4PJDF

Structure of human mr1-5-op-ru in complex with human mait c-c10 tcr
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
235
structure length
233
Chain Sequence
GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSPPGGTDTQYFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
total genus 55
structure length 233
sequence length 235
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjdF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjdF02
2E6PA 3G5VB 1H5BA 2G5BA 3O4OB 3DX9A 1SJHA 4ODXA 5EUOA 3QUZD 1KULA 1UYWL 4D3CH 2PUQT 1U8KB 4JQIL 2MKWA 4NFCA 1UGNA 4OQTA 1YJDC 5GJTL 5KSUA 2F74A 3V7MA 5EOCH 5M95B 2XTJE 3IU3A 2NYYC 4QWWC 2H26B 1GZPA 4GXUM 4XNYL 3PDDA 4KMLB 1LO4L 2G2RB 2JB6A 3AY4A 3SY0B 3MV8E 3QNZB 4F33A 2A6DA 3ZL4L 1LE9B 5A16B 2NPLX 5HDBE 3GJFA 3O8XA 3SE3C 4PTTA 5KW9H 1CL7L 4Y8DC 2NNAB 5GGSA 4OKVB 4P99A 3TBVA 5JQHC 1J9CT 3P11H 5K9JH 4OZGB 1FYTA 4F7MB 4N9OB 3O6FA 3TBYB 4RNRA 1I3VA 3RVVD 2OSLB 3RAJH 4BZ1L 3LS5L 1YN7B 3KPOB 4M7ZC 2F53E 1XIWD 1NFDE 1SYVB 2R9HC 3GMQA 4YBQD 3GZKA 3QXUA 1IKFL 4G9FB 4HIJA 2YZ1A 1EHLL 5DYOA 2HKFL 2JTDA 4ZQKB 1J8KA 3TZVB 3LKRB 5KVGH 1TVHB 5TFSL 1U8PA 3TZVD 5DJDA 1M7DA 2GJZB 3LN4B 5HVFB 1CGTA 1AKJD 4JGMA 1TTFA 1IKFH 4MJIA 2GTZB 1ZLUK 1NCUA 3OXSA 5J1TC 3ES6A 3MCKA 1XAUA 1FCCA 3LS5H 5DHYB 4JY4B 3TWCL 5JW4Q 3PWUA 2IFFL 1OAXH 4S2SB 3VFMA 4M9OA 3B9VA 2W0FB 3LPGA 3PHQB 4HFWB 4LSTL 4N8VA 4MS8C 2LQRA 4EI5B 3P11L 2R2HB 3P9LB 3KYMB 3DVNB 4HKXB 4RA0C 1RMFL 4CGTA 5FYLL 1HEZB 3C5SA 1NKRA 1LO4H 4L29B 5DS8B 1DLFL 1R3LA 3U6RA 1IT9L 1DDHA 3N1GC 5EOCL 3UROR 3T2NL 4X5WA 1TVBB 4S1RL 2VDLH 3KJ4C 3V6FA 3BPNB 1MIEH 3WNPA 4KJYA 5IV2A 3G5ZB 3FO0L 2YWYA 3E6HA 2SEBB 4KU1A 4HIHA 3T0EA 2FH6A 3WCYA 4AENA 3VDCA 1ONQB 1IFHL 1HYSD 3QUZB 2YPKB 4OZFA 3C5ZC 4F2MA 2KL6A 1HI6B 4QLRA 1QRNE 3LVEA 4MA7H 5CBAA 3Q6FB 1O5DT 4RBPH 3CSBA 3ARYA 2B7DT 1KLGA 1MLCB 3V6ZB 5FF6B 2K9UA 3QH3A 4S11A 1LO3L 4WRLA 1NFKA 5GGUA 1Q9LB 1FO0H 3S34L 1D5BA 1Z3GL 2Z91B 3OGCB 5IHZA 5IMOB 4ZUSA 5EH1A 5HHNB 3U83A 1WCQA 3TN0C 1A6WH 5D2LB 1Y6NR 2M8XA 1MCCA 2C4FT 4KPHH 4Z7VA 1AQDB 4G9FD 1AGBA 1WBXA 4NQDD 4OLVH 4LCYB 3QXTA 4PR5A 4HS6B 4NQDB 1WWBX 2JELH 1BF2A 1DUZB 4R3SB 1S9WB 4BH8A 2CUHA 1FL6B 2NTFA 4M7ZB 1JWMB 3QDMB 3EYFA 1INEH 2IF7A 4YFEA 3N06B 5L6YL 3O3BB 2AEPH 3HNTH 2APWA 5GGQH 1AO7D 5MEOB 2X1XR 3ARZA 4WFGE 5EWIL 25C8H 5JA8B 1T04A 3MNZB 2NLJA 1DL7H 3SDXF 5JXEA 4Z9KB 1WFOA 1WTLA 1R3IL 4XXCC 4YHML 1CFSB 2X4RA 3WKML 3CU7A 4J3WA 5KANI 4ODUB 1MHCB 4LNRA 3GSWB 3U4BH 5HXMA 5BVPH 3SJVB 1WVZA 2WINB 2ID5A 3ULVE 1AQKL 4P9ML 4K2UL 2J4WH 5GS0H 4XH2B 5DJ0A 4AL8L 1BD2B 2LV4A 3SOBL 3ARFC 3QZWA 2IG2L 3B2VL 2MQ3A 2Y25A 2IPKB 4X9FA 4Y1AE 3TVMA 4YHYB 5CILH 2Y23A 1MY5A 4I5BB 2VKXA 3KNBA 3MRJA 4ZFOB 4U49A 4KK5D 1PYWA 4UT7L 1I85C 4Y88A 3T3MF 5GSRA 1A5FH 3D3VD 3S8WA 5A3ID 4AK1A 2VABA 1AR2A 4XNMB 3DXAE 2R4RH 4JREC 1K3ZA 4ZD3L 4HC1A 4OCSH 1XZ0B 3QDME 4QNPF 3CC5A 5D1XC 3IAGC 5IBTH 4GH7B 4NO2A 2CPCA 1MAJA 4NQTA 2EXYD 3MLPA 1KPRA 1MCJA 1U8QB 4M48L 1YEHL 5BVJA 1BHGA 4XI5C 2EC8A 4FQQA 4RIRA 2ADJA 1KTLA 1TZHB 4MLSA 5HDQL 4QY8A 3UTZA 1D9KD 1B0RA 1T66C 3BW9A 4HKJB 3UC0H 5L2JA 2A6IA 4JPIA 4XX1G 1ZEAL 2ENSA 3VFTA 1IQDA 2NY5C 3F5WA 5JHLH 1ZHBB 3R06B 3ZKND 4JFOB 1N6VA 2A38A 5D1XA 2IBBA 3V0VA 4U1MB 3VWJB 3K4DA 2EEDA 3MGOA 3EYQC 1CCZA 5EU7C 2R1WB 3MJ8A 1I85A 2YKLL 4MJ5A 1KJ2A 1X5XA 2DKMA 3IDJB 2D7TL 2NY4B 1CGSL 5C0DA 4PYGA 4Y5VA 1T89C 2BZDA 3HMXH 4H0HB 2P7TB 5BCAA 5E2WH 4YUEH 1CLCA 3FB7B 3HR6A 1YECH 2YEZA 4JFQA 2P8PA 4Q9BA 4M48H 3P9LA 4LIQL 1CF8L 1FPTL 1RU9L 1P7KA 4JANB 4LCIH 2PW2A 2ESVB 5C71A 4MJID 1YEIH 2EYSA 1P4LB 4JPWH 3RPIB 1BVLB 3UZEA 1U8LB 3OF6D 3DX8A 4BZ2L 1DN0B 1N59B 2BVOB 5F72S 4I1NB 3W0WE 3AAZB 5DRNB 1YY8A 1CFQB 4Y4KA 1NPUA 3NABL 1U8PB 3LQAC 4IOIA 1HH9A 4PV8A 3IDUA 3X3GH 4UT7H 4P5KB 4NIKB 1BQLL 2ZCLH 3MSPA 3MBEA 3O4LA 5HGBA 1QFHA 4P9HL 1WC7A 3TT1L 3KPQA 4UBDD 5JNYB 3RWHB 5JXED 5E1AA 3WIHH 4H26B 1OGTA 3SOBH 2FYYA 2NX5D 3FJTA 3V0VB 1F11A 4HPOL 3BE1L 4YXHH 2J8HA 1SY6A 5I1LA 3OKDB 3EFDL 3S4SB 2NY3D 3FONB 3J8F7 1BZQK 2WQ8A 5E5MA 1HWHB 4QRTA 2BSRA 3TN0A 4LBEB 1QACA 3KWWA 2DQDL 4P5TB 4F33B 3LKPB 3KPLB 3KPMB 5CINL 5I1AA 3CFJA 1S7UB 3QPQC 3UAJD 4N9GB 3DUUA 4NRZA 2UY7A 4HUUB 3LQAL 1HHHB 4IDJL 5GZOD 3GBNL 5T1LD 4JPKL 4WI6A 2EIDA 4G43B 4YHKL 4X7FC 3DUUB 4NRZB 3O9WA 2AJSH 5FUCC 5L6YH 5C0BB 2VUOA 2BC4B 1KELL 2BC4A 3C8DA 5IB3B 4RFEA 4YX2L 3VG0H 4Y5XB 3C5ZA 3T04D 4PJHB 1QR1A 1XZ0A 4OFIA 1LDSA 2E9IA 4NHUA 4OLVL 3U7YH 1QLRB 4K3HA 1ZVHA 5ADPL 1GAFH 1VESA 3FONA 1NGYB 4HMCA 4HIIB 2E3VA 3GI9H 4C54A 3Q6GH 1BAFL 3MA7A 4NNPL 1F02I 5I8EA 5I1KH 1OGTB 3IDNB 2FO4B 2AJVH 3LKNB 1UB5A 1W0WB 5JW5A 4XWOD 4FFZH 3L5WA 1AI1H 1JN6B 3C60D 3O3EB 5DJ6B 3S34H 1Z5LB 3X12B 1VEPA 4HUWB 3BDYH 3VXMB 4LF3A 5HGBB 1FV1A 1DLHA 4JCLA 2AJYL 1FFNB 4AQ1B 1NFDA 3QISA 3ZKMC 4XH2A 1ES0B 3TT3H 3ESVF 5DSCB 1JNHA 1JRHL 2VWEE 3BD3A 3CSYB 5EO0B 1XR8B 4H88H 2BVQA 4XWOC 2V9QA 3FN3A 4P4RB 4RDQG 2OMNA 4P2OA 1AXSB 4JM4H 4K94H 4KQ4H 3MLWH 4NQCE 4NZUH 3HNSL 4O51A 4XP9H 4M3JA 2QADD 4WW2F 3OPZH 2W92A 3BSZH 2BSTA 4I0PD 4LLDB 4CU6A 3B9DA 4XP5H 