4PJDF

Structure of human mr1-5-op-ru in complex with human mait c-c10 tcr
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
235
structure length
233
Chain Sequence
b'GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSPPGGTDTQYFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 233
sequence length 235
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjdF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjdF02
4F7PA 4P4RA 3KPLB 4GKNB 2ZUYA 3G08B 5F88A 5JA9A 4MCYA 1RZJC 3CZFB 2VLRB 3KWWA 1KF9B 1EEYA 1U36A 4NGHL 1JTOA 4OLXL 1HHJA 1IKNC 4HGKC 4HDIB 2GUOA 4MA7L 2X6MA 3P4MA 1GGBH 4HSQA 1C08A 1U8MA 4NQUA 3QH3A 3RU8H 4I5BA 3AFLA 3V6OC 3L3OB 4UINH 5C0AE 4OLVH 4PJCB 1INQB 2NXZD 1MFCL 5BS0D 5C6WH 1NC2A 3UMTA 4BFEA 5E5MB 3DROA 4XMKL 4X4YA 1BQHA 3MLUH 5C0IB 4RMQA 5FHBH 4HWBH 5IBUB 1UZ8A 3TVMA 5K9JH 4NO0D 1QYGL 5CEZL 2A6JB 4PJFF 5IMOA 4ZTPL 2HTKC 2JJTA 4WEUD 3CPLB 3G5ZA 2P47B 5GRZA 4KKLC 1MCBA 2DF3A 3KXFA 2X5PA 1A47A 5AD0A 2H26B 5EOQH 3SDDC 4YR6A 4ZFFA 1AE6L 5F3HB 1X5AA 4Y16D 5BXFB 4WEMB 2ZSWB 5CJQL 4LMQI 3GMNB 5EUOA 1IAIM 4HCRA 4NFCA 3T1FB 3BKJH 4PTUB 4WUKH 5HYSA 4R7DA 2ERJC 4FFZH 5LCVH 3VI3E 3PV7A 1YEKL 2KPNA 4KRLB 3MV8A 2IBZX 2BCKA 2MHAB 5ICYA 1X44A 1KJMA 4OZHF 1JHKL 1RK1B 1PLGL 1YEGL 3VFRB 2HLAA 2I9LA 3MNWA 5ANMB 1T03L 1GC1L 4G80A 5HGBB 2EYRA 4LCWD 2GITA 3ZE2E 2EC8A 3QEUB 5DHVH 1I9EA 2DD8H 1QSFA 4JM4H 4AIOA 3MMEB 5C0DB 4XNQB 1T0NB 3QXAB 4H8WH 5T5NF 3SCMA 1FRGH 1A1OB 1OARL 3VWKA 1CE1H 1F90L 3ABZA 3NGBC 4I18B 4JFPA 4G42A 1S9XA 4M4RA 1MLBB 4WHYH 5CMAB 3C5JA 4YHIA 3D9AH 1JPST 1ZVYA 4NSKA 3GSWA 3U0PA 2EDEA 2YUVA 2IAMB 1F3JB 1XCTB 1D3CA 3GSNL 5HDLA 3EYFB 3OPZH 3Q2CA 4LSRH 2QHLA 4DGVH 4WWKD 1A3QA 4O02L 3QFDA 3U9PL 1J9CT 1SMAA 3NCFB 1B0RA 1FIGH 4HIHA 4WV1A 5D5MA 1YEDA 3SJVB 3P73A 2ESVD 5I1AA 4PJ5E 4WI6A 3MUHL 5E00A 3U0WL 3NIDE 5D6DA 2HA1A 4XPBL 4NQTA 1PX4A 2A2QT 1Z3GH 4PBXA 3KG5A 5GJTL 3SY0B 3UTZA 5BO1H 4LLAA 3ZE0F 2L0DA 1LK2A 4NKDB 1A14L 4NQEE 3MNZB 4ZYKA 3VXPB 2VLMD 4FG6C 4F57L 1DTUA 5D2NB 4BSJA 2CUMA 4BA8A 3MLYL 5D6DC 4ERSH 3FFDB 4CN4A 3NAAL 3VGHA 1XR9B 1AGDA 2DQDH 3H0TA 4JPWL 4JJ5A 1F4AA 4CVXA 4WFED 4NPYA 5FCUL 3PGDB 4WU5A 1MCEA 1CLZL 3IFLL 5C0CB 4OLZL 4JRXB 4MZ3A 2L7JA 1H3PH 4WI4A 3TBVB 5I15L 4DEPC 5IV2A 4IS6A 1CLCA 2ZUXA 4EVNB 3WFCH 4JLRA 1P4BH 3JV4A 4D0CA 3CX2A 1QFWI 3V7AE 3VWJA 4D9LH 3TNMB 5HHME 1FNEB 5ITBL 5DD6B 5IOPB 4OKVA 5HVHB 1MCRA 1F4XH 4K7PY 5DQDH 4LFHG 3H6JA 1OAXH 1CCZA 5EC1B 4C56D 4Z77B 4DVBA 4YDVB 4RBPH 3LKPB 5T3XE 2ADJA 3L5JA 4FFYL 3NN8A 3VWJC 2NLJA 2VH5L 3CVHB 4LLMB 2QTEA 5GISH 3STLA 4MWFB 5E03A 3T0DA 4GLRH 4PJIF 3VGEA 4LCYA 3GSVB 3NZ8B 5KW9L 2DBLL 1JPGB 5L88H 2C7UA 5FKPA 4F58L 1BVLA 3JTTB 4UB0L 1XF3B 1CD0A 4XNMA 1BOGB 2J4WL 1HE7A 4DKEH 4KKCC 3I85A 2Y36H 5ETUA 3LCYA 3DSFL 5DI8A 3UYRL 1F2QA 1KT2B 3KLAA 5C0RL 2IBZY 4Q6IB 3MQIA 3QEQE 4G7VL 3UAJC 2V5YA 1A1MA 2JLLA 3CK0H 3OKDA 3DRQA 4FQXB 5D2LF 5LGKA 3IVKB 4ZNEA 2ZSVA 2VDLH 4X8JB 1JZ7A 3S88H 3GSRA 5JW4R 4QHNA 1KACB 2UUDK 3C87A 3B9VA 4V2BA 2ZUVA 5EORL 3VFSB 4LU5L 1HYSD 1HKLL 3MOBL 4S1RL 4YDIH 5C09B 4HUUB 4RQQB 4DTGL 5I9QB 3N1FC 1HHKA 5C3LD 5DJ0A 1DE4B 5DSCA 3CFDA 3R06B 4FQHA 4FOMA 5E2JA 3PE9A 2R8SL 3LD8C 5IEKB 1FN4A 4TUKH 5J6GA 1IRAY 1DQLH 1FYTA 4JM2B 2VDML 4QXGH 2BFVL 4XTRC 1GAFH 1N4XH 4LBEA 5D7IF 1V7ML 3DV4A 1BX2B 4C59B 2G9HB 4D9RD 5DURD 4NKOA 2CUHA 3T0ED 3C6SB 1U0QA 5B21A 4YXLL 2WSKA 1HHGB 1GZQA 3IDGB 2C26A 4YE4L 1K9TA 4BQ6A 2B39A 1BJ1J 2W60B 5H35B 2VQUA 3W82A 1U3ZA 2NY4D 3SDCA 3HZVB 1MRCH 4Z18A 1NSNH 5B38A 3VD4A 3FO2A 2RCSH 2YR3A 2Y23A 4X9BA 4KPHL 3AMLA 1XT5A 1WZ1H 3CXDH 3BWAA 4F33A 3FQWA 5L9DH 4NZUH 5FUZL 2JIXB 1L0YA 1I75A 4LQ1A 4K2UH 3HI1A 4JFEA 4J1UA 4EXKA 3S96A 1T3FB 4MA1C 5I0DA 1D6VL 2H2SC 2DB8A 1C7TA 4JY5L 3MZGB 1P1ZA 4PGCB 3IXAB 1LDPH 3H9HB 3QDHA 4PJGF 2QEJA 3SKNA 2OJEA 4AMKL 3C09B 1ROWA 1T7VA 3O2WL 1I7UB 5FYKH 1CFBA 2J2ZA 1J0HA 4HIJB 2DIBA 2YRPA 1QBLH 4YHKH 2F5BL 4F15C 2YPLD 4UI2A 1KCVH 1SBSH 1XIWB 4ZO8A 4R7NA 2R0ZL 1BJMA 4LSSL 1NFIB 3T8XB 4MNQA 3U4BL 4TNWF 2R0LH 2RFXB 4JQIL 4MDIB 4G3YL 2Q8AL 2EIDA 3DNKA 5JOFA 5T3ZD 2R4RH 4OB5H 5K33A 2Y7QB 4HUKB 3A67H 4NNXB 3OL2A 2FH8A 2YD4A 2P45B 2E8ZA 3WV0A 4H26B 4I8DA 3GBNH 3ARBD 5CD3A 5IR1B 4Y4HB 2ADGA 1S7XA 3O8XB 4KDTC 3KS0J 3EYUL 1NEZA 4I77L 1OWWA 1GIGL 3QG7H 1T22B 1JWSA 1IQDA 3DUSA 4Z0XA 2YN3A 3KPLA 1FSKB 2E3VA 2QV2A 4GKNA 2B1HL 2BP3A 4BK4A 3T08A 2HVKB 4R0LA 4WI3A 5KSAC 3MRJB 2X41A 2VLRA 4ZSOA 5SX5K 4JG1H 1ERNA 1SJHB 2BDNH 2B1AL 3ARVA 3QHZH 5AAMA 4JFFD 5IT2L 4KKBC 2DWEB 2DLIA 2M26A 1ZHKB 2CMRH 4HPOH 1MCWW 3L3OA 4U05A 2WBJA 1AQKH 3LPWA 2AV1B 2ED8A 4PJCA 4R0LC 4V1DE 3ZKND 4RWYL 5FO8B 4UZGA 1RUPH 1CDHA 1QO3A 4JAMB 3ET9F 2FX8L 2ORBL 2P5EB 2BZDA 4BQ9A 4EI5C 4ONFL 4V2CB 4ZUTB 4YAQB 5E5MA 5C0IA 4MJID 4Q9RH 1EAPB 1MCJA 2WBJC 3UTPE 5GS0L 2A6JA 3HFMH 2IFFL 4QCIB 4P5KA 4PJXB 5GQBA 2CGRH 4OCSH 4KH2A 3OJVC 2PYFB 3H42L 1J1OL 3RAJH 3MV9B 5DQJB 5F3HA 1PSKH 4MXQC 3AB0C 4FNLL 3BIBX 1EO8H 3RPIB 5BXFA 3QDJB 2ZSWA 2OTPA 3GMNA 3C9NB 5EA0H 4GRMB 3T1FA 5T1LB 4I0PD 5E9DB 3MR9B 4X7FC 4PGBB 3PP3H 4S2SB 1PDKA 3QEGL 3VU2A 