4PJDF

Structure of human mr1-5-op-ru in complex with human mait c-c10 tcr
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
235
structure length
233
Chain Sequence
GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSPPGGTDTQYFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 233
sequence length 235
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjdF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjdF02
4L3EB 5EBLA 4WJ5A 4NYLA 1E4JA 4WWID 2XA8H 4P5TA 5DUBB 1B0GB 5MEPB 1P84J 1FG2A 3DX8B 1UXWA 3QCUL 3HI5H 2X70B 3DWTA 5JW3L 1FPTL 4K94H 3QQNA 4RA3A 3VFVB 4Z0BL 5CCKL 3PNWB 5HYIA 4HIEA 5CSBA 3NVQA 1BM3L 1ZS8B 2XIDA 3DYPA 4ZUSA 1OSZB 3O6LH 1A7OL 3TFKC 1E6JL 1V7NL 4NO5B 3RHWF 2YMXH 4NO3A 4WI6A 1AI1H 4NKIH 5I1KH 3TPUA 4JKPL 3W0WE 4J1UB 3GMPB 2QSVA 1MH5A 3HE7C 4HUKB 2NXZC 4YIQA 3RNQB 1M7DB 4YHYC 1CR9H 1RJZA 2P5WE 1RZFH 3VXQB 2GJZA 1MRFH 5DJAA 3P4OB 3VE0A 2OL3L 3TA3C 1J8HE 2ICES 5DS8B 3WFEH 4FQHB 2XG5A 2FECL 1FCCA 1RUKH 5I15L 2LU7A 3VGHA 1C7TA 5CJBA 2PCPA 3VFSB 1MUJB 4PJ5D 1EZVX 2FJHB 3MJ7A 3BP5B 1NDGB 4S1SH 3SDAA 1CTNA 5GSVA 3ISWA 1PY4A 1W2KT 5IR1B 1MLCB 3RL1B 1LO5B 1RZKC 1BD2B 4JM2A 4ODHL 1VFOA 5GRJH 1YUHA 2W0KA 1DQDH 1JTOA 4PGBB 2APVA 1I1YA 5IWLA 5BOPA 4LQFL 3OAZH 3UX9B 3MLPA 2Q3ZA 2E27H 2XICA 1PZUB 3VXOB 4PV8A 4FQ1H 1G0XA 5C2BH 1I3GL 4PB0L 1F45A 5EZIL 2QSCL 4P4KB 4KY1H 3MRJA 3H9SD 3VU2A 4MB5A 2H9GB 3NCJH 5KSBB 3G6AB 2EECA 3F7YB 2FEEI 3EOTH 5E7BA 3QZWA 5IJVA 3DVGB 1QLRA 2VZUA 4X6CF 3T77A 3V6OC 2HMIC 3MV9D 2P47B 3MRPB 1PYWB 4NO2A 1I1FA 1HIML 1A3RH 1HH9B 5BW7A 2IPTL 1WAAA 1S7VB 4NJ9L 1ULVA 2P7TB 5FYLL 1LEKA 3OKEB 3G6DH 4F33B 2ICEA 3STBA 5DHYB 4G7VL 4MLIA 2QQLH 4LSQH 3SE9L 3PWUB 4J6RL 1C08B 2CKBB 1XF5A 5AG8A 5D1ZD 1QO3A 1MRDH 4CBPA 2E7HA 3MACL 4Z0XA 3I6GA 4RIRA 1MCEA 1A6UH 5GPRA 3MRHB 4EUPA 1X5LA 3L95A 1VENA 4ETYA 3RL2B 4LDLB 4D3CH 1QRNB 3CH8A 3GK8L 4HC1A 2DL9A 3X13B 5KS9E 2J7LA 4OZIB 2ESVD 1E6OH 1F3DH 4FG6C 1SYSB 4R4BB 4YE4L 1NAKH 1AGEA 2XXMB 1DQTA 1CLOH 1X44A 1IILE 3RX7A 4Y2DA 4XNZB 3LSOB 5SWQB 1S7QA 4Y16A 4A2LA 1ZHBA 3M17A 3OG6B 5LBSH 3OF6A 1P53A 1N4XH 3G6JB 1XGTB 5C0ND 5E99L 3HNSL 4N0FB 4NC1C 1T7VA 3BQUB 3ROLB 3IXAA 4HJGA 3SJVE 3LOWA 5K9QI 3SDDB 5CUSH 1IAIM 3AB0B 3VFWA 3RZCA 4PJAB 2G75B 3U82B 3O3AB 1VGKA 1NCAH 1L9NA 4R2GC 5CJQH 5D6CA 4MCZA 5CGTA 1ZHLA 1A6VL 3MRDA 1MIML 5C0AA 5E5MA 2UUDH 4X6CA 4RGNC 4X6DE 1FC1A 1NGQL 4YAQB 5F3HA 5DZLA 3H3BC 4PJ7A 2PXYA 3Q5YA 3G5ZB 1QSFE 1UKTA 5JHDD 4UINH 2IC2A 5FUCC 5FDWB 2XNAA 5MEQB 5L6YH 1R3KB 1ETZA 5JW4R 1UH3A 3BP4A 4DKEH 3FRPA 3PDDA 2BERA 1JI2A 4JY6B 3MFFA 3RWFB 4MXWL 1J8KA 1MFBH 1C5BH 2VC2H 1EHXA 2XXCB 4I2XB 4LCYB 2GSGA 1FBIH 5IW1B 2V5MA 1DUYA 4LDEB 2V2TB 1KB9K 4X7EC 2A6KB 2VDPL 3IDNA 3F8UB 5EOQH 1QTYT 1Y6MR 1JF1B 2K7PA 5ILTH 3KS0H 3BZFB 4Y89A 5I1HL 4MDIA 3QHZH 4MSWA 4U3XA 1OTSD 4FZEH 5EO1B 4NNXB 5ANMB 4IRSC 4MNQA 2YWZA 1WWCA 2X05A 2VH5L 4IDJL 3AS3A 5T33H 3HNTL 1I9IL 2GJ6A 3OB8A 1PZ5B 4PJFF 1DSFL 4J4PD 8CGTA 4YBLB 3ZHDA 2R1WA 2ITCA 3RZWA 2DQFB 2QADB 2XRAL 1NANH 1A0QL 2XPGB 4I3SL 5DMKA 1AY1L 4F57H 3I6LE 3EO9H 3O4LD 3U7WL 1SMOA 1DN2A 3DX9B 2IAND 3BKJH 4HUWA 3TWCH 4IM8A 3WIHA 4CKVX 2O5YH 4PJBE 2NY6C 5JXAL 3U0PA 5DRZB 1I3VA 1YY8B 4L8BB 5LGJA 4FFVD 5T1KB 2E6QA 4EQ2A 3BT2L 3L7FA 3QUYC 1VEOA 4YHML 2FATH 1IKNA 5T3ZL 3TH4T 4WEUD 2JIXD 1J9CT 4X4MA 4URTB 2CDEB 3CXHJ 4YUEH 5KTEL 2WWMC 3HC0B 2Y7QB 2YZ8A 4JQXA 3VFGL 1BQLL 1CBVH 1NAMA 2J8UF 5F9JA 4GKNA 5I18H 1GVIA 2PYED 3X12B 3IDXL 4CU6A 2VLJD 4Q7DA 5JO5A 4PRNA 3L3IA 4E41E 1XGQA 1DQML 1WFTA 4KGJA 1KACB 4LVOC 3E6FB 2L0DA 4B50A 1H3GA 3O3BA 4WFFE 2EH7H 4KRNA 1HCVA 3BSZL 4DTGH 4OB5H 2YOCA 2WAHA 3PXHA 1NQBA 2R4RH 4RZCA 5EUOB 4YDVA 3MNZB 3LVEA 4CMMB 4XCCL 4N0UE 3B6SB 3W81A 4LRNL 5MI0B 3ARGB 4C4KT 1BOGB 4DGVH 3N1FC 3V8CA 1FORH 3I9GL 1RULH 5EZOL 3T1WA 1EFXB 4FTVB 1SM3H 3LN5B 3RVVC 4AQ1B 1WFOA 4KRMB 1ZTXH 2L7JA 4KK6D 2LTQB 4C56B 1ZHKB 4PJIF 3D48R 4PD4K 3QEQD 3VFOA 3KJ6L 1F2XK 4XC1L 4QOKD 5CSZA 4KROD 1OAUL 1YYMH 3GJEA 3SDCA 1QFUL 3BW9A 2APBA 3A67H 5DMYA 2A74B 5I66B 5I0DA 4WFEE 1LEGA 3W9DA 4GLRI 5C0GB 3LKPB 3LKSA 1J12A 2MKWA 2ZJSL 1IGYA 1A9EB 4WTZA 3D1MC 1I9JL 2Z8WC 2CKNA 4GXVH 4LCWB 2OMNA 3I3DA 1MI5A 1BP3B 2V9QA 4GKSB 4ZQKA 1YEIH 4DZBB 3HUJE 5L2JA 1S9VB 2AEQH 3HI1B 1GL4B 2G2RA 1UCBH 4N0YL 3FQWB 4PLJC 3BX7C 1AP2B 3KPQB 1L0YA 1FGNH 4M7LL 5K9JH 3BN9D 4NSKA 2EIDA 4M03A 1NL0H 4GAYB 5TFSH 4EIGB 1OAXH 4JZNA 2FR4B 1T20A 5E70A 3TEUA 5E4IA 2BSSB 4NN7C 5B38G 2EDTA 2W0PA 4PYHA 1RZJH 1ZLSH 3QAZB 5L88H 3C5JA 3HS0B 2APTA 4U6VH 4HS8H 5EU6B 4ZO7A 1KTRL 4HXBL 5EZLB 5DK3A 2IPUG 4OGYH 3AU1B 4JFXB 1H3TA 4C59B 3QG7H 3PWLA 4QRTB 3EUUA 4ORGB 3SGJC 4UT6H 4JHZA 3AREA 4NCDA 3ZKXC 1DBMH 3PV6A 2HKHL 5BS0B 5GRXG 5AEAA 2B39A 5FCUH 5CBEA 3NA4A 3TIDB 5F7UA 2AGJL 3RPKA 5H2BA 1QYGH 4NHUA 1MLBB 3K1DA 1EAPA 1CF8L 4P46C 1OTUD 4QXGL 5J4MA 5HI3D 4XVUC 1VDGA 4OLVH 4R90H 5DJCA 1HILA 3QIUC 4QRQA 5HJ3A 1MREH 3JV0A 2IQAB 3RBSA 1CTOA 1CVRA 1QR1A 4HUMB 1OM3H 4H1LH 1WC7B 4Y4FB 4F7MB 3MRFB 4PIRF 3RUGA 3WJLC 3MV7A 3VD5A 4PREB 5DR5H 4BQ6A 5E6ZA 4XPBL 3VXNA 1U8QA 2ED7A 1T7ZA 3O8XD 3OAZK 