4PJDF

Structure of human mr1-5-op-ru in complex with human mait c-c10 tcr
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
235
structure length
233
Chain Sequence
GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSPPGGTDTQYFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
total genus 55
structure length 233
sequence length 235
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjdF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjdF02
2BK8A 2HMID 4LARL 3D25A 1P7QA 5EZIH 4ISVA 4LHQB 2Z8SA 4MLSA 2EDKA 3GNMH 1TFHA 1JN6B 2DQIH 2FBOJ 2Z92A 3U4EB 5I73C 1VCAA 5IBUB 5A16A 4BFBD 3FB8A 4G9DB 5EBMB 1U42A 1WFTA 2J8HA 1F00I 3RBGA 3ES6A 4MDIA 3D0LA 4LVNB 5HVHB 1FDLH 2B8OT 3FQNA 1ES0A 2VN7A 2UWEA 1CVSC 2GTWA 5I1IL 1CGWA 4OCWL 3WFEL 4JO2L 3HPLB 1URLA 3W11D 1AO7B 3LN5B 1GYAA 3QPQD 3QEQA 4P5TD 4X6FB 4BJLA 3T08A 5DDHB 4EVNA 1A6ZA 4Q7DA 5T1LB 1WWBX 1G7IA 5CGYD 3I9GL 1NUGA 1Z9SA 3UO1H 4OZ4B 5T3ZD 1VERA 1OM3L 4MX7B 3KYMB 2D7OA 3OZ9L 1JYVA 4I77L 2GIYA 3X12A 3PGCB 1R3LB 3Q6FA 1T1YA 3ESVF 4CAGA 2WINB 5I76B 1QBBA 4IMKA 1FSKB 5DR5L 1ZOXA 4PB9H 1T83A 3TYFB 5FKAB 4JDZB 2KPNA 2X9XA 4HXAL 5F6IB 4XCFL 3EO9L 4JANA 2KUTA 3IETB 1P7HL 4G3YL 4WI7A 3SKJL 3RWGB 4X7TB 1BOGB 3WNLA 1PKQE 1JZ2A 2B2XH 1X5LA 2MWCA 4ZUUA 3VI3F 1N59A 1I1RA 4JN2A 1HHJA 2ADIB 1X5ZA 3FQNB 5HHQA 4UT6L 2Y36L 2GW5A 5FHAH 3T8XB 2JB5L 1E4JA 1X6NA 1FVDB 1TVBA 1IT9H 4M1CC 4YXHH 4G6KH 4P2OD 4D94A 4XAKD 4QWWD 4PJFA 4ELMF 2XWTA 2A6JA 5TFSL 4JFQB 2L7UA 4NSKA 3RY6A 1HCFX 3DVNA 1I8LA 5CEXA 1E6OH 1XIWD 3STLA 3TZVC 4PJHA 2VXQH 3TO4A 4WCYL 1FC2D 5A2LH 5L7XL 3BE1H 2J6EH 4QXUH 4GT7A 4P9HL 5I30H 5F3BA 3QH3B 2YD8A 2YUXA 5EU6E 3LN9A 4KKLC 3RTQC 3HMXL 4OZIA 3QG7H 3EO1B 4HZLA 1HKLH 2EO9A 3P30H 3IDNA 3GSVB 3V52H 3FTGA 4DZ8B 3I9GH 5J6HA 4NM8H 5TFSH 3TYGL 5A3IC 4WHYH 3SO5A 5F7LB 1OY3B 3DO7B 1WAAF 1JPSH 5DHXB 3TBVB 4K23H 4UTAL 3ILQD 4OD1L 1EPFA 3FN0L 1NSNH 2BVQB 4XNUH 2E27L 4A2MA 3GMNA 5I1JL 3RKDD 5HYJB 1AIFA 1AP2A 5E2TL 3MRCA 3E2HC 3VJ6A 3ZDXF 2ESVD 4D3CL 4MQXD 4G80B 1NEZG 3EOBB 3SGKA 1J0YA 1CLZH 5FYJD 1JFQL 1P9MC 4PJ7A 5AYUH 2A6IA 3ZTJH 5ISZD 1N3NA 3IJYB 4L3EB 3IGAA 1S9XB 5FB8A 3ARDD 1MQKL 1UCBH 5E8DH 4HT1H 3QUKB 2NX5D 4KJQC 4LSPH 3DIFA 3SCMA 2NY4B 4J4PA 1HXMA 2X4RB 4PRAB 3X3FH 3CFKB 5KSVB 3KPOB 4O9HH 4EUPB 