2PW2B 4XWOC 3RVTD 2YMXL 2QKIB 1LVEA 2W9DL 5CEZE 2MHAA 4IOIB 1RK1A 3GMOB 3MV7B 2VXSH 4N9GB 3VFRA 4CRPA 1UVQB 4B7LA 4YH6A 5ANMA 5TE7L 4X6DE 3H9YA 4MGXA 4OCYL 5L2KB 3HMXA 5HGBA 4ELME 3RY6C 2ZUTA 4CL7A 3FQTA 2MFNA 3LKOB 4X5WA 2Q87A 5MERB 5DQ9B 1CGSL 4XNQA 1T0NA 3QXAA 4NO2B 2HKHL 1A1OA 5GRJL 3JVGA 1DBJH 2NYYD 2PO6B 1NEUA 4I18A 1BJ8A 3D39E 3NFNB 1MLBA 2NW2A 4OCXL 4Q9QL 1AJ7H 1AQDB 2VJXA 2VL4A 3W5NA 4NQVB 2P5WB 2IAMA 1F3JA 3CXHJ 4WO4D 2MJWA 1EJ6A 1WUNT 3S36X 5DC9B 2NY0B 4FP8H 5JPNB 5JO5B 3HHRB 5JXED 3O6FD 1YJDH 5DJ6B 2QSTA 4X4ME 3SJVA 2IPKA 5KG9B 5F9WC 4Z7NF 4P9HC 1EERB 2PCPB 2X4SA 5B22A 4PBWD 3SY0A 5CS7A 5KTEL 1EA9C 1NAKH 4WENB 4NKDA 1DZBA 2VL5B 4PJBE 3F8UB 4X6CE 3MNZA 2RB8A 4R90H 3JWDH 5T5FL 1P7KA 4KTDL 2OSLB 5D2NA 1R3JA 4QRUB 4AG4L 3E0GA 3WNOA 2MOVA 3FFDA 1XR9A 4M7LT 2OR8A 5E2WH 2KH2B 4YEFA 4AEIH 1UKSA 2EH7L 4LARH 1NCNA 1YY8B 3TA3B 5EUKA 5C0AD 3PGDA 4PJDB 5D9SA 5C0CA 3NFPB 4LPTA 3GJFK 4HK3N 4HUWA 4JRXA 4ODSL 4YC2B 1NCTA 3HTLX 4LSQH 3TBVA 4WJ5B 5ILTL 2XRAL 4EVNA 2A77L 2WANA 2XWBA 5I1KH 1HNFA 1BIIB 2A1WH 1AC6A 3ULSA 3H8NA 1FNEA 5DD6A 5FM8A 1CFQB 1UXWB 5IOPA 1MHCB 4LRNH 3I2CL 1JFQL 1MHPL 1FH5L 2DJSA 1F3RB 5EC1A 4YDVA 2VDNL 4M7ZC 5ICXB 5SWSE 4Y1AD 4NOBA 5SWZE 5GRUL 2YN5A 4LLMA 2D9QB 3CVHA 1QG3A 5I19H 3T0XA 1ZLVK 4RRPG 4MWFA 3ARDB 3KPSB 4RNRB 1QA9B 3GSVA 5AZEL 4HJ0D 3NZ8A 3RHWK 3Q5YA 1U8PB 1W72B 1OHQA 5CGYD 1XF3A 3K2UH 3QPXH 2IF7A 3V6BR 3GM0A 1KT2A 1T89A 3U48A 1EPFA 1MJ8L 1U58B 4Q6IA 3KYKL 5KSUB 2EDQA 2DWDB 1TJGL 2H8PB 3MLZH 4JR9H 1S7VB 4YZFE 5J57B 2EE6A 4M7JH 4FQXA 1BBDL 3IVKA 4X8JA 3OAUL 5E99H 2PXYD 2H9GB 3VFSA 1WWWX 4R3SA 3GUTB 5C09A 1AIFB 4Z95H 2YC1B 4RQQA 1LGVA 5TF1L 3OG4B 4QY8B 4HCRL 5D96C 1DE4A 4WTWA 1JZ2A 1WCBB 3D48R 3D3VE 1KLUB 4KRMB 1DN2A 5IEKA 4TYUA 1FCGA 4J23A 4N90E 1JF1B 1S8DB 5A16B 4L4TE 3OKOB 4PJ5D 5IQ9B 4JQVA 2ADIB 5GJSL 2FEEI 3PWLB 1VSCA 2G9HA 3MJGX 4JFYB 4UV4H 5E6ID 3C6SA 4FTVB 3U46B 3W9DB 1BD2B 2HT3C 5CFHA 2HT4D 4NQED 1DQMH 3O0RH 1EO5A 4DQOH 1HHGA 1YYML 2JB6B 4G8FA 3IDGA 1URLA 2VDPH 1CDUA 3NFSL 3S35L 2W60A 5H35A 3RDTC 3BPLC 3TESA 5F7DB 5EZIH 3WIFB 4U1NB 2CIKB 3QUZC 3AM8A 1LO2L 3DGGB 3GIZL 2VLLB 4I2XB 3IKCB 5JUEH 3IDXL 2JIXA 1A7QL 5IW6A 3X14B 3L5HA 4PJFE 3CXHK 3VGGA 4RAUB 3DYPA 3NPSC 1T3FA 5FGBC 2ZCHL 3WXVH 4OZ4B 4XVUC 4YXKH 4JN2B 2IPUG 2CPCA 3BT2H 4BQ8A 5E6YA 1Z9MA 4RCAA 4PGCA 3IXAA 4ZD3H 5HHMD 3GMMB 1OM3L 4ZXBA 3KPQB 4NO0B 3A6CL 3FKUS 2G5BB 4OIIL 5GGTA 3NCYS 3K4AA 4HIJA 4OCRH 3LH2H 4OGAD 3P4LA 4M6ML 1QBMH 2R9HD 1TZGH 2X70B 5T3XD 1XIWA 4Y4FD 3SDXB 1NFIA 4D0DB 3QUMB 1ULVA 2X4UB 1FVCB 4ZXBC 1HSBB 2RFXA 3TP4A 4HWNA 3V6ZA 4MDIA 3WXWH 3QJFB 4R97B 1JJUA 2OQJB 2VZSA 1AR1C 5CP3A 2KZ1B 4ZO6A 1FVDB 1AO7E 2GAZB 2XA8L 4YUEH 3TN0B 3UTQA 1L7TH 1MHEB 4NJ9L 2EEBA 3JWNC 2Y7QA 2O61B 4PJCF 3FJTA 5FXCH 1UWEL 2WLYA 3QEQD 4Y4HA 5KVEL 3QO1B 1G9NC 1YNLH 4YFDB 3S7GA 1OAKL 2NX5B 3ALPA 3NOIA 3O8XA 4P4KC 4Z7QF 3EOBA 4X83A 1T22A 5IWLC 3BZFB 2X4RB 4NBYB 2BXZA 4NN5C 5JOPE 5F7MC 1NBZB 2FHBA 1A5FL 3PP4L 4QNPF 3HI6H 3C6LC 3O41A 3S36H 2HVKA 4JO3L 3MRJA 3TJHD 1BFVL 3ZKXC 1CI5A 1HCFX 3UTTB 2ITCB 4LLYA 3Q6GH 1SJHA 1W0YT 4PPTA 8FABB 1H3WM 3WKMH 1L7IH 2DWEA 5C3TA 1ZHKA 4Z0BL 4KJWC 2VLKE 4TSCH 4GS7B 1HOCA 3ZE0E 4J2XA 5ALBL 3C60D 4WWKB 3JXAA 5FO8A 2AV1A 5I1IH 5C2UB 1DN0B 1T4KA 1I8MB 5BCAA 3H2WA 4JAMA 3QFJE 4OBSA 1GGCH 2ESVB 4PRNB 3K7UA 5FGSA 1MREL 3OX8B 3QQ9D 1GL4B 3MLRL 3BUTA 3VXRB 4YAQA 1S78D 1KIUA 4M62L 1CDGA 5I8OL 1EAPA 2OP4L 4GLRI 4J8RA 5LG1A 1TQCC 3MJ9A 5LAXB 4OSUL 1EO7A 1YNKH 4QCIA 5C9JB 1H8NA 1RI8A 1LO0H 2PYFA 2D3VA 3ZYOA 5C8JB 1BREA 1IC4L 1M7XA 1RUQH 5DQJA 1KN4L 4XX1E 1R3LB 3LQAH 3RPIA 3QDJA 2EYSB 3C9NA 2R0WL 5T1DL 3AREB 2DQGL 3ARTA 5E9DA 4PGBA 3ES6B 4S2SA 1A9EB 1JP5A 4KZDH 4NKIL 5FB8B 3K74B 2PW2A 2A6KB 2ZG1A 5INCB 1X4ZA 3ZTJH 1RURL 4RGNE 2DLHA 3NACH 4U7SA 3VJ6B 4KXZH 3BXNB 3DXAA 3RVUC 5KVGL 4IOIA 3GMOA 3MV7A 4ODHL 3X3GH 4N9GA 2WWKO 1KCRL 1UVQA 1TETH 5FUCE 4KROC 2EKSA 5L2KA 1EZVX 4P2OD 4PJIE 5E4EB 1A2YB 3LKOA 2YA0A 4H20H 3FCTB 5HVFB 4EJ1C 4BELD 3BKCL 5MERA 1DBAL 1BFTA 5TQ2L 3SDAC 5FECA 2PR4L 4G9FE 4NO2A 4OI7A 4C56B 3FZUC 4K9EC 3WFBH 2PO6A 3OF6D 3NFNA 1DBBH 3UZEA 5MEOB 2W07A 1AQDA 4XAWL 3SE9L 4NRYB 1TENA 5D2LE 4NQVA 5DLMH 1WK0A 1DBKH 2P5WA 4KQ4L 4NRZB 2AI0L 3U6RB 3IDYC 2BERA 3PL6D 4IRJC 4XMLL 1CS6A 3FB8B 3N06B 4NZRL 3DO7A 4WHTB 4N5ED 3MRGA 1HWGB 2P1YA 2BVOB 3BYYA 1P84J 5C0FB 2X44D 5JO5A 4UUJB 3VD3A 5DJ6A 3SO5A 4PLKD 4R2GC 2FGZA 4OLWH 3UBXA 1B3JA 2C5DC 4WIQA 5KG9A 1TJHL 2PCPA 3RA7L 2AJZB 3ZKMC 1KLGB 5ABDE 2DQUL 1ORQA 5T3ZH 3VFTB 5SV3A 3UJJH 4XP4L 5CSGA 4NQDE 3TYFB 1PG7H 4ZFOL 1FPTL 1GCFA 5D7IE 2OSLA 2ZG2A 4QRUA 2Z92B 2X9YA 3L5XL 3DJ9A 4J6RH 1INEH 3MZTA 4Q2ZB 3N85L 3B9KC 4IIQC 4O4YH 4U1SB 5K59E 1G9ML 1A7RL 1PKQB 1SBBA 1YY8A 4KK6C 5DTFB 2ICWB 3TA3A 4UQ2B 4V1DD 1HH6B 1SY6A 4ONOA 3IRZA 1GGIH 1A8JH 4LCIH 3BW9B 5IFAH 1FO0B 3JWOH 3MO1B 2XN9E 3MXVL 4EOWH 3C5ZB 4WJ5A 2GFBB 3FL7A 3UTPD 4NUGL 4DWHA 3NH7L 2C4FU 1BIIA 4Z6AT 4N5UA 5GSRB 4YXHH 3KLHC 5ALCL 1CFQA 5CJXA 1UXWA 2RJMA 5C71A 1MHCA 1X3DA 4ZS6C 1Q1JL 1B4JL 2NY4B 5GS3A 4JGMA 3AGVA 4UT9L 4UOW1 