3OAYH 4OBRA 4PJEB 1QSED 3CCHA 2FH8A 1NDMB 1T1WA 4AG4L 1KBGH 1E4XL 4LVNB 5GGSA 1D5MA 1UJ3A 4LAQL 1BECA 4ZXBB 5L0QC 4LMQI 1OGAA 1UH2A 2NY0D 1MFNA 2ZKHL 3UPCA 4BYHA 3RDTC 4P5MB 1KXVC 1B0WA 1CL7H 3CGTA 3B9KD 4M62L 2GUOB 3MNWB 1KYOJ 2QV2A 4XBGB 3BMVA 1AQDB 1FFRA 2R69L 2Z31B 5H94B 3ZHKA 4U2YA 3W11D 3R0MA 5GGTH 4ODVH 2NX5D 4LARL 1V3KA 1NBZB 2H2PD 3C5ZB 4PRDA 5GRUH 5JTWA 3C5SA 2QQKL 1FFNB 1B0RA 4WV1C 2YK1L 3Q6FA 3MJ9H 4LEXH 3FCTA 4N0RA 1WAAE 1JGDA 2AI0H 3JBG7 4FOMA 4HWBL 5TE4H 1N8ZB 2AV1B 3MBEA 4WO4A 5ITBH 4JRYB 4WW1A 2DM3A 4NNPH 3WD5H 1J18A 1X6NA 2ZPKL 1NCWL 4FXGA 4O58H 5CKGA 4FA8A 4KUZL 1YN7A 5B38B 3S98A 5JIPA 2ZG2A 3IDIB 4AK1A 1KB5H 3FQNB 4ELMF 5MHSD 1GCFA 1NLBH 3JTSA 2B1HL 3TBTA 5B8CB 5HVHB 1U9KA 3LDBB 2VN4A 5E8OA 4Y2OA 3WLBB 4M3KB 4Y4HC 4NUJB 2DM2A 2X1QA 5J1AB 1KLUA 5IMLB 2C1OA 2XQYK 4FQQB 4ZD3L 1A21A 3ZTJH 4X7SH 1HDMA 3OKMB 4YHIA 2C5DC 2R0KH 1VKXB 3EYQC 2IAMA 2YD4A 2VDRH 4X4XB 1XGYL 5EOTB 3T0EB 2DLGA 1R5IA 4FMKA 2WWKO 2O61B 3FQTA 1UACL 4ONGH 1FNSH 5KN5A 1AC0A 1NFDE 1SBBA 1FO0H 1U3ZA 3MGOA 1LK3H 5F8QC 2DMKA 3DJ9A 3VWKC 3VWJA 2F15A 1TMCB 2X1PA 1SY6H 4J23A 5C0EA 4KMTH 4PJ8A 1GC1L 4NQCD 3T09A 2Q76B 3ARFC 4FFWD 2QJDA 2P44B 3U7AA 2UUDK 5SX5K 2Q8AL 2Z35B 3U30B 3LMJL 4ELKB 1U58A 3PGFH 2AS5M 5MERA 1YECH 4XRCB 2BJML 5C0AE 3PWPE 1G9ML 1ACZA 4ZSOA 4P4KD 2GAZB 5EU4B 2DL2A 4PJ7E 3LEVL 4KDTC 2ZZUT 1CGUA 3UPAA 4N8VA 4YC2C 3U9PH 1IJ9A 3RGHA 2F8XC 2DWDA 1RVFL 3EJYD 3CPLB 1TDQA 2I07B 4GW5B 5KOMC 2IALB 4QKXB 4XBPB 5IROA 4Y19D 4U6TA 2KBGA 3PABA 3CLEH 4EVNA 1KN2H 2X09A 1JWUA 1J1OH 4NUGL 4R26H 4Z9KB 5HYSG 5E6ID 3K2UL 1P7KB 2VSDA 3IDUA 4F3FA 1CD8A 4ELMA 5JOFB 3BAEL 1S9KC 2VABB 4YDIL 1NEZA 5EPMB 4QHNA 5CEZL 3CSPA 3L6FB 2YA2A 3MMEB 4MJIB 3VH8G 3EYVA 2IF7A 4PRBB 5K9OA 5FOJA 4L3EA 1CCZA 1IGCL 4MNQE 2EKSA 1RHHA 5SWSA 3ILPB 1T2QH 2F19L 1IQDB 2B5IB 2GJ6E 2EDLA 3GSNB 3DX8A 1JGUL 3GGWA 3IDGA 3KR3H 5HI5D 1MIEL 5C09B 4NKMB 3LS4H 1QRND 3DOSA 3FN0H 2MQ3A 3NH7L 4HW6A 4NT6B 3KPSD 4DKAA 2FJGA 1J0KA 4BQ8A 4M7LT 1JUFB 1H8NA 1M6OB 3D69A 3OZ9H 5INDA 3IRZA 1JGLH 5DT1L 2WIIB 4MNGB 1XH3B 8FABB 3REVA 1HSAB 3E3QC 2GITA 3FL7A 2Q86A 4J1UA 1TJHH 3RNQA 1NMCB 2CLZB 3BQUD 4L8DB 4LLDB 4ZFZA 4X4ME 3VXQA 3FFDA 3SDDD 12E8L 3PF2A 4LDOB 5D9SA 1X5FA 4Y5VB 4YDKH 4ODUB 4FQHA 1JZ2A 4ZUTA 2COQA 3O4OC 5JLZA 2HKFH 4O4YH 1MVFA 4CNIA 4MMZC 3WXWL 1DE4B 1YEDA 3O11A 4KQ3L 3PWJA 1CS6A 1QBAA 5SV4A 3ARUA 4FMFA 4HFWB 1RJLB 5IR1A 1K6QL 32C2B 1CXHA 2EEBA 3MUGA 1LO5A 5DVNA 2NR6C 4EN3C 1BD2A 4JR9H 3MLVH 4LHUD 5F9WC 2DYPD 5AWNH 4OIAA 4PGBA 1UXSA 4HIJB 2YXFA 1FL5B 4ESKA 5E00B 4GAGH 3BPCB 1AGDA 4NKDB 3EBAA 3H9ZA 2VDML 3PJSB 5D7SL 1FFPB 3S97C 4JLRA 3UTPD 1RIUH 3CVIL 4J3UA 2E9IA 3SKUD 2D2OA 4MS8C 3KHOA 3KWWB 1F4HA 1UZ8B 2H45A 3BXNB 4KDWA 1AFVH 4R0LA 4OZFG 1W0WB 3G6AA 3F7YA 1HXYB 3WYRA 3DVGA 4JFQA 3BIAX 1A14H 1NSNL 1T1YB 1UB5B 3EOYG 4OT1H 5HYSB 2N56A 1CICD 3RVXC 1HH9A 4WCYH 4F58H 4FQIL 4MJ6B 2A0LD 4PJFB 2B0SH 2BRRL 1AR2A 3L1OH 4LSVH 4RFNB 5F3BA 1C5CH 2Q8BL 3OR7B 4WUUA 1U8IB 3DVNB 5BRZD 3LH2L 2A1WH 3LN9A 3OKEA 5BVJB 2YBRB 1N2RA 4X98B 3RIFK 5DHYA 4B5EA 4ODWB 2M2DA 3W5MA 2NQCA 4M48H 2C26A 3QWRA 1FYTD 3OPZH 3B9AA 5DQJB 1FH5L 1OHQA 1XIWC 5CMAA 3K8LA 2FD6L 4XPHL 4GMTH 5T1KD 5TDOB 3C6SB 3MRHA 5F88B 3I2CH 2Y9RT 5ENWA 3AFLA 1TZGH 2YUZA 3RX8A 4LGPB 4D9LL 3S8WA 4IHOB 3RY6C 4NPYB 3F7RA 5J6HB 1SYSA 4R4BA 2J8UB 4HKJA 2G5RA 3JWOL 2R56L 3LSOA 3DURB 3DMMA 5D2NC 1S78C 3CDGB 2FBJL 2IH3B 1XGTA 3DXAA 3UZQA 4EZMA 1W0VA 1C5DB 4EBQL 1MHHA 3MCKA 2ZUTA 5ICZB 3UDWA 5KOVC 1I1AA 1A7QH 2FX8H 4RMSA 3ZDYF 4ONFL 1F58H 3U0WL 2EDQA 1F3RB 4NM4H 4TUOB 2OJZL 3DO7B 4XVTH 2VERN 1WWAX 3ARGD 1FVCB 1JPTL 4MYWB 4XP6H 2OP4L 1R3HB 3GRWL 3KPNB 2R4SL 5E8NA 5DRWB 3ILQC 3RUGE 5D1QA 5FV1L 1FRGL 4Q6IB 5IFJA 1GXEA 1P9MC 1AHWA 3MV7E 3MV8A 5FXCH 3OAYK 4C56D 1HHGB 4PJIB 4WI8A 5MEQA 4LPVA 1R3KA 4KHXH 5L9DH 3EYOB 2IH1A 2YC1A 3THML 3RWFA 4QWWC 3P4NA 5DD1H 2UY6A 1NMAL 1I3UA 5EH1A 4CJ1A 1AC6A 2YRLA 1I8LA 4KTEL 3A6BL 1YEFL 2P46B 1X7QB 4LCWD 4Z76B 1LWRA 1A3QA 4PUBH 5DD0H 3GJFB 3BJ91 1A4JB 5IMKB 3CFKB 1JNHB 1YEJL 3NZ8A 3KYMB 4GRLB 5EO1A 4WDIB 4NNXA 1OTTC 4L9DA 4BZYA 1A6ZA 4PY7B 3D87B 1CDGA 4FXKA 5AD0B 3L3HA 4P23C 1FAIL 1OAQH 1PZ5A 4P99A 4JQIH 1AO7D 3RWGB 2P8MB 1MFAH 4EEEA 3I02B 3L3OA 5D70L 3WHE1 1B2WH 3CXHK 5E56A 4LLMA 1FVDA 4OGXL 5ISZA 2XPGA 3IJYB 4I5BA 5HGDB 3E6HB 1T7YA 5I6XC 4OIIL 4HIXH 1A9BB 5DJXB 3DX9A 4MGXA 1BGXL 3L5JA 5EU6D 4ZMAT 3K8MA 4NC0B 5DRZA 1YY8A 4RISL 3IU3B 1KLGA 3H7BB 4WFGD 4Q74A 4Y8AA 5I8OH 1IEAA 3TC9A 4Q9RL 1Q0XL 5BS0D 3RWDA 1TZHA 5MENA 4L4VE 3ULVF 5DJ6A 1NMBH 2VKWA 4NRZA 2CMRL 3DUSB 3Q6GH 4IRSB 1KXQE 2XA8L 4Q6YA 3ME0A 2CO6B 3WIFA 4RQQB 3SBWC 2G5BB 4LLVA 2Q1EA 4MX7B 4R3SB 1OD7A 1WBZA 5FKAB 3HI5L 2V7HB 1OAZH 4K94L 4MZ2A 2AJXH 4GKOA 1WZ1H 4Y4FD 4YHPB 5E5RB 3FFCB 4YZFF 4XX1E 5ESVA 3O6LL 2VYRE 4BH7B 5F6IC 1E0OB 2QBWA 5L7XH 5EUOA 2YMXL 2VE6B 1AI1L 5FA3B 4NKIL 5I1KL 4MQXC 4GAFB 1IZJA 5J3HC 5CKAA 4WI4A 4MZ3A 3QUZA 2ZOKB 2P5EA 3QUYB 3OSKA 4X6BB 4ZXBD 1AD9B 3VXTA 1CR9L 5HYQA 4FTVA 5INCB 1RZFL 2NXYB 4U1HA 4U1MA 2HT4D 1MRFL 2UZYB 3QNXA 1LP9E 3WFEL 