1E27A 4XXDA 4K71B 4JM2D 1NC4B 2RJMA 4LCWB 4Y5YA 2VDPL 1G7HA 4OFYA 3VRLE 1PKOA 5FAAA 3MRIA 3E8UH 4Y5VB 1P69B 3KLAA 1NAML 1NDMA 4R3SA 2D9QB 4FFVC 5HYIA 3K0WA 4D0DB 1FIGL 3KDMB 5FUZL 1LO2H 4OFKA 1SJVA 4FXGB 1F4YH 1FJ1B 1FGNH 3WKNA 5T3XL 5DD1H 1A7PL 2FCBA 4OCLC 4J12A 2RGSA 2NY1B 4P57A 1DQJB 1NGXA 3ELAT 1HILB 3MODH 5I17B 4WWKD 1XIWC 1X4XA 1ZOXA 2YA0A 5F9DC 4DGVL 4LSTH 3RY5A 3S6CA 3CXDH 2GJ6B 2I24N 3WHXB 3G5YB 1IMHC 1SM3H 3K8KA 4A6YB 3LDBC 4XNUL 3PHOA 4JFXA 3CVIL 4MAUL 5FV1L 2A6IB 5FUCE 4Y0GA 1ZGLP 5C0ND 4PJDF 4L5FH 1NCCH 5E24E 1TZGL 5F7DA 5DT1L 3ZDZE 3HHRB 4FXGA 3O2WL 3GJFK 3QFDA 2QQLH 3FZUC 3HAEA 3U46B 1P84K 3MRCA 3ROLA 3BGMB 5HYJD 3EW3B 5I6XB 5J56B 3OB8A 5EUKA 1HHIB 3MOAL 1NCNA 3B9KA 2VN4A 1SHMA 2EXWD 1C12A 4CDGC 4NN5B 1A6AA 5KSBF 3LHPH 1NSNH 3HZKA 5D9SA 4P2OB 1F6LL 2F5AH 5H94A 3MQIA 1CDJA 4Y2DA 3U7AA 1A1NA 4WUKL 4ZO8A 3JUYA 4AY0A 4OD3L 3QZWB 1GH7A 1CXEA 2E8ZA 2JCCB 4PJAA 1GGCH 4MA1C 4U1NA 4UUJA 3U36B 3D48R 2Q7YB 3MJ9L 3ZE2E 2D3VA 3OBAA 3LPWA 3MUGB 4UIKL 4K7FA 4L8SB 2G75B 1S9XB 2FX8L 5J13B 3QQ4B 4JHAH 4NM8L 4OF8A 1ZA6B 4MSWB 5DHVB 4HWEH 1NMCB 1MY7A 4X6DB 1NCAH 4PRAB 4K3DL 1KYOK 4J2XA 1F00I 1R5VA 3HUJE 3BXNB 4JG0L 4LSDA 3MOBL 1L0XA 4HJ0C 5H37G 2BSED 4NKOB 1FRGL 2EDRA 4Z7OE 3AS2A 1G7LB 1K9TA 4WWKB 3ALXA 1RJLB 4MXVF 4F7MA 1L0YA 2X70A 3QUKB 3BO8A 1KCSH 4M93B 2PCPA 4JE4B 4LCWE 5E8PA 3RUGF 3WFEL 5J7CC 1C08B 5ID0B 4MAYB 1PX3A 4PJ7B 5IJVA 3FQWB 1T0MA 2WK2A 2YD4A 4MAYD 1NCWL 3CK0H 3L7EB 5F7YC 5A16A 2FWOB 1D5XA 5FCSH 1J1XH 4LVOC 4B41A 1ZA3A 4Y7MA 1B90A 3QPXL 5D1ZB 3OKDA 2WQRA 4EOWH 2DDQH 4X7EC 5F7UA 1CXFA 3BO8B 1IGFH 1GYAA 4XZUB 1BFSA 4RGOL 5TE4H 4LKCB 1A6VL 1OAYH 3DX9B 3MLUL 4KXZH 1AR1D 3Q6FA 4GAGH 5GS3A 5F6IB 4HZLB 5C07A 4RFNC 4KK9C 3MJGX 2Z0BA 4HLJA 1QEWB 5F9JA 4QHUB 1QQDA 5D7LE 4L9DA 2EE6A 4JHWH 4JVUA 4S1QH 4YPGB 5GRJH 5I6XC 4WIQA 4ERSH 5LQBL 3RNKA 3WN5C 1NCBH 4WCYH 3RIAF 2FB4L 3E6HB 2A83A 2C1OB 1YNKH 1VGKB 1GC1L 2J2ZA 1BLNB 4WENB 4OGXH 4BFEA 4NQVB 4EDWH 1XMWA 5TH2A 1JHLH 4ZAKA 5D7SL 5JW4R 5CSZA 5ACZB 1YMME 2P8MA 3JV4A 1ADQH 4RZCB 3WJJA 1V7ML 3P4NA 1AY1L 3STZA 1HQ4B 4M6OL 4RZCA 2R0KL 1R3HB 3AFLA 2FGZA 4H5SB 3RTQB 5C86A 2VDRH 4WTZG 5AD0B 2FBJL 3HPLB 1VACA 2WUCH 3AVEA 4LRIC 4EIZC 1QTYT 3VWKA 4JREB 2WBJA 4JR9H 1FVCB 4JKKA 4L4TD 3HB3D 4MNGA 4P59H 1ODAA 3QQ3B 4UT9H 2DI9A 5IROC 1ORSB 1S7RB 3S35H 3RZWA 1YYLH 1N5YH 2H9GB 4RWYH 2XKUA 1CG9B 4M62H 1U58A 2A0LD 4RDQF 3O2VL 5KOMC 4KK9D 2WAHA 1HH6B 4KK8D 3TNMA 4LFHG 5CGYD 4JZJC 3WNLA 4DUVA 4BUHA 4GMSL 2KUTA 2O5ZL 2DLFL 3GRWA 3PP4H 3BT2H 4NWTL 5TQ2L 1G7JB 1WEJL 2X4SA 4OB5H 3G6JA 1I7RA 5D1ZD 2HJLB 3IJYA 3W11D 1LDPL 4XHJC 3ARWA 1WF5A 4GLRI 4X80L 2F54B 4QTHB 5C09D 1MVUB 5I15H 2AGJH 4HGKC 3UXFA 1NKOA 3QEGH 3EOBB 4GBXD 4LVOB 1KTDB 2BRRL 2R0ZH 4OV5A 4UB0H 2OR8A 1KFAH 5E6IC 4RMWA 3QEQD 3TLRA 2JJSC 1FJ1A 3MRKB 4Y16B 2OZ4L 1FH5H 4QGTA 3LSOA 3REWA 2P24B 4DEPB 2ZUWA 1QFUL 2C3GA 2C3WA 4TUOA 5H2BA 3CX5K 5GSVA 2R23B 1HSAB 2IALA 4G8GA 1IGYA 2JE8A 1TFHA 5FYKD 1UADC 3MV7A 2ZZUT 4M7JL 4O02L 2AJXL 1OAUH 3F7VB 5F9OL 1OCWL 3D85D 4ZUVA 5E8EA 1U8MB 4X6CA 1JHKL 1T66D 5CHNB 3HI1B 3TV3H 1BQHB 5IWLC 2R0ZL 1IBGL 4R2GD 1I3RB 4OD2A 3VFWA 3F7QA 4IRJC 4YEFA 1UZ8B 1EXUB 2HT4C 1NFDB 4DVBA 4XP1H 2ARJQ 4P3WA 4DFHA 4CVWA 4G6FD 3RBSA 4O58H 2NTFB 1HHJA 1WEJH 5HGDB 3BT2L 4NWTH 2VH5H 3RGVA 4N0UE 4F37K 3O45B 1NUDA 1TCRB 4JZNA 4L9LB 3FOMB 1K8DB 2GFBB 1JTOA 5CZKA 1AP2A 4D0BA 3S35L 5KVEH 1Q0YL 5A2LH 2CR3A 3GJEB 4PUBH 4YAQB 2K1MA 5IHZB 2ICES 4X9GA 1PKQA 1MFEH 1LE5B 4FN0A 2VLJA 4CMMB 2A74B 3RY6A 1LK3L 5DO2D 1SYSA 3REWB 1EFXA 4LPYA 3PWJB 4MB5A 2EDKA 1XGPB 1MLCA 4MJ6A 2CKNA 2F54D 5C09B 4N0FB 2HT2D 2UYLB 2VR5A 1MHEB 4XAKD 2V2TA 3VD7A 1H3GA 3BIBX 4M6OH 5M94B 5LCVH 1KTDA 3MLSH 3S98A 4NNXB 3WIIL 4LVEA 1V7MH 4X5XB 4PRBA 1UWXK 2NTSP 4E42A 3WDIA 4PTUA 2V5YA 5ERWA 1KXQE 4TVSa 2YK1H 1WAAE 2D0HA 4X5LA 2D7NA 2LU7A 2XPGB 4I48A 3S4SG 1DQJA 1NGXB 4JRYE 4KV5F 3WEXA 1H3PL 4RAHA 2ZOLA 3L95B 2FB4H 4M8QB 3V79C 4ZPVB 1JGUH 1WFNA 4EDXB 1K8IB 2ILLA 1HK6A 5ISZE 3X14B 2X9YA 4UV7H 3CFKB 2AERT 1A1MB 1ORQA 1AGDB 3N85H 2X7LB 4LQFL 1C7SA 3DXAA 1ZT7B 3UJJH 3TCLB 3KXFB 3OKEB 3QUYD 4XBGA 4Y4FD 1DFBH 4X6BB 4FQLH 1WGOA 3MRIB 3SGKA 4M9PA 3ILPA 2AK4D 4CKVX 2F15A 1NGWB 1ACYH 5D7IB 5DD3L 1CFVH 1OAYL 2XTLA 3PWLB 3EJYC 4ISVA 4WW1A 1WT5C 5JIPA 5SWQA 2BOBB 4WO4A 5T1KD 3QDMD 1J5OH 2OX5A 1Q72L 4EI5C 4ENED 4Q6IC 3UYRH 3VMOA 3OSKA 3HNVH 1NCTA 1A0QL 3D87B 2RCSL 4BUGA 1I7ZB 4IRJB 1CTNA 1MFDH 3BZFA 1TVHA 2B2XH 4PJ8B 2VLKE 4PGDB 3P9MA 4G3YH 2Q8AH 5JOPD 5C0BE 2C4XA 1FNSH 4I3RL 2EZ0D 1A7RH 3L3IA 4JKPL 4ZPVA 4KHXL 3QCVL 4IRSB 5KSAB 5I1JL 4L8CB 5HJ3B 5HY9A 2YMXH 3REVA 3KLHD 4CJ0A 4DKFL 2LU3A 4JZOB 5EB9A 5GXBB 5BO1L 3OKLB 3VXUA 3H42H 2X4QB 3I9GH 1QSED 1L7TL 4HIEA 3G6DH 4PLJC 2X09A 2A6DB 1I7UA 4FQPA 3P4MA 2P44B 4KVCH 1HHGA 1JYVA 2ADJB 3BN3B 4UIKH 1OD7A 5JW4N 3V5HA 3EYUH 4KMTL 5IVXB 1TZIA 1YMMB 1J8HD 4LQ1A 5EORH 4XVUD 3VJ6B 1CU4L 3GJEA 3KPLA 3TN0D 3RHWK 1NMBL 2DLTA 1QFOA 1T03L 4XRCA 4P2CG 2QTEA 1O7VA 4NZRH 5JZ7C 5ILTL 5D7IE 5KSBE 4A2MA 2J8UA 1U3YA 3BKCH 4JFEE 4LEXL 4CNIB 3HUJF 4GW1A 1QRNA 