3A6BL 4LL9A 3MV01 1ZLWH 9CGTA 3DIFB 4PJ7B 5D1ZD 1IILE 3ARDA 3KPSA 1G7LB 2NY2D 1NCAH 5I1HL 3VG0L 1U8PA 1W72A 4BZYA 5CEZD 3CIQA 1MJ7H 4X80L 2Y07L 4WY7L 3VRLE 1WT5A 1J0ZA 1FC1A 5I1JL 3BKYH 4Y5YB 1I1AB 5DDHB 1U58A 2FBJH 3WKNA 5KSUA 2F58H 1E4XH 3VGFA 2F53B 1S7VA 4OLUH 5DRZB 6FABL 4GXUM 4UV7L 1I8KB 2GQHA 1WT5C 1EZVY 1TZIB 2EE2A 2H9GA 4X7TA 4Y88A 1HI6B 2XG5A 3O11A 3GUTA 3D39D 2G5RA 1AIFA 4HUNB 2YC1A 4PY7B 2VUOA 5JTWA 1FFPB 4QY8A 2OZ4A 3WFDH 4HLJA 3S5LG 4RX4A 3TBTB 5FEBA 1I9RL 5CUSH 5D1XC 4MJ2A 1WCBA 1I1CA 4XP1L 4OD3L 1KLUA 1A3RL 3O6MH 2F8XC 5LXGL 4QOKB 3MCKA 5IBTL 2FECI 1LDSA 2AJUH 3SE4A 4DKAA 3LQMA 1MCHA 1JF1A 1S8DA 4D0BB 1BZ9B 4PUBL 5F9OH 3OKOA 5IQ9A 1X5IA 4L9DA 4QYOB 5EOCL 2ADIA 3KXFE 2G75B 1W8OA 2NY3B 4G7YH 2WK2A 3PWLA 1ES0A 1GH7A 3HMXL 3NPZB 3TGXA 4YNYB 4YHZL 1KPVB 3B2VL 5JDSB 4FTVA 5CKGA 3U46A 3W9DA 1BD2A 4FHBD 2YRLA 5D1QD 5EUOE 5D71H 4N8CL 2XWTB 1PD6A 2JB6A 1A9BA 4B41A 1R3IL 1EUTA 5JZ7D 1D9KD 2B4CC 4NN6B 3MV8E 3O3EB 4U1NA 2CIKA 1IGYB 2V2WB 1HK6A 3ESVF 3W39B 3HE7D 1NBVL 3EYQD 3DGGA 4IDLA 3MREA 3OGOE 2VLLA 4I2XA 1UB5B 3LS4L 3X14A 4LGPB 2P42B 3RKDC 2J6EH 4ZOCA 1QSFE 4H1LH 4KKNA 4RAUA 1AH1A 1R5IB 4GXVH 4YLQT 1EFXD 4PS4H 5F7KC 4YQXH 4OZ4A 4JN2A 3NCCB 3TZVB 1BAFH 2ED7A 5DZLA 1ZSDB 3DOSA 2IALA 3G6JB 3GMMA 1E28B 4ZMAT 2CD0A 4MDJB 3HMWH 3KPQA 4NKMA 2G5BA 3V5KB 2KQNA 3HNTH 3PDGA 4HPYH 1YY9C 1IC5L 4OAWB 1MAJA 3MCLL 4RFNB 3RL2A 2X70A 5SWSD 4PJ9D 1T7XA 5D7SH 3SDXA 5SWZD 4IMKC 3QWRD 5D5ME 3JSSA 4M6NL 4D0DA 2R39A 3QUMA 2OK0H 1KC5H 4PRIB 3I3BA 2X4UA 1FVCA 4NQXA 4P46C 5HPOA 1HSBA 2KZWA 4JVPA 4HWBL 4PJ8D 1BQSA 5CCKH 4LRIA 3VFWB 4GRWB 2OQJA 3WFHB 2XTJE 1FVDA 4FXKB 2GAZA 3TN0A 3HRPA 5DFWH 1A4KA 4PD4J 3VXSB 1MHEA 2VYRE 3BEVB 3GK8H 4P3CH 4M9OA 1AI1L 1CXKA 3QNXB 2O61A 3PWPB 1A6UH 3B6SB 3D2UB 5D7JB 2EIZB 3TEUA 2NY5L 4UILL 1FFQA 4OZFG 1P6FA 4LRIC 2W0LA 5GS1B 3QO1A 2LTQB 3BKJL 2NX5A 2FIKB 1A7NH 1T04B 4FFZL 5LCVL 5MP6H 3MRPB 2LE9A 3PHOA 1TIUA 2DM3A 5DRXB 3L3GB 4POZC 4XNYL 3BZFA 2X4RA 1S7TB 3RGHA 1RIUL 4KV5F 4FQ1H 1V3LA 2J5LB 3KPMB 4PLJC 4WGWB 1LEIB 1KTLB 1T5XB 4G8EB 1S7UB 3CVHL 1I3RB 3N1PC 2Q7NA 3WIHH 1XF5A 4CU8A 4EEEA 3IDMB 4ALAH 4Z7NE 5A2KH 3UTTA 2ITCA 1L0QA 3D3VD 4X4XB 5HHNB 4WWID 2DD8L 4JM4L 4FZ8L 4N90D 4FQLH 2DQTL 4L4TD 4RAHA 1MRFH 1FV1B 2DLFH 2X4NA 4L8DB 4N0FB 5DJAA 2DL2A 1DN0A 4Y5VB 1NGXB 1GOHA 3BDYH 2XKSA 1I8MA 3BEWB 5I1CH 1U3HD 4PRNA 1QNZL 2QQKH 5DC4B 3RPKA 2V5MA 2FB4H 1GGUA 3MBXH 5FUOL 3VXRA 5IJKC 3MLVH 1Y6MR 4LLQB 4LSRL 1E27B 4Z7UB 3OHXA 1NQBA 2XXCB 2FATH 3BHBB 5LAXA 2EICA 1LQSR 3L3JB 2R2BB 2DMBA 1UG9A 3GNMH 4H1LB 4Y5XC 3HA0A 2X9XA 5C9JA 2ZJSH 4M48H 1RFDH 2Q8BH 3GGWB 5C8JA 5DO2D 4GG6B 25C8L 1Z3GL 4Z76B 2PW1A 5CINL 1XGYH 4HZLB 2M2DA 2EYSA 2CK0L 1P53A 3AREA 1KYOK 1TVHB 1A9EA 2C1PB 5FB8A 4ZNEE 4U1JB 2A6KA 5INCA 3BESR 4M6OH 1PX3A 4YFLI 3VJ6A 3BXNA 5EBWB 4WUUB 3EJZD 1EHNA 2CDEA 5I17A 5HDOA 1CYGA 2JCCB 1WZMA 2ARJB 2I07B 4MQSB 3V2AR 2BMKB 2C3WA 4ORGB 3MNVA 4KTYA 3THML 1J5OL 2B5IB 4ZUUB 5JQ6H 2DMKA 3VI4F 3OKLB 4JHZA 4ZO7A 15C8H 1H3PL 4MA8H 2OMNA 3P0YH 4XPTH 1FYTE 1JNLH 3KJ6L 2Z9TA 3L95B 1JGLL 3WIIL 1P4BL 3GBML 2HG5A 2V9QA 5MEOA 1FLRL 1AO7D 4D8PB 4NRYA 1YPZF 1JRHH 5HJ3B 5HI4D 3WS6A 1J11A 3PHQB 2PTTB 2EDKA 4WHTA 4XMPH 1OAXL 3EJYD 1YECH 2BVOA 4G43B 5T3XH 5C0FA 1IBGH 4UUJA 1DCLA 3GI8H 4YPGA 4XPGL 3LKRB 3WS6C 1HN1A 3INUH 1QZ1A 2ICEA 5GGTL 5IGXL 1KLGA 5JOPD 3VFTA 2M1KA 2MPAL 2Y36L 1AGBB 4K7FB 3HRZB 4JFEE 3MRLB 4M6AA 2NTFB 4XNUH 2Z92A 2XOTA 1SM3L 5DRWB 3PUCA 3CK0L 1A6ZB 1EVTC 1OAUH 2AJ3B 1YEJH 4Q2ZA 1WWAX 2VLKD 2VDLL 4U1SA 1PKQA 2N4IA 5DTFA 4UQ2A 1HH6A 1H9VA 4WTXA 43C9B 5LJYH 3K8MA 3WFEH 4YDIL 5J6HB 4JFDB 1W0VB 3BW9A 5JIPA 1ZT1B 1FO0A 3QFJD 3TWCL 3SO3B 3MO1A 4PJ5B 3DX8B 1MFBH 2VQ1B 1QHPA 4DN3L 1ZT4A 4CDHA 4K8RC 2NXYD 1YEEL 2RIKA 3C5ZA 4NCC1 5KVDL 4EDWH 2GFBA 4NNYB 4QRPB 1CU4L 4MNQE 4G8GB 1H8OA 3ARWA 5E6IB 3S4SB 1J87A 5GSRA 4NQEB 3B9EA 5FM5O 2HN7B 2F74B 5DEGA 1F00I 2AEQL 3IFOB 4HJJL 1GAFL 1N4XL 4U1KB 1MY5A 1AHWC 5TE6L 4JE4B 3QIUD 2VTFA 3RL1B 1JYXA 3QUYD 1FVEB 5DFVD 1HCVA 4M00A 5I71B 5I6XC 3DIFA 3CSPA 5C0ND 2CLRB 3A0OA 4QRTB 1A02N 1G7LA 3TJEH 1HXMB 1N0LA 1QQDA 4RGND 4EUPG 4WW2B 2X42A 2WV3A 3PDOB 4J3OC 1WQVT 3I75B 3JZ7A 4QXTB 2YUWA 1NSNL 1OTSD 1YEHL 4A6YB 2VXQH 5IB1B 5DRNB 1KCUH 4Y5YA 1NGZA 1WZ1L 4YGVB 5F9DC 2VLRE 1I1AA 4QXUH 2K3TA 5DDHA 1BFOA 1NCBL 1OB1B 4ZSOE 1WWCA 5L9DL 3UYPA 1OTUD 3MRQB 2F53A 1EXUB 5DRZA 4LLVB 1TVDA 4YHOH 2VXVH 2I5YL 1I8KA 5CZKA 4G9FD 1J1XL 4PY8I 1Y18B 4LK4A 3PP3K 5I76B 2F5AL 1TZIA 5MI0B 4GAJH 4PJCE 1HI6A 1DEEB 4HXAH 4PY7A 3W81A 2DYPB 1FFPA 1UJ3B 3O2VH 3DX9B 5E5UB 3HS0B 4P99A 2BRQA 2XZCL 5I18H 1F6FB 3TBTA 1I9IH 4Z5RB 4Z7QE 3BGFC 2ICWI 4YHKL 1ACYL 4QOKA 2GY7B 4HT1H 1WFOA 4HF5L 5AWNL 1MLCB 1BZ9A 2ZOLB 3HNVL 4F8QA 4ODVL 3WN5B 1RV6X 4QYOA 3KPRB 3CDYA 3NABH 2G75A 4JFXB 3V6FB 3ALXA 3EBAA 5AYUH 2JELL 2XY1A 4YNYA 4QTIL 4MMZC 2QADC 5GGSY 1TQBB 5DHYB 3TCLB 4N0CD 3WLWC 2R4RL 2JJSA 2HRPH 4NQDD 4WI8A 5GZOC 2XWTA 1B4RA 3QXVA 1UWXH 1YN7B 3JBG7 2H3NB 1TTUA 4JHWL 4PRHA 1YZZA 3GBNL 4KXZI 1U95B 1VDGA 4M4PA 1LO4H 5BV7B 4Z7WB 2VWEE 3WNPA 4C4KO 