1SEQH 1JWMA 5F7EH 3HHRB 1WZKA 1RUKL 3GUTB 2Z31D 4LP4A 4BZ2H 5D5MB 4XTRD 3D2UB 3O45B 3JWDH 4F15B 4S1SL 5D72H 3ZKNC 2X42A 5TF1H 1EXUB 1VEPA 4LVOB 4KRLB 1KJMB 1X5IA 1RZ8A 2R2CA 1EEUA 3RGVA 5GRJL 1TTFA 1IGJB 4LRIC 1DQDL 4ONHB 3TZVB 4PGZA 2F74A 2D0HA 4G8GB 1S9VA 2E27L 3HI1A 3ZE0E 5JNYB 4FQ1L 2H1PH 1HCFX 3QEUB 3IRPX 4OD2B 3SO3B 1HI6A 4PRHA 5GQBA 5C2BL 3GBMH 1KPVB 4WWKC 3KPQA 3KPMA 2JK5B 4KI5E 1S5HB 4KY1L 4L3EE 1RSFA 1XZ0B 2LV4A 3NCJL 2LVCA 1IE5A 3EOTL 2F9BT 1G9MC 5CP3A 5DI8B 1Z0MA 1I7RB 2BSSA 3WFCH 1UGNA 4TNVK 1T21A 3S3SA 3ROOB 3HS0A 1A3RL 2AJ3A 4PRAA 4WU5A 4X8JB 3GIZH 4WI7A 3O2DH 5D6DA 4FQ2H 3EW3B 3AU1A 1QBMH 3ULUD 4JFXA 3NIFE 4QRTA 1FNGA 3WHE0 3G6DL 1MCPH 2VLKA 3TIDA 3SO5A 2PYFB 2QQLL 4LSQL 2W1NA 3OKKA 1JYVA 1WIUA 4O02H 1JF5A 3ARBA 4LLYA 5J0BA 4M8QA 2V2WA 1LDPH 3P30H 3QCTH 5BV7B 1MRDL 2VLRB 2DQTH 3H9HB 1EO8H 4JFYB 5DFWH 3G5VB 1A6UL 4Y16D 1IRAY 1IT9H 2GK0B 4KK8C 4PJ9B 5EZJA 4EI5A 2Y25A 3IKCB 3QNYB 4D3CL 4F7MA 4M7ZC 4OLUH 4NN7B 4R7DB 4ZNEE 2XTJB 1KYOK 5DQ9B 4G9FB 3SN6N 1JCKA 2EE2A 3ZSSA 1E6OL 5F7MC 1NAKL 2AXFA 2VLLA 5I1DB 4G6AD 1CLOL 1BD2E 4W4NA 4U1JB 5IFHH 3FB6B 2OTUA 1X5XA 2QQNH 1NDMA 4M61A 5LBSL 2M1KA 4HULB 1N4XL 5DJ8A 4QHLB 5TDPB 3AGVA 4P3DA 1LEIA 1JYWA 5CUSL 2PXYD 2O5XH 1E28A 2VIRA 4Y5YC 1BFSA 3EOBA 4G43B 4L3CA 4MQ7B 1NCAL 5CJQL 1CK0H 2MMXA 1JFQH 5H94A 4N0CD 3HR6A 2ZWLT 1UC6A 2X4UB 1A1MB 2UY7A 1QFWM 2B1AH 3C5ZA 4FRWA 3BN3B 1T0MB 2XWJB 5JOEA 3ULUH 1FFNA 5D93C 1QRKA 1NGXB 4UINL 3F58H 3QJFA 2AABH 5L6YL 1N8ZA 1U93B 1IVLA 1WF5A 2JF1A 4DKEL 1HZHH 4PG2C 1XCQB 1AGCA 1RIHH 1U8KA 1MFBL 3ARPA 5IB4A 1C5BL 4TVSa 2VC2L 5L0QB 1FBIL 3WEXB 1O0VA 3MROA 1BLNB 2OM5A 3IDIA 3KLSA 3K46A 1A3LH 2R1YB 4RMRA 5EOQL 1F13A 3KYOB 4HUUA 5ILTL 2OMBA 5B8CA 2F8OA 1CT8A 2VITA 2XZCH 4JZJC 5C8JB 2MHAB 4FZEL 1XEDA 1QRNE 1UM6H 4NUJA 5EO0B 1ZLWH 1NGPH 5CBAA 3GSUA 4LEOB 5IMLA 2GTWA 4OZIE 5T33L 1V8HA 4FQQA 1AXSA 2DM7A 4KMLB 3VRLE 3OKMA 5KSAA 1EEYB 2Z92B 5KJRH 4Y4KC 3TT1H 3OKLB 4OQTH 1Y18B 3IDJB 4U05A 4F57L 3KJ4B 3EO9L 2ATKB 4JGJA 4M9PA 3BKJL 3NIGF 3TWCL 4M93C 2O5YL 4H26A 3VG0H 5HVGB 1KFAH 4BQCA 5HGAB 4QXTA 1IAKA 2Q76A 1L7IH 2NYYC 2FATL 2HFFB 1T22B 4ELKA 4BFIB 1CFSB 3EDEA 1C16B 1KGCD 3IB4A 4YUEL 4ZPVB 4MAYB 1T89C 1CBVL 4FN0A 3QRFM 3GSNH 4GG6A 2GAZA 5EU4A 5I18L 1PBYA 1E4KA 1AGFB 3DIFA 1TCRB 3T08A 5GGRY 4ZPTA 2OK0H 5BZWB 3OTTA 4FQPA 1UZ6E 5M7QA 2IALA 3SE4A 3M1BA 3ZYIA 4LFHG 3UTPE 1Y0LB 2BY2A 2EO9A 3VMPA 3KLHD 3LQZB 2EH7L 2R0LH 5FEBA 3JWOC 4DTGL 4OB5L 3OB0H 4I2XE 4ZYKB 3X3GH 5ITFB 2GHWB 2PW1B 2R4RL 3VDCA 1P2CB 4MJ5B 1MCOH 5JOFA 2D9QB 4DGVL 1FORL 2VABA 3ARFB 4FS0A 1RULL 1WCBA 3N1MC 4Y1AA 5JA9A 4H25A 1SM3L 3L6FA 4MJIA 3MMEA 1RV6X 4WHYH 1IC5H 3N50A 4OM0H 1ZTXL 4JO2H 1YDPB 3GSWA 1R5WB 4OF8A 1SVCP 3ILPA 2OXHA 3A6CH 1IQDA 3NBNA 1U8HA 2E9WA 1MFDH 4MB4A 1RUPH 1YYML 1O5DT 1FZOB 3A67L 4ZFOB 5GS0D 1XAUA 3D9AH 1K8DB 5C09A 3SDXA 2CD0A 3QUXC 2DQCH 3RKDC 4LP5A 4A6YA 1CGXA 3SEPA 2J2ZA 3TNMB 4NKOB 4WW2F 1U91A 2BC4A 1EO7A 2EC9U 1EHAA 3RTQA 5ISZE 5GJTH 5C3LD 2FX9H 4CN1A 4JPIB 1JUFA 1M6OA 4HFUH 4PV9A 4PP2B 5GRWA 5DURB 1K3IA 4GXVL 3TBSA 1XH3A 3GSVB 5DRXB 1KLFA 2R2HB 1YEIL 3DRTB 2GTZB 1CI5A 2AEQL 4PY8J 4PRPA 3GMOB 1UCBL 3K4AA 4J3WA 2ARWA 1QLEH 5E8EA 3MBXH 2FECI 2CLZA 4YXLH 3O41B 2Z9TA 5MENE 1A4KA 2HLAB 3K4DA 4LLDA 3SGDI 2BNQA 3Q5OA 5K9JL 1NL0L 2PF6A 5TFSL 1OAXL 4Q58C 5CJXC 4ODUA 3N9GH 4Z7UF 2NY3D 4M1CC 3ARED 5CZXD 2XWTB 1DE4A 4KRPB 4GMSH 1RZJL 4FFYH 5C07B 5IMMB 3AS0A 4LNVA 1ZLSL 5L88L 3FQUB 2ZG3A 4U6VL 2VR5A 4HS8L 3HZVB 3PXJA 4GSDH 32C2A 5DJZA 1EA9C 2G60H 2JJUA 4OGYL 2SEBB 4C83B 1W72A 3QG7L 5FO7B 1FL5A 5EUOE 3PGCA 5E00A 4NKDA 4UT6L 3DYOA 4HD9A 5ID0B 1DBML 3HMWH 1RUMH 4NBXB 5CZVH 5FCUL 5I1EH 2I9TA 1U3HD 2FGWH 2LAAA 1F90H 5DO2D 3OXRB 1J10A 5I1JH 3HE7A 3O2VH 1QYGL 1QVOB 3QQ9D 4FTVE 4W68A 1KPRA 4Z7OF 3HZMA 4R90L 4OLVL 1ZLUH 1JWSB 3TA3A 4PR5B 5IB3B 4GRWF 1MREL 5ADOH 1HXYA 4XPTH 4OUUA 1R24B 2BNRB 3QFJB 3T0DA 3O4OB 2QR0B 1OM3L 3MRGA 5FYKE 3P0VH 2AQ2A 1T1YA 4QTHA 4OFYA 1OGAD 4X0KB 5HYSA 4CUCA 2OCFD 4HAGA 1NC2A 4GRLD 5A2FA 3HKFA 1AIFB 5DFVD 3RWJB 3EYUH 4O2CB 5DR5L 1YMMA 5C0DA 4O51B 3EZJB 4K94C 5I16A 1PDKA 3VH8A 3UTTA 1U8IA 2BHZA 3HPJB 2RCSL 4R97C 1CLCA 1KBGL 1VPOH 5EUKA 1KSRA 3IS0X 2F8VA 1ONQB 4QRPD 4BA8A 4PRHE 3TM6A 1CL7L 1L4IA 2J5LC 4GFTB 4UUJB 3U4AA 3CFIC 4UTBH 2YZ1A 1G7MB 4PTUB 2Q87A 4G5ZH 3MV11 5CP7B 3QPQC 1ZSDB 4LSSH 4U1LB 1FV1B 5GGTL 2RQ8A 4ODVL 1T6WA 1D6EB 3MRCA 2AJUH 4XB7A 4HLJA 1CWVA 5A1AA 1YEHH 2VZSA 1CGYA 1L0QA 3FO9B 5IMOA 5GRUL 2NTFA 4UIMB 3V6OA 4PJXA 4NPYA 3DARA 4D0BB 3MJ9L 4KJYA 4LEXL 3U36B 5EU6E 4HWNA 2AI0L 2LAGB 5TE4L 1EGJH 4TUJA 5CWSB 5ITBL 3QDHA 3DURA 2PO6B 5IVZB 3TH2T 4NQEB 4NNPL 3WD5L 5ACZB 2VLKE 1G6RB 4V1DB 3FFCD 1NEUA 4ZO6A 1KTDB 5IEKA 1HWGB 1KB5L 5CHNB 4KTYA 5ETUB 1NLBL 4HMDA 1T1XA 4OTXH 3G9AB 4U3CA 4HG4J 1Z3GH 3C08H 3R06B 3OKDB 1R3HA 1OT2A 2NXYD 3ORJA 2HT2D 1H3XA 4HJ0D 5DRWA 5GRZA 3SKNB 1M7IB 1SQ2N 1FYHB 2OYPA 1RUAH 4R7NA 4X7SL 3LQAH 1XF3B 3QNZB 1PQZB 1J11A 4OLEA 4YHLH 1B4RA 2R0KL 3BI9X 4CMHC 2VDRL 4PJEE 4ZUWB 2BOBB 4UI2A 4OZFA 1EIBA 4KKBD 2EC9T 4ONGL 1FNSL 1MHEA 