4L4JA 4W6WB 3C2AH 3KG5A 1T03H 1A9EA 2GYSA 1G6RL 4WU7B 1U41A 2PXYB 5BS0E 4OCWL 2AJZB 5C0AD 2YUXA 1G6VK 1UM4L 4GG6B 5EBLB 5H8DA 3BP6B 2XWBB 5HYSG 5I9QB 5FGRA 2H45A 1BOGB 2X4OA 4N68A 1NUGA 4UIMB 2QSQA 5C0AB 4HBCH 5IBUB 4QRRE 2DJSA 2B4CC 3V7AE 4GMTL 1MHEA 4OD2B 3HZYB 1CTOA 2CKBB 3NPSB 3O2WH 3FB6A 5FKPB 4POYA 5AYUL 2X4NB 2V9RA 4MDJA 2BVOA 3NCJH 4BQBA 1FVEB 1U8LA 4HIXH 2GJJA 1MSPA 2ORBL 1VFBA 5D2NB 1TIUA 3SDAC 5F1KC 5BO1H 2OQJB 2WWMD 2H6PB 4YEEA 2NY4D 2Z35A 3PWLA 4FZEL 1BFVH 1SM3L 1P7KB 1VDGA 1DBMH 2CRIA 3NCCB 5HHME 2XTJB 1N3NB 1U9KA 5F71A 3OG6B 2JCCA 4HCRA 4PJAB 4D0BB 1IGYB 3UPCA 5D1QB 3QWOA 1EGJH 5AZ2H 4JKPH 4JZNB 3LB6D 3OKNB 4IDLA 4DW2H 4AM0A 1T3FB 4I2XB 2DIAA 3OKMB 2B5IB 4MNGE 1O0VA 3IRZA 1N64H 2CRZA 5DD6A 3BQUA 2F5BL 2VXSL 2FX7H 2PN5A 5CEXA 1BQSA 2GY7B 1NGZA 3IKCB 1FBIL 3T0DA 3UYRL 5HHNA 3RVWD 5D93B 4JQVA 2CK0L 3OR7B 2VDPH 4NZTL 1GPOL 2E6JA 4NOBA 4JFOA 3K80A 2V5RA 3MV9D 1NBZB 1I1RA 4BYHA 5EU4B 5EU3B 3LIZL 3C6SB 4PRBB 3O3UN 1AXIB 5DJYA 3DRTB 2GJ6D 1AGFA 5DD3H 4PG2A 1QFWI 4G6AD 3MLWL 2XFXB 2GSIA 2I60H 3QNYA 3CFBB 1QRKA 5C0IA 2W91A 3QUMH 4RFNB 5D7IF 4G7YH 4UV7L 1S9YB 5I1GH 3KPSB 3TT3L 3VU2A 3I3EA 1GJIA 1KLUB 5CBEB 4HFUH 3JUZA 3DOSA 1M7IA 3W11C 1FL5B 3T0EB 2QQKL 4MNQB 1FNAA 5A3IC 4CMHB 4MNQD 4XP6L 3DURA 1QLEL 2YK1L 4L9LA 3LAFA 4K9EH 2A73A 4KVNH 4NNPH 1KGCE 3L3JA 3GI9L 5E8DH 3WIIH 5J0BA 4MGXA 4DGYL 3IFOA 4C83B 2IAND 2OJEA 5BZDB 5LCVL 3B9AA 5ADPH 1T21B 3ARDC 5SWSB 2XN9E 5E00A 4GKSB 4KHTL 3L5XH 3AB0C 5J12C 1OTUC 1CE1H 1AGEA 1UM6H 4KGJA 2HJLA 3IJYB 1N3NA 2ZG1A 3JSSA 4K3JH 4XCEA 4FQXB 3SE8L 4LSVL 2EDWA 4HDIB 1T4KA 2XIDA 3GGWB 3LQAH 3C60B 3O6MH 1MCWW 3NAAL 2XY1A 3V9FA 4X6CB 3GMRB 3VXOA 4WFGD 2VL5B 1VFUA 3NIFF 3O3DB 4X6CE 1KXVC 1KIPA 3RWGA 1G7QA 3K1KC 3V4PH 2JLLA 4WJ5B 5F7FA 2R56H 1JJUA 2AABL 1INQA 1OF2B 1P1ZB 1W8NA 4DFIA 1AC6A 2X1PA 4JRYB 3NCBB 5EBLA 5L0QC 2BY1A 1RIUL 1TMCB 1RZ7H 5ETUB 2FO4A 4NQDA 1BQUA 4XNXH 1IM9B 5MENA 3AROA 4XMLL 1RUMH 3GMNB 1P53A 4P9HH 1FYTB 1PG7W 1BQLH 2ZCLL 3FN0H 1G7MB 1NGYA 3X3GL 1QLRA 2FEEL 1AD0B 1I1AD 2X4PA 3LN5A 4LARL 2VLRE 4LSUL 4CN4A 3A6BH 3I50H 4NUGH 2BP3A 3V6BR 1MJUL 4LKXA 5IB2B 1PG7L 2C1OA 3QUKA 5C9JA 5HHVL 1DR9A 4ONOA 4J6RH 1R3JB 3IDGB 1A2YA 1FPTH 1OW0C 4OF3A 4C59B 2PR4H 5FO7A 1H5BB 2G5BB 2NY7L 5DR5H 3VGFA 1WFUA 2Q3AA 4YUEL 3HR5B 4PRIA 3ZKSD 3D9AL 4PRPD 1U58B 3JWOH 4IJ3C 4LVNB 1HWGB 4TYUA 3BRDA 1N2RA 5EG6C 1VADB 4PJEA 3GHEH 5TDNB 1IAMA 2DQJL 1F11B 3TF7C 3DIFA 3TPUA 4JRXD 4WW2C 2KH2B 4R4BB 1FVCA 4Z6AT 4NN6B 5H37H 4HEPG 5IB2A 5BS0B 1RUPL 5DC0A 4OZIE 4KKCD 2HRLA 2C1PA 5K9OB 4DVRL 4DKAA 4JO2H 4N5ED 1JNNH 3BP5B 2WLYA 3OJMB 3CFIC 1AH1A 1KUMA 4TSAH 1NANI 1KEGH 1XIWB 3I02A 3F7PC 3CJJA 5T3XE 1N5AA 4R8WH 4DZ8B 1HCVA 3CH1A 4CVUA 4ODSL 1A1NB 1FDLH 1YC7A 3SKOA 3UC0L 2I26N 3AAZA 5CSZB 1PKQE 4R0LB 3KYMA 3VFOB 1IC1A 3C8KA 1YEFH 1F8TL 4GAYB 4Y19E 4JG1L 4JFDA 4MMXC 3S37L 4PY7A 2NXYC 3TVMD 4QTIL 2ICCA 4M7LL 4K94C 3AMLA 4JFQB 1CD1A 3O6KH 5IFHL 1KLUA 2G9HB 5C6TH 4U1KB 4PJGB 3U9UB 4M61A 1FFPB 4TQEL 4ZD3H 1RIHH 3O4OC 5F97E 1A7NL 3RX8A 1S9XA 2VDRL 5CSBA 3BEWA 3MMEB 3QFDB 4G9FA 1RAMA 1EO7A 5ICZB 1A5FL 1BJ1H 2GIYA 2YD5A 3DVIA 5I18L 3DUHA 1HZHL 2XFXA 3QNYB 2FH8A 4M8QA 3VRIB 1IGIH 4WEBL 5JDJA 5D7SH 4X98B 1DBJH 4WDIB 5JOPE 1F97A 4JN2B 1AO7A 4LHUB 5DJ2A 2CMRL 5D8JL 4KTDL 5GS0L 4QRUB 1OSPH 3LEVL 4KKCC 1K3IA 2I07B 1Y0LB 3TH4T 2E27L 4DZBA 3HZKB 4DGIL 2JJTA 3U4BL 4P4KB 3QNZA 1GOFA 3U7WH 5IJVB 4S1DC 2XXCB 4ERSL 3GMOA 1C08A 3VD4A 5IT2L 4IIQB 1M4KA 3DURB 1R3IH 4I2XA 4PLJD 3UZQA 4LAJH 4N0YH 3BVNB 3SDXA 4FQQB 2CJUH 3U2SA 1KIQB 4PD4J 4F8QA 3JZ7A 2A1WL 2ESVE 1UXSB 3PWJA 4Y16D 1VEOA 1ZTXH 4NT6A 6FABH 4CMMA 1EVTC 1DUYA 2DQEH 2O5XH 3PP3H 2R2BB 1TNMA 2OBGA 4GBXA 3HNTL 2W9EL 4RGOH 3QDJE 3BRFA 3CCHA 5K9KB 3PWNA 4PJBF 5JORB 4GRLC 3PWPB 3ARPA 3RNQB 5IHBA 1W72B 2VABB 3T1FB 3NIDF 1DQLH 1ZGLB 3MRLA 2D2OA 3SDCA 4WWKC 4L8SA 3CK0L 5DJXB 1ZT1A 3VFNB 2EZ0C 5SWZA 3ARGA 3WFEH 5E56A 2Q7YA 4MAYC 3IF1B 3O2DH 5CUSL 4WY7L 2P1YA 3PGFH 5JUEL 2XWJB 2ERJB 1S9KC 1F4WH 3IF1A 2ADGA 5BQ7B 1QSEA 2AJZA 3N1QC 3VXNA 3SGJA 3E2HB 2APXA 5CJ8A 4JG0H 5HYSB 2DYPD 3QXWA 1CK0L 2PW1B 1T1WB 1A1OB 1QBAA 4HIIA 3NIDE 3ZLQC 3MV7B 1BFOA 4WTWA 1WZMA 4FQ2L 4R97B 2FX8H 4O2CA 5I74B 1X5HA 1CLZL 5GZOC 5FV2A 3RTQD 5EUKB 2P8LB 4FNLL 1FVDA 3DXAD 2HFGL 4RCAA 4KGLA 1J0KA 4ODVH 1PY4A 4QRRD 3HAEB 5DI8A 5I73C 2J1KA 4HUUA 4N9GA 1P7QA 3GO1H 2EO9A 4IIQA 1MF2H 4HS3B 1KYOJ 8FABB 3VXSB 2E6QA 3I6KA 1U92A 4GS7C 3IU4H 4GOSA 3QIUA 5FFLA 2ATPB 2VDKL 5INDA 2XQYG 3ZE2F 4MX7B 2H8PB 2XWBA 4WFFE 1T7YA 5T3ZD 3ARGB 5GGUB 4M4PA 3L3OA 3VFNA 2PO6A 2KZWA 3QJHB 2AJUL 3MOAH 5DUPH 2RHEA 2KZ1B 3TWCH 3VRIA 1FG2A 2JF1A 1CXKA 4LU5L 3RNQA 1AIFA 1FZKA 3V5KA 1QR1B 4F58H 5KVGL 1TZGH 1ORSA 5DFWH 4JPVL 3QIBB 4JO3L 3FL7A 3CVIH 4MAUH 3DUSB 2GTWB 3MV11 4HKZA 1ND0A 3AM8A 1HHGB 3CXDL 1LEIB 2ADIB 1I8IB 3VFPA 3VWJD 2DQGH 4NRYA 4YWGH 1NGWA 5E9DA 2P5EE 4QRTB 2XZQH 3RTQA 2VL4A 3ILPB 5T3ZH 1EA9C 4QRUA 1PDKA 1H8NA 5L8LB 4J23A 4F7PB 3W5NA 5EBMA 2W9LA 5DZOA 1A7PH 3SE4A 4OZHF 2YA2A 1ZLVH 5B8CC 5D7JC 3T08A 4OD1H 1Z0MA 5E99H 3X14A 4JHZA 1DVFC 5I1EL 