2BY3A 4X98B 1RY7B 3T2PA 2CGRL 2HKFH 4PJ5D 4NO5B 4U7MA 5EB9A 1BLNB 1FH5H 2N1KA 4OFDA 4KK9D 4MD4A 1A6WL 2NY5H 2ED8A 3BPOC 3DO7A 3LVEA 2AI0L 2X1QA 5CIPA 3BHBA 1CXIA 1R3JA 2XWBA 1KB5L 4P2QD 3HMXH 4ALAH 1ZGLB 2M26A 1OWWA 2EE6A 4X6EB 3CZFA 3SGEI 3HC4H 3DVIA 2R2EA 4M6OL 2VLRA 1YC8A 5C08B 1RURL 1YNTA 4M6AA 2ICCA 3VWKC 1CXKA 4ONHB 3MRIB 1GZPB 4DTGL 3D3VE 3GMQB 1QSFE 3WXVH 3QIUC 1FGNL 1HI6A 2ZPKH 4JPKH 2Q8AL 4HFWA 5KG9A 3V9FA 5E5MB 2AGJL 3EZ8A 4K55A 4FXKB 4PJAB 5TDOA 4PP1D 1D9KA 5HYJA 3RWHB 1FFOA 2R4RH 1OB1B 3PL6C 1HINL 4M9PA 2APTA 5HJ3B 5F1IA 2ZUWA 3H9SA 1HWGB 1GSMA 4OAWB 5HGGS 2GI7A 5T5NF 1TQBC 2HFEB 4LRNH 1BVKA 1GGIL 4PGBB 3T0ED 2XRAH 1E4WL 4LHUG 5AZEL 4CKVX 1NCCL 4AT6B 5C2BL 1PLGL 3DX8B 2UY6A 4FTVE 3U7YL 3W81A 4HWBA 4Y4HC 1JK8B 3QUYC 1UVQA 1FZJB 2YC1A 5EORH 2VOTA 4J6RL 3QCTH 2J4WH 1G6RB 1OW0C 2X70A 3P0VL 4O9HL 5GZND 2NY5C 3DUUA 4ZFOA 3U0PB 1GPOH 4JY5L 2BVUA 5FHBH 2P5WB 4MQTB 4XPHH 4BUGA 3FB5B 4HKJB 1EXUB 2KDGA 1T7YA 4K3HA 4JCLA 3TV3L 1EFQA 5FHAL 5IW1B 1XIWC 4MD0A 2RCSH 3RUGB 1HOCB 1JWSB 5KOVC 2PUQT 2EEBA 1WBZA 2BFVL 4PJFB 1FNFA 1W2KT 1SBSL 2P7TB 3TO4D 2YPLA 3WFCL 4KK5C 1INEL 2BOBA 3FFCA 4OLXL 3L9RA 1E6OL 4HIJA 4YUEL 2M8XA 4UT7H 8CGTA 4M7ZB 2NR6C 3LKPB 4Z95H 4DGYH 4UOW0 2G9HB 2NY6C 1AXSA 2BSRB 4H0GA 4OKDA 4YH6A 3MNWB 4X83A 3VXME 3QBTB 3EFFB 1P7KA 4YHPB 4QF1A 1U8NB 5CBAA 5FYJE 3MXWH 3FOLB 3DURB 1A14H 5HDOA 4OZHF 5EUOF 4BKLA 2N56A 3IJSA 3DI2B 3LRGA 4I18A 4KXZI 4KKAD 3K8KA 2XY1A 4I3RL 3I50H 3NFNA 2J8OA 4M8VA 1I4FA 1ZA6B 3OR7B 1SY6L 3ARZA 2AQ3A 4YUEH 5J06A 3IVKA 1MCOL 1AJ7H 1HZHH 1ONQB 4LIQL 2R2HA 4FZEH 4JM2A 4JFFA 2X4SA 1CGYA 3MOBL 4JO2H 1UCTA 3S36L 5FM5O 3LDBC 2B4CH 1CD0A 1J18A 4NUGL 1A14L 4DN4L 2CR6A 2D7TL 3V79C 5C0BE 1E4XH 5E4EB 1L0XA 1KCRL 4B50A 3T2OA 3SCMC 1H3PL 3TESA 5E6ID 4ONFL 2UVEA 3NCJH 4TRPL 3MGOB 5BV7B 3MA9H 3SGDH 5FCUL 2OZ4A 3H9HB 3CK0L 1I85A 3L6FA 4QHMB 4XH2B 3WS3B 5HJ3A 1BWWA 1C12A 2V17L 4KJPD 2G60L 3W0WA 4ZS6C 4PJ7F 2VC2H 4OF8A 4PRPA 1GGYA 4I9WD 4A6YL 4XXDA 5D5MA 2P8PA 4KMQA 3MV8E 2O26U 2B1HH 3LQAH 3H9SD 4PG2C 5ICZB 4WI9A 3JVGC 3DYMA 3LMJL 3TNMB 1ZHKB 3DUUB 2SEBA 3EYQD 4ZFOB 1UZ8A 2DWEA 4LLMA 1CFBA 5DHVB 2D7NA 3VFRB 3ZYZA 3VWKA 2F19L 3WUWB 1CIUA 2NY0B 3V8CA 3SE3C 5KS9E 1Q9OB 1J05A 1JF1A 3WLBA 1BVZA 4MB5A 2FJFA 1UACL 4B0MM 4HC1H 1OQOA 