4CVXA 4XCFH 3WJJC 3UTOA 3RHWK 1QEWA 2VXUH 1MY7A 1FO0L 1HN1A 4AENB 1LK3L 2YSSB 4XHJD 4X9FA 1CFNB 1SY6L 4D0DB 1X7QA 4KMTL 3JVGC 5DK0B 4Z76A 5DHVA 4G8GD 4XCEB 1HHIB 3STLB 1JBJA 15C8L 3PGFL 5HDOA 3GJFA 2GK2A 3CFKA 5IMKA 1YECL 5A40E 4CL7A 5FYJD 1JN6B 4ZO9A 5I73C 2VTFA 4H5SA 3FAXA 1URLA 1JJUA 5GRVK 3RWGA 2CQVA 3B9DA 4LHQB 5D7JB 4U6HA 3E1F1 3U9PL 3BZEB 5GHWH 4Z5RA 4QY8A 3QI9D 1PEZA 2CDFA 1I8IB 1HEZB 4W70A 3QG6A 2HT3D 4JRYE 3V0WH 5AAMA 3MUZ1 5I30H 1FHGA 1QSZA 2EH8H 1S3KH 3CLEL 4KI1A 4S10A 3SY0A 1CFQB 1KN2L 5SWSD 1J1OL 5I1AB 4R26L 43CAA 3GKZA 3BKYH 3U6RA 5C1MB 1TITA 4X4YB 1S8DA 5D7KE 4RRPA 2ATPA 1FAKT 3QDGA 4QO1A 3BRFA 3HG1B 1FSKC 5B4MD 1RZGB 1BQHB 5DC0A 2MNUA 5CD5D 2CLRB 4J8RA 5TH2A 4IRSA 1T2QL 3LV3B 3NCFB 3NFNB 3KLAB 4POUB 4RQQA 5H37G 2G5BA 4MX7A 4PJ9D 3KR3L 5FKAA 2H8PA 3L3JB 1QP1A 4JY4B 1N6UA 1X5ZA 3AUVA 3LS4L 3UZEA 3FN0L 3T0EE 4YHPA 4LQ1A 5F71A 2XTJD 5TE6H 1ORSA 3JV4B 1CXLA 4G9FD 2E7CA 3OZ9L 1BPVA 1SJVA 4A2MA 5I6XB 1JGLL 5HHME 1IM9B 4L8SC 1ZA3B 4JFDB 5K9KA 5D1ZC 5E1AB 1TJHL 3WL9B 1B6DA 5FYJH 1AD0A 3IVKA 3QUYA 1FQ9C 3ZSTA 1TNMA 4M8VA 3GMMA 4WI2A 1A02N 4X7FC 5JOPE 4JDVA 4YDKL 2VOTA 3WFZA 4GG6E 3W82A 4BK5A 2GCYB 3JXAA 3UP1A 1INQB 1L7TH 1CFVH 4Y7MA 4O4YL 3UBXI 4C57C 3VXSD 5SWZB 5D5MA 3D2UA 4BSVB 2C4FU 2ADGB 2FWOB 4P0DA 1GGBH 5DJ0A 3OB0K 3VDBA 5IESH 3GNMH 1RZ7H 5C0NC 1FL6B 2AXGA 4JR9L 3MLVL 4FQCH 5E5UB 3C60B 1TIUA 3QH3B 1IGJA 2PTTB 1CFBA 5AWNL 3T2PA 4F7TB 4IOIB 2B8OT 1U3YA 1U8JA 4GAGL 1XF2A 1LD9A 1N0XH 1YPZA 3BEWA 5JNYA 1RIUL 4W6XB 4K55A 4JKKA 5GGRB 4OFPA 4P49A 4Y1AE 4KKLD 3MGAA 5BV7H 2D31A 4MJIE 1AFVL 3B83A 3KPOB 3BWAA 5HYJA 3MOQA 4WUUD 1WZMA 5DUPH 2PETA 2XG4A 1JK8A 2V5SA 2ZUYA 1A14L 3BUTA 3EYSH 4OF0A 3P73B 1I7RA 3ZKMD 5IHBA 4OT1L 4KZEH 5CEXB 2V5RA 2MPAH 3DX6B 5C09E 4OCWH 4KUCF 1IGMH 1PKQB 2J6EH 5DDHB 3T1FB 4WCYL 4F58L 3MJ8A 2PN5A 1K5NB 2B0SL 3L1OL 4LSVL 3P4MB 1C5CL 2H3NB 4MNGE 2A1WL 3FO2B 4PRPE 3BP6A 3Q2CA 4CRPA 2PYFA 3TO4D 4M48L 1CD1B 5ALCH 1YQVH 3BDXA 3OPZL 4WWKB 1OTSC 3HI6H 1AKJD 1U42A 2HTLD 2IADA 2R29H 3H9HA 4GMTL 3NPSB 1VFAA 3DMMD 4MD0B 3VRJB 3QUMA 4J4PC 3DXAD 2H2SD 1U8OB 1N59B 4MXQD 3I2CL 4LGSB 1PVHA 1TZGL 3IYLW 3PHSA 3Q48A 4MAYD 2VZ1A 3V0VB 1E4XI 1P4LA 3PQYB 4AYFA 3EDJA 1DBKH 1A7RH 4D94A 3LN4B 4X99A 3PWNB 1EMTH 4U1SB 5C9JB 4JVPA 4RFEB 3BYYA 3SE3A 2X2YA 3E0GA 2QQQA 3KPRD 2DIAA 4FFVC 1Q9LB 5LGKA 4QHLA 3SGJA 2XN9D 1A7OH 3B8SA 3S37X 1KJ2A 1NCUA 3QQ4A 5DWUH 2JKXA 4HMCA 1P7QA 5D1QD 5CIPA 3VCLA 1KGCE 3MV8D 1A7QL 1BVLB 4X8XA 2FX8L 4XCNB 1ZLUK 1FN4A 4JG0H 1F58L 1KNOB 4D9RD 1N26A 4P46A 5IF0A 4MQ7A 3BUYB 5L8JB 4NM4L 4XVTL 2XQBH 4OZGB 3QIUA 4JFEA 4NN6C 1MCBA 4XP6L 3TN0B 3NMEA 5IHLB 3ZLQC 3V4PH 3VI4E 2XWJA 4M7KH 5B21A 3WJLA 5HHNA 2NW2B 4DUVA 5D2LF 3EHBD 3Q1SH 5T1MB 3WS3B 1NGXA 1RZJC 2WSKA 4JO1H 4LVHC 4WENB 1U93A 3UTTE 1IEBB 4GRMB 4KHXL 5L9DL 2HLFD 1ERNA 5DD1L 1HHJB 2NY2D 3DROA 4WW2B 5DTFB 3WEXA 2V9RA 1FVEB 1IL1B 4GJTB 5JIHA 3RDTA 5DURD 3QHFH 3VGDA 4OV5B 3I75B 5C86A 3KYOA 1YEEH 1J87A 5GXBB 4KK6C 4Y5YB 2M8XA 3KPLB 3QJHA 4PUBL 2GSIB 1IMHC 5GGQH 5C8JA 4JRXB 4KROC 2AJYH 5EO0A 5IVNA 5I2IB 2OL3A 3O0RH 3V6OE 5J89A 4PJXE 1OAQL 3IDYB 4JQIL 1MFAL 4WV1A 4F9PC 2CK0H 2J8UE 5DXWA 1EEYA 1B2WL 2Z92A 5FGBA 2YD8A 3DUHA 3FOLA 4FXLA 2C4FT 4U1NB 4KRPD 3T65A 3VGAB 5E2WH 1H0DB 3TBWA 5C07D 2DD8L 2Q3AA 4I0PD 4HIXL 1NKRA 1G7HB 3RWIA 4APQB 4FZ8H 1D5BA 1Q9KB 5FM8A 4O2EB 2FO1A 3D25B 3BN9C 4W81A 1JGVH 1MCCA 4TVPE 5I8OL 1X9QA 4J6RH 1T22A 3UTZB 5EIIB 4YXHH 3WNLA 4GLRH 1C16A 1NMBL 1TPXC 4Y4HA 3Q6GL 3DX7B 3MRKB 2DLHA 4Z7VF 2ZUXA 3QXUA 1BF8A 3BZ4A 1MCWW 3LRHA 3W9EB 4GRWB 1QZ1A 1ZVYA 1OAZL 2UWEF 4MHHG 2AJXL 1DTUA 5F7DA 3G9VA 1WZ1L 4I4WB 4Z77A 4IRJB 4Y4KB 2W65A 1N5AB 1MFEH 1CG9A 2DQIH 3DVIA 4ERSL 1MQKH 5JDJA 1T1ZB 4NC1E 5KAQG 2BCKB 1QHOA 5L7XL 1JNNH 3BO8B 2BY0A 3JTTA 1TZIA 1OTUC 3VWKA 4XWOD 5ADPH 3ARRA 5HI3C 1R3JB 3ARFA 5J1TC 3X14B 3ARXA 2EDDA 3VXMD 3E2HB 3QA3A 3ETBF 3RGVD 3FT3B 3PG2A 2Y5TB 4RGNE 1SEQL 5F7EL 5IGXH 4HGWA 3HAEA 3EJJX 1QUNA 4KDTA 1FZOA 4BZ2L 3O8XC 1K8DA 3LPGA 3LPWA 1EVTC 1NFIA 3JWDL 5D72L 5FUCE 1CDBA 2W0FA 3TNMA 5TF1L 5LWYL 5C0BB 3ULVD 2BVPB 3PIQB 5DA4A 3ZDXE 2NY0C 1KT2A 4P9MH 4PP2A 2LVEA 2QHLA 4LCCC 5DRXA 2W38A 2HP4A 2JB6B 3B9KC 1NUNB 3OR6B 4W6YB 4XVSH 1KCRH 4IMLB 1ES0A 1ORQB 1VADB 3GBNH 2PO6D 2XFXA 2JCCA 4JANB 5D1XD 4NQED 2H1PL 4JDZB 4Y88A 3QDGE 3NCEB 3GBML 3TO2A 3W11C 1UM4H 3GMNB 1HXMB 3EFFA 4LKXB 1B3JA 4V1DD 3IDMB 3RWHB 1KJVB 1H15B 4ZOBA 2ZCLH 2H2PC 3RP1A 4XZUB 1E4WL 3LKRB 3DBXB 1OSPH 2R9HD 1U3JA 4W4OC 1JZ7A 2NY5C 1TQBC 2XACC 3WFCL 5JR1H 3H0TB 2P45B 5C0JB 2EIZA 3GIVB 2QSQA 3FQUA 3FO1B 1MCQA 3ES6A 3V52H 3GIZL 1FNFA 3GHBH 4EI6B 3O3EA 3O2DL 3ECBB 2VWEC 3NAAH 5EOCJ 1QBML 3S4SB 5B3JF 4PTTB 5AZEH 2BVTA 3QQ3B 5FO7A 4EI5D 4JFFB 43C9B 1TLKA 1GOGA 4MNHB 1MCPL 3QO0B 4Y5XC 1VACB 4R96A 1ITCA 4PJHA 3P0YH 1NBQA 2OLDA 1NFKA 2DWEA 2K7QA 5D96B 4NZDA 2EDFA 4O02L 3BT2H 2ZSVA 3U1SH 3D0LB 3DGCR 1A2YB 1LDPL 3P30L 1RJYA 3F5WA 3QCTL 5JUEH 1TVHB 1INDH 2BSRA 2DQTL 2YPKB 3VXRB 1HOCA 1DANU 4IIQB 1EO8L 5IB3A 4PR5A 1PAMA 1IT9L 1U8LB 3FOMA 2VXSH 2BNRA 5HY9B 3GKWH 4AM0A 3ULVH 