4CVWA 3SDXF 3W39A 5DXWA 3LN5A 2JJSC 3QG7L 4KRPB 1KEMH 3HE6C 5C2BH 2JJUA 5D7LD 4LPWA 5ACLA 5ANME 4JPKH 1PGRB 3SN6N 3T4YB 2CKNA 2AV7B 3K4DA 3QG6B 4XC3L 1BBJB 2XN9D 3EDFA 3DX7B 1XGQB 3MACL 5C1MB 1FG9C 3F7VB 3QHZL 3TZVA 3ISWA 1ZSDA 3CVIH 4JCMA 4EXPX 3ZSSA 4FMFA 3G6JA 3X3FH 4HPOL 1E28A 4MDJA 2FEDD 5JR1L 4MS8C 5A3IC 1KTKE 2K7PA 5I1EL 4HWZB 1RUPL 3T09A 1JGVL 3BN9C 4APQD 4OAWA 1ZS8B 3ZT5A 3CNKA 2ID5A 3SJVE 4ZQKB 4G5ZL 4PRIA 4Q9RL 3MUJA 1SY6L 4OLXH 1CQKA 35C8L 3VFWA 1TDQA 5DVNA 2OR9L 2HRLA 3NCJL 3O3BB 3WFHA 2Z31C 4FXKA 4MA7H 2VISB 3VXSA 3BVNA 3G5XB 4OCSL 3RHWF 2GSIB 2CK2A 3PWPA 4YX2L 3B6SA 3PV6B 5EC2A 1HIML 3D2UA 1MFCH 1PSKL 2EIZA 5D7JA 3LDBB 2DLGA 5MEPB 4RRPA 5D2NE 4CKVX 4QHLB 3P9WB 5GS1A 5EA0L 3H3PL 3FOLB 5JPMB 1BZQK 3IDNB 4NBXB 5F7UA 1T04A 1IARB 1YA5A 4XMKH 4XP5L 1QLEL 3MRPA 4H0HB 2A6IB 3L3GA 5DRXA 2AKRB 5CEZH 1S7TA 4JO4L 4PY8J 4ZTPH 2XPGB 1WTGT 4DKFL 1LEIA 1KTLA 1T5XA 5C0CE 4G8EA 3OSKA 1BEYL 1Q94B 4JRXE 1NC2D 4L5FL 5L0QB 3QDMA 5DJZA 4X6EB 1NCCL 2YBRA 3IDMA 1EEQA 2NZ9D 3M07A 1AE6H 2ZOKB 4XNZC 3BD4A 4X4XA 5HHNA 1W72L 3TVMD 4TTDD 5CJQH 4X4ZA 4LVHC 1I1FB 5DT1H 1NUGA 4L8DA 4N0FA 1DBJL 1YEKH 3BQUC 4Y5VA 1NGXA 3KXFD 1B0GB 1M1SA 1MI5B 3S5LB 3BEWA 2HFFB 1WCQA 2HJLB 3REWB 1JHKH 1PLGH 2EE9A 2FWOB 1DL7L 2AXJA 4LASL 4P3DA 1FFNB 5DS8B 3QPQC 4LLQA 3IDIB 2SEBB 3MFGB 1T03H 1E27A 3IJSB 4Z7UA 1GC1H 1CFTB 3G6AB 5EZOL 1IAKB 5BW7C 3WO4C 3BHBA 4GQ9L 1CDYA 3L3JA 2R2BA 3AROA 4Z9KB 1WSST 3MV8D 4OCWH 1M71B 3KHOA 2OZ4L 1QTYT 3ARFB 3GGWA 1K3IA 4GSDH 4GG6A 2UWEB 1F90H 5IW1B 1QLFB 2DMCA 3F7RA 4Z76A 5EZLB 4WI2A 1E4XI 1FL5B 1CL7H 5B3NA 2CO6B 1QSFD 4W6XB 1CGYA 4ZAKC 4UNVA 3GSNH 1J0JA 2AK4D 3SCMD 5IF0B 1NMCC 3VWKD 2D03H 1BM3H 2O5ZL 5DEZA 4O02H 3RFZC 4J3XA 4HKZB 5EBWA 5FGCB 3U9PH 3VXQB 2FSEB 4WUUA 4HAFA 2A9ML 2OMBA 1JCKA 5C09E 4KJQC 2DQJH 3L3KB 4LARL 2R15A 2JCCA 3RGVC 5I1GH 1MVUA 2ARJA 2I07A 3U0WH 3FQNB 4ORGA 2F9BT 4S1SL 4XPBH 4ZUUA 3JUYA 5FDYA 5EH1A 1QRNB 4JO2L 5GJTH 3U7WH 3OKLA 3BZEA 3JTSA 4H8WC 3ILQC 2OTUB 1A14H 2APFA 5E1HB 4JHAH 4U0RB 2DQCL 3HC0A 3QIBC 4F57H 4KGJA 3MLYH 2ENSA 5L2JB 4JPWH 2XTJD 3QIWC 4D8PA 1P5VA 5LGJB 1NDMB 5IIEB 4UNUA 2PTTA 1UADC 3L1OH 2FZ3B 5BMFL 1CLZH 3IFLH 3SKMB 2VABA 4OLZH 5H37H 1N2RB 3B4NA 5J3HD 3O3DB 3TC9A 1TNNA 2E7LA 3IU4H 5I19L 5I15H 3QXDB 5A2IH 3LKRA 4S0TD 1IAIH 3DVNB 2BY1A 5E2VH 4KMTH 3DX6B 43CAB 3EFDL 1XCQA 3K2UL 3WJJC 1I85A 2NNAB 1AGBA 4K7FA 3HRZA 3QPXL 2E7LC 3QUML 3EOYG 3D39B 1N64L 5ELIA 4NJAH 1NGYA 3RX5A 3WHE0 1MCQA 3MLZL 4JR9L 5DRWA 4EN3B 1A6ZA 4S1DD 1WFUA 4NQCB 4FFYH 1GHFL 1NBYB 2BVYA 5DUBB 3VWJD 5IB4A 1L6ZA 2VH5H 2YA2A 5E99L 1NC4B 4UAOC 3ARSA 4PV8B 43C9A 5KW9H 1OGTB 2DBLH 4JFDA 3AAZA 1ZT1A 4LHUG 1KCLA 3FAWA 4F58H 2MCPL 2NY1B 5EULV 4UB0H 3DX8A 2VQ1A 3ZMRA 2J4WH 4P23B 5EU7E 4J7RA 2MKWA 4J4PD 4JZOB 1G7PB 1P4LB 5FO9B 3QI9C 4HQQL 3DSFH 4QRPA 3UYRH 4G8GA 1LNUB 2ZUUA 4G7VH 3UAJD 2QBWA 3ZL4L 5KVFL 4M7KL 5DK2A 1B2WL 1LEKB 1YN6B 2FYYA 4X6CB 2HN7A 3FRUB 4JY4A 3IFOA 4U1KA 1K8DB 1BIHA 1XGRB 3DMMC 1BLNB 4LU5H 1PY9A 3MOBH 4S1RH 3RL1A 3K8KA 4JDZB 4U6VH 3DETC 4DTGH 2RHEA 1QFPA 2XFXB 1RZKC 4WW1B 5FA4A 1P5UA 1FHGA 2DKSA 3O0RL 2CLRA 4QRTA 2EIBA 4LPUA 5E8DH 1N6QL 5JIIA 3UO1H 5EO9B 4WW2A 3PDOA 3WBDA 3BYTA 5EZIL 3I75A 4QXTA 1GGYA 1I7RB 4WI9A 3FB7B 1JHLL 2VDMH 1UM5H 2FX7L 4A6YA 5I75C 4PGEB 5IB1A 5DRNA 2BFVH 3RVVC 2R69H 3RJDA 1KPRB 2MNUA 3WUZA 4G6FD 3MRQA 5IVXF 4KK8D 1EXUA 4LLVA 1ZTXL 1KPUB 4YXLH 1NFDB 1FYTD 2A6DB 1Y18A 5I76A 3DUHA 4MD4A 4YE4H 4YXKL 1DEEA 4PJ9B 5SWZB 4DVRH 4A2MA 3OGCB 4DJMA 2IGFL 4ZD3L 2DYPA 3DX9A 3HS0A 2XKUA 1KNOB 2BNUB 1TNMA 3QISA 4Z5RA 3KPTA 1VA9A 2R56H 4NKQB 4R6UA 2BXYA 5DF0A 3LH2L 5BZWB 5JW4M 1CICC 5CILH 1CZ8H 1ONQA 4DUXA 5HI3C 4G6MH 1QBML 4E42B 1MLCA 1I3VA 3WDIA 5HSFA 3SDCD 5KZCD 3PG2A 3WN5A 3KPRA 4JFQB 5F89A 3WXWL 4JFXA 2D9CA 2VZUA 3W0WB 3V6FA 1D6VH 1YDPB 3T65B 2YHGA 2DDQL 4YUEL 1L7TL 1JGUL 4F9LA 3TCLA 4PB0L 3G6JF 3QDJE 5ECJE 4NN7B 4AMKH 3O2WH 4JFED 3MRKA 5E9DE 1X6LA 5FYLL 2KL6A 1YN7A 2H3NA 4Y8AA 2W0KA 4OF3A 1UM6L 4HUVB 1U95A 2F5BH 4Z7WA 1JZ5A 3DXAE 2EXYC 2R0ZH 2XT1B 3CD4A 4LSSH 4F9LC 2D4DA 3MV7E 1KULA 4HIXL 5GGVL 3U4BH 1FQ9C 3UJTH 4E5XA 4G3YH 2WLZA 2Q8AH 4LP4A 4LPYA 5L2KE 1HH9B 4JKMA 3T4YA 4PB9L 2P4AB 1A7OH 1D5ZB 2AV7A 3TF7C 2DQIL 2LU3A 1BBJA 4P59H 2CLZB 4U0QB 1CIUA 4B5EA 1YMHB 3DX7A 1XGQA 4PP2B 4MNQD 4ODWB 3KGRA 3Q6GL 2H2PC 4X7EC 3UYOD 3F7VA 3H9ZA 1CXFA 1F6AA 1N6UA 4LCUA 1JRHI 4I4WB 2KDGA 4P5TC 2YOCA 2UUDH 3EYUH 5I1IL 1GIGH 2P5WE 4CU6A 1LE5B 4HWZA 1BHGA 5GGRB 3KVQA 5TDPB 1G0YR 1SQ2N 5E1AB 1ZS8A 3U7YL 4OF8A 2W0FB 2R1YA 2D7TH 1Y0LB 1W0WB 4ZQKA 3E8UH 2YXFA 4PJFB 5J11C 3X13B 2B1AH 1WGOA 5IT2H 3O3BA 1LHZA 4KHTL 1FO0L 3O9WA 4KKBD 2W1NA 3T2NH 3S35X 2VISA 5I66B 4N9OB 3G5XA 1I8LC 4HKJA 3ZDZE 1MCIA 2GSIA 4RWYH 1RUQL 3PV6A 1XGTA 2VLRD 3LIZH 4JQXC 5MEPA 1NGPL 4IOSD 2D31B 2FX8H 4QHLA 2ORBH 2BJMH 1JHTB 3CU7A 4EUPB 3UEZA 3FOLA 3O9WC 4ONFH 5SV4A 3IDNA 4ZUSA 3RIAF 5ICZB 4KZDL 5M7QA 3X17A 4Z7UF 2AKRA 2WBJD 3NACL 4XPAL 3RWJB 4OZHB 3I50L 1KB5A 2F19L 2IFFH 5FO7A 2XPGA 2X4QB 4HAGA 4KKAC 3NA9L 1Q94A 3H42H 1MELA 4X6EA 1J1OH 2EDJA 1RJZB 