1G6RH 2EDLA 3V6OC 4CDGC 4HUKB 4FFWC 2P7TA 2WSKA 4XVTL 4WI8A 2KBGA 4HGWA 4XP6L 3H9ZA 1HOCA 1UXSB 4YFDB 3LQAL 4X9IA 5FXCH 3QIBA 4EI6A 1YN6A 4V2BA 2Z31D 1ZKAA 2W65B 5DJDA 5D7LE 2XQYK 5D72L 2XZQL 1BZ9A 4U4BA 4EN3A 1SY6A 4S1QH 2X4NA 4ETQA 2ARJB 4WU5B 5D2LE 1QR1B 1RZKL 4NQCE 4FQJL 5C71A 3ABZA 1MJ7H 4PRPB 3FT3A 3BUYB 2BNRE 3MACH 1XAUA 1FYTB 5HVGB 1RK1A 1K5NB 2ERJB 1CN4A 2HT4D 2MFNA 5I18H 1CDBA 3HZVA 4FMKA 2XN9D 1X5XA 2GTZA 3MUGB 4XP6H 3VFUB 4CVWA 5JA9A 1IM3A 1L6XA 3VFPA 1CG9A 4GW4A 5GGVH 3VG9C 2CKBH 1YQVL 3VCLB 2X4TB 4IIQB 4ETQB 4NC1E 1A8JH 3GUTB 1WT5C 1KT2B 1RUPH 2L7JA 3SY0B 5MEPA 2ADFH 5MERB 2VDPL 4XNQA 1K4CA 1G7QA 1H3UA 5JLZA 1WWWX 1EJOL 1ZVSA 3BPLC 2C1OB 1AY1L 4HLZH 3NIDF 4ZFZB 2DYPB 4O58H 2LU4A 4D0CA 1JRHH 2EIZB 1F4WL 3TBVA 4MB3A 5DJCA 1PVHA 3RGVD 2WP3T 1IL1B 5E6YA 3CNKA 3L3IA 4H8WC 1J1XH 3MZTA 3QG7L 4PTTB 1IGIL 1FL5B 4L1HA 3B83A 4PD4J 3BMWA 4OFKA 3VXNB 4AEHL 4ZFFB 4UU9A 2XYCA 4PD4K 3WBDA 2R56H 2O5YH 1OCWH 2EDDA 3O8XD 3VFTB 1WBXB 4GMSL 5I8KL 4WTZA 4PP1C 2Q86B 2EEAA 1U8IA 1LEIB 1BIIB 3FT3B 3BUYA 5DD1L 2EDTA 5T3XE 3H3PH 3J7HA 4QCIB 5H94A 1NGYA 1X6LA 1L7TH 2GY5A 4YX2L 1GIGH 3MRMA 2APFA 2NY1B 3OR6A 4DQOH 2C7UB 4U1HA 2IBZY 2DN7A 3EAKA 5FGSA 3BXNA 5DJDB 5KW9L 3QUXA 2FL5A 2HVJA 2YD7A 3L3DA 3CFKA 4RFEB 3EDDA 3QULB 4KV5F 5IROC 1OTSC 3HHRB 5TE4H 4M5ZL 4LQ1A 1UXWB 3VXRA 1YECH 3V5DA 1EGJH 4ZAKB 2OK0H 1BFTA 3ILQC 5DRZA 2OBGA 4F15B 5FB8B 1XGQB 1VKXA 5SWSA 3PWPE 4NPYB 5F89A 4EI5A 1AFVL 3NCFB 4N8PA 3OKLA 4J3WA 5HHOE 4FNLL 4YLQT 3ZE0E 4X0KB 3QUZA 1FE8L 4TOYH 2AV1B 4X6EA 3RWEA 3QCVH 5KSBB 1BJ1H 3QDJB 3V5HA 4Z7QE 3QG6B 2NY4C 4GAJH 1QBML 5BRZE 5JUEL 5I75C 4UQ3A 4NCC2 5KSUA 3G6JA 3VWJD 5SWQB 4JRWA 1RZKC 4H1LH 2GSIA 2X1XR 2V6HA 5IQ9A 3RVVD 3NIGF 3LPGA 1V7NL 2OJEB 2CR3A 2B7DT 3ARDC 4ORGA 5DVNA 1YYLH 1MCRA 15C8L 5HYSB 2WBJC 4HUXA 4OZFB 4U3HA 3VI3E 4NM4H 5C0BA 1WF5A 3OJDA 2AJSL 5C07D 3GUTA 5DEFA 1J86A 5I8EA 3WCYA 4NQXA 2WUCH 4OIAA 1GCFA 4L8SB 2QV2A 3S88L 3RZCA 3PP4H 3HFML 4CVZB 5ADOL 4Y5VA 1VADB 1GPOL 5DZNA 4QXGL 2AK4B 1T5WB 3AB0B 1E4KC 4EDWL 1UWGH 4MNHA 1BD2D 3GI8H 4XMPH 3KJ4C 2P5EB 4OT1L 2ZWLT 5C0RL 4X6CB 1CDJA 2NTSP 4M7KH 1P1ZB 1LO3L 5EC2A 4LVOC 1HILA 2VDLH 4KVNL 4EDXA 1JWSA 5FEBA 1ZLUH 4F37K 5CJ5A 1RZ8A 1VGEL 3D48R 3BWAA 1OTTD 2DM3A 4H0HB 4P46B 1DBKL 2CUIA 4ODXA 