1GGUA 2AJZA 4OLUL 2EIBA 1U6AH 1OAKH 5D5ME 4P2RA 1QG3A 5JQ6H 1PX4A 2AK4B 1DQQB 5L2KB 4HGMA 1TJIH 2OQJA 5I8CB 4DZ8A 5IFHL 4EN3A 5HSFA 2MTPA 3QDMB 5D7JD 2QQNL 4U6YA 4JCLA 3UTSA 4UNUA 1X5HA 1IAIH 1KTLA 3HPJA 1NCCH 1YPZE 1A6PA 1G6RH 2AV7B 4HCRH 1HH6B 4HUVA 1ONQA 3KLDA 5CJOL 4FFWC 5D7IA 4NHCH 5GGUB 3TIEB 1IQWH 1DFBH 2O5XL 3F7VB 2R23B 1D9KB 2WUCH 1G7MA 3I9GH 5CP7A 3P4LA 2W9EH 4M5ZH 1CK0L 5IG7B 4P4KC 1JFQL 1J05A 1ZT7B 3MLRH 2E9JA 2HAZA 1LE9A 5ICYB 3HG1D 5F6HJ 2B1AL 3FO9A 3EJYC 2GEEA 4JN1H 3LIZH 3ULUL 4JGUA 1CZ8H 1RK1B 1QFUH 4PS4H 4D0BA 4QCIB 3HMXH 1KEMH 5GRVL 3F58L 4UT9H 1S7XB 2AABL 4PYGA 2ADFH 3EAKA 3V4UH 2A73B 4DUXA 2X4PB 1HZHL 3KXFD 2X6MA 1I4FA 3JV6B 5E6IC 4IMKC 1RIHL 3FJTA 2G9HB 1VEMA 3EO0B 3S36X 5D7LB 3VI3F 3RJDA 3IS1X 3FB7A 3X3FH 4ZS7H 5ERWB 4OD1H 4ZOCA 4XAKE 1KTDA 4K7PX 3QWOB 1R3LB 3FT4A 1IM9D 3STZB 1A3LL 3RKPA 5KSAD 2CUMA 5ETUA 3M8OL 2VLRE 1XIWA 2NLJB 2BVOA 3QXDA 1SYVA 2V7NA 2XZCL 2XQYG 4KJPD 3SQBA 1SJEB 1UM6L 1LNUA 1NGPL 5HI5C 4RX4A 4YHKH 4NRYA 1EEZA 4JHBA 1FFOB 1AGBB 2MKLC 2XTJE 4L4TB 2R2BA 4G9FE 5FKPB 3RY6A 1DBJH 3GO1H 4JRWA 1BFOB 1XF3A 4LNRB 1KXTB 2FL5A 2ZG1A 4GKZB 5KJRL 3QISA 3TT1L 4ZUWA 4MHHI 4P57B 3O3UN 4POZD 5D71H 1NUFA 4OQTL 5D2NA 1V5JA 2B7DT 3TYFA 1FIGH 4OCXH 4S2SA 1AXTH 1LQSR 1V7MH 4AT6A 1OL0A 3VG0L 5HXMA 5F1NB 3BQUC 1QFHA 2CO7B 3IJHA 3ZE1F 3C60D 1KFAL 3SDDC 3DTXA 5HHOB 1L7IL 2P49B 4TNWF 1E27B 4AH2B 1T5XA 4XCEA 5IFAH 3STLA 3AS1A 2LU3A 4JFEE 2CIIA 3MGTB 4WI9A 3GSNL 4ODXB 5DK2A 3LKOB 1P9MA 3QDJA 1R6VA 2DQHH 4JFOA 5E8PB 2OK0L 2DOCA 3MA7B 3TCLA 1HEZA 4QHUB 4CMHB 4TSAH 3BPNC 2DF3A 2X1XR 1X6LA 1Q9OB 2R0LL 3MFGB 4KAQH 3WDJA 4WEBH 3X3GL 1TVBB 4NRXB 3VD7A 1MCHA 4QYOA 2R2EB 3FZUD 4PJCF 4X7DC 5DEGA 1NGWB 1MCOL 3MREA 3V8OA 2IJ0C 2FLBT 3T2QA 4I13B 4GQPH 4X6FB 1G7IB 4YFLF 4GUPB 4YBQD 1KCVL 1IC5L 4OM0L 3EDKA 4JO2L 2EXYD 5EOCH 1DZBA 5E6YA 1BVKB 1DANT 3A6CL 4Y0GA 1MFDL 4G8IB 1RUPL 3NFNA 4P23A 2A6IB 1OVZA 4BZ1H 5A2IH 2A0LC 3D9AL 4LOUD 2DQCL 1PLGH 4YBLC 4CVZB 4X5WA 3EDFA 5FCSH 4OM1H 5GJTL 2BNQD 2HN7B 2FX9L 2VISB 4HFUL 2C3WA 5T1DH 4PP1D 3BIKA 4G6MH 1UM5H 4UV4H 4AEFA 5IK3B 4L8CA 1KEGH 2F54B 3B43A 4RMWA 5E1AA 1HYRC 1S9WB 5GRYA 1QLEL 3H9SB 3MBXL 4PGCB 2XZAH 4DEPC 4YXLL 5FO9B 4JQVC 2BVQA 4WVRA 2MJWA 3REWB 4BKLB 5FO8B 5DQDH 1I75A 2OZ4H 4OUOA 1GOHA 1NC4A 5EU3B 3MV9B 3MNVA 3UPRB 3N9GL 3UO1H 1INQA 2AJVL 1DDHB 3K74B 3SBWA 1J88A 5SWZA 4GMSL 4FFYL 3TN0D 1F8TH 2Y6SD 2FJFA 2DKMA 1ZA6A 5DD6B 1S5IH 2ARJA 4GSDL 1U8NB 2BHUA 5IV2B 1S7RA 2G60L 5D2LB 4HWBA 3BH9A 4LSRH 4ODSH 3BP7A 3V6FB 1U0QA 5FYLE 1T0NA 2NPLX 3IFPB 3HMWL 4OFYD 1RUML 3HRZA 4JFHD 5CZVL 5I1EL 2YD1A 5D1ZB 3WXVH 2FGWL 1CXFA 1F90L 5I1JL 3O2VL 1BIIB 3ARGC 3I6KB 1MFCH 3G08B 1IGTB 3GMLB 3KPTA 4ACPA 3C6LD 4PG9A 4NQDD 5FF6B 2UZXB 4FQXB 3RA7H 2A6DA 4F9LC 3PHOA 3P9LB 5ADOL 5CLWA 3MCG1 4XPTL 3ZT7A 5BQ7B 2ESVB 2XI9A 3P0VL 1J8HA 4LPWA 1UVQB 1P69B 1A6WH 1PJ9A 1YNTA 3BVNA 3ALWA 3PDOA 2YRPA 3S5LB 4JKLA 4KWUA 3EYUL 3T4AA 1PKQA 5DDHA 4N5UA 1S7UA 5KS9F 4GOSA 3RWEB 4M6AA 2NY1B 2Q7YB 2AEPH 4LRIA 2H3NA 4OCSH 1Q94A 5FK9A 1VPOL 2VB5A 3S36H 1JHLH 3MRRA 4Z7QE 1RI8A 4OLWH 2HMID 4PRIA 4UAOB 4UDUB 4K7PH 1W72H 3GSRB 4WWKA 4CJ0A 4G5ZL 1D5ZA 3MR9B 4LSSL 5GS1B 2A83B 3HR5B 3FT2A 2AJUL 5AAWA 5DEFA 5JHDB 4LCUA 1YEHL 3PV7A 3TVMB 3VXPB 3P11L 3RNKA 1V3MA 1UYWH 2ID5A 4X6DF 4XNMB 2PTUA 2YA1A 3PQYA 4Z7VB 3QAZC 4B7IA 3TNNB 3LN4A 1GIGH 3GFUA 3JWDC 1EGJL 4U1SA 4NGHH 3W39B 4TULH 1Q1JL 3CFEB 5I1IL 1BEYH 2UWEB 1Q9LA 5EBMB 5JW4M 4IRJD 2R8SH 3E3QE 2VQ1A 4PJHE 1ADQH 4HGKC 4OI9A 5DMGD 4H1LG 1D5XA 3D3VD 4XCNA 3EO1B 3P2TA 1T4KB 1K4CA 3T0VA 2YS4A 3HPLB 5JW5B 1CXIA 1T0PB 1KELH 3BGAA 4OTXL 3BHBA 4KHTH 4OZHB 3OHXA 1Z3GL 3C08L 4OZGA 12E8H 2XWBA 1ND0B 3QFJE 2BNRE 2X4OB 1YNLH 3SCMA 2YEZA 5I17A 4XXDB 3MRNB 1FCGA 1T3FA 2MCPH 3QCVH 1CGSH 4YFDB 4Y4FC 4G80A 3V5KB 1R5VB 2R39A 5FOBB 1RUAL 3LQAL 1GRWA 5KS9A 4KQ3H 4K3GA 3O4LB 5EU7C 4YHLL 1ZT1B 1RZIA 4F2MA 2HJKB 2IANB 1Q0YH 2A77H 1OGTB 4GBXA 3WFBH 3K81A 4ODBD 4XCFL 1ODAA 2X9YA 3OWEA 1IZKA 2VXUL 4LVNC 3VFMB 2X41A 2YN3A 4RAVB 4ZXBC 3H2WA 1J0YA 3WFHB 2HT4C 4NIKB 5I8EB 4PJBF 1K9TA 3AAZB 4LLUB 3DV4B 1NJ9A 4RAHA 3KPLA 1KTKE 1R3IH 5J12C 5T3ZE 2PYEB 1MHCB 1CU4H 3BD4A 3RY5A 2Z31C 35C8H 4NN6B 4G9DB 1C8PA 2IG2H 3WHXA 4AY0A 3VRIA 2VLJB 5I2IA 3L7EA 4DVRH 4XTRC 5MP6H 2C4XA 1J1PH 3MLSH 4HIHB 5AZ2H 3KYNB 4GRWH 3GEWB 5GHWL 1I7UB 3NFPA 4XCYB 4YDLB 1QSFA 3V0WL 4OKDA 4PG2A 4GH7B 1FFQA 2BRRH 2FCBA 3PE9A 4HV8B 2EH8L 1S3KL 4WU7B 1I7TB 4LPUA 5IB1A 3BKYL 3CXDH 4TTGA 3HRPA 2H6PA 3D25A 2R0ZH 5IVXB 1XGRB 3LRGA 2RFXA 3ZTJG 2VAAB 2CGRH 3K8KA 3QEQB 4JAMB 2JLLA 4NQXB 4JZJA 4L9LB 5HVHC 2NNAB 2X4SA 1MJ8H 5BXFA 3DX7A 1OY3B 3SQOH 4WHCA 2Z8SA 3V95A 2A6JA 1OP3H 4NNYB 1S7WB 7FABH 2XYCA 5FM5O 5EC2B 3KNBA 3ESVF 1NUDA 3MRBB 1HKLH 3QEGH 1BWMA 3ULUC 1AH1A 1KIQA 5D2NE 4MWFB 5TE6L 5TGBB 1FGVH 1T1ZA 4Q2ZA 4WI5A 5HYEA 5EBWA 2IEPA 2FEEL 3FQRB 3WE6A 4DK6A 4NP4H 4OKVB 3VFRA 2CR6A 5FYJL 1I1CA 3CFDB 3HUJF 1AE6H 3EGSB 4PJDB 3ARDB 4Y16C 4H0HB 3OXSB 4U6XB 4H8WH 5T1LD 5BZDB 4RAUA 3BDYH 5I71B 1DEEB 5C08A 3FT3A 5FDYA 3BGMB 5TPWH 1WVZA 1D9KD 1UQSB 1T89A 