2R1WA 5KANG 5GJTH 2ICWB 5F1IA 4UNTA 1WICA 4X6FB 3T4YA 2X89A 4LGSB 3L7FA 3OXSB 4OAWA 3O9WD 4Z78A 3AGVA 2MQ0A 2CUIA 4NUJB 1BD2D 2FX9H 2DJUA 3OAUL 4XBPA 5ICYA 3MR9A 5DYOB 5F6HI 5IOPA 4OI9A 5A2KH 4PGCA 4HHAA 2H1PH 3QFJB 5IB3A 2OTWA 2XZCL 2UWEE 1OP9A 1SYVA 1EBAA 3LCYA 4FFWC 4RIRB 2R69H 3O6FD 2BHYA 2AJYH 1UQSA 3D3VB 5E5RB 3CFCH 1XF2B 1JF6A 5EA0L 3CZJA 5EUOE 4GW5B 4M4RA 4R7DA 3IETA 4FFZL 1S7UA 3BPCA 4ELKA 5SV3A 1S8DA 3OKOA 3KPMA 3C8HA 3CUPB 3KPPA 3QEHB 4R26H 5EOTA 5IVXE 3HC4L 3U0PA 3TNNA 4EDXA 3KPSD 2VDQL 4NWUH 1BEYH 1MFAH 3BIAX 4R4BA 1PLGL 3QO1B 3MRMA 1CR9H 5FCUL 1IAIH 4XAKE 5ETUA 4OM1H 4DQOL 1TJHH 1HXYA 2DIBA 5HYQB 1SJXA 5HHOA 1ZMYA 1IEBB 5FXCH 1EH9A 2VR9A 2H2PD 1S7TB 3MNVB 4FQXC 4F37F 5F9WB 1BOYA 4YR6B 5BXFA 3LEYH 2D03L 2OL3L 3NVQA 4JAMB 1QPPA 3ARTA 5LVEA 4PJIE 3DX8B 1VSCA 3O4LD 5A2FA 5FDWB 4NKIL 4ORZC 2Y36H 1N0XL 3LY6A 3EFDH 4LKXB 4NHCL 2IBGA 4NHCH 4QKXB 4MA8L 4RRPA 4OZ4B 3MRPA 3CSGA 1DP0A 4PJDB 2IH1B 1XEDA 4EQ2A 3TJEH 4TTGA 4PJDE 1KG0B 3MBXH 4PJ5D 3HS0A 1BVKB 2DQUL 2ESVD 4UILH 2CSPA 1T21A 1MJJB 5EC1A 2D7MA 1DVFB 5HVHB 5CP7B 1INDH 3G6JF 4LPCA 3SDXE 1KJMB 4JDTL 1CZ8L 2A73B 4KRLB 1NEZG 1TJHL 4J1UA 5JIIA 1VFAA 4MQ7B 4ZODA 3OAZK 1C16A 2HLFD 4BZ2H 5C7XL 3HFML 3RWDA 3QQ9D 5IW3A 2DM4A 2K3TA 2R15A 3CFEA 3S9DB 2VDQH 1U8NB 1CQYA 5F1SA 5SWZB 2YPLE 2VMFA 3RU8L 4L4TE 4YBHA 5KSAD 1WZLA 35C8H 4R7NA 1MWAH 4XHJD 5CIPA 4U1SB 4NJ9H 2B39A 3FQXB 4YXKH 4HT1L 5F7HA 4LFHD 3H3BC 4XB8A 5CBAB 1CGSH 4U1SA 5KVDL 5JPNB 2PYFB 1RZIA 3CFCL 3PHOB 3ZDXF 1KCVH 2VDOL 4KK8C 3FB8A 1X5KA 1MQKL 1Q9OB 1CXHA 5H2BB 5C0NC 4R96B 4P5TD 3LSOB 1J88A 4Y1AA 3MRMB 4E41E 2PKDA 1MH5A 5T1LB 1N0LA 4AMKH 4CVXB 1QKZH 2HKHH 5DRWA 1FLRH 5I1IL 2DBLH 4Y4HA 2QHLA 1OM3L 3HE7C 5F70A 1KJMA 2VZ1A 3PXJA 1GHFL 5GSRB 4HUXA 1WBYA 3ULVC 1ZEAH 3U0WH 1MJJA 2R0WH 1BVKA 2DQFB 4TUJB 3OGCA 3O3AB 4HXAH 4Q9CA 3DO7B 2Y06H 4IBLT 1BGXL 1Q9KB 3I2CH 3JV4B 1OOAA 4X98A 1T20A 4PJDA 1G0XA 5E99L 2DRUA 5HGGS 3OJVC 3GFUA 1J0IA 3I6GB 5IMMA 1BLNA 2APBA 3G04B 4B5EA 1MPAL 2OXHA 3BPLC 1K4CB 4JM2C 4C56B 2YRPA 4HHAB 2CLZB 1T83C 1ZHLB 3PJSA 4OCSL 1CFSA 4C56D 1S3KH 1P9MC 4JAMA 4CVZA 1RK0B 2YD7A 4F9LA 4HUKB 3C6SA 1KB9J 3QWRD 5BRZD 4IEFB 4OAWB 4PJ9C 1A8JH 4G6KH 4IMKA 4KK6D 32C2A 4ZQKA 4AENB 2IFGA 4U6HA 2R1YB 1JGVH 1V3KA 1YJDL 5J4MA 2VAJA 2DD8L 5FYKU 4ZSOA 5CILL 2X9WA 4GAYA 5MEPA 2HTLC 3IFNL 4LSQH 4ONFH 4XWGH 1ADQA 1E4KC 3U6RB 2BY2A 4N5EC 1XH3B 1B4RA 3VD3A 3D0VA 5EBMB 2BNQB 3RKPA 5A43C 3MJ7A 3N1FC 5KG9B 2VLRA 4E0RB 3A67H 3FHQA 4UINL 2BNQE 4P46D 1KCKA 3L7EA 1LVEA 4PJHA 2QADC 5DZNA 3WKMH 5TH2B 4BA8A 3P0YH 4U1LB 4URTB 5E03A 5BV7H 1JPFA 2CGRH 4E41B 4HWZB 1D5BB 5L2KA 4GW5A 1VFBB 4HEME 5D2NA 3RX7A 2NX5E 4PYHA 4G43A 3X11B 5J6HB 5IK3B 4XBEL 3P3YA 3V6ZA 3QEQA 1UA6L 2G60L 1U2CA 1B6UA 1TVDA 1XT5A 3VE0B 1S5IL 1INEL 1M7DB 1MF2L 4NKOA 3MRFB 3IDIB 4Z7NF 2A9MH 1SJEB 5SWZE 1QEWA 3GSUB 5DMGC 1AFVL 3BMVA 4ODVL 4PRPB 3GSOB 1FORH 5DK2A 4FQCH 7FABL 3LN9A 2J12B 5FO7B 4R2GC 1ZA6A 4MSWA 2RFXA 2XI9A 4NN7C 2HVKB 3L6FA 1UWXH 1A6WL 1CLZH 1AHWB 1F3JA 2V2XA 2Y07H 3RWHA 2UWEF 1K85A 4OFDA 1WK0A 5FGBA 3EYOB 2DMKA 1Z2KA 4LCCA 2LU4A 3EJYD 1LE9A 1C5CH 3OB0H 4M5YL 4P2YA 3Q5TA 4KY1H 3T0ED 4YHLH 4PV8B 3P73B 3EDKA 4J4PD 2H26A 4PP1D 4D9RD 1XH3A 1OTTC 3D0LA 3X3FH 5E6YA 3V5HB 4QXUL 4UTBL 4YC2C 5I8OL 4QHNA 3LH2H 1UZ6F 4WO4D 5T1KA 4WY7H 5KSVA 2Y07L 4BK5A 1QHPA 3ESUF 4LPWA 3BH9B 4WO4B 5CJXA 4MNQE 4JFHE 2W65A 2PW2B 4P3CL 5KVFL 2X42A 1CFNA 1OQOA 3B9KB 1MLBB 2AKRA 5F44A 2CD0A 7FABH 3CXHJ 2AXGB 3QIBA 1I9RL 5JMOC 1D5ZB 4X6CF 2O61A 1XR9A 4U2ZA 5FO9A 4NZDA 4V1DD 3MLTA 1OP3H 2VDLL 5LG1A 3HAEG 1M71A 5EZOH 3V4VH 1RK0A 1T1WA 1UH3A 4X99A 1KJ2B 3F58L 4OCMC 5I1DB 2A2QT 3SBWC 4HIJB 4EI5D 2E7MA 4ENEC 2W9EH 3QHTC 5K9QI 2EIZB 4JVWA 4WI3A 1FN4B 3ZE1E 4HH9A 2O5XL 2DQEL 1RMFH 1WIUA 5IMMB 5D7JD 4W6XB 4GS7B 4MWFB 1AO7E 4Y19D 4PRHE 4YO0A 1CDYA 1GGYA 1V8HA 1DEDA 1T20B 2E9JA 3PWPE 4FTVA 3UTQA 1E0OB 1BWWA 4PGDA 2HTKD 4X7TB 1RZFL 1VHPA 1J0HA 2NW3B 3DETC 5E00B 1OAXL 4NQUA 1IRAY 3RGHA 3RFZC 2M1KA 1KN4L 4Z76A 1ZHBA 1HILA 2LTQB 2VWEC 4O2EA 3NBNA 1TJIH 2F58L 3D2UB 4Z7UA 5IB5B 5K93A 2I9TB 1R5IA 1F3DJ 2BOBA 3MV01 2UYLA 1P7QB 5TFSH 1KTLB 1YA5A 5KSUB 1F42A 3G6AB 5GRWA 4MJ6B 4L8DB 3QJFB 3RWIA 1QBLL 5J3HD 3N1MC 4Y1AB 1KGCD 5IFAH 1WAAF 4R4ND 2ICWI 1YJDH 2MJWA 1JGVL 3QQNA 4Y1AD 3QUXB 1NFIB 2P49B 2YPVH 4PJGF 4M6NH 3BHBB 3GI8H 4DAGL 3HE6D 2VLRD 3ZDZF 2X7LA 1UACL 4JKLA 5SWSE 4GUPB 5BOZG 1S3KL 4OCXL 5IQ7L 3WNMA 3FQTA 5C6TL 2GSIB 1A1OA 2Z31B 3O4LE 3KYAA 1MPAH 4PREB 2DJ4A 1A6ZA 1C5BL 5E4EC 1DTUA 3DVGA 3WXVH 4M7LH 2PO6B 1Y0LA 1QR4A 1EEQA 3NIGE 3P30L 2BVQB 4K23L 5C0GA 2PTTB 1JNLL 3PIQA 3W2DL 3WJLA 1OTUD 3M1BA 3ARBC 4OM0H 2ZJSH 3SDYH 4FXKB 3PWVA 1RJCA 3QIUB 4JQIH 4MA1B 3RL2B 2R0WL 2V2TB 2NY2C 4R8WL 3BPNC 2YXMA 1JNNL 3MRQB 2QSCH 3MA7B 2HKHL 2QEJA 1NL0H 1M71B 2A74A 4JO1H 2P5WB 3PWPA 4FTVE 3ZTJH 1S7SB 5DQJB 1OSZB 4EN3C 3NPZB 1GCFA 5TE7H 3BESR 4Z7QE 4WEMB 1S7SA 4PY7B 2Q20A 1X4YA 1EUTA 1RD6A 1JWMA 2OS7A 3QDMA 5ESVB 3O9WB 3BPOC 5FYJL 2OP4L 1RUKL 2UUDK 4QHNB 1JMZA 4U3CA 1EEZA 3WN5B 4DCQA 3JWOL 5F3BA 4P4RA 1A6PA 5I16A 