 1T21B 2X1OA 4JRWA 4KKCD 1JRHI 1LEGB 3EJZC 3U30C 2XZCH 3A0OA 4X9BA 1EFXB 2VLLA 3VG9C 1GHFL 2VLJD 4ESKA 3GJFK 4IOIA 3BD5A 4HGWA 2F8XC 3KNBB 3EJJX 4LCYB 2Y25A 4PJ9D 4PGCB 4MDJB 1J1OL 2PXYA 4PGBB 1B88A 5DMGD 4ZPVA 3UC0L 5L88L 1YEHH 3GK8H 4KHXL 5EBMA 1RUPH 1ED3A 1P7QA 3HRPA 3F6LA 4PJAF 1QVOB 2EDWA 1D5ZA 5EOCJ 1XGRB 2JIXB 5LGJA 2NW2A 2DQDH 3RQ3A 3HZYB 3KLAB 3RNKA 1YMHA 3TIEB