4P4RB 5IEHA 5K33A 3MRQA 3D85A 1EUUA 3QXAA 2OXGA 3G04B 1L7TL 1CFVL 2C3VB 5T5NG 1PGRB 1XGPB 2NW3A 2HH0H 4G6AC 4ZFFA 3IFLH 4TQEH 3CC5A 1R0AH 5IJKC 1GGBL 3JV5A 3LEXA 5F97E 5IESL 4JY5H 3GNML 1RZ7L 3RAJH 1UWXK 3BKCH 4FQCL 3GB7B 5HYJD 4RMQA 2RHEA 3QEHB 4AMKH 2PXYC 4HWEH 4HS3B 4KZDH 4U1KA 1A7PH 3OR6A 4WY7H 4ZTPH 1N0XL 3SDYH 4CGTA 4IMLA 5DJYA 5J6GB 5TF0A 5JZ7D 4JDZA 1F3DJ 3CLFH 4D9QD 1A1NA 2X4TB 4AEHH 1G7PA 2C3XA 4UNTA 3L9RA 4N0UA 5D7LD 4P2QD 1HXMA 1DP0A 3HG1E 5BV7L 3O3DA 4N0CC 1P4IH 3INUH 3RWHA 1H15A 5F7YC 4F7EB 1JV5A 1JL8A 4YK4C 4R8WL 3LKRA 5T3XD 1NBYB 1A6AA 4EDXA 5DUPL 2V2XB 3HNVH 4YFEA 3VGFA 4BQBA 1GZQA 3EYSL 1ZWIB 3GRWA 4XC3H 4KZEL 5FYJU 4M1GH 2MPAL 5C0JA 1W0YT 3HLAA 4OCWL 1A1OA 3QUXA 1IGML 2J6EL 4PLJD 5GISH 2VDNH 1QLFB 2EYTB 4F7CB 4DCQA 2C9AA 2XZQH 3RWCB 4PTTA 3N0PB 2BZDA 4K7FB 3K3QA 4I9WD 4JFDE 4JM2F 4LCCB 3S35H 3B9KB 3P9WB 4DAGH 3QO0A 1XF1A 5IM7A 4ETQB 4G42A 4RNRB 3NCYP 1ZT4A 3MQIA 5ELIA 2OI9C 4RGOH 5ALCL 1YQVL 4MLSA 5IBTH 2Z91B 3V4VL 3HI6L 2OSLB 1DVFB 1NMCC 5E9DA 4DKDC 4LLWB 5C0CA 1TVHA 3TV3H 4F8QA 5F7FA 2R29L 1XGUB 2YPLA 5HHOD 2GYSA 3GSOB 4DK3A 5CJXA 1U8LA 3GMRA 4Y5VC 4X6EB 3QIWA 4MD5B 2BVYA 5K59E 3U4EA 3MA9H 4HMEA 1TQBB 2W07A 1P7QD 5SWZE 5IB5A 4HX1A 1IEHA 3QULA 5F9DC 4DGIH 4KTDH 4LIQH 2AK4A 1IM3B 1BBJA 5L2KA 4P46D 1DBKL 1A7RL 3KS0J 1SJHB 2D7QA 3MO1B 4JQXC 1EMTL 3QDMA 1CL7I 2ADIB 5HBBA 1KULA 1WAAF 2Z93B 1S9XB 5EO9B 4Q97A 4JCMA 2ZOLB 4Y5XB 1C1EH 5DWUL 3P9MB 3S96B 4HWZA 4KUCD 5T3XH 4UZGA 4I48B 4JG0L 1KJ3H 3FAWA 3IF1A 4OFDA 3S6CA 4PJCB 2W92A 4ORZC 2XQBL 3NPZB 1SHMA 4TTDD 2X40A 3ULUF 4HUXB 5DRNB 3WNKA 3WBDA 3PGDB 5F44A 4GG8B 3BEVA 4DUWA 3V4PL 4M7KL 1M71B 1CE6B 1PKQE 3Q1SL 4BSJA 4PLNC 5IT2H 3KLHC 3SPVA 5HD8D 1CXEA 1TFHA 2JJSC 4JO1L 4I77L 4WFHD 3DPBA 4JG1H 4RFNC 5EIVA 1HHHA 2G9HA 2DDQH 1WZLA 1H5BC 4WIQA 1PW3A 2R1XA 2BFVH 4K3EH 1GGIH 4QF1A 4NQCB 4P2OB 2DJSA 3WLWD 2AQ3A 3CH1B 4PRIE 4BSWB 3QWOA 3QHFL 2EXWD 4LHUG 4BUHA 4H88H 4ISVA 4YR6B 4LLQB 4QRRA 1YEEL 3FB8B 4MD4B 1N7MH 5JXED 3O6FB 3UROR 1FJ1B 2F54D 4KXZH 4K3DH 3HB3D 4PGEB 5GZND 4OFVA 1ZANH 5GGQL 1F6FB 3QFDA 4QGYA 2AJYL 4HKXA 3V79C 5GS0C 3TJHC 4XP9L 1JPFB 3O0RL 4AJ0A 1MAKA 4Y19B 2CK0L 3PQYE 1DQJA 2W60A 4PJ7F 1P4BL 3D39A 2K3TA 5JW4Q 1FLTX 4P57A 3KYKH 5E2WL 3VXUD 3WO4C 1JZ8A 1J5OH 5E6IB 4YO0B 2X5PA 4OQ1A 4FZ8L 2DI8A 5CJ5A 5F1NA 1U92B 3WUWB 2IPKB 3QO1B 2C7UB 3L3KA 1JGVL 2BMKB 2QEJA 4NO0B 2ICWB 3IKKA 1MQ8A 3EYQD 1MRCH 1MY5A 4OZGE 4YXHL 5CEZE 2NY3C 1I8MA 3AREC 5CZXC 1G0DA 2XT1B 1Z9MA 3H6JA 1ITBB 1AQKH 2I5YH 4O2FA 4ZFOL 3KPSB 4FQXD 3VWKD 4Q6IC 1WGOA 3OGCB 3MA7A 5DSCB 2D0FA 4IS6A 4QHUA 1MJJB 1PFCA 1WICA 1MFEL 2DQIL 2ZCKH 5HPMB 4ZAKB 2QKIA 1MQKL 2E7MA 5I9QB 4H20H 2MCG1 1U3HC 4KVNH 4NRXA 3WJJA 4MA3B 5DO2C 3W2DH 1JNNL 3LRSB 3QQ9C 1OLZA 1NGWA 1ZVSA 1NFDA 1F3JB 2NY1D 5ADPL 3UTQB 3T3ME 5E94B 3JVGA 1I8KB 1G7IA 2GT9A 4OLXH 1KCUH 2Y36H 2OX5A 1OD9A 4YNYB 4JRXE 5JW4N 3NABH 1CIDA 4PJ5A 4GRLC 2FIKB 3LD8C 5DFVC 3PWPA 5IGXL 1XR8A 1UWEH 1EPFA 3FRUA 4OAWA 4LHUB 2DYPB 3BPNB 3TVMD 3LQAC 4XNYH 5DYOA 2WMPA 6CGTA 1S9YB 3U46B 4X6DB 4P9ML 1YC8A 3O9WA 3VFUA 3ZKSD 3EYFB 4CN4A 1HHKB 1OB1A 4XVSL 1KCRL 4E42B 3GBNL 5C70A 1K3ZA 5CEYB 1UM4L 3B2UD 2CLVB 4H0GA 4X9BA 5FHBH 1OP3K 2ZCLL 5E2JA 5EU5B 1HYSD 3L5IA 3T2OA 1LE5B 1ZEAH 3VD3A 3ULSA 1CICB 3G5XB 5EU3A 1OSPL 1JTTA 4Z7OE 3GMQB 5DJDB 1B90A 3MOBH 5JR1L 4J3TA 1BQSA 4HKBB 3AXLB 1A47A 4NZRH 4C58B 3V52L 5BRZB 3GHBL 1F4YH 1U8NA 2Y06H 4CU8A 3IXTA 3GHEH 3NAAL 3NTCH 5J1SC 4U1GC 2YD7A 5AZEL 4L8SA 2IBZX 3RY4A 5EFIA 1FYTB 1WTGT 3IFPA 1H3VA 3P0YL 1A7BA 1MF2H 4P2RD 4OBSA 3Q3GB 1YMHA 1LO3H 3OKOA 4BFBD 1EDQA 4CW1B 3U1SL 4DEPB 1IGTA 5JUEL 3ZZ1A 1INDL 5C08E 5SV3A 2NXYC 2CDGB 2HT2C 4HJ0C 1MCNA 1B9ZA 2VXSL 2IQ9H 2ESVA 1U2CA 3GKWL 3ULVL 1U95A 5IP4A 1MWAH 1UVQA 1U6AL 1OAKL 4DVBA 4XNQB 5BVPH 3NZHH 2IFFH 5JQ6L 3HCVA 5FGSA 1UB6A 5C0BE 3L3DB 4KKBC 4F15C 1TJIL 4RCAA 1JNLH 3QXWA 3DHMA 1XF4B 1FZKA 5GS3A 2Q7YA 3CUPB 3E8UH 3HZYA 2P24A 1IAIL 5DJ2B 3F6LA 1BJ8A 4XHJC 1NCCL 5KG9B 1G6RL 3TZVC 4HCRL 4NHCL 3FTGB 4E41B 5IB2B 4HEME 4B53A 1IQWL 1DFBL 4UDUA 3WKMH 3PP4H 3GSRA 4JZOB 3BMWA 2WUCL 4JE4B 3SO3C 1RD6A 3TBVB 4O9HH 3T0AA 2CIKA 4G6KH 2X7LA 4M5ZL 1QFWH 2W9EL 4M5YL 4U1IA 4WHTA 3U79A 3MR9A 1NUGA 3MLRL 4RDQF 3HR5A 3CFBA 1DUZB 1B6UA 1T7XA 3MYJB 2DKUA 1JHTB 2WBJD 2XKNA 3QI9C 3VXPA 1G7QA 3PL6B 4HZLB 1DCLA 4JN1L 3LIZL 3ET9F 2HT3C 1CZ8L 2X89D 3ELAT 4PS4L 2PW2B 3BYTA 1FG9C 1NGYA 1YJDL 4NCC2 3RUGF 3HMXL 1KEML 4XGZA 4UT9L 1KIPB 2ADFL 2PNDA 3VD9A 4KKCD 3W39A 3V4UL 1BX2B 3GSQB 5I8KH 4JFFE 3U9UB 4ZOEA 3L3GA 1EHLH 5LAXA 1X5AA 4PLOB 1BZ9A 3X3FL 3VJ6B 4ZS7L 4OD1L 3S7GA 4NCC1 4S11A 5JDSA 3O6KH 5B4MC 5IKCB 4N90D 3SKMB 3CSBA 3HPLA 5CD5C 5E9DE 2OBGA 1QA9B 3QIBB 5C0CE 3VXRE 3U2SA 1TVDA 4OZHA 3VG9B 2YPLE 2P8LB 5BV7C 4JREC 5FA4B 1ZGLB 1ND0A 1AO7B 1VFBB 4J4PA 3ARDD 1B4JH 4UDTB 3FONA 2MWCA 3LKQA 4PJ9C 2WP3O 1K85A 4YHKL 1QNZH 5TDNA 4YGVB 3EFDH 5J13B 4WHDA 1FL3A 1F11B 3HE6D 3V5KA 2AK4E 1DBJL 3GO1L 5FOBA 1WBYB 2XTJC 5L2KE 5AUMB 1ED3B 3O4LA 2GQHA 5IHZB 4UB0H 4UQ2A 3QDME 4NYLB 2VLMD 4WJ5B 4JB9H 5D71L 2CH8A 3D18A 3DETD 