3EYQD 3FRUA 1I8KB 1MWAL 1XR8A 4ZTPL 2DF3A 4FQHB 1YNLL 5EO1A 2DL9A 3QAZB 1SVZA 1FFNA 2HAZA 1TITA 1N6QH 3RZCD 3GMPB 5E6ID 1YDPA 5HHMD 1JI1A 1W8OA 1FZMA 3X12A 1ZLWK 2VISA 1C7TA 3OJDA 2PTTA 5FYKH 2X4TB 3IDXL 1XGRA 5DJXA 2MPAL 3K3QA 3JWOC 3R1GL 5GPRA 2YA1A 3BX7C 4JDTH 2HVKA 3L6FB 1NAMA 4GW1B 4P23B 3WMSA 3NN8B 3UDWA 5DWUH 4WI2A 1U8JB 3HG1D 3TO4A 2V9TA 1RUML 5FO8B 3QI9C 5HDBF 1WBZA 4YBLC 3TJEL 1SQ2N 2VLME 5HGAB 3LZFH 1S9VB 4K8RD 1T0PB 4PJFA 1LNUB 4I3SH 5DRNA 4P5MB 2K7PA 2P24A 4J3UA 2WWMC 4NOFA 3B43A 4NT6B 3WS3A 4ODBD 3PL6B 3QEQB 5ISZD 2H2SC 4AIXA 1FE8L 5C9JB 1E6JH 3PABB 4LPUA 2DLIA 1JZ4A 4NKIH 2W07A 3BZEB 1D9KA 4MXWL 1FZJB 4WGWB 4Y89A 4M6ML 5E7BA 4HV8A 2EC9U 4HIEB 3O6ML 3BEVB 4ODHH 4L29A 3STZB 3EFFA 3D0VB 4JQXA 2VXQL 2XKNA 4WGVB 2DAVA 4PJCE 1QA9B 4DJMA 1DBKL 3ZE0F 3KXFD 4R0LC 3TBSA 1C5DB 3QDGB 4PJFF 4OM1L 4DQOH 1I4FB 1EPFA 2CDGB 4Q9RL 5FCUH 4QHKI 4N8VB 1Q8MA 4KRNA 2A83B 2CLRA 3UYOD 4UOW0 1BEYL 1MFAL 3NH7L 4Y16C 3HC3H 5B4MC 3ES6B 3MCKB 5CD3A 4DGYH 4IMLA 1CG9A 1OVZA 4MJIB 3HC4H 5TDNA 3SO3B 5CLWA 2BNRA 1QLEH 2G9HA 3LKRA 5EOQL 1IQDB 5TE6H 5EU5A 5GRUH 3R4DA 1NC2A 2QQKH 1MEXL 1DCLA 5LGHL 1K4CA 4C56A 5DDHA 4YHIA 4ZO9A 4PJIA 2HT4D 3TPKA 4OZGE 1ITBB 3FRPG 2R69L 5INCB 3MV7D 1UVQA 2R2EB 4G7YL 3IVKB 5KTEL 4QF1B 4PGEA 1CDHA 2H1PL 2P7TA 2XKNB 43C9B 1RZKL 1AJ7L 2FX9L 2X4PB 3VH8B 3DXAB 3KS0J 5D96C 4ODWB 2I25N 4KRPC 3BOVA 1ZLSL 4KJQD 4PJ7A 1K8IA 1LHZA 4DN3H 5LGJA 5HI3D 4W4OC 3ZKQD 1GC1C 3RHWF 3IU3B 3MGOB 2FECL 4P46C 1AXTH 4RMUA 5E2TL 3TCXA 1J18A 2NY3B 2R4SL 3BFOA 3DV6A 4FQJL 4P23C 5DFVC 4JO4H 4Z7OF 1N64L 1GOGA 4MCZA 3FB8B 3T1WA 2DQTH 5GGVL 2JK5B 5JPMB 4EVNB 2DICA 1IGCL 5F9JB 1R5VB 3K1DA 4GKZA 1BD2A 1CN4A 1RZIB 3GBML 4R6UA 5E70A 4XVJL 5T3ZL 1YMMD 2XXMB 5F7LB 5C07E 2XZQL 4HZLA 2J6EH 3WS6C 3VGEA 1HNFA 1CVSC 3VE0A 4C58B 1EZVY 1A2YB 1RULH 4ODTH 4PD4K 4YWGL 1BF8A 4J3SA 2UVFA 3W9DA 2UWEA 2X4RB 3DGGA 3UEZA 4XZUA 3DRTA 5HHQA 2X1WL 3TYGH 3AUVA 4HDIA 1JE6A 5GZNC 4Y4FB 1DEEB 3D69A 4KJWC 1YEEL 1D5XB 5ICXB 2BNRE 3ZYZA 3GSNB 5DD0L 5KG9A 4E0RA 1I7TA 3M45A 4BM7A 1KPUA 5HI5D 1P4IL 3GSQA 2PCPB 1DUZA 4PJ5B 5GS0C 2NXZD 4U0QB 1JWUB 3B5HA 4XC1H 4ZFOA 4ORGB 3VXNB 4I0PC 1I1CA 1AQDA 5DUPL 5J8OA 2BRQA 2ZCHH 5LXGL 1F4XH 1X5YA 3C09C 4HQQL 3EYSH 3KAAA 4KDWA 5DGRA 5DLML 3TYFB 2IGFH 2QADB 3C2AL 5DA0B 3TZVC 4F9PC 3PNWA 3BKCL 3MO1A 5AYQA 3T3ME 5ILTH 1QBMH 1YQVH 3T0WA 2VDML 1GIGH 3QH3B 3VXOB 4AEEA 4ZFGH 5EIIA 1HNGA 4LCWD 4OCYH 1YEDA 1BVZA 1NMBH 1JWSB 2J8UF 3JVGC 5I73B 1F2XK 2NY5H 2VO5A 4KDTA 5C0IB 4YDJA 1MCLA 4HS8H 4LRNH 2ZCKL 5T5FH 4J3TA 3BKYL 3EGSB 1X9QA 5JTWA 3KLSA 1IEHA 1VERA 5BW7A 5DVKA 2WW8A 3OX8A 3G5YA 3VRJB 4KVCL 4I18C 3IFLH 2H32H 1VGEH 3WLBB 1LP9A 1U8IB 3EOAA 3TA3A 2HTLD 4Z7QF 2Q87A 1KT2A 3MLZH 3MV9B 4QOKD 4AEHL 1ZANH 4J4PC 5CAYB 4HGMA 4QOKB 5JXAH 2NW2B 3FFCD 3FB5B 5IVNA 2N4IA 1FL5A 4UMGA 1HEZA 1A7QL 3GRWL 4LK4A 5CBEA 4R96A 4NQCB 1K4DB 3B8YA 3CD4A 1A7RL 2W38A 5CUSH 1T22B 3ROLB 2DQCH 2Q8AL 4G3YL 2PYFA 4L8DA 1E27B 4H8WL 1M05B 1MAKA 5D72H 5D2LE 4PB0L 4O4YL 1NAKL 3QEUA 2W0FA 5MEQA 2MCPH 4YDJB 1MFCL 1AGCA 2ITDA 5E8OB 5DC4B 4PJIF 1HKLH 3P4MB 3SKUD 3V8CA 3RDTA 1S7VA 2XTJC 4ALAL 1IKNC 3LS4H 3MFFA 1JPTL 3MLRH 3WHXA 1U6AH 3KPRA 1U8NA 4XGZB 1MFCH 3L3DA 3VRLF 4FA8A 5ENWA 5GRYA 3IJHA 4X7TA 3GB7A 4KJWD 1ITCA 1S7XA 3RWCA 4R90H 1BZ7A 1YUHB 2CO7B 1OY3B 3BP6A 3NIFE 3V6FB 4FQLL 5JW5B 4G42A 5I1CL 1DFBL 4N0YL 4YHNB 2EIZA 3VFOA 3TBSB 4LQFH 1UXWB 4ELMA 5LJYH 5GHWH 2G5RA 3R8BB 1P6AB 2COQA 1JZ8A 5D1QD 5E9DE 2KDGA 5EPMB 4IRZL 3LEVH 1I7TB 1G7HB 2DTML 2CRYA 2H2PC 3LDBB 1A4JB 3KYOB 3ULSB 2VDNL 4JGUA 3MCLL 1CBVL 3NCYS 1DBJL 3FAXA 1VGEL 1GZPB 3V4UL 5FHAH 2VTFA 1ND0B 4O51B 4KI5D 3MRGA 3UX9B 3BKYH 3H3PL 3QWQB 4OCRL 3SKNA 2D0GA 3DHJA 4LRNL 5JOFA 1OAKL 1A7NH 2FIRT 2YXFA 4KZDH 4ZNEE 4KWUA 1G9EA 3O6KL 1EEYA 3T77B 4I18B 3SHSA 3H9ZA 3IDGA 3RZCC 2CDFB 2IGFL 2V17L 3CX2A 5DLMH 1F8TH 3TO2B 3TA3C 2IJ0C 5KSAA 3J7HA 1OWRM 5F8RC 1SY6H 1I9IH 3L3IB 3LOWA 5LXGH 4OSUH 4OLZL 4BQ8A 5DXWA 1A7BA 3O8XB 1EFXD 4NHUB 3QQ9C 2QLVB 3P9MB 4JFPA 3SGEI 3WIHA 3ARQA 4Z18A 1NFDF 1QYGH 1SVCP 4TSAL 3EZ8A 1KEGL 3THMH 4O58L 1LO0H 5IVXA 1UJ3C 1ZAGA 2DWEB 3UBXB 2R2EA 4XP1L 5T1MA 2VLJE 1PVHA 2EYTB 1HHHA 2DQHH 5GRZA 4WI8A 4U1GC 2VLJB 3SO5A 3BUYA 4JN1L 4LMQI 1MCIA 4WWID 3Q3GB 5M7QA 4X7SL 5DQJA 2O93L 3KHOA 3MJ7B 1OAUL 2YUVA 2GFBA 3CIQA 2J6EL 5C0DB 3OQ3B 3QUMB 3D9AH 4I0PA 4ZXBA 2VL5A 3VD5A 4RGMB 4APQD 4PJ7E 4MJ5B 5IP4A 2BHZA 3P2TA 2GAZA 1D6EA 1F45A 4POZD 1FNLA 3T65B 1G0DA 3VWJC 1IGCH 4OLYH 2PF6A 1RUQL 4RMQA 3HMXA 4XPFH 1CGXA 1U95A 3IS0X 2WIIB 4OI8A 1PG7H 1KJ2H 3ROOA 3TBTA 1K6QL 3OXRA 4APQC 4JEGB 4FP8H 4BSVA 4LARH 4P2QE 3BAEH 1KNOB 1EXUA 4WHCA 1WFTA 1KFAL 3V52H 3L3DB 4WI5A 4DN3L 4F15B 2W0KA 5L9DL 4MA3A 3W9EB 3T8XB 3QEGL 1PG7X 3SDCB 4TPRH 1B4JH 4Z0XB 1U8MA 1E4JA 5J06A 1D7FA 3SDCD 2H32A 2ADIA 4X80H 1RZKH 5IG7B 5MI0C 4N0FA 1R0AL 3WS6A 4EI6B 5JORA 2IQAB 4PLOB 3C60C 3IXTB 4GQ9H 5KTEH 3CCHB 5FECB 4UQ2B 1IQWL 5IB1B 4GMSH 4NO0B 5GSVB 3PV7A 3O3AA 4NC1C 3CLFL 3PGDB 3KXFA 1I1FA 3OKEA 4FQIL 3SCMC 1S9YA 3O2VH 1IM3B 4M62L 1AGDA 1MEXH 3IKKA 3AREC 4CMHC 4JFHD 