3TN0D 3L3OB 4OM0H 2DLFL 5ACLA 4FHBD 5I1CL 1CU4H 1EBAA 3JV5A 4OFPA 2B1AL 1JTTA 5I0DA 4K8RC 5IG7B 3MJ9L 1RFDL 1NDGB 3U4BL 1LVEA 5IEKB 5IT2H 1U8KB 5I1HH 2HG5B 1O7VA 5FM4A 5C0IA 4JANB 1NAMB 4V1DA 4LMQE 4U1SB 3D2UD 4IHOB 1Q1JH 1SBBA 4PRHB 5ITBL 2P8MA 4QRRD 3SDAB 1INDL 4JN2B 5CLTA 2F5AH 1EBPA 4HK3J 4LLYA 3EYOB 4MA3B 4D0DA 1MRFL 3TN0C 5CP7B 3SE4A 4EN3D 4DGIH 4U7KA 1LD9A 4L8SA 3D3VA 4U0RB 5TE6H 4X6DA 2X41A 3WDIA 5LXGH 3T0EA 1B4JH 2OYPA 3QDGA 4E5XB 1TVHA 3GBMH 2VWEE 1MFAH 1QD0A 2BP3A 5I9QC 2BXYA 3WN5C 3K2UL 1OP5K 5HYSA 3DX6B 1SJXA 1FZMB 1BFVH 5E1AA 1D7FA 2FR4B 3MV7D 4OKVA 1LO5A 4X7DC 4J3UA 2ZP0T 4AG4H 1I4FB 2XG4A 1F4WH 1RI8A 4ZXBC 3VFMB 3EFFA 1NJ9B 2O5XH 2FX8L 5F7WC 1TPXB 3I6GA 3WD5H 4JJHA 5DLML 3PV6B 2CJUL 3MLWL 3VA2C 2HT3D 1UG9A 4FQHB 5FYLE 4ZSOE 5J3HC 5D1XD 3V4PL 1BQHB 3VXPA 4LKXA 1YEKH 5FA3B 6CGTA 3GSNA 1RUKH 4HJJH 3NH7L 1I8KA 1A2YB 4JDTH 4NKOB 4HUXB 4JG0L 3EYFA 5SWZE 1ZAGA 4XNXL 1OPGH 5GGTL 4XNZC 4U1GC 4NKDA 1MHEA 4WCYH 3U7AA 2FH8A 3WFBL 3BISA 1IGTA 5IKCA 3NIDE 1CDHA 1EAPA 3K3QA 4HV8A 4NQSB 3K1DA 4ODXB 4QT5A 1NGQL 5F9WB 2DQTH 2H32B 4PJXA 5I2IA 2I25N 1HYSD 5I1GH 1VENA 4XCEB 3C6LA 1FRGH 3BXNB 1FNGB 5E8PB 1T1WA 4QOKD 2DB8A 5CILH 5D5MB 2JCCB 2A73A 1D5BA 5FDYA 5CBEB 3QDGB 4Z7VF 1TVBB 4QRRA 2O61B 1JZ5A 4HS3B 1HSBB 3GMPB 1J1PL 5JW4R 1NC2D 5C6WH 1JPSL 4CN4A 4X5WB 3C2AH 4RSVA 3MRBA 4MA3A 3QAZB 5C07E 4JCMA 3BPNC 43CAB 3WL9A 1BECA 5L8JB 5DGRA 5KVGH 4OLZH 2BSSA 3ARDA 1QP1A 3MLVL 2GKIA 1WZ1L 3TT3L 5B38B 2BRRH 3V6BR 4WNQB 5DJYA 3V6ZA 3QEHB 4CW1B 1BHGA 3QCVL 1G9NL 4GAJL 1S7WA 1BD2E 1W8OA 4HH9B 4Y0GA 5INCA 3ZDZE 3CVHH 1RVFH 4WHTB 1QLFA 4X99A 3RWIB 5BVPH 3BT2L 2OTPA 4UV7L 1T83C 2PF6A 3O9WB 5DWUH 2HWZH 2L4OA 3KPTA 4Z7WB 5HY9A 1BQLL 5ILTL 4KK8C 1CDYA 3LKSA 4LHJB 4W81A 2CUMA 3VI4E 3ULVL 5K93A 5D1XB 2VLRE 4ZNEE 5M95B 1FFNB 4LEXL 4TPRH 2EH8H 2X4OA 1T21A 5DJXA 3SKNA 4M6NL 4FQXB 5JIPA 4I5BB 1EO5A 1HI6B 2XXCB 4MS8C 5BMFL 2FWOB 1G9ML 1BM3L 4Q6YA 3DBXA 3U0WL 5J6GA 1UM5H 2PW2B 1MH5B 4OD1H 1CGUA 2QQQA 1NC4A 4Y2DA 3SKMB 3GSNL 3NZHL 4AMKH 1I8LC 3B9KC 3VMNA 4JREB 1AHWB 1IC7L 4JEGB 1KGCD 2YPVH 5T33H 3L5WA 2AJYL 3DWTA 3OMZA 5E6ZA 2IGFH 1ZT4B 4ZD3H 4WFFD 4LSSL 3GHBL 5F1IB 1MCPL 1MWAL 3QPXL 2Y9RT 1NC2B 3RKPA 5A2KH 5HHOA 3MUY1 3MRQA 5A16B 3GSRA 2NTFA 4NN6B 2C5DC 1D5MA 4NQEB 