1W8NA 4ZODA 1FIGL 4OCXL 1FG2B 1UXWB 1AXTL 2DI9A 2FO4B 3PWVA 1V7ML 1I9EA 1U41A 2IBBA 4XPFH 2F53D 1FC2D 2BP3A 2HRPH 1KPUA 4HIEB 3QDJD 1N0LA 3WFHA 2JIXA 3LEYH 3ZYJA 2WBWB 5E0QA 2CSPA 1TNNA 3PUCA 5IFAL 3K4ZA 4NO3B 2DS4A 3TPUB 4L4JA 2X9WA 2VLJA 1BFVH 1PKOA 1GYAA 1MH5B 5EWIH 3IFOB 4YIQB 2PUQT 2VXVH 3C9NB 4XBEH 1RK0A 1ZHNB 1RJZB 2CPCA 1F00I 1QQDA 4LIQE 2DQHL 3FB5B 4G8EA 3QUKB 4R0LC 5DJAB 1IC1A 3VE0B 5EULV 4TSAL 3WFDH 4KAQL 4WEBL 3MODH 4HLZH 4KK9D 1MNUH 2PCPB 2RCSH 3MJ7B 3SDAB 1NGZA 4KKLC 1UEMA 4QRRE 2DQJH 5IVXA 4JM2B 2VAAA 2LE9A 5BJTB 4PJGA 4TN9A 5J12B 1GJIA 4QOKA 4NOFA 3U0TA 3ZKMC 1GZPA 2N4IA 4OF6A 3QWQB 4PV8B 2A38A 5EOCL 5IW6B 1JIBA 4L4TE 1DVFD 1WBXA 4XMKH 1EX0A 1JHKH 4H1LA 4BZ1L 2ICWJ 4Z6AT 4F9PA 1P5VA 5C0IA 3CD4A 2BSTA 1PLGL 3D39E 3MRJB 3QZWB 4OM1L 1QLRB 4POYA 5ACMA 3T77B 2Y23A 3O6MH 5T1DL 1H3PH 2DRUA 2P8PA 3KJ4C 1NC4D 4G6ML 3TO4C 4N5ED 5HDLA 1UM5L 2QTEA 1I1FB 4UV4L 4K2UH 5MEOA 1KEGL 1QFOA 3F12A 2N1KA 4OI7A 2WIMA 4X7TB 2HTLC 4YXKH 3CFDA 5A16A 2HVJA 3ZE0F 3DMMC 4PJDA 2XZAL 1T03H 1K8IA 1LEKB 2FEDD 2H2SC 4MXQC 1FZMA 1DEEA 4MDJA 4OLYL 2ICEB 5DQDL 2OZ4L 5IIEA 4L4VA 4WGWB 4P4RA 1FP5A 2QL1A 3UO1L 4MAYC 5GGTA 5LCVH 3SKJH 1FNAA 3SGKC 1XF5B 4YDJA 1QO3B 4TSCH 2DB8A 4KJWD 1XMWA 1F8TL 3I6GB 4RIRB 4XP1H 3W0WD 4HSQA 1MOEA 1J0JA 1S5IL 3O2WH 4EUPB 3MJ9A 3L95B 1RPQA 3AVEA 3DNKA 3V6BR 2EDYA 4LSRL 2P5WD 4ODSL 1KV3A 3QEHA 2A2QT 3BFOA 4WHYG 3IETA 4HS3A 1J8HD 4Z7WA 3TF7C 4HH9A 3U4BH 1AGEB 1YN6A 3NIFF 3WXVL 4Y2DB 2X4TA 3GM8A 4JPWH 4Y16B 1MFCL 1ZHBB 3M17B 4P2OD 1KB5A 4HK0A 4HEPG 5F1IA 5HTSA 4F7EA 3IXAB 4HJGB 15C8H 4K8RD 3RA7L 3T0WA 4PJ5E 1A22B 2V2XA 5EC1A 3EHBC 2NY5H 3O6FD 3VFWB 1IAOB 1LP9A 3RZCB 1A6WL 4X83A 2NMSA 1H3UA 3CNKA 1VGKB 3O8XA 4B41A 5BO1H 3EOAA 5D6CB 4MCZB 5HHVH 1QSEA 4XP5H 2HLFC 1TCMA 4HIIA 1ZHLB 3MRDB 1CN4A 2EYTA 5BOZG 5F93C 2NY2C 4X6CB 3R1GH 5F3HB 2AEPL 5KW9L 2RJMA 1NLDL 4K7FA 4OCSL 1LK2B 4QT5A 4PJ7B 2PXYB 3AS2A 3MPCA 4LCCA 3S36L 1JHLL 1KIUA 4OLWL 4ETQA 4D2NA 4AIXA 4RNRA 2XNAB 1FO0A 2NY7H 3H9SE 4K7PL 1W72L 2E8YA 4PBXA 1SY6A 3MFFB 5J8OA 5JPMA 2NX5A 1WISA 1G1YA 4PGDB 2I9LB 2GSGB 4YK4B 3GSOA 3MV9E 1DUYB 3R4DA 3KVQA 4NO0D 2Q6WA 3OKNA 4X9HA 4MD5A 4W4OA 1NPUA 3IDNB 4UTAH 3M07A 5DUBA 1B0GA 5KSUB 1UYWL 5E4EB 5MEPA 1DQLH 1KF9B 1J0ZA 1IM3A 3G5YB 4KRPC 4MDIB 1CLZH 2X70A 4I0PC 3ARQA 1YC7A 3MO1A 4LPTA 1GIGL 3VFVA 1JPGB 3PNWA 4NGHL 4TULL 1ZS8A 1BEYL 3BGFC 2GJ6B 3SCMD 1OSZA 1I9RH 2Z93A 1TJGH 1S9XA 2FH6A 2R8SL 4NO5A 2R1WB 1SVZA 1ADQL 2ITCB 4ZAKD 2HFEB 4K8RH 1G9NH 2OI9B 3GMPA 1M7DA 1KELL 4DWHA 4KHTL 5I19H 4GBXD 3U0PB 4D0CB 2EKJA 5F1SA 3P4OA 1YNLL 2ESVE 5LGJB 4RBPH 1TTGA 1RMFH 3RVWD 4LPYA 4HUXA 5DS8A 5DRNA 1Q8MA 3PGDA 2YD3A 2MCPL 3QCVL 1CGSL 5A3ID 5HGGS 2VDQH 3SJVD 3VFSA 1MUJA 2PKDA 4ZNEA 3SHSA 2FJHA 3BP5A 1NDGA 3SGEH 3VRLF 1Q0YL 2A77L 4K71B 1NAMB 1MLCA 3K80A 3RL1A 1YY9D 4GKNB 3WFBL 1ZE3C 4KC3B 3S3PA 1XFPA 3FN3A 3P40A 4XWOC 5AYUH 2BK8A 2HJLB 2Y5EA 4PRNB 3L3IB 2OR8A 4NQCA 2FHCA 1XGQB 4KV5E 3VXOA 3T2NH 3O3BB 2DTSA 1H8SA 4LLQA 3RGVC 3FB8A 1QSFD 4P4KA 1R3IL 4RZCB 1CU4L 4YDVB 35C8L 3VW3H 2IG2L 4QXWA 5FUZH 3OG4B 2H9GA 5KSBA 5JHDE 4DVRL 1VESA 5MP6L 1J1PL 3MLSL 5ESQB 4I18C 1Y6KR 5AZ2L 3ULVC 3BISA 2W59A 4Y19A 4Z7VE 3MRPA 1PYWA 4M02A 4Z78B 4FQJH 4QGTA 2CJUH 3VFOB 1QKZH 5C6PB 1QSVA 2PO6C 1UZ6F 1S7VA 3GJEB 4QHKJ 4IMKA 3SDCB 3X11B 5D1XC 4YO0A 4YEEA 4GAJH 2P7TA 1H5BB 5DVLA 1LEGB 4F33A 5SX4H 3CXDL 3TH3T 1NCDH 3LKSB 2C7UA 2R0ZL 2BMKA 3CVHH 1IGYB 4X5LA 2CGRL 1DLHB 4OZHE 3PWUA 1C08A 2CKBA 5EA0H 2R9HC 4FFZL 1MI5B 4ZQKB 5L2JB 1MJ8L 4I0CC 1U8MB 3SQOL 2G2RB 3RL2A 3I6LD 1QRNA 3C2AH 3MXVH 7FABL 3KPSA 3X13A 2B4CH 4NSKB 2EZ0D 4OZIA 3O4LE 1P7HL 2VAJA 1HKLL 3QEGL 2IANE 4EI5C 1YJDC 5HPMA 3WO4B 1FGVL 5SWQA 4F7PB 4PGJA 2J88H 1J0IA 4MA3A 2B20A 3HTLX 4LSPH 3G6JA 2V9TA 4N0FA 3C5JB 1I3RB 4NC2B 3CDFA 3BQUA 2FHFA 3ROLA 4NP4L 4JDTH 3SDDA 2VN7A 3Q5TA 1X5GA 1AE6L 4PJAA 2G75A 3PWLB 4J7RA 3O3AA 2PYEE 4H8WL 4E41D 2NY3B 3I85A 5IQ9B 3AREB 3BDYL 2VLJE 5TPWL 2NY4D 5CBEB 1GSMA 2Z8VC 4WFFD 4XI5D 4QLRA 4K3JH 3OBAA 5H2BB 4NHUB 4RMUA 1EAPB 2VNCA 2HH0L 4YAQA 3IFLL 4TQEL 1R0AL 4F80A 4LHUA 3G5ZA 5D7JC 2C1PB 5F96H 1JNJA 3ZE2E 4QRQB 5HJ3B 4JY5L 3PL6D 3RAJL 5FDWA 1JYNA 2YPVH 3BKCL 4AIOA 1U3HB 3EYFA 4AMKL 4JY6A 2I27N 4HWEL 4XB8A 2EICA 1J7VR 4KZDL 3MV7B 1A7PL 4WY7L 4ZTPL 3SDYL 4I2XA 4E42A 2WM0A 4LCYA 1IBGH 4JO4H 5IW1A 5EUOF 3VXNB 1U8QB 3CLFL 5IVXE 5CEYA 3WNPA 2V2TA 4AEHL 3RVTD 2A6KA 3CCHB 3R8QA 3QEQE 1JF1A 1P4IL 4PJGE 3INUL 4WFED 4QOKE 1D5MB 5FFLA 3BZFA 1OGAB 4JPVH 3P0GB 3HNVL 2J4WH 1OARH 3QIBD 5ANMA 3LD8B 3IAPA 3R0NA 5DJDA 4XC3L 4FQLH 5EG6C 4M1GL 1X5JA 3AXLA 4LASH 3CFJB 5GISL 2AK1H 5BRZA 2VDNL 2DQFA 3UYRH 1I85A 2XZQL 1CD9B 5J11B 4K07A 4PRDB 4QRPB 4ONOA 1EUTA 3MLUH 2DD8H 3A0OA 4TSBH 5AG9A 3DLQR 3QIWD 3S35L 1FYTA 3Q6FB 4M1CD 4DAGL 1YA5A 5KSAC 1BF2A 4RSVA 3FCTB 5LQBH 5HDBF 4P5TD 1JGDB 3T4YB 3VMOA 4L8BA 1D5IH 3MBEB 3Q3GA 4PJDE 4RGOL 4WO4B 4WW1B 5T1KA 5IBTL 2HTKD 4KJPC 4JQVA 3TV3L 1RHFA 3V5DB 2YR3A 4FXGB 2CDGA 3UJJH 2DM4A 2KKQA 2O93L 2CDEA 1YN7B 3HC0A 2Y7QA 5LXGH 2FGZA 3MA9L 4LBEB 2H41A 3JTSB 4J3OC 4XNQA 