1KBGL 2DTSA 4OLXH 5J89A 5D70H 4PJCA 5F7DB 1FG2B 1T7XA 4FQ1L 1KXTB 4XVTL 1EK3A 2IPTL 1QSFE 1S7QB 4O2FB 5DJYB 3SE8H 1N26A 1UFUA 2AEWA 1JTTA 1MCPL 1Z6JT 4FMFA 2DLEA 3R06A 3SDDB 1K5NA 2YBRB 2IWGA 4C55A 1DBKH 4Z7UF 4WUUA 3KS0H 1YMHB 2C9AA 5DK0B 2VQUA 2OI9B 1TZHA 2WM0A 2Y6SC 5C09A 5E8DL 1AR1C 3U30C 1T3FA 5GIRA 4XVTH 5IVOA 3ZSSA 1XGTB 2GAZB 5EBWB 4M6MH 4N0CC 4ZUVB 2MHAB 4OLXL 5DF0A 4EDWL 3D39A 3QULB 4U1KA 1XR9B 2AXJA 3K8LA 2V2WA 2VSCA 4LCWA 4Y5YB 3CLFH 4WCYL 4Y5XC 4O2CB 5FYLD 4JVPA 2BJMH 2NY0B 1H9VA 4FRWA 2PTVA 2W65B 5GRJL 5K59F 4NCDA 4S1QL 4PRHB 5CEYB 4RAUA 1T7VA 4YDLC 5GGRA 3ZDYF 3HPLA 1U91B 4ZYKB 4FG6C 3LKSB 4YZFE 4LGPB 5DWUL 4JQXC 2YPLD 3MLUH 3M8OL 5TJWK 2BY0A 5TE4L 2MPAH 1EHXA 4L8BA 3VXMA 4NZTH 4J8RA 1QFWH 1ZVSB 2CK0H 2DDQL 4Y4FA 4NKMA 5E6IB 2F8XC 1I3RA 1MRCH 1KJ2L 3RUGB 5B38A 2B20A 4LNRB 3DECA 3CSPA 4ZSOE 5FDWA 3V0WH 2EH7H 1AHWA 4KFZC 3DIFB 1T5WB 1RUQH 2IANA 4CNIA 4DW2L 1OAQL 4N1HB 3P4OA 4QRRB 3ZMRA 4HXBH 5HI4C 4QXTB 2DQIH 4JFZH 4I3GA 2FECI 2EH8H 4GRLD 2BXZA 1KIUA 1IEAA 5GZND 1YMMA 5T5NG 1CICB 4JN1H 1FL6A 3QQ3A 5HVWA 2X1QA 4WHDA 4UDTA 1BFTA 2X6MA 1FL3B 4QRQB 1IC5L 3UO1L 2ORBH 1JZ2A 1CLOL 4HIXL 1R3KB 4HJGA 4JO1L 4Z7VB 4ZUUB 3HG1A 5LGJB 4IRSC 5GS1A 1BM3L 1I7UB 3OR6B 1LO0L 3ZKMD 4UOW1 5E5MB 4S0SD 2VLRB 1MVUA 3T0XA 4GMTH 3H0TB 1PFCA 4L3EB 3CVHL 2Q6WA 2XV6B 3VXUD 4HBCL 4WDIA 1CDCA 5BMFL 1G9NC 3ZKXB 4WVRA 4EQ3A 4Z0BL 1EJ6A 3PWPD 5D6DA 5HGHA 1WJ3A 3ZTNH 2ZUYA 5E7FA 5EUOF 1DQQB 4NQED 4RSVA 4ZSOB 3W2DH 1BQHG 5C0CD 5GRVK 3ARXA 1C5BH 3DSNA 4EN3A 5I1DA 1OL0A 4NZRL 2BDNL 4PJ8A 2XT1B 5DJDB 2EO1A 3KPRB 1QQDB 3DX7A 4PP2B 4I4WA 5DJZA 4KZDL 4GW4A 1CGUA 2V5TA 3VXUE 5I0ZA 4JLRA 1MREL 4N90D 1BWMA 2FEDD 5IV2B 2YPVL 1UEMA 2Y72A 2BCKA 3BH9A 3C8KB 1Q9WA 1YPZB 1R6VA 4HSQA 4PJ8D 2KKQA 1QBLH 4LOUC 2P8PB 4Z7VE 5DS8A 4OZGA 4H5SA 3GHBH 1CBVH 3BP4A 3DO7A 1CXIA 1J05B 3VGHA 2C7UA 3K7UA 1ZT7A 2QL1A 3H42L 4NSKB 2P8MB 3BP5A 3DVNA 4HKXA 1B6DA 5H35B 4NO5A 3ULVD 2YD1A 3OR6A 2R0LL 4HUXB 2NY2D 5GHWL 3HKFA 3VA2C 2Q86A 3VXRD 3F7YA 5I1JH 3RDTD 4LGRB 3VXRB 5KSBA 1FNSL 1MWAB 2GTZA 4NCC1 2VLKD 4KUZH 3SDAB 5DD1L 1MJ7H 4O9HH 2APTA 2YD2A 3BXNA 3F65A 1RHFA 4JPIB 3EGSA 1SJEA 3C2SA 3TO4B 1JPTH 3MLRL 3PQYD 3LS4L 3HNVL 4ZNEA 5IJKA 4JDZA 4MD0A 2VZVA 3E8UL 2D7QA 1CICC 3FQRA 1YN7A 1Q72H 3QBTB 4G8IA 4KTEH 1ZWIB 2X4UA 4PJ9D 2OZ4A 4GRWE 4OUUB 2F53B 1CIDA 1JGDB 5D72L 3FRPA 2X10A 4OTXL 2IMNA 3ARBB 1FZMB 2V7NA 1H3XA 1AD0A 4JM4L 5I8OH 4UTBH 2FATL 4OZIA 2ERJC 5J6GB 1VFAB 1A7QH 1U92B 3LRHA 5DD6B 5GGVY 1JRHH 1TCRA 4HKBA 1II4E 4ZOEA 3C6LB 5LBSH 1ROWA 3O45A 1C5CL 3VXMD 2VE6A 4ODXB 1ZANL 3C08H 5EUOB 5MEPB 1F4AA 2NY4C 3KLAB 5FYJU 5JIHA 2FNBA 2N7BA 3WO3B 3FT3A 1MCDA 2BVPB 4YDVA 3WIFB 5JOEA 5GGTH 2EDOA 2YSSA 2HN7A 4QEGA 4OZ4A 4BH7A 4MCYB 4TULL 2D31A 4YK4B 4UT6L 2IEPA 5DHVA 2PNDA 1RIVH 5CJXC 2MCG1 2ZCKH 3S36H 3WFZA 4D2NA 3W9DB 5GIRB 2HP4A 2NY5L 1NC4D 1PZ5B 1A6TA 1FNGB 1WWAX 1KELH 4WI4A 1S5IH 1YYML 2AJSL 5BQ7A 3K2UL 1GIGL 2VDMH 1DVFD 4JFXB 4JPKH 4XBEH 4XPBH 1AGEB 1GGIH 2EKSB 2OL3A 1BJMA 5KJRL 3RKDC 1Z5LA 4HW6A 3AS3A 3I3BA 5DMIL 3EYSL 1PEWA 3B6SA 2HJKA 4C83A 2DQDH 4UINH 4CU8A 4F7CA 4RAUB 5CCKH 1GGBH 4YXHL 2XG4A 4HMDA 4BSWB 2DM7A 3U0PB 1P4IH 3FFDA 3PDOA 2B4CL 2VXTL 4HWUA 4OLUL 1TQBC 5JMRA 3TFKD 4QXGL 4HJJH 2YC1B 4LLVA 4O5LH 3IDYC 3VJ6A 3BYTA 2WV3A 4U33A 3WNKA 2F9BT 3G5XB 5EOCJ 1TTUA 1YEEH 1Q9LA 3KPSA 4Z7WA 5L7XL 3EHBC 2XOTA 4DTGH 3D3VA 3FKUS 5LWYL 2DIJA 1XF2A 3W39A 1UVQB 1OAZL 1P7HL 3TYGL 3T2PA 3EO9H 5D2NC 3TFKC 4KI5E 2YHGA 4RISH 4TTDC 4ODTL 4TVPH 5D6DC 1NBVH 2HRPH 1LP9F 1QHOA 2ED7A 5BJTB 2EE2A 4XVJH 1U3HC 1ZSDB 2OR9L 1YEIL 3NA9L 4WV1C 1W72H 3L5HA 4NQSB 2VLJD 4ONHB 5T5NF 5L2KD 2V5MA 1CF8H 4LIQH 2KPNA 4MNGB 3QG6B 1FAIH 5GS1C 4IRSA 3ECBB 3L5WB 4MHHI 2QKIB 5CWSA 2BFVH 3OKMA 5B4MD 1NDGB 3H9SE 3VDBA 1AXTL 5E2TH 1H3WM 3O4LB 3U0WL 3D39E 4JGJA 2KQMA 4APQB 2YKLH 2DI7A 1P5UA 5IHUH 5ITBL 4HWBL 1A4KA 3MFGB 4IMKC 2BRRH 5BV7B 4N0UB 4N8CH 4KAQH 2EDLA 4WV1A 4U7MA 4NO0A 3B2UC 1KB5A 3UTSB 3DI3B 3QG7L 4UQ2A 1IJ9A 1EAPA 3E3QE 4ZAKB 3C5ZB 4AT6B 3ULUE 2BNRD 4JM2A 5DRXA 3WO4C 2GSGA 1MCKA 3N9GH 3H7LA 5C0BA 4ZXBD 1ZHKB 3PWUB 3PABA 4ISVB 1OTSD 3DMMD 1IC4H 3UTTA 3RNKB 4HMEA 1MRDH 4Y4HD 2CKBA 2VAAA 5LGHH 5CD5C 1Y18A 1CLYL 4GSDL 4Y4FC 1N5AB 1IM9D 3IJSA 5BZWB 2FJHA 3KWWB 4G7VL 4OI7A 1WV7T 1YEHH 1C1EH 1OTSC 3UBXI 3P4LA 2IC2A 5JHDA 3GMQB 3WHE1 5E0QA 5HYFA 4YHYC 1X5LA 5KAQG 3NH7H 1D6VL 4JR9L 1EO8H 2PXYA 3V2AR 5DMYA 5C7XH 3ARSA 3RRQA 2FYYB 1Q0XL 2EDYA 4RMSA 4X8JA 5ESQA 5I71B 4OGAC 5HVHC 4Q9RH 4TN9A 2WUCL 1SBBA 4ZS6D 3QDAA 5KZCB 1WC7B 5KZCD 2VXVL 2NXYB 3KR3H 4XRCB 2CXGA 1MCOL 1KEML 1AY1H 4Y5XA 1RVFH 1ADQL 5I0DA 5C2UB 1B0RB 3BW9B 4B7IA 4E9LA 1MFNA 1KN2L 2OJZL 5E8PB 1JHLL 2AXHA 3P0VH 4MXWH 1EEZB 5F3BB 2VITA 4ZFOL 1G6RA 2BNUB 4NBZB 3DMMA 1P4LA 1FE8H 1IGJB 1CL7I 4MA8H 2APVA 4XCCL 4E41A 5L2KB 1RFDL 5TPWL 3T2QA 3MX0A 4GRMB 1Z9OA 3OKKA 4QHLA 5D7LD 4B0MM 2YEZB 4JFYB 1IC7H 3KYNB 5F1NA 4WV1B 1BIIB 3ZHDA 4YDLB 4OFYD 2HT3D 2A9NL 3N0PB 4P4KC 1FO0B 1QLFA 4LHUG 2D7PA 3TJHD 1CD9B 3WXWL 1BZ7B 4HWNA 1BREA 3RWCB 1BPVA 5FYKL 3MROA 2JELL 3AREA 