4JDVB 2ZOKA 1AO7B 4JDTL 5E8EB 4FNLH 1ZMYA 1FNHA 2R2EB 4LIQE 4TRPL 1I3UA 1I1FA 1UA6L 2OM5A 1C12B 3T0WA 3QEGH 2GJZB 1G7MB 3WFBL 4EQ3A 4XWOD 1B0GA 1MI5A 3S5LA 2YMXH 2HFFA 3K2MC 4XBPB 4P57B 4Y4KC 2HJLA 3REWA 4X98B 5GZNC 3EKCA 3WUWB 2AXGB 2CR3A 2QQNH 4MZ2A 4QHKJ 1UEMA 1DBKL 1BVKB 2EC9U 1WIOA 2LAAA 1P7QA 1FFNA 5DS8A 2YKLL 3PQYB 3ROOB 3IDIA 2SEBA 1J0IA 5TE7H 1TVBB 2GK2A 3IJSA 3K3QA 4OCYH 4QRRB 4U6HB 5IBLC 3KPSE 3G6AA 5DJ8B 3Q48A 1M71A 4Y2DB 4OLWL 1CGSH 2HKHH 3GB7B 1RMFH 3ARFA 5GRJH 2UWEA 5IW1A 1QLFA 1TPXC 5EZLA 4W6WB 1FC2D 5C7XL 4OGXL 2VLKB 3UJJL 1FL5A 4I3SL 3O6LL 4R96B 2GCYB 1A6VL 1PG7L 4HKZA 4J6RL 3VXQA 1LEGA 3EDDA 3ZKSD 2AW2A 3VFNB 1NH6A 3FQNA 3GEWB 3JV0A 1RJYB 2IAMD 5AEAA 4LCIL 2NY6C 1QRNA 5IFAL 1KCSL 1YUHB 1YC8A 2OTUA 2DI9A 4P2RA 5F97E 3MJ8A 3MLTB 1OWRM 3SJVD 3TO4B 1ZT7B 4JZNB 4KTDH 4AG4H 2YD8A 1IT9L 4K55A 1MH5B 3QUXC 5CJBA 1KIQA 5LGJA 1YEFH 1NDMA 5IIEA 2EH7H 3ZDXE 1PY4A 4FTVE 1BD2E 4N8VG 2APWA 5E8OB 2FZ3A 4OFIA 4PFEA 5F96L 3KYOB 1YJDC 5DMGC 3QWQB 1FORH 2I25N 3IFPA 3HG1B 2ZPKL 3SE8H 1N2RA 4XRCA 2Z4QB 2Y4SA 3O3DA 4ODSH 3RTQA 5IROC 2X4OB 3QXDA 4GAYA 2DM7A 1J86A 2E7CA 2XRAH 5ILTH 2A77H 1NCAL 2W9LA 4RDQG 5JOEA 3CFJB 4GRLC 4Q74A 4I2XE 1IEBB 3DX6A 4QWWD 5B4MD 4P2QB 43CAA 3BP5B 4U2YA 1XF4B 4GKOA 3JWDC 3MYJB 4OZFA 1EJOL 3BISA 2NNAA 2Z93B 5C0CD 1VADB 2X4TB 4JRXD 3I2CH 3RTQC 2EDOA 1CD8A 1J12A 1JFQH 1MHPH 2H41A 1FH5H 1CD1A 2FBJL 5CZXC 1Z0MA 2F58L 4YIQA 1RSFA 2YA1A 1E4XL 4M8VA 5F7HA 4EN3A 4NQCA 4XBGB 1NBYA 4U6TA 4ZPVB 3B8SA 5GRUH 3S6CA 4Y7MA 2HMID 5L7XL 3VXNA 2F54B 4YK4C 4AH2B 2NY7L 4TUOB 3VRJB 1NC4A 1OPGL 1HHIA 5AZEH 1CDCA 1R5WA 4P2CG 3UC0L 4MAYB 3SDXE 4JZOA 1G7PA 1P4LA 5FO9A 2HLFD 1KG0B 3GHEL 5CUSL 2E6JA 2VMFA 1AGEA 1OAYL 3OTTA 4X5XB 1LNUA 3KYKH 1DUYB 1VGEH 1TJGH 2AJUL 1MCSA 3T3ME 2NCMA 1YN6A 1LEKA 1E4JA 1BBDH 2WINA 2NXZC 1GOFA 4NC1C 1FFOB 1XGRA 1BLNA 4QEGA 4JDZA 2VR9A 3CDCA 4QO1A 4HCRH 3TV3H 4WW1A 1JYVA 3ULUC 1BFSA 4FQXD 5DMKB 5FFLA 2NX5E 4G8IB 2EDWA 4JPVH 2WUBL 2QSVA 2AJSH 2EZ0D 3C8KA 5C09D 4OF0A 2R0KH 3FB7A 4QRQB 4YO0B 4F7CB 4PGEA 2FR4B 4IRSB 1KOAA 4Y16C 5CD5C 6CGTA 3FTGB 4UIMA 1J1PH 2P43B 2VDKL 5FYJL 4NOFA 3AY4C 1Q9KB 3MBEB 1KPUA 1K4CB 1NFDA 1JVKA 3RNQB 4JM2D 1DSFL 3J8F7 1YYMH 1FP5A 1H3VA 3S35H 1MCOL 1HKFA 4M02A 3OGCA 4TTGA 4Z7WF 4PJGB 4JCLA 4CJ1A 1KNOA 2BNUA 2ATKB 1RJCA 4RFOL 2YD2A 3WNMA 5C08B 3VXRE 3GIZH 3PF2A 3MROB 4M5ZL 5BZWA 4F7PB 5HHXL 1A7QH 4K3HA 3VRIB 4D3CH 4E42A 3I02B 5FA3B 5EBGA 1NMBH 5K9QI 3LSOA 2BOBB 3V79C 2OK0L 1KC5L 1UC6A 3BI9X 2VLJB 4XI5D 2IC2A 2ZCHH 3W0WA 1YDPA 4O5LL 1FBIL 3MTRA 2PTUA 4KUCF 5FCSH 2EO9A 3PJSB 2WBKA 3T65A 3ECBB 4CMHC 4B53A 2JIXD 5DUPL 1CL7I 1ZWIA 4DOHB 1OM3H 1NUNB 1G7IB 1NUDA 2ZNXA 4XZUB 1HZHH 3A6CH 4F37K 1A6UL 5HPMA 2D7OA 4OIIH 3EUUA 4HUVA 4M6MH 3VXMB 2APXA 5KANG 5JA8B 4M1GL 5AG8A 4P5MB 3SDDB 3DROB 4X4YB 5MP6L 2VC2L 4ZXBD 4IJ3C 2WWMD 5IMOB 3OBAA 3QSKB 4M3JA 1D5ZA 2ERJB 2CLZA 1YMHA 2P8PB 4NJ9H 4PG9B 3IDUA 3KXFB 5T1MA 1XIWD 4GUPA 1IKFL 5AD0B 2DTMH 3UDWA 4ALAL 4ZFFB 4PP2A 4ODBD 4ODWA 3PNWB 1UWEH 5FYLE 4WI7A 1FZMA 5E8NA 5TH2B 5HYSB 3DECA 4I4WA 4R4ND 1MCDA 2NW3B 1LE5A 4OF7A 4RSVA 1R6VA 2E5EA 2DLEA 4N68A 3U36B 3VG9C 1DLHB 4TVPL 3PP4H 5TDPA 5ICYB 5E1AA 2LV4A 2AEWA 5E08H 4AYFA 3VA6A 2W0FA 3MBXL 1Y0LA 1Q38A 1W0WA 4Y4HD 2O5XH 3NGBB 2I9LB 1BFVH 3VW3H 3O8XD 4RGMC 2EYRB 1IAII 2EE3A 3MODH 2OYPA 3OG6B 3X13A 2XACC 4J3VA 1QSFB 4KWUA 2MSPA 4Z0BH 2ZJSL 5I66A 1RFDL 4KJWD 2Q8BL 2FJGB 5ALBH 3LN9A 2VKWA 4MB5A 2R29L 3IAPA 3RZCA 1WICA 3IAQA 1S9XB 1MJJA 1IM9B 4PP1C 4YHYC 2D31A 1UWGL 3VMPA 4L9LA 4BJLA 1JHTA 4K07A 3WD5L 5L8KB 5EN2B 5C0EB 4NSKB 1CXLA 1MREH 4EUPA 4EBQL 3FO1B 5ICZA 4L8BB 1PKQE 1T6VN 2OP4H 3QZWG 4OZHA 2D0HA 1B0RB 4HIHB 2WQ8A 3P73B 4OF5A 1VGKB 4L9LC 3RVXD 5E00B 1WWBX 1MRDL 3NZHH 2CRMA 3RNKA 1IC4H 3ARZA 3JV6A 3CUPB 5JQ6L 1KN4H 2LFGA 1MPAL 1NKRA 3QQNA 5E8EA 1ZAGA 2R0WH 4PRPB 5T1DH 2LVCA 5A2LH 2DQGH 1JNLL 4A6YL 1HYSC 1C12A 4ONGL 1TITA 2GJZA 1G7MA 4CNIB 1AD9A 4XBPA 4OGYL 4LHJB 4P57A 5TDOA 5KVGH 3H0TB 4JJ5B 3WUWA 4JY6B 2AXGA 4ODHH 1OVZA 4DEPB 1N8ZA 3QDJD 1QSEB 1BVKA 2LVEA 1KCRH 4GMSL 2V7NB 3PQYA 3U2SA 4E41A 4XMPL 5E9DD 4U6HA 1B6DA 4QRRA 1YECL 3KPOB 2IQAB 5T3XL 4KTEL 4NO5B 1IBGL 5DJ8A 4Q9CA 4TSBL 5B39G 3GI8L 5C6PB 3L3DB 4OLYH 3DXAD 4Y2DA 3BUYB 5TQ2H 1SEQH 2PR4H 3GB7A 3MV7D 5GPRA 3G04A 5EU6A 4WFFE 4U2ZA 5JIHA 3T0EC 3LQAC 3JV4B 1T6WA 1M4KA 5IVZB 5L2KD 3VWJB 2XZAL 1F42A 4OQTA 5FOBB 4N1CA 2F53E 2GCYA 1Q72H 4KQ4H 2AI0H 1M7IB 2C3XA 4LSTH 4XMLH 4NZRH 2Y25A 4XNUL 1P4IL 1UWXK 3EHBC 4L8SC 3ZT7A 4DK6A 2PO6D 3F5WB 1OAUL 4MXVF 2OX5A 3VFNA 1TJHH 2VKXA 3RIFF 1RJYA 1T7WA 1SYVA 2P5WD 4M1DH 4HIIB 4MVBD 5FKPB 2DQUH 4K7PL 1BVLB 4QOKE 2NY0D 4XP4H 1YUHA 5BV7L 1ZANL 2YSSA 1X5GA 1JE6A 4KI5E 1PFCA 3MLTA 3O81A 3RUGA 3TO4A 4JZNA 1FPTH 3L5XH 1MH5A 3OKDB 1IAOB 5IVXE 2XA3A 2FH6A 2ZSVB 4G6JH 1G9MH 1A7RH 4MLSA 3GSRB 4QHNB 1RZFH 5E8OA 3LD8B 3MA9L 1CGXA 3KYOA 2ZZUT 5CHNA 4PRHE 1IFHL 2QJDA 3HG1A 3MXVH 2WAHA 5E2UL 5IK3B 3MOQA 3CFDB 1PZUB 2UYLA 2HFEB 1ITBB 3MRHB 2O26U 3CFJA 4NUGH 3TA3D 4P2QA 3OKMB 5ALCH 3BP5A 4HWEL 4U6XA 1XF4A 1FYTB 2Z93A 