5DRNB 2GK0A 2O93L 3KPLA 2D0FA 4TVPH 5CMAA 4ZUVB 4XC1L 4Y2DB 2RR3A 3X3GH 4NO0D 4TQEL 3LKQA 1UWXK 4I0PB 2MOVA 4DTGH 5MENA 4Q2ZB 5HGBB 1RJYA 4Y1AB 3I75B 3BRGC 3LV3A 2VQTA 3CSYA 2DJUA 2BSED 4LVNC 4M00A 3T0DA 4WHYG 5E99L 2GT9B 1G6RA 2X70B 3DSFL 2Y4SA 1YZZA 4FFYH 4GAGL 2GJZA 4ODVH 5BOZG 4G6JL 1MHPL 3FO1B 1MY7A 4K9EL 5GJSL 1R3IL 3LS5H 3SGKC 1KJ2A 3BPLB 1Q0XH 3WUZA 3CD4A 3RWIA 4DK6A 1OARH 4IRJB 1YEHL 2EDQA 1DBML 2HT3C 4ZXBA 5FO8B 1F02I 2UYLA 5IMLA 4TSAH 2FIKB 1QRNE 3HUJB 4WWKA 5EZLA 2ICEA 4CBPA 1Q38A 1UZ6F 1YN7B 1XCTB 4W68A 3QHFH 1DTUA 2ZPKL 5KSAA 1FG2A 1OTTC 3KPNA 2P8LA 3BN3B 3O2WH 3FQWA 1DQLH 1KEML 5DFTA 3FQRB 3C6LD 2W0FB 1KELL 4XZUB 2PW1A 1MIEH 5DRWA 4JDVB 2FB4H 1DDHB 1REIA 2WIIA 5E00B 5CEZD 2KH2B 3GIVA 5JDJA 3DMMC 1LP9F 4PS4L 4U6VH 3TF7C 5E08H 4FABL 3Q6FB 3DX7A 4GH7B 2F74B 3UDWC 4OZIE 4UTBH 4GMTL 5TDNB 1G6VK 3CX5J 5E2VL 3BKML 1MHEB 4H0IA 2FX7H 1OWRM 3ZL4L 5HYIA 2DJ4A 1PQZB 1J88A 4UAOB 3EO0B 3BEWB 4OGAD 4ZUUB 5IVXF 3T0WA 3VGAB 4CNIA 4ZPVA 5CEZL 4N5EC 5J9PA 1JZ7A 2DQJH 3QDMB 3F58L 4U05A 4NC0B 2F58L 4HWZB 5D2LF 2BNUB 2LE9A 4P4KB 4NJ9H 2MPAL 4XVUC 1CICD 5MEOB 2F15A 4RX4D 3P4MA 3T2NL 3WNOA 4JFZL 43C9A 2PO6B 3PJSA 1A1OA 5HPMB 4Y5VB 4WTWA 3LZFH 1D5IH 4X5WA 1J8KA 5DEZA 1CLCA 3ALPA 5LBSH 1CGTA 3TO4B 1YYLL 4YGVA 4EBQH 1NGZA 3UYRH 4PUBH 4XBGA 5DGQA 3O3AB 3UZVB 1YEDA 3E1F1 1K8IB 4P2RD 3D3VD 1QYGH 1YPZF 4HX1B 1A4JA 3TP4A 4K8RH 1KCSL 3JV0A 5DJ2A 1A21A 1I3RA 3I84A 4LLVB 2VDOH 1KCRH 5IB5B 5FGRA 1Q1JL 4GBXA 4EIZC 4FP8H 2X9YA 5IMOB 3Q5YA 1QBLH 2VXUL 1INDH 2JIXD 1N6VA 3IU3A 5I15H 4OLYH 2B2XL 1YDPB 3ARRA 4P3CL 4LRIC 3S5LA 1AKJB 4G5ZH 3U1SL 3T1FA 1KELH 4X6CF 4H1LG 2DLGA 5TGBA 1A7RL 1S8DA 5E9DD 3VXSB 5ITFA 3O41A 2NNAA 4G8GB 1RJZA 3EDFA 3LCYA 1T5XB 1VGEH 2R1WA 1R3JB 2XWBB 3R8QA 3QXUA 3ZSSA 1WWCA 1NL0L 3DJ9A 5DUPL 2F9BT 3DI3B 4OJFL 2Z93A 4M7JH 4LIQH 4R97B 1OQXA 5TDNA 1FIEA 3VFGL 5HHMB 5T33L 4FS0A 1JUFA 1XGRB 3BH8B 2IGFL 1LNUA 2QSQA 3DSNA 4NSKB 1JN6A 3N1PC 1CICB 1IT9L 2FSEB 1BBJB 3TIEB 5DRWB 2VAJA 5DHYB 1TXKA 4OUUA 3MLYL 1ZHLA 2E6JA 4NGHH 5CZXC 5FUZH 3ZKMC 3LD8B 3QUYA 4JDVA 1CGXA 4LCWA 5DI8A 4K3EH 3BKYH 35C8L 1OW0A 4Q9CA 4YHKH 2J6EL 4QXUL 2UWEB 1OF2B 5HHNB 4HG4K 2BY0A 3JWOC 4JJ5B 2Z4QB 5IK3B 2CMRL 4OTXL 5IQ7H 2DWDB 4JKKA 1JPFA 1MWAB 1OT2A 3REVB 5JZ7C 1YUHA 1BF8A 3VXQB 