4EJ1C 4P2RB 4HUNB 1WIPA 1NMAL 3QPXH 5GRXG 4M1CC 4P2OD 5F8QC 2IBZX 3PUCA 4KPHL 5DO2C 3VFWB 5C0GB 1YY8B 2Z8WC 3MRDB 1UG9A 4Y2DB 2YPLB 1T6VN 4QGYA 4R26L 4Z7NE 3NCMA 1A6ZB 5CHNA 4Z7WF 3MRLB 1MCSA 1HDMA 3C60A 3WE6B 4BSJA 5HD8D 3GK8H 1LEIA 1IE5A 1IAII 5MEQB 5IJKC 4U6VL 4WW1B 2OP4H 3BPLB 1I1YB 1Y6MR 4FQXA 5FYJH 1M1SA 2P5WE 3CH8A 2GTWA 4XX1E 43CAB 1CQKA 3VFVB 3QIWC 2P45B 3RWEA 3O3BA 4OIIL 3GIZL 1NFIA 4TVPD 5HDLA 4GKSA 4U0RC 5I19L 2XZCH 3WHE0 3NTCH 1NCDL 4HUVA 4APQA 2ED9A 1J1PH 1WBXB 4TNVF 4HPYH 4OKDA 4R4NC 2H41A 3EDJA 1BJ8A 3BISA 3JV6A 4H1LH 3MUHL 5IFJB 5FM5O 3LEXB 2Z93A 3GB7B 3T4AA 4A6YA 5DD5L 4QHMA 1UKTA 4FHBD 5FA4B 1REIA 3OAZH 5FM8A 4Q0XH 3VRJA 1ZSDA 3MZTA 2C3HA 2EC9T 2ZJSL 5C08E 1XGUA 1IT9H 5E4IA 4OD1L 4YO0B 3G6JB 1DLFH 4FXLA 1UM5L 4FMKA 1X5ZA 4PPTA 4S1SL 1YEKL 4HS3A 5IR1A 1FN4A 3UYPA 1ZS8A 3HE6B 1JF5A 1HI6A 1N8ZA 3LHPL 1M05A 3ILQD 1U3ZA 2V6HA 4CN6A 5TGBB 1FNEA 5C9KA 2D9CA 1V7NL 2R29H 3G5XA 5FO9B 5KOVC 1B0WA 1YN6B 4NQCA 4PJ8C 4U3XA 5MP6L 2O61B 1SEBB 2WANA 4M6NL 3CNKA 3GM0A 1JPST 3VW3H 3D85B 3NIGF 1MI5A 5DJCA 4ELMF 4UAOB 1AP2B 2SEBA 4XNQB 5IFAL 1FP5A 2B0SL 4KJYB 4R2GB 3C5JA 1YPZE 3QWRA 3H6JA 4Y2OA 3VXPA 4JY5L 4BJLA 2PW1A 4JY5H 3QCUL 4LSSH 1F2QA 1J0YA 1EHLH 2HTKC 4CAGA 2HJFB 5AD0A 5B22A 4JJ5B 5B3JF 4G8EB 4OF7A 4Z95H 4JJHA 4HJ0D 3TVMB 1T2JA 1PW3A 4XNUH 3VW3L 5FYJE 3B9KD 3I02B 5MP6H 1KN4H 4H20H 5DVMA 2QHRL 2LTQC 1L7IH 3HN3A 4OJFL 2Q8BH 4QRPD 4X4XA 3KPSE 3S88H 5K9OA 2CUMA 1YQ2A 3MODL 1MFBH 5E1HB 3ARFD 4OZHB 4QRPB 1CL7H 1E4WH 3ALPA 3ALWA 5EU6E 4F7EA 5J3HC 1B2WL 5DHYA 1ZT1B 1UJ3B 3GKZA 2Z4QB 4PRDB 2FJFA 4AIZA 3IU4L 4E5XB 1F4YL 2X4NA 3D18B 4XNYH 4DK6A 3FQRB 2R8SH 2DS4A 4YPGA 3GO1L 4BH7B 4CBPA 1N2RB 4M3KB 4U1IB 1NAMH 4L1HA 2VZTA 1UYWH 4D3CL 2YN3A 3ZT5A 4HK3J 3NCFB 1ONQA 2E7BA 1H15A 4X6DF 5D1XD 3VXSD 3EYVB 4FNLH 2AEQH 3MV8B 3HRZB 5KVFH 3RZCB 1UB6B 4PJBE 1T0NB 2BERA 2O5YH 4DOHB 3KJ6L 2FSEB 4DUXA 3OG4B 1J1PL 1P7QD 3ISWA 2VIRA 3NCEB 1ETZB 5E2VH 3RX5A 3LN5B 4PTTB 1M6OA 4F57L 2APFA 4X4ME 5H35A 1UCBH 1A9BA 3QIUC 2FWOA 4CU7A 4K7PX 4O00A 3Q0HA 3E0GA 3D3VE 5ID0A 1G7MA 5HSFA 1TZIB 3WNOA 4JN2A 2LVCA 3BDYL 4H1LG 4U6VH 1IKNA 2IPUK 1KJVB 1IM9A 3RDTC 1ZWIA 2X4UB 2NX5A 2OM5A 4RA3A 1YPZA 2NYYD 2AJVL 4QWWD 3BDXA 1A6UH 2BMKA 4JDZB 3HE6C 1BAFH 4JFED 1H3VA 3Q6GL 2R1YA 2CXKA 3V8OA 4Q9QL 1DQDL 4FQCL 4LLMB 3QUXC 2EE3A 1QNZH 3MTRA 3WFHA 4YX2H 2AV7A 3VGAC 3AXLB 4M7KH 4XVSL 4YHKH 3G04A 1A14L 5CMAB 3RVXC 4LP4A 3WL9A 3B4NA 4TUKL 2Z31C 2GJ6E 1OGAD 4U1NB 4UUJB 3U36A 3TBYA 2A1WH 1OGAB 1XF1A 3ARFB 2CJUL 3SKOB 3C5SB 1IC7L 4LPXA 4K7PY 4EEEA 5E2JA 5IT2H 3RWFA 5I9QC 3RWEB 4F15C 1RFDH 2HG5B 1JHTB 1UC6A 1JK8B 3MLVH 5BW7C 3TBWB 4MZ2A 5ACZA 3V95A 3IVKA 3SDCC 3BE1H 3WYRA 4G8GE 4HPOH 1Q9WB 3B83A 1F13A 2CMRH 3EHBD 4KDTC 3P0VL 4LSQL 4CVXA 4JLRB 3IFNH 2BVUA 3TT1H 5L2KE 4WTXA 1MCEA 4XP4H 1NC2B 5CEZL 4K8RC 3SCMA 2DD8H 5D1XB 1RVFL 2I9LB 1KEMH 2YS4A 1LNUA 5JA9A 2A6JB 4MNHB 5AG8A 5IQ9A 5I30H 5HHMB 3KR3L 3TZVA 3BH8A 5AWNL 4LNVA 1ULVA 3UJTL 3L5JA 4TRPL 1CXLA 5CD3B 3P4OB 1G9ML 2GEEA 4TQEH 3D25A 4P23D 4RGNC 4YHPA 4TSCL 3ZT6A 1EO8L 2ARWA 5SX4I 2FEEI 5TF1L 1I8LA 3RVWC 4JPWL 5HGHB 5IBUG 1C5DA 3QDGA 4AEIH 1A47A 3L3KB 2ICEA 3S96B 1RU9H 2VISB 4NM4L 5ALBL 4JG1H 3HZMA 2BHUA 4I77H 4U05A 1BGXH 5C0JA 4X5XA 2HLFC 2CIKB 1MHHB 5EZIH 5JLZA 4BKLB 5F96L 4MQ7A 1MRDL 8FABA 1J7VR 3BQUB 4ZUUA 4UU9B 1ZK9A 1OLZA 1LD9B 1L6XA 1BZ9A 5I16B 4G8FB 2BNUA 1RUAH 1UB6A 3NZHH 1FYHB 4PJFE 1FLRL 1I8LC 5I1IH 4XC3H 4K3EH 5DJAA 4KROD 5F7WC 4K3EL 2QBWA 3VFGH 2AQ3A 4MJ2A 1INQB 3NZHL 1SBSH 2Q7NA 5C0RL 5E2UL 5DJ0B 2Y7QB 1OWWA 5JHLL 3V6OE 3QDGD 5IHUL 4P2QD 3LKQA 3QUYB 4UV4H 3O3DA 2WWKT 3GSWA 5AUMA 4P23A 3QR2A 1UJ3A 5DTFB 3MRNA 5IF0A 4P46A 1FSKC 3L3HB 4I77L 5DR5L 3HZVA 4OZHA 4QRPA 1JZ3A 2UV3A 1LQSR 3RVXD 3QAZC 5MEND 2DL2A 5HHVH 5IEHA 4NNYA 1L4IA 4FXKA 4MXQC 3EYFB 3M1BB 2AQ2A 4JDVB 3I50L 3L9RA 2XWTB 2DWDB 4TVPL 4NC2B 5KSAC 3L3HA 4RISL 1NC2D 2R4RL 3VXSE 2OJEB 2OLDA 4TRPH 4N0CD 5LAXA 4L4VD 3UJTH 4TOYH 4Q97A 3F62A 1AGBB 1INDL 2Z31A 3FOLB 4KKAD 5MERB 5SWZD 5I30L 4FOMA 5L7XH 4JM2B 5DRXB 4MNQA 2NY6D 4LVNC 4GAJL 4HJJL 4O5LL 5F9AC 4H8WC 1MOEA 3QCTL 4OLUH 4G8GB 3RI5F 2P5WA 4EXPX 3QUXA 2I27N 2J4WL 3VXME 2JJVA 1AQKH 1UH4A 2WNGA 2XQBH 5C1MB 3SPVB 5E08L 4Z8FH 3MRQA 2JJWA 2AABH 3IXTA 4Y16A 1W2KT 5CCKL 3SQBA 2MTPA 3HE6A 3CFBA 3BMWA 3MXWH 3GMOB 4YHMH 1A02N 1FQ9C 1KCLA 2D03H 3RL2A 5FUOL 1J1OL 4KKLD 3T8XA 3RWJA 3H9YA 3IDMA 3X13B 4LBEA 3NAAH 1TETH 5DURD 4OT1H 1E28A 2BVTA 3HC0A 25C8L 1GGIL 5GS2H 4LSVH 1LEKA 1G84A 1A14H 1KSRA 4WU5A 4UNVA 5I17A 2AEPL 3K2UH 3E6FA 3RWJB 1QFPA 3ULUF 3BGFC 1IAIL 4LSPL 1D9KC 5IESH 3KJ4B 2AI0H 5HI4D 4IHOB 2ICWA 4WTZA 4NWUL 1RIVL 4GUPA 5J1AB 4H25A 3DI2B 4P3DA 5CJ5A 4MJIE 1QSFD 4HBQA 2X44D 2WMPA 1FFPA 4Y4KB 2R1XB 5TDOB 5C0EB 5E9DB 1NC4A 3B5GA 1HKFA 3VFVA 1EIBA 3QI9A 3TO4C 5EA0H 1HQRA 1LO3H 3G6AA 4MHHG 1HCFX 3VWKB 4UDUA 4S2SA 2HMIC 1ZHNA 2NQCA 2P43B 1HDMB 4CUCA 4F7CB 5I1GL 5D7IA 2DWEA 2AV1B 3FB6B 4AIOA 1FYTE 1A22B 3VFSB 1PSKH 4U0RB 1PJ9A 3TCLA 3P9WB 3UTQB 1RZ8A 3TGXA 4LCCB 3H7BA 3WFBH 1T1XA 1PQZB 1WITA 3LIZH 3EJZD 1IZKA 