5J9PB 3ULUF 1VADA 5ACMA 1BWWA 2B2XL 5E95B 1Q1JH 3TT1L 1B4JH 3ARBC 4U3HA 2I26N 1KGCE 5J7CC 2CQVA 1MJUL 4UT9H 3F7YB 1V7NL 5AG9A 3A6BH 4XBGA 2CKBB 5BVJA 1G6VK 4PGZA 4YHOL 4ZPVA 4F2MB 5KSBB 3G6JE 2F54A 1T83C 3VRJA 3F6LA 1S3KH 4ZDHB 4GAJL 5I1HH 3VG0H 3PXHA 1CLOH 3JWOC 4HXAL 1YMMB 4Q0XL 1U8IB 5KZCB 2H6PA 5F6HJ 5CBAB 4HS8H 2Y07H 3DI2B 4WY7H 4MA1B 4MAYA 4YFLF 5I18L 1JBJA 2J8UA 3ZSTA 1KG0A 1CGUA 1FAIL 4PRIE 4X5XA 3MLWL 3SKJH 3ARDD 1DUYA 3KPSD 3RI5K 3C2SA 4HT1L 3R1GL 4GRWE 2COQA 3VD5A 3KR3H 3B8YA 3ZKNC 4JFEB 4J1UB 4L3CA 2Y5TB 4UV7H 2A83B 4C4KT 3VXSE 1NFDF 1FFOA 3QDAA 3ARRA 4YBQD 4JFOB 4F15B 3PWPE 5FM5M 2XQBH 1S7QB 3LHPL 3HZYB 3SDYL 2WUCH 2GK0B 2VB5A 5DMKA 5LWYH 4JZJA 3FMGL 4JKLA 4G8IA 4XP1H 4OD3H 5HI5D 1A3RH 3OWEA 3V0VA 4BYHA 1A7BA 3QNYB 2WBWB 5HHOB 4QRQA 1AXIB 1DVFA 2EDDA 4YO0A 4F7CA 2FR4A 4BK5A 4HUXB 2DI8A 1IC7L 4IRSA 3SGJA 1KEML 5EOCH 5A1AA 4NO3B 5C2BL 3QDME 1V3KA 4JZJC 4RX4D 3HMXH 2OL3B 4YHZH 4I0PC 3B2VH 4UOJA 2X2YA 1K5NA 3QRGH 2FRGP 4JB9L 4HK0B 1Q9KA 3MBEA 3RVTC 1K4CA 4N8CH 1LD9B 1DVFC 3RNQA 3VMOA 3SGJC 1OTTD 2V6HA 1F4WH 1KUMA 3MGTB 5DD1L 2BVEA 5JHDB 1N6VA 5KSAB 5GRYA 4PJGA 3TFKD 1NKOA 2APTA 4FTVD 2ATKA 5E6ZA 1BD2D 5C08A 4NZTH 1DQJB 1IKNA 4OZIF 5IM7A 4Z0XB 3LS4H 4AZ8A 4Z7UE 3VRIA 3I02A 4ELKB 5FA3A 3V6OA 5FYJE 2BOBA 2NYYC 4R0LB 2BY3A 4LDEB 2GHWB 4ZSOB 3IS1X 1RU9L 5T33L 2VLJA 1FIEA 4GG6E 4N8VB 3ARQA 5A40E 3PJSA 3ECBA 4UBDD 4EI5B 2BVPB 3BMVA 1WBZA 4WO4C 5DVLA 2WM0A 3QULB 1G7IA 5BRZB 5TGBA 2WBJB 4XZUA 5JXEC 3O6FC 2Y72A 3T2QA 1QO3B 1IC5H 1IGJA 1X5JA 3L6FA 3MCLH 4AK1A 3VXMA 1CDJA 4WUUE 3GRWA 2JF1A 4P5MA 4M6NH 3SDDA 5GXBB 2WNGA 5DK3A 2HJKB 2JCCE 4RFEB 3AB0B 5C92A 3Q6FB 3JUZA 4O51B 2W65B 3BAEH 3ZDYE 3GSXB 4DKDC 4P5KB 1ZHNB 2P8PA 4PG9A 5DWUL 1AI1H 3P77B 1H8SA 1QKZL 5IKCA 3QR2A 3MLSL 3PNWA 2NY5H 1UXSB 4HX1A 4UILH 4RZCA 4MYWB 2BY0A 3LS5L 2X1PA 5GS2D 1IZKA 4Z7VB 5DT1L 5IEHB 5TH2A 4LFHD 4LHUA 3TN0D 2NW3A 4MD5A 5DD0L 3PXJA 3U36A 4XNYH 2GI7A 4XXDA 1DLHA 1RIUH 1F02I 3UZVB 4KHXL 2CRIA 3CVHH 2VIRB 2NX5D 1KBGL 3FQTB 5CGTA 3QCUL 4OCWL 3HN3A 4X5WB 4FZ8H 2DQTH 2FJGA 4K3EL 4RMVA 4WRLA 4GSDL 1PAMA 1WVZA 5GRVL 5FOJA 5E24E 1IM9A 2NW2B 4TVPE 3UTTD 1CL7L 5F9WB 2GTZB 5EN2A 5C86A 5C0EA 1DANU 1QNZH 4ENED 3FO1A 5MENA 4HJ0C 5FUOH 4L8BA 2OTWB 2D03L 1BM3L 5CGYC 3IJHB 1OGAA 4JFDE 1XGPB 2DQJL 1MFEH 1VGKA 2IPKB 4AL8L 4L3EB 5I1GL 1R0AH 3RWHB 4G9DB 2X4SB 3VXRD 1U6AL 25C8H 3CUPA 4JKKA 4QRPE 3U7WL 4G8GE 3ULVL 5CINH 1NCDH 2C4XA 5ID0B 4M3KB 1FYHB 2CK0H 4PRPA 1M6OA 2PXYC 3LEVL 3IKKA 3EAKA 2HWZH 3VCLB 1Q9WB 2FD6L 3GKWL 4JHAL 1NAMB 1P7KB 3WEXB 4DFIA 1R3JB 3MJ7B 3LMJH 4CNIA 2AAVA 5C0BA 4JY6A 3MOAH 1QSEA 3QDGB 5AUMB 3ARED 5EUKB 2V7NA 3L1OL 3THMH 2HH0H 1J5OH 2A38A 3KPOA 2IQAA 3VGBA 4NO5A 3ARPA 4UT6H 5D9SB 1YQ2A 1XF2B 1FGNH 2R1WA 4HUWB 4BKLA 3L3DA 1V5JA 1WIUA 1MF2H 3BUYA 3IU4L 1A6AA 3K8LA 2Z0BA 3KJ6H 1JGLH 1LO5B 3RUGF 3WIIH 1E6JL 5DUMH 1V3JA 5IVOA 1IAIL 2XWBB 4M7ZB 5E2VL 4KMTL 1T2QL 5ACZB 3GBMH 5IVZA 2BY2A 3HAEG 4AQ1B 2HT4C 5C07B 1C5BL 3ULSB 1FLRH 5FOBA 1K2DB 3FB6B 1K6QL 1M7IA 4K71C 4ZFZB 2IEPA 2P8MB 2QSCL 3RWCB 2V9TA 3CX5K 4NJAL 5FYLD 3GHBH 2RAMA 3F5WA 1NPUA 2E8YA 2AJYL 4LLDB 3U30C 4XPGH 3ZYZA 5CZVH 1FL6A 3BIKA 2Y9RT 5GGTH 5IGXH 4HIIA 1GVIA 4PJAA 4K3GA 4AM0B 2A9NH 2MPAH 2J8OA 5DJDB 1UZ6F 3GMRA 1XGUB 2AERT 5AZ2L 3KPRE 4GG8B 4MQTB 3DRTB 3ME0A 3P3YA 3VDAA 1SM3H 2R2CA 2XKNB 1JWUB 5CP3H 5D96B 1IGMH 3OZ9H 4RAVB 1G9NH 1IAOA 3TH2T 1J0KA 1D5XB 4OGAC 2IMNA 5ENWB 4LPCA 3TO2B 1ZHBB 3CFIC 2R9HC 3UXFA 2YXMA 4J3TA 4Y4FC 4R3SB 3MRCB 4U6VL 1T1XB 3TWCH 1EHLL 4UTAH 3QA3B 5IK3A 4Z7WE 4DN3H 3BH9B 4OZGF 1YEEH 5KVDH 3F6IA 2J8UF 4YBLC 4OFDA 1CU4H 2HFEA 5F1IA 5E8DL 5TQ0L 3MRHA 4MB3A 1PG7W 3RZWA 3UO1L 1V8HA 4N0YH 3OKMA 3LV3B 1KJ2A 4NP4L 1UM5L 2AEIT 5J9PA 3K46A 2AEQH 4HJJH 4X7CC 1J18A 3RWDB 3RDTB 4X9IA 3BPLB 3C5ZD 2R69L 5TE6H 3U1SH 3RJQB 3F7YA 1IM3A 4PRBA 3QUZB 1C1EH 2EO1A 2CKBA 5DYOB 3UTSB 4F2MA 3KAAA 5FKAB 5KSBA 5FYJU 3V4PL 3D6GA 3HB3D 4H5SB 3MRIB 1Q9OB 4G8FB 3RY5A 3C08H 4ZDHA 4EI6B 1YMMA 5CLTA 5DEFB 1U8IA 2FJFB 3TJHC 4DVRL 5CBAA 1YEHH 1S9WB 1SJEB 3NPSB 4CU7A 4OTXL 3BZDA 2XXMB 2BSTB 2R56L 1EDQA 1NCBH 1CZ8L 5CILL 5CJOL 5F7WC 5IW6B 4G6ML 1CLYL 3MJ9H 3C60C 1GRWA 2I5YH 2Y5TA 2A83A 2XYCA 1J1XH 2K7QA 4JGJA 2F5AH 4WFFD 4JFOA 3T0AA 3TH4T 3QQ9C 4Y19B 1I1AD 1S78C 1S7QA 4AENB 1QR4A 3HZYA 2F53D 4ZXBB 3U83A 2GK0A 5B39B 2XZCH 5J1TC 1OP5H 5I74C 2VZ3A 1ACYH 4DGYH 3QNYA 4K94C 1PQZB 5EIIB 4LAJH 4HF5H 5HHOA 2ZP0T 5AWNH 1T7YA 3HNVH 1JPSL 5F6IC 4HUXA 4ODVH 2WP3O 5HHPB 3VH8G 3UJTL 4NO3A 3V6ZB 1X7QB 3QAZC 4X99B 3CLFH 4OFYA 2OL3A 2LU4A 2JELH 4QTIH 1LE9B 1A7OL 4P4KB 4QOKD 3UTQB 3UJIL 4KDTA 4TNVF 4P59L 4HK0A 2AK1H 5ESAB 4PJEA 4KI5D 1LD9A 1YNTA 1UM4L 4NN5B 5IB2B 3AVEA 2J1KA 4CBPA 5EFIB 4JHWH 4M9PA 2JJVA 4L4VB 1MI5E 3C6LB 2NY3D 3MGTA 3MYZA 4XPFL 4RA3A 5JHDA 5KSAA 3ZKXB 4P2OC 3EOBB 5JHLH 1D5IL 2QL1A 4WCYL 5B38G 2C1OB 2IH3B 1DQJA 1H3UA 3QYCA 2W38A 4Q9BA 4L8CB 4ELKA 4PRHD 4XC3H 2O5YL 3O41B 5CWSA 2D7TL 1WTLA 3O2DA 4JKWA 4S1QL 3E8UL 5JMRA 3X11B 3G9VA 4LLYB 3MACH 5D6CA 2UWEE 4N8VA 4LKXA 4Z7OE 3WNKA 4EI5A 5DFTA 2BVPA 1D5BB 