2B1HL 4KPHL 5E8OA 2XI9A 3IFLL 1CFSB 1FAKT 4LAJH 5EBWB 5IOPB 3U2SA 3DXAA 2OQJA 5JOPD 1KJ2B 2V9RA 2OR9L 4J3TA 2XOTA 2Z91B 1VFOA 4P5MA 1RUAL 1DUYB 1M7IA 3VFTA 4C58B 4AY0A 2YPLE 1I85C 4PJIF 1OLLA 2Q3AA 3MTRA 5D6DA 3BP7B 4NFBA 1TJIL 5F1NB 3U30C 3C5JA 3D39E 1A64A 3BWUC 3OTTA 4U33A 2EECA 4KAQL 4I4WA 2QSVA 4PJ8A 1UM4H 1P84J 1AD0A 4X8JB 1FLTX 5IJVA 5CD5C 3P11H 4XWGL 3V7AE 4U1KA 2YD2A 5FYKU 3UDWA 2P4AB 4Y4HB 4YNYB 3FL7A 2A6DA 1JMXA 2DQTL 3L1OH 3BN9D 5JW3L 5I1GL 5B3JF 4NFDA 2BNRD 3VXRB 4ONOA 1YEIH 5TE7H 4KDWA 2CDGB 4BK4A 4CW1A 2YMXH 4Z7VB 3IXTA 1JP5A 2ZG2A 1CE1H 1CGSL 3R0MA 1NLBH 1EJOH 3ME0A 2L0DA 3EBAA 4MDJA 1NEZB 3OKEB 1P69B 1QHPA 1DE4B 1OAQH 3G6DH 1NFIB 2HTKC 4P57B 1OHQA 1N2RB 3KLAB 4Q74A 3MV8D 4LCWB 4XBPB 3H9SE 3CCHA 3ZE1F 4K7PH 2MKWA 3RKDC 4M7ZC 1NMBL 3ZMRA 2XTLA 5DXWA 5HGHA 3UC0L 3MRHB 3RVUD 5D2NC 3U36A 1RD6A 5D7LA 5F9JA 2R23B 1AY1H 1ZHBA 5TQ2H 1HHHB 5C0AA 4APQC 2H26A 1XGUA 1DBBH 5GSRB 1MCSA 4KK5D 3S34H 3FOMB 4GRMB 4YXKH 5F1KC 3G6DL 2ZSVB 4LSQH 1XZ0B 1TJGH 1U2CA 3MREA 1PW3A 5DD6B 1B2WH 3FONB 4F37F 3EIFA 3PXJA 4K2UH 2XZAL 4LDOB 3P9LA 3PV7A 2FEDC 4OSUH 1MVUA 4JFPA 1WFUA 4LPXA 1FZOB 1SYSA 2AXJA 2BSSB 1ACZA 1FO0B 1KLGB 4QRPD 1F4XL 1OLZA 1CL7L 3LDBB 3OHXA 1MH5A 3AFLA 1HDMB 4JGUA 4HEME 4YQXH 5HGBA 1NUNB 4RISL 4MD5B 5C0FB 3KYOB 4N0CC 3O0RH 1ZMYA 4OGYH 1ZANH 4G9FD 3D69B 4ZS6D 5E8EA 1JL8A 1G84A 2FDBP 4NUJB 4U1NB 3VFOB 4WW1B 1FZOA 1SM3L 2FLBT 9CGTA 2GCYB 1MJUL 2GQHA 4PJ5A 1P6AB 1FFPA 2Q76A 4NT6A 5ACMA 5EN2A 1U93B 4YWGH 4JRYE 4OCXL 2IMNA 3BZ4A 4M7LT 3SCMD 3QXWA 3HI6L 5I16A 3GRWH 5TPWL 1NKRA 3GSUA 1S78D 1LEKA 3WIIL 4I0PC 3FQXA 3QIBB 3FOMA 4JPVH 4R4NC 1IEAA 1FV1B 1H0DA 3QRGH 5DK0B 1QPXA 4MA1C 4WDIB 2ITCB 4IRSC 4WV1A 2RJMA 1XF4A 2D7TH 3ULVC 3WFHB 4HGKC 2EDWA 4HJGA 1HH9A 4DUXA 3IXAB 4YHZL 3RY5A 3VMOA 4C83B 5TQ0L 3BEVB 4E9LA 1UJ3B 3KXFE 5E1AB 3X13A 4OCSL 5TF0A 2YD4A 5IQ7L 4PJHB 2ATPA 4L29B 4XNYL 4TSAL 1FZMA 5JW4N 1AGCA 4OZFG 1NPUA 3VXQA 4QRPB 3KPSB 5EC2B 3S35X 4HXBL 2P49B 1EEYB 1IM9B 1P7QB 3OGOE 4LNRA 1HH9B 4ONFH 3CPLA 3KDMB 1U8HA 3SDCB 4EQ2A 2HLAA 3HG1E 3EOTL 1JNHB 1T7WA 4XPFH 4Y5YC 4P2RA 4I77H 4G9FB 4DOHE 1G9MC 5A1AA 3NVQA 2AJXL 4S10A 3U9PL 3JWDH 2FB4L 2V17H 2E7LC 1UVQB 2R9HD 3BUTA 4UILL 4NBYB 4JFDB 4UB0H 1VEOA 4HWZA 1EEYA 2OP4L 4KUZH 1I9JH 1C5DA 1RZJH 3JXAA 