1IGMH 4MXQD 4J4PA 4P46B 2YD3A 3F12A 3BUTA 4YC2B 4I48B 1Z9SA 2EE9A 3T2NH 1D5IH 4GLRH 2VXSH 5GGSB 4NGHL 1VB9A 4I18A 4PTUB 5F7NC 3C09B 2R39A 1VADA 1IL1B 5DK2B 1MJ7L 2HN7B 4O9HL 4X6EA 3LQZB 5FYLH 1P5VA 4XPHH 3IS1X 2ZOKA 4BELD 5C07B 3ORJA 1E4WL 3RVVC 5C3TA 4U1JA 1EGJL 4LIQE 5AZ2L 2NZIA 3P77B 4HX1B 2AXFB 2EDQA 1NLDL 2HLAB 4BQ9A 1CIUA 2VITB 4K7PH 5J6HA 4G8FA 3OL2A 1LP9E 4W68A 2XNAA 5ESAB 2VXUH 1JPFB 1FZOA 2IADA 4H1LB 1ZA3B 4JQVC 1QRND 3NCJL 3KYOA 1A9BB 2EEBA 3GHBL 1T0MB 5I76A 3R0MA 3UTPE 5I1LB 3ARBA 2F8VA 2GCYA 3EDDA 4JZOA 1ZLUH 3E2HC 3EOTL 1UXWA 5ANME 3L3KA 4ELMB 2E7HA 1PYWB 1BIHA 5HYJB 4BZ1H 3HRZA 3DYPA 5DJ8A 3JTTA 3K46A 3PQYA 2R29L 1EJOL 1T1XB 1BP3B 1RZ8B 5K9JL 3GSOA 4U1HB 2UVEA 4X4ZA 5TDPA 1G6RH 2EEAA 5ID1B 2BDNH 2FGWL 1U8HB 4LHJB 2A6JA 4JB9L 4LVHB 3SJVA 3UTTD 2IAMB 5DMKA 3QIWA 3KPRE 4YDKL 2EDEA 1XF4B 4ZOBA 3DROB 3ZTNL 2VNCA 3S35X 1ZVYA 3QXVA 1LEGB 3K8MA 1VCAA 2NLJB 5K9KA 2HFGH 1EAPB 2VERN 4KK6C 4NFBA 1HHKB 3GMMB 4ZUWB 3SKMB 3C5ZD 4KDVA 3IFPA 4G8EA 3BP4B 1BM3H 3HMWH 3IDJA 4QYOA 3DRQB 1F58H 5D9SB 3BVNA 5H94B 1WBYB 3MV9E 2ZKHH 1IC5H 2W60B 2Q76A 5I19H 1CI5A 4XMPH 3GIZH 5DUBB 4Y4HB 1TJGH 1F90H 4P4KA 4DKFH 4S0TD 1C12B 1GVIA 1VKXA 4MD5B 2FL5B 1F4WL 4ZUSB 3ARED 1IAKB 1OT2A 1X6NA 3BWUC 3GMLA 3GK8L 2DBJA 3O2DL 4HXBL 3EO0A 1JGEA 1XGYL 1RZJL 3PF2A 4GXVL 3KHQA 2DLGA 3AU1A 4MDIB 4OZFH 1KB5H 3UJIL 1UENA 1I1AB 2VQ1B 3QNXA 5E8OA 1MFDL 4QY8B 3OHXB 5FA3A 4QCIA 3DMMC 3RIFK 3FQXA 3BPOB 1MRCL 4MDIA 2IMMA 4IS6A 4F2MB 3BEWB 3MMEA 1YEDB 3W39B 1BMGA 5CGMA 1EFXB 1KPRB 2DKUA 3H9SA 3EO0B 4BQ6A 1S7RA 3WXWH 3PDGA 2YC1A 4LASL 4LLVB 4DKEL 3M8OH 4DN4L 3BZ4B 3IAQA 4X7CC 1CFVL 1KCRL 2VUYA 1ACYL 3DTXA 4WW2B 3LRSA 1A7OH 3BWAA 2NR6C 4M43L 3D6GA 5MERA 5FGBC 5I1HL 3W81A 5CP7A 4AM0B 1MH5B 4R0LA 3IAPA 1DDHB 3N85L 3ZO0A 5D2NE 4FS0A 1JWUA 3CMGA 4D0DA 1ZV5A 2PXYC 3QIUD 5HGDA 1CE6B 4KTYA 4ZG1A 4K8RL 4DGIH 2BJML 1HIML 4DZ8A 4XCCH 12E8H 1KCUL 1Q9OA 4EUPH 1KLFA 2YOCA 3QWOB 3KVQA 1RHHB 1OSPL 3VMNA 1JCKA 2E5EA 2V5SA 4DVBB 3H9HB 4QOKE 4QXWA 5DRZB 4U1IA 4DUWA 4Q6IA 4EI5A 4KROC 3WO4B 4PRIE 1URLA 1KN2H 2BSTB 2OJZH 2QR0A 3LRGA 5CJOH 1U8OB 1IGIL 4WEBH 3I75A 4JY4A 3P40A 4ZTOH 3GIVA 3F7VA 5FB8B 1W0VA 2GW5A 5CEZE 1TQCB 2B8OT 1PEZA 1RIHL 1MCPH 2EXYC 1Q0XH 4B53A 5GS2D 5IMLA 2JK5A 3G9VA 4J1UB 4OF6A 4K3GA 2FHCA 3I85A 1V5JA 1HE7A 3UDWC 3HI5L 4BH8B 5AZEL 1X7QB 3GJFH 2IPUG 3D2UD 4U6YB 4G7VH 5DFTA 3JWNC 5D70L 1KBGH 4LP5A 2B1AH 2B5IC 1CLYH 4GSDH 3L1OL 4UU9A 3W0WB 4U31A 3TNNB 4OQ1A 3BWAB 4FQIH 1FDLL 3DETD 3ARGD 3O41B 4QO1A 3SE9L 2VH5L 1E4XL 2ZPKH 1DEEA 4PJ9A 1YN6A 1UT9A 5ACLA 5F21B 3ULVF 4R7DB 3PV6A 1U3HA 1GOHA 3MC0A 3U30B 1KC5H 4F9LC 1D5MB 4PB9H 3DX6A 5HTSA 4MVBD 1YEGL 1E6OL 5A2IH 1QVOA 5GGTA 1WAAA 3F7RA 3QG7H 1XGTA 2B1HH 2XKSA 1B4JL 4DEPC 4YIQB 4JRYA 3ZDXE 1CFTA 4PGJA 5L9DH 3A6CH 2DQJH 1YMHA 2W0PA 2ZUXA 3IYLW 1S7TA 3MNVA 5KN5A 5IOPB 2ZOKB 4LDEB 1JHKH 2VLLB 4XBPB 1F4HA 5ICYB 3BAEL 1G7QB 4O02H 5HYQA 1TDQA 3NFSH 1KTKE 2XYCA 3NACL 2AK4E 3LV3A 1MCBA 3L7FB 1S7QA 1OB1A 3VXRA 1MJ8L 3RGVC 4RQQB 4L8CA 1P2CA 2EDDA 5A1AA 2UZIL 15C8L 4FABH 3NA9H 4Q7DA 3S37X 1QFUH 4Z7UE 4TVPE 4XCFL 3NFSL 2MQCA 1DANT 4WI9A 1NBVL 2OZ4H 1RZJC 3KPPB 3LD8C 3QEHA 4POUB 2P5WD 5GISL 2C7UB 3EFFB 1I7ZA 4IRJA 4CADA 5CKAA 4UB0L 4OIBA 3MRBB 3A6CL 2A0LC 5BZDA 5IWLA 1OP5H 2PYEA 3O0RL 4RX4A 2ZSWA 4DTGL 2DQHL 4BZYA 3KPRD 3M17B 3PHQA 4HFWA 4EI6A 3VFMB 4ZFZB 3QDJA 3QO0B 2CR6A 4YHIB 4XCYA 1KC5L 1RIUH 4M1DL 4M1GL 4JFEA 2B4CH 1CD8A 2FD6H 3THML 2ZPKL 4IRJD 1QYGL 3DX7B 1E4XH 1FGVL 3MLXH 2O5ZH 5DQ9A 3U9PL 5IW6A 1GGBL 1TQCC 3G08A 2R56L 4U4BA 4NDMB 1P4BH 2R9HD 3MUJA 1FFQA 4NKDA 2EICA 2QSTA 5CJQL 1OLLA 1AIFB 3V5KB 2B1AL 3W0WD 2DOCA 2H3NA 2BMKB 1DBAL 5DMIH 4IRSD 5CWSB 1HOCA 2HA1A 1NQBA 5IKCB 3NN8A 3GKWH 1QLFB 5AZEH 2NX5B 5D7LA 3UCRA 4XPBL 3QHFL 1CGYA 3QXAA 3NMEA 4PJGE 1MCQA 5LGKA 3H3KA 2GJ6A 1YYMH 1TNNA 3H0TA 4L3EA 4NBXB 2Q6WB 1UM6L 1ZKAA 1CE1L 5IBLD 1CICD 3HC0B 2A6KB 1N4XL 2FBJH 4JKWA 4NNXA 5TF0A 2X5PA 3IKCA 3S36L 4Z7WE 4ZOCA 5L2JB 1FZOB 3VXSA 3T0BA 1UWGH 5DURB 3JTSB 3BZEA 4U6XA 4YE4L 1RK1A 3BQUD 2F74B 4KVNL 4HULB 1T0NA 5IBLC 5BVJB 2HLAA 2VKWA 2N7AA 4XP6H 1SJHB 5C70A 4ZUTB 3MCLH 2FZ3A 2M2DA 1CICA 4PRID 3ZHKA 4HFUL 5IROA 4PJ9B 2DTMH 3CC5B 4I13B 1S78D 1YY9D 3MRHB 3RVUD 1XGQA 4KJPD 4YHZL 4UAOC 3VXTB 4QRRA 1U8JA 3QRGL 2J6EA 3W0WA 1KJ3L 1MRFL 3U79A 1P6FA 3QQ4A 3GDBA 3RL1A 2GY5A 3RGVB 4R90L 5C8JB 4N0RA 4M93C 4GAGL 2VZOA 4PJAE 3TIEB 3WD5H 4LPVA 4XAWH 2IPKA 4WHTB 4DN4H 2W59A 3I84A 4L8BB 1F6FB 3IT8D 4KTEL 4LCCC 3LD8B 1PGRB 3EIFA 5BZWA 2N1KA 1X5GA 4WHTA 2Z8VC 3QHZH 3MYJB 3GM8A 2JCCE 1N7MH 3TIEA 4M6AA 3VI3F 2ATKA 4RX4D 5IF0B 1XF5B 3IDNA 3RUGE 4DCQB 4ODUA 2HJFA 5DI8B 2IH3A 2JIXA 3QP3A 1NAKH 3UMTA 4L4VB 4OZFG 4PB0H 1KB5L 3UJIH 5AUMB 1FNHA 5ESVA 2HVJA 2FLBT 3JBG7 5IGXL 4KUZL 4JM2F 2F8OA 5JR1L 2JCCF 3MNZA 1HQRB 2RQ8A 2XTJD 1RZGA 3EDFA 3CU1A 4AT6A 5DRZA 1QO3A 5C0CA 1HHIA 1SEBA 4PJAF 5I75C 1OPGH 4M5ZL 5K9QG 5DUML 1DBML 2Y5TA 1F90L 5HHXL 4FZEH 4LOUD 4LLQA 5EN2A 1MCFA 2I5YL 4K3DH 3SDXB 4ZDHA 1RURL 2ZKHL 4N8PA 3KXFE 2ATKB 3MLZL 2CQVA 2HH0H 4U6XB 3LMJH 5C07D 4Z5RA