1G9EA 3X12A 4DGIL 4KTDL 4LIQL 3T3PF 4POZC 5E8OB 3KYAA 3L3DA 1F42A 5HHXL 1MVUB 5KVMC 1CDJA 3E6FA 5TQ0H 1XF4A 4HKZB 1WITA 1KLUB 1E4KC 4U1GB 5DFTA 4ERSH 3NN8B 3C60C 4Z7WE 1HDMB 4D8PB 1C1EL 4CADB 1QFPA 3MC0A 3MNZA 4CMMA 2IAMB 2H32H 5T3XL 4PPTA 3B6SA 1R5IB 3ARGA 1BOGA 1KJ3L 3FQTB 4TNWK 3MTRA 4YX2H 3SDAD 2Y1VA 4ZS6D 4KPHH 5K9QG 1EFXA 2ED9A 4IBLT 3LN5A 5C2UB 1T04B 4F9LA 4CAGA 4JM2D 4XXCC 3C09B 3VWJB 3H3PH 3BPOB 3L5WB 4C56A 4DN4H 3MYJA 1GH7A 1ZHKA 4CVUA 4PJ8B 3VMNA 4HZLA 1JZ3A 4R9HA 3VDAA 1QSEE 4G8FB 4ENED 5IBLD 4M1DH 4DQOH 5IT2L 5I66A 2A74A 1T83C 2ZUUA 4S1QH 4ZSOB 5LWYH 5C0GA 3LKPA 4JG1L 3FZUC 2JJWA 4KDVA 4U49A 4BM7A 1FIEA 1A9EA 2DDQL 4N8VB 2BFVL 4K3EL 1GGIL 2CRMA 4LCWA 3VJ6A 4GKSA 4DZBA 1S7SB 1N5YH 3WN5C 1EO5A 4NBYB 3ABZA 3FQXB 4YBQC 4BK4A 5C7XH 5IKCA 3SKMA 4H88L 3FO0H 2NX5E 3MRMB 2EXYC 3FQWA 1N7ML 1AP2A 1HINL 4EVNB 5F8RC 4K3DL 5JORB 1ZANL 5JIIA 5FA4A 2JJTC 3NPSC 4GAYA 1E4WH 4UDTA 4F3FB 4ELMB 1QR4A 3MUY1 4LOUC 2FR4A 4JKWA 3QI9B 1NEZB 4QHNB 4XHQA 1I1RA 1WBYA 5K9OB 1K2DB 2VWEE 4IJ3C 2EKSB 1CE1H 1RHHB 4PP1C 5SWSB 5EU6A 3KYKL 4HBCH 5C6WH 5EZLA 1J5OL 5C9KA 5JMRA 2FO4A 1ZXQA 3CK0H 3GGWB 5MHSE 3IDGB 3QPXH 4ORGA 4UNVA 5A2KH 3B2VH 5BS0A 3VGGA 2FJGB 2J1KA 3D69B 4PJCE 5INDB 4RBPK 4OLZH 1MLBA 1OPGH 5AYQA 1MRCL 3C8DA 3MX0A 4JREB 4I8DA 4Y2DD 4PY8I 3REVB 1UENA 4Z7NF 2GITB 3CIQA 2Q86B 3OF6D 2IQAA 3TN0C 3WSQH 2HWZH 2Y6SC 3IFOA 1AQKL 3H8NA 5IQ7H 2I5YL 3C9NA 1WC7A 4Y4FA 3MRFA 1ZHNA 2KH2B 4NFBA 4OGAD 4ZFZB 3FB5A 3FFDB 3QUKA 5C71A 5D9SB 4N8CL 4PREA 3RZCD 4MVBD 2MFNA 2ZCKL 4ZUTB 5IVOA 5JLZB 2E9BA 4X80H 4H20L 2GY7B 3O2DA 1G7JB 5EORH 4PJEA 4CNIB 4KVNL 1Y6NR 1YEDB 3O11B 4NQCE 3W2DL 3PWJB 1NCTA 5C0AD 5HYFA 3PWPD 4WW2C 1UG9A 4ZXBA 4V2BA 5CJOH 5FGCB 3JSSA 3MUGB 4P5MA 3LAFA 3C6LC 3GDBA 4KQ4H 4GW4B 4AQOA 4OLXL 3RX5A 2XV6B 2GUOA 2LQRA 5BJTA 2BXZA 1UXSB 3MNWA 1KCUL 2Y36L 4XBGA 1AGDB 1AQDA 1A64A 2Z31A 3NABL 3O9WD 5KSBE 4JLRB 1OF2B 4QTIH 3VXSB 5IW6A 1UJTA 1WQVT 3GI8H 4RFOH 3ZL4H 1UWEL 1NBZA 4Y19E 4GG6F 3IDYC 4R0LB 5EN2B 4EUPH 1KCSH 4JFQB 1WSST 4XNYL 4HC1H 3HC3H 4UMGA 2AV1A 2E5EA 4JRYA 3VGAC 4HK3N 3UJIH 2J3SA 4APQC 4MNQD 1I7ZB 4J3VA 1G84A 1H9VA 2GJ6D 4X7TA 5B38A 1AJ7H 4P48A 5F3BB 3HZKB 2DTMH 3FQNA 4WUUB 5FHBL 3M8OH 4N1CA 5DA0B 1J86A 1N2RB 1JZ6A 1ZEAL 3OJDB 3EIFA 3WLBA 4P9HH 3KPSE 3MOBL 5J1AA 4MA1C 3TLRA 5CMAB 3CSYB 4NZRL 5DVOA 6FABH 3SDXF 5I1CH 1F4YL 1VKXA 2Y06L 4IRJC 4X4XA 5EOTA 3GHEL 3T0EA 3NTCL 5ENWB 2O61A 5DMGC 1LMKA 4Y8DC 3G6JE 3TO4B 2NTSP 4S1DD 2KL6A 3ARVA 4IOFD 1CLYH 1N6VA 4HKJB 5FHAH 1LVEA 1MF2L 1AKJB 2X4RB 4AIZB 1CFTB 5F7HA 1LO3L 4ZO8A 2AERT 3DMMB 4PJAE 5BCAA 3DXAB 1X4YA 5I1LB 4KKNA 4M6MH 1W0VB 2Z35A 3HN3A 1MHHB 3MCKB 3E2HC 5E7FA 4XRCA 2IQ9L 2FBOJ 1I1AB 2AJSH 3MLZH 1IAOA 4OZ4B 1MWAL 3V7AG 2FX7H 5BVPL 3BD5A 3NZHL 2IFFL 1BIHA 3CDCA 5IJKA 2B2XH 2BHYA 1QBBA 1LILA 4J2XA 3KPRB 4OSUH 1JNLL 1VHPA 3CPLA 3MLTB 2XN9B 2I07A 4GW5A 5SX5H 4XBPA 4ZTOH 2YD2A 5E8NB 2DLTA 3E8UL 5D1QB 5IFJB 1LK2A 1BQUA 5B39G 1AHWB 3MV8B 4HPYH 4OQTA 2I26N 4JGMA 1Q9WB 2W9DH 2ILLA 3N1PC 2DMBA 1HQRB 4P3CH 1LO2H 3SDCD 1P7KA 3WKML 1MCJA 3PP4L 2IH1B 2YC1B 4KK5D 1JZ5A 3P4NB 4O9HL 3WIHH 4G6KL 5JQHC 5EPMA 1QFWL 4PGDA 4FNLH 2I9LA 1DR9A 2WINB 1KCVH 4H8WC 4PRBA 5ANME 1TQCC 1MI5D 5ICXB 5KSUA 3GSNA 3G5YA 4WNQB 5BRZE 4NKMA 3NZ8B 3VI4F 1NAMH 2NY2B 3NACH 1WFUA 5FM4A 1JPGA 1A6ZB 4NT6A 4MQSB 1Z9OA 2R0WL 4R4ND 1LO0H 4FXKB 5I8KL 3L3HB 5HVWA 5F9OH 1FYTE 1EHLL 2WIIA 3L3OB 2NZ9D 4MNGA 2CK2A 1GGCH 4N68A 8FABA 4YJZL 2HFEA 3D0VB 1HSAA 3O6KL 4LLMB 1FVDB 2XTLA 4WRLA 5ISZB 4E9LA 4I5BB 5D96C 3MLXH 3DGGB 2HVKB 1VERA 5TE7H 5ACLA 4L8DA 1IGFH 4D0CA 4EIZC 4IIQC 1OQOA 4Y5VA 1KCKA 1B4JL 2BVEA 1HK6A 1KLGB 2DLEA 2QSTA 1QNZL 1S7TB 4OD3H 1WUNT 3EFDL 3WIIH 1IEAB 2AJVH 3KPPB 3QSKB 3IT8D 3NA9H 4OCYH 1TZHB 3RWDB 1SJXA 5MENB 5DJ6B 4PJXF 4NRZB 4I0PB 1AXIB 4K7PY 4QRUB 4L1HA 4UB0L 5DZOA 1T66D 3DO3A 4HFWA 3NIDF 1RJLA 4JB9L 1WEJH 2DJUA 3WIFB 3BGFB 3CZJA 4XMPH 4LLVB 2EDEA 1WBZB 2HJLA 4HIJA 4XPFL 3BPCA 4YHOH 4UV7H 3ZDZE 2HRPL 3PJSA 1FFPA 5A2LH 3VFPB 4NDMB 3LEYL 2XY1A 2NCMA 5ESVB 3MV7D 3ZMRA 2YN5A 5M94B 1D9KC 1FZJB 4HAFA 3KWWA 1UZ8A 2VDOH 3BXNA 4FP8H 1UKQA 2EDWA 5GS0H 1W0WA 4C56E 1CDCA 5DD5H 5B39B 4OF5A 1BFVL 3UJTH 3QUZB 5EWIL 5ESQA 2P5EB 4ZNCD 1N3NB 2VXVL 4XBEL 2E6PA 1UB5A 2P48B 4MA7H 3VXTB 5HYQB 3H42H 4JFZH 4U1HB 4U1MB 3QB7C 2JJSA 1X3DA 4Z78A 3QNXB 1JWMB 2APFA 1JRHH 4RA0C 4MJ6A 3WFDL 3BESR 4PJFA 2HYMA 3EJZD 3MODL 3X11A 3OR7A 2FNBA 5JZ7C 1MNUL 1FDLH 1H5BA 2FLRT 3DVNA 4LCWE 5GZOD 3MYZA 5ALBL 5E03A 5BVJA 1BFTA 1ZLVH 2YBRA 2HFGH 4X98A 3PHQB 4Z18A 4ODWA 1OAYH 1HQ4B 5LGHH 3VXMB 1RZ8B 2DQJL 3V7MA 3RGVB 2Q7NA 1DLHA 2OJEB 1BJMA 2F74B 5DQJA 2VL4A 1KENH 4MMXC 1AO7E 3MBED 4WO4D 5TDOA 3C6SA 1U8MA 4IOSD 3LB6D 4JJHA 1Q38A 3RI5F 1HI6B 3EDDA 4PRHB 4QNPF 2W91A 5F88A 4I18B 4XMKL 1REIA 1JHKL 3TP4A 3KPMB 3P11H 4IHOA 3IFNH 5J6HA 5GGVY 2J8UA 4MXVE 2ZCHH 1BQHG 3RBGA 1Q1JH 3UAJD 5I1IH 3O6ML 4WFGE 5D1XB 4F7PA 3CDGA 4L4VD 4S1RH 1H3PL 1T21B 2IH3A 3ZDXF 3QP3A 1I3RA 4K2UL 4OGZA 5BS0E 1C5DA 2AJ3B 4PRAB 4WU5B 1UKSA 5ICZA 4YXKL 4LU5H 1KCLA 3SE3C 1T03L 4JFPB 3AY4C