3NA9H 1FN4A 2Y1VA 3QUXC 1HQ4A 4KDTC 4BQBA 3OKOA 3JTSA 1DBAL 3QA3B 4C4KT 2V7HA 2ZUTA 1AGDB 4NN7B 3O3EA 4Z9KB 5GS2D 1ULVA 3RA7H 3QQ9D 4QRRE 1NBVL 4FG6D 4UAOC 2BJMH 2P8PB 1S7TA 2YR3A 2ORBL 3Q48A 1Q72L 3U83A 2Y5TA 5EO9A 4EI5C 4RRPG 3OGCA 4ODBD 3RWCB 2EIBA 4IEFB 5E8EB 4HWUA 4PJGE 3QUZC 1RZ7L 1INQA 3MCG1 4KRPB 2ZUXA 2I07A 3PE9A 3KPPB 3RVTC 1P7KB 1WCBB 1F3JB 3W9DA 2I26N 3R8BB 5B3NA 5D71H 4K94C 3ALWA 1Z9MA 3VG0L 4QYOA 3H7LA 3NCYS 3MV7B 4TNWF 1DUZA 4JM2F 5IBLC 5HI5C 5DMKB 3LKRA 4GRLB 3UC0H 4U2ZA 5BXFB 3FO9B 2AXGB 3L5XL 4X4ME 5MEND 1XR8A 4MQ7A 1XF2A 3ZHDA 3GJFK 2ATPB 4OF0A 3QEGL 5HHPA 4H1LB 4N0FA 1R3LA 3T77A 1A9EA 1BZ7A 1DJSA 1S9YB 3O2DH 3I3BA 4DVBB 3ZE2E 4JKPL 5JHDD 2R1YA 1G0DA 1NFDE 5HI4D 4F58L 4I8DA 4JN1H 1J0JA 5F9DC 1E4KA 1JHTB 4OLZL 2W9EL 1ZLUK 2BRRL 4L4VA 1JGUH 5DK2A 3W11C 4Y4FD 1NC4D 1DR9A 4LCUA 4H5SA 1MJ7L 3L5XH 5DUMH 1U3HB 1T0NB 3VGGA 4CGTA 5I0ZA 2R1YB 5FUCE 1LDPH 4OCLC 4OJFH 1XGTB 2NZIA 4NP4L 3NTCL 3LKOB 5FYKH 2QKIB 5HTSA 3QXAB 5HI3C 4AM0A 4LLWB 3R4DA 1WGOA 2VLME 2AJVL 5CGTA 5GGVL 3QWQB 3GJEB 4R97C 5DRNA 5EZOL 2EDRA 2NW2A 4KQ3L 4WFEE 3MJ8B 4Q0XL 4CDHA 4PJ9A 3VXUB 1T4KB 1U3YA 5ERWA 3ARDB 4YDKH 1IGJA 1YEEL 2BVPB 1L0QA 1G1YA 1KLFA 2NX5B 3QUKA 2OTWA 4KUCF 5IR1A 2GT9A 5KAQG 5GRXG 2UUDK 1EGJA 3K81A 4XP5H 3FT2A 1C1EH 1AH1A 1A6UH 1TTUA 4MJIA 3B2VL 5F88B 5SX5H 4DZ8A 4R8WH 1A1NB 1KN2L 3QPQC 4R0LA 1S7XB 5DJAA 4L8SC 3O3DB 5ID0A 1FZKA 2CUHA 2ZG3A 2ICES 3PF2A 3BDBA 3IDMA 4MWFA 3HG1D 1YNLH 4GRWB 1PG7X 1JHTA 2WWKT 4Y4KD 2YMXL 5DJ0A 1KACB 1ZSDA 1KENL 2W9DH 4OM1H 3VFSB 1FJ1A 25C8H 1OAYH 1Z3GL 1A1MA 1N5YL 5K59F 5I1DA 3VGDA 5LWYH 5FYLD 1WZMA 1ZS8B 2VSDA 4ZPTB 1ROWA 5KZCB 1NCBH 2HH0L 1B90A 3ARVA 4BFIB 3RIAF 3LKOA 1YMHA 4BM7A 5KSVA 1I8IB 1NC4B 1FIGH 1SJVA 2QQLH 2YD3A 4LHUD 4ODHL 5I66A 2NY7H 3UZEA 3X11A 2VLKE 3OX8A 5D2LA 1EUTA 1ZTXH 3WEXA 3WXWL 3C5JB 1MAJA 1NGPL 4HJ0D 2JJWA 5FUOH 4RMQA 5E5RB 4QY8B 4KGJA 4JG1L 1S9XA 5J3HD 4L8DB 3B5TA 4QOKE 3LS5L 3IJYA 1DBBL 32C2B 3CMOL 5E4IA 3QT2A 1JZ8A 3VI4F 3O6FB 1LK2B 1QOKA 4M48H 1NSNL 2DQHL 3AM8C 1A7PL 1M4KA 3SN6N 4ZQKB 4JE4B 4NQED 3MNZA 1KC5L 4U6YA 3BFOA 4NO0B 4P9HC 5LGHL 4I0PD 5ESVB 1KLUA 2LAAA 3PDOA 5BVJB 3T0EB 3KPQA 4U0RC 1RZJL 1QBMH 3NA9L 4MNQB 4X4ZA 3UBXB 2ADGB 1IMHC 2G2RB 5AYUL 1A6AA 1CT8A 4I3RH 1OP9A 4DGVL 2BNQB 4NOBA 