3R8BB 3T2NL 3LEXB 3PL6C 5B3JF 1HOCB 4N5EC 1B90A 5JR1H 3QULA 4PRAB 2YEZA 5BRZA 3BRDA 1T4KB 1RZIB 1TQCB 2AJVL 2Q76A 5I1EH 3LIZL 1JGVH 1KGCD 1S7RB 2BJML 1S7SB 2APBA 2W92A 1JZ6A 3TZVD 2VO5A 5FGCE 2YD6A 5EO0B 2GJ6B 4G5ZH 2ZKHH 2DKMA 2HJKA 4OLEA 4RFEA 4UT7L 1SY6H 1EHAA 3Q6FA 4J8RB 35C8H 3VE0B 3PGFH 2EH8L 3PABA 2OR9H 3NCJH 1ZEAL 4O51A 2W65A 4HG4K 3GSXA 1QRNE 5E94B 1ZHNA 2BNQB 3BSZL 4XCCH 2OXGA 3P77A 4P2RE 4DGIL 4YX2H 1HIMH 4PRID 1UXSA 1Q0YH 3DVIA 4UDUB 2VN7A 4LIQH 4Z7VA 5C9KA 4GAFB 2OI9C 3H3PH 5IEHA 4JN1L 1M7DA 4KROB 3TPKA 4XP5H 3VXSD 3ZE2F 1QLEH 1T5WB 4WI5A 3RY6A 2A0LD 3ZTNL 3PWPD 4F9PC 3DXAB 2HT2D 3KJ4C 4JO4H 3D2UD 5D7JD 4LVOC 2DBJA 3HPLB 3F7QA 3SDAB 4DKFH 2QQNL 1BEYH 4BZ2H 3P0VL 4L5FH 1G7HB 2EKSB 2V5SA 2VIRA 1NCCH 4HBQA 5CEXB 2ATPB 3DURB 3I6GB 4EKXA 5B8CA 1W72H 2OBGA 4XPHH 4FS0A 5E70A 3IDYB 4IRJB 4BSWB 5FECB 1RMFL 5KS9B 1ETZB 1T1YA 3QDMD 4BUHA 4M8QB 4ZPTB 1KSRA 4R2GB 1QBAA 5KOVC 2F8OA 5D1ZC 5B8CC 2GTZA 5DJCB 2NY2C 1DL7H 4NQCE 5GGSA 4LASH 1CGWA 3DO7B 2OTWA 5EIQA 3MRGB 3OXSB 4EIZC 3EYOA 4CVZB 5EZOH 3IJHA 3LPGA 4GQ9H 3QEHB 1J7VR 1ED3B 1XGPA 4OT1L 1EAJA 3UBXB 4L3EA 2OZ4H 5LQBL 1KN2L 1UH3A 2FL5B 3RWHA 4G9DA 1EGJA 1F2XK 5E2TH 1ORQB 3B9KB 4FMKA 4IIQB 4ZS7H 2YS4A 5ID0A 1ZVHA 4X9FA 5FYJD 4FQ2L 4HC1A 3VCLA 3RWGB 1Q9WA 3ULUE 1VEPA 1NAMA 1S5IL 3WEXA 4JREC 4P9MH 1FGVL 2X10A 3MJ7A 4W4OC 4AEEA 3PWVB 2O5ZH 1Q0XL 1YPZB 2A9MH 1YEFL 4H0GA 4ODUA 1C8PA 4XP9H 3PGCB 5AUMA 3QDGA 1OSPL 4XCEB 2QHRH 2ILLA 1GC1C 3N9GH 3M17A 4S1SH 4TSAH 3Q5OA 3MUZ1 3MUGA 4JO2H 1FORL 1XF2A 3ULVE 4KQ3H 3SE8L 4NDMB 1RZJL 4KC3B 4PJAF 4F37F 4WUUD 3GFUA 2E7HA 4FZEL 4KK9D 1LO5A 2DQCH 2HKFH 4QHMB 4DCQB 5J12C 1S9YA 5ACZA 5EO1B 2UZYB 3ROLB 1RULL 4X5LA 5C07A 5D1QC 3DUUB 2HJFB 3KLSA 4XH2B 1K2DA 3FB6A 5EIVA 4W68A 1TJIH 5JZ7C 1QD0A 4ZFZA 2P8MA 1D9KC 4N0RA 1NFDE 3RWCA 2H32B 5BMFH 1FDLL 3FRPG 3HE7C 3EYQC 4LLDA 5BOZG 3N1QC 4TQEL 4KVNL 2EDTA 5K9KA 4YDJA 2NPLX 1KV3A 4XP6L 4ZUVB 3RX8A 3EFDH 5D72L 1RUAH 3D69B 4AM0A 1CFSA 1LK3L 5DJDA 3C8HA 5KSVB 1RHFA 3QUMH 1N64H 4YWGH 5I8CB 1XGUA 3GI9H 1SJVA 3OXRB 2OCFD 4GG8A 1OP9A 3DRTA 5GS2H 1VGEL 4KY1L 2XKNA 1JWUA 3UPAA 3W0WE 5JW4Q 3CFCL 1GHFH 4RAVA 1RVFL 4LVNC 1H5BA 1D5XA 5D1XB 5KSBF 1ACZA 5ENWA 3TO2A 1ZHBA 4X7TB 2Y06L 3O11B 3B5TA 2J7LA 2P24B 3MRCA 2CR6A 1T1XA 2MCPH 4TVPD 3TIEA 3LRGA 3O4OC 1UH4A 3TV3L 3QA3A 4PJ8C 3BH9A 1LP9B 1H5BC 4FFWD 3UTOA 4HQQH 4GXUN 5GGVY 1PG7X 4MHHI 3MCKB 4JPVL 3ZL4H 5KVFH 4M7KH 1B2WH 3LV3A 2AJSL 3W9EB 4JFDD 2R0KL 5CJ8A 5T1KB 3BD5A 3FONB 3E3QC 1T21B 3QXWA 2YUXA 3FQUB 3RY4A 3RWDA 3RDTA 1KELL 2Q86A 1ES0B 1MVFA 1J1PL 2AJXL 1ZOXA 4YHPB 2DQHH 4QRPD 4G8GD 1JPTL 2VSCA 3BE1H 2XZQH 1GOGA 1OT2A 3QUZA 1RD6A 2PKDA 1CGVA 5DYOA 3UTSA 5HDQH 5FKAA 4BM7A 1U92A 4OFPA 1UYWL 3CFEB 4H5SA 3MRIA 1Q9OA 3ALWA 1A9BB 1CE6A 2ADFH 3DLQR 4EI6A 1N6QH 5SX4H 3HC3L 3QUKB 4ZOAA 2CDGA 5DEFA 2FJFA 2Q6WB 1FG2B 5IMLB 4LP5A 1S9WA 1SJEA 1JHLH 2FX7H 5FGBA 4ORZC 4PLNC 1HNGA 2BSTA 3MREB 4NM8L 1J8HB 1K3ZA 3RVVD 4GQPH 4D3CL 4PJHB 1NMBL 4WHYG 2D0FA 1ZTXH 2LAGB 3WNNA 5CIPA 4PJEF 3NIGF 1U3HC 4RMTA 1SJXA 4HK3J 3LOWA 1JF5A 4XNXL 4Y19A 5HGDB 1O7VA 2IALB 2IGFH 5EOCJ 5H94B 5IMKB 4AENA 4P46B 5B39A 1HZHL 5IB5A 1VERA 4NC2B 5HGAB 4NKMB 3WSQL 3S37L 5J13C 5EIIA 1PQZA 3RL2B 2GJJA 5HI3D 4OZHE 3BN3B 5DO2C 3EDKA 4HWUA 1RIHH 3HAEB 2DYPD 4XHJD 5HHPA 1RUMH 4NQXB 4W4NA 1X7QA 1KXQE 1OSZA 4X99A 2DDQH 1LE9A 4P4KA 1JGUH 1A4KB 5ESAA 4PB0H 3D87B 1C16B 5GRXG 2ZCLL 2F8VA 5IWLA 2DTML 2IH1A 4JO1L 2MCG1 3GJFB 4MMXC 5IB2A 5FYLH 3EJZC 5EFIA 3E2HC 3KPRD 4L4VA 1UM6H 3C6LA 5F93C 3Q1SH 1JV5B 4RDQF 5J56B 3VGDA 3STBA 3IRPX 2E9BA 4CW1B 2DKUA 2IPTL 4HIXH 2GYSA 5GGVH 3UPCA 3PHOB 2C1OA 3W5MA 2IH3A 3T0EE 1X4XA 3PQYE 4E41E 4MD0A 3EZ8A 4QRRE 4PB9H 3OR6B 4L8CA 5CSZA 4UQ3B 2X1WL 2DQIH 5E08L 4M7LL 2O5XL 4IRZH 3X11A 1XF5B 3VW3L 4J3WA 3MODL 5EU6E 3TNNB 4KRPD 4TVSa 2H2PD 5HI4C 3CDGB 2YWZA 4XCNB 5F7NC 1D5BA 3LEXA 1AR2A 4Z7VF 1UACL 4O2CB 2VSDA 4PRAA 3EJYC 3OKYA 1BZ7B 3CH8A 2X4NB 4JHBA 5DJAB 5SWQB 1RZIA 4ZFGH 1JNJA 4H88L 1S7RA 3A6OA 2WMPA 4Y5XB 1F8TL 3FO0L 1CXIA 1S7SA 3U7YH 4KUCD 3CMOL 1H0DB 2X89A 1OLZA 4NWUH 5EO0A 1BGXL 2DOCA 3ESUF 5H2BB 2J3SA 2GJ6A 2R4SL 5ISZB 1I4FB 3WHXA 3OHXB 1IGIH 2X1XR 3SEPA 3VE0A 4MJ4A 4NNPL 4KHTH 1FO0H 3GIVB 4K3JH 1L0XA 5E94A 1JNNH 5K93A 2BNQA 4QKXB 1FNGA 3TCXA 4LEOA 3NZHL 3VXOB 4ETQA 3RUGE 2L7UA 3FB5A 3RWIB 2PW1B 1NGPH 4UDUA 2EDLA 2VOTA 4PG2C 4X6DF 4JANB 3QP3A 4C55A 2KBGA 3O9WD 3LB6D 1CIDA 4ELMF 3P30L 1T5WA 4FFVD 3F12A 4XPAH 2V7HA 2F19H 3I50H 3CAFA 2NXYC 4PYHA 3HPLA 3SDAA 2CDEB 2R2HB 3DBXA 5I17B 2CKBL 3NA9H 3HG1E 5I2IB 1G7HA 5CEXA 3MNVB 4P48A 2AQ1A 2ATPA 1CDIA 2DIJA 3DURA 3I6GA 4JDTH 1PVHA 2VZVA 3WE6B 4OM0H 4OLYL 4P2QE 4TRPH 1UA6H 4IRJA 4BSWA 1SEQL 4LOUC 2D4FA 1XF1A 3QIUC 5KS9A 4C57C 1ETZA 1UCTA 3QUYC 4CJ0A 2BNRB 1UZ6E 3QWOB 5DFVC 4M8QA 4ZPTA 2HG5B 2I60L 5MHSE 5C0NC 4I3RL 4HMDA 4HH8A 5DJCA 4FABH 1Q72L 4WTZG 1D6EA 4LAQH 4RGNC 4LSTL 2YKLH 3M45A 2F54E 5GS0C 2W9EL 4R4FL 1MWAB 3OXSA 1OTSC 4CVZA 3VH8B 1A21A 2YRZA 1MI5D 3QEHA 1VFUA 1N7ML 1ED3A 2EXWD 3U0TB 2ARJQ 4LSVL 4YPGB 1DR9A 3KDMB 1YC7A 4MB4A 4BH8A 2FL5A 1OTUC 2ICEB 1IGFH 2J8UE 4KK5D 4M1DL 1P7QD 3GJEB 2NQCA 1F58L 2OLDA 3BDBA 3QO0B 5C7XH 4OGXH 3B9KA 4IIQA 5HHVL 4I3SH 5EWIL 3O6LH 4UU9B 5J1SC 3VGAC 1A6VH 4O58L 3RWGA 2AP2A 1KJ3H 1BP3B 3ARFD 2B0SL 3PWVA 1CXEA 3I3EA 2OL3L 4PREB 1YPZA 4IMLB 2HFTA 1X5YA 1CQYA 3GSQB 3PGCA 4G6JL 4G6KL 4XCEA 1RZFL 3FO9B 3EO0A 1AC0A 1ZLUH 3NVQA 1KCSH 1MQKH 1L4IA 4NDMA 3WLBB 3IYLW 1C5DB 1ZT4B 5F7LB 3L9RB 1AHWB 4HJGB 5AAWA 4Z78B 1QP1A 2VXTL 4YJZL 3WJLA 1WJ3A 4QHMA 4DCQA 4N0CC 5EO1A 1IT9H 3ROLA 1U2CA 4QT5B 3DUUA 4MNGB 1QEWB 2HJFA 5I6XB 1QRND 5DEGB 4XH2A 4KJYB 3K81A 1IL1B 4ZUWB 4DN4L 4P2RD 2H32A 2HYMA 1KIPB 5F96H 3WJLC 5DMGD 1FZOB 2ZPKH 2E9JA 4PJGE 2ZUQC 3IS0X 3QQ4B 1S3KL 4YZFF 5DA0B 5HYJB 5I8EB 1QQDB 1CLOL 4LCCA 2DQFA 3G6DL 4TPRH 5C08E 4ZUVA 5ESQB 3QJHB 4MAUL 3D69A 3HLAB 3V0WL 4HS8L 1U9KA 4XBEH 1EJOH 1JYWA 5IQ7L 5DR5L 5KSVA 3V6OE 1NGZB 3UBXI 3BFOA 5D93C 3RTQD 5IESH 5I8CA 1A6WH 3SKJL 1BFOB 3OXRA 5CZXD 2VLJE 4OFVA 4GRWH 4JFHE 2FEDC 4LCCC 1EK3A 3SE3A 3KR3L 2ZUSA 4HMEA 5L7XH 4CMMB 5D1XA 3BGFB 4DOHE 3VFMB 2H45A 4APQC 2NY7H 1OPGH 1E0OB 2P24A 4L1HA 2YWYA 2XQBL 4KZEL 3VXME 3SE3C 1WLHA 3UC0H 4EN3D 2WUCL 1LP9A 4NQCD 4CVUA 5LWYL 2C3VB 3GHEH 4Q97A 1QR1B 1OAYH 1QVOB 2QADB 1YYLL 1NC4D 1KYOJ 1VFBB 3QQ3A 4GFTB 2D0GA 3P4NB 2C4FT 3W9EA 5TF0A 4BZ1H 1MCCA 5D8JL 5ESVB 5T1KA 2NY1D 3FONA 1T21A 3FQUA 4P23D 3FT3A 1G6RB 4M93C 4YHPA 4DUVA 5IVXB 3QRGL 1FZJB 3HC4H 5CAYB 4K7PX 5B3JE 3HE6B 3CFEA 3CC5A 3ULUD 4ESKA 3VFPA 1IE5A 4UTBL 3TBYB 4XB7A 4U1GC 1F4WL 4PRHB 1F45A 2JE8A 3QUKA 2Y5EA 2WUBH 5HD8D 5F1NB 2Q6WA 1FG2A 5IMLA 3BP6B 2P44B 3BP7B 2NZ9C 5HGHB 4P9HL 5I1DB 3LN5B 4LSUL 2RR3A 4NZTL 3TVMC 1J8HA 4TTDC 5CD5D 4F7MB 4Y1AE 3KPPB 4LKCA 2VDKH 3TIDB 2JJTC 1CWVA 5FYJH 4PJHA 3ULVD 1YEIL 5ITFA 1DSFH 1G0DA 1PEZA 1EGJL 1QLRB 4BFGA 3L3HA 1MCOH 2Z8SA 5HGDA 2XQYK 4IMKA 3E1F1 4DW2L 4PBVC 2IG2L 5H94A 5IMKA 4MQ7B 5KAQF 2BSSB 4P46A 4RFOH 4B7IA 4HC1L 5HGAA 5FDWB 5MENE 1ADQA 1NAML 4NBZB 4M5ZH 3NIFF 2Z31B 5HHXH 1JYNA 4C58B 2AK4A 3EOAB 4XB8A 3QHFH 1OGAE 2XG4A 3HAEA 4MJ6B 4PGJA 1MOEA 5INDB 2Y6SD 5E8PB 2EKJA 3GSUA 4O5LH 1FBIH 5DZNA 3KYNA 2GSGA 3BAEL 3DARA 5DUPH 3BVNB 5C70A 1C16A 3SCMC 3VWKC 4PRPE 4ODTL 3H7BB 1JPFB 4GBXA 4MJ5B 3GJFA 4XWGH 5EC2B 1HILB 3QT2A 1PZ5B 4HBCL 3SPVB 5HVWA 3W0WD 5I0ZA 2IMMA 1JV5A 1AKJB 5C0BE 4M1GH 1BOYA 4TOYL 4CW1A 1OP3H 2VC2H 1QSEE 4XNZB 1SMOA 5IJVB 2ZWLT 3EW3B 4GBXC 4X7SH 1ZKAA 2X1QA 3OR6A 3W11D 4LVHB 4UQ3A 4WV1C 1VEOA 1XFPA 5LKNA 3FHAA 3BQUB 3O45A 3QDMB 5DJZB 1IKFH 2YBRB 1I3GL 1FJ1A 2XTJC 4I9WE 5GIRA 3TNNA 5TJWK 4KGLA 3CDGA 4XCNA 1RJLA 5IJKA 1NMAL 1K4DB 4O2CA 4GW4B 1BZ7A 2FCBA 5SWQA 2KUTA 3WO4B 5DD3H 4TVPH 3OJMB 5J3HC 2EDFA 4Y5XA 2AABL 1O0VA 3QCTL 1H0DA 1KIRB 2DL9A 5H2BA 1JZ4A 2OJZL 4P3DB 5ISZA 3ZE1F 1S7WA 1I4FA 4PR5B 1CR9H 4GKZA 1KFAL 2Q1EA 1A6PA 4U1HB 2JJWA 3CLEL 3GIVA 4ZAKB 5HYFA 1MFEL 5FAAA 4PJAE 4U4BA 1OCWH 1R0AL 3MFFB 32C2B 1NMCB 1C7SA 3VXOA 4MNHB 2R29H 5KS9F 4S1DC 3RWEB 2EDHA 2XTLA 1FZKB 3RWIA 1NLDL 4J4PA 4CAGA 1NCDL 1CK0H 2NR6D 4PP1D 1UWGH 3EYVB 4G6AC 4UMGA 3RGVB 3WD5H 4YHML 1RZKH 4JANA 3QRFM 4EBQH 5J06A 2HWZL 5LBSL 4GW1A 3BPNC 3DI3B 5DHVB 2FIRT 3LMJL 4OF6A 4CN6A 3RZCD 3C5SB 4J4PC 2R2HA 1JMXA 3MOAL 1MVUB 3QIBB 5I2IA 1MRDH 2HTLC 1T2JA 2HH0L 4LVEA 2EDRA 4UT6L 1MPAH 3QIWB 5DJXB 5KJRL 3VXUB 1FGNL 3BZEB 3B43A 3JTSB 3WE6A 1MF2L 3SGEH 4A6YH 4ONGH 3GM8A 5DUML 3HC0B 5KVMC 4YDLC 5F71A 4WDIA 2BNRA 4GW5B 3QWOA 4JVWA 4OGYH 12E8L 5IHUL 3D85B 2IANB 4CDGC 1P7HL 1NCWL 5TPWL 2Z8WC 1OAZL 3ZT6A 4GMSH 1U8NB 5KSBE 3OAYK 2YZ8A 4XCFH 1OP5K 1MWAA 3QXUA 4OFKA 3GHBL 4KTEH 3VH8A 5SX4I 2VABB 5EU5A 4TSBH 2QSQA 4YFEA 3K1DA 1YMME 3U0TA 5I73C 3KDMA 3VFVB 5CZVL 4OM1L 4CGTA 1RIVL 3H7LA 4KK8C 3GJEA 5EBLB 1F11B 3V8OA 3PQYD 4E41D 3DYOA 3WFZA 1NGWB 1E4WL 3QO0A 3UROR 3Q5TA 5K59F 4QRRD 2XZAH 4BSVB 1XCQB 2A9NL 1KLFA 3FN0L 4UU9A 4UAOB 3HNSH 3S98A 4Y2DD 2EYTA 1P4IH 3V4VH 1NGYB 2UY6A 3EHBD 5EU6D 2FGWL 2UY7A 3I3DA 7FABH 4MQXD 1IGML 4PREA 3OZ9L 4P2YA 1G9NL 4IMLA 5IB4B 4U7KA 3QI9B 3GSQA 3O4LB 1LMKA 3FO9A 1I1YA 2YK1L 3AAZB 3L5WB 3SDCC 4K7PH 3S34L 5BV7H 1HQ4B 1ZANH 4UTAL 3WLBA 2E27L 1C5DA 3GDBA 5HHOE 3DMMB 3L9RA 1AHWA 4HJGA 4Z78A 3SOBL 2QQQA 3ARGA 4HD9A 4LPXA 4N0YL 5DK2B 4QT5A 2FYYB 4F7EB 4MNGA 1QEWA 3SGDH 3RBGA 4KJYA 4JY4B 3STZB 1IL1A 4ZUWA 4ZTOL 4LDLB 4PJEE 3MA9H 3NIGE 3TO4D 1AFVH 1KIPA 3U1SL 3LEYH 3ARGC 1IEAB 4OUUA 3VRLF 4LPVA 4AT6B 1C1EL 3F7PC 3FN3A 1FZOA 1IFHH 5I75B 1JI2A 4ZFOA 3MRBB 5E2UH 5JHDE 5FA4B 1LP9F 5IP4A 3QQ4A 3B2UD 3C08L 5HYJA 4YHLH 5I8EA 5D7KE 2V17L 5ESQA 5F7YC 3F58L 3QJHA 3HLAA 4HWEH 4KDWA 5A2FA 5EDXA 3KYMB 3HG1D 4KUZL 2B2XH 2Q7YB 4KRNA 3TT1H 4RWHA 2ITDB 1MJUH 2E9WA 1V7NH 3MJ9L 1G9MC 4P2QD 4CMMA 3FFCB 3VFMA 3SHSA 5HYEA 1CICB 3MRFB 2WP3T 4MD4B 5BRZE 1WEJL 3VA2C 3G08A 3DPBA 1X9QA 3UCRA 1XH3B 5MHSD 4Q0XH 3BH8B 3CZFA 4I13B 5DC0A 3LPFA 5E5RB 4LEXH 3ARUA 1E6OL 4PIRF 5FK9B 2C3VA 3V4UL 1PW3A 1QR1A 2F54D 5F7EL 1MNUL 1FAIH 4HDIA 1QVOA 3TH3T 3MLWH 1ONQB 4L3AA 3LKNB 4LLWB 4DGYL 5EUOF 1VFBA 4LF3B 3R1GH 1KB5H 3P4NA 1XMWA 4QNPE 4PJHF 2ED9A 1INQA 3EDJA 5ESVA 4K9EL 1N0XL 3MLXH 4XVJL 3AUVA 3IF1B 2DJ4A 1G6RA