2DQEH 1BLNA 4NQTA 1RHHA 2YN3A 1CLOL 4GAFB 4GG6F 4PJDE 3CMOH 5DVLA 5JQ6H 5DJ6A 4OIIH 2IANB 4NDMA 4NNYA 5GXBB 1XGTA 4IHOA 4UINH 3VD4A 4GKSA 3GHEH 4FQCH 3UTSD 2GUOA 1MAMH 3U36B 2AAVA 3VXNA 5GHWL 5FA4B 2YOCA 3LN4A 3IDXH 4Z5RB 5MP6L 3JZ7A 1CZ8H 1Q0XL 2X4PB 1CD1B 4LNVA 3CDCA 1NCAL 1LO5B 1H3WM 4K8RD 1QRND 1F3RB 3O6KL 1P2CB 3EYQC 4HX1A 2IALA 2X1WL 1PY9A 4RAHA 4N8VG 2AXGA 2ADJA 2DQJL 3ZE2F 1DDHA 3VFWB 1A7QL 4ENED 1CR9H 3HC0B 4F57L 3B2UC 3KNBA 5IW3A 4QRTA 2W07A 2ENYA 2MCPL 5J89A 5L2KB 4H8WL 3G08A 3EYFB 4I3SH 2FO4A 3AXLB 3TJHD 3GMLA 2RB8A 3LOWA 1FO0H 3VXPB 3EFDH 5LGKA 4MQSB 5ESAB 5EG6C 3IDIA 1LO4L 3WHE1 1FVEA 3F7VA 3VFWA 2XA8L 4X8XA 2HMIC 4ZPVB 1C7SA 2BNQD 4RBPK 2FJHB 3MPCA 4YHOL 2AK1L 3NABH 3FZUC 1PG7H 5C09B 5ALCH 4KROC 2VIRB 1N6UA 3CPLB 2ZUQC 4PJEE 1XGRA 1FORH 4BFGA 4C83A 1KPUB 4LPVA 1X5IA 2AVGA 3GGWB 4NIKB 3BGMB 1CFNB 3P4NB 3BW9B 3ZDYE 5CWSB 1S7QA 3AAZB 1EHXA 2LAGB 4HKBB 5EWIH 3RNQB 2OM5A 3BZFB 1I3UA 4XBGB 4JFDA 4BSWA 4F7PB 2YN5A 4K8RL 5FOBA 3IFNL 4LCCA 4OLWH 2VZ1A 2J4WL 1I9JL 3QUYD 4XH2A 1YMMA 1T2QH 4JG0H 1X5GA 2Y07L 2GTWB 1MHHA 4IRSB 4J7RA 3L3HB 4CVZA 5DUPH 4P2RB 1K8DA 2H45A 4CVXB 1AGBA 1CWVA 2AK4A 4G8EB 2PYEA 3MRNA 3RZWA 3VRIA 2DTMH 4Z6AT 1P4IH 2CJUH 2VDQL 4BSVB 4OIBA 1R3HB 5KVMC 1JYNA 4OGZA 4PGJA 1YEKL 3EOYG 4LGSB 1ED3A 3CC5A 2WWKO 3QEQE 4X9HA 1LEKB 3TNNA 4OZGB 3KPSA 4S1DC 5DMGD 2R2HB 4EEEA 4G7VH 2VDNL 2HKFL 4P3CH 1U8MB 4D8PA 1CTOA 1AI1L 2H32A 3L3OA 2VYRE 4IDJL 4MJIE 4L9LC 1OL0A 3TBYB 3O4LE 4U6XA 2EDBA 5C0NC 2AI0H 4HUUB 2NZ9C 3C5ZD 4NN6C 1T6VN 5CEYA 3CFJA 4FXLA 1FNHA 4KI5C 2HKHH 4RMTA 3LEVH 3I75A 4V1DB 5DT1L 2IC2A 4NZUH 1PG7W 1JGLL 1MCWW 3AREC 5DFVD 3S7GA 2OJZH 1LO2H 3FB6B 3L3KA 1RURH 5C0JB 3DMMD 5F7HA 4Z7UF 4TULH 3JTTB 1AXSB 1F8TL 4Y16B 1W72L 2Q8BH 3RA7L 2CDEB 3MLSH 1ZT1A 4MAYA 4XCCH 1RIHH 2XN9E 3FFCE 1Q94A 1J11A 4KI5D 1A7NH 1SYVB 3HNVL 1KFAH 4MJ2A 5GGQL 5BVJA 1V5JA 4HS6A 1JZ4A 2OI9C 1I7ZB 3D6GA 3KJ6H 2H1PL 5B22A 4KKCC 2WAHA 2BHUA 1N7ML 4JY6A 1LHZA 4EZMA 3GO1H 2HWZL 4XBPA 5DQJB 3MA9L 3X3GL 2WBJD 1CK0H 1FLRH 3ILPB 2R23A 5GS1A 1AQKH 2IQ9L 5L8LB 4HBQA 2DYPD 4XAWL 2JJVA 3UXFA 3S37H 3JSSA 2H6PB 4WO4C 3CMGA 4P59H 2VC2L 4GJTB 5E99H 2E9BA 2IPTL 4XP9H 2QADD 3ZKQD 3CUPA 4JZOA 2WUBH 4X6BA 1S5HB 3QEUA 3C60A 4X7FC 5MEQB 2OR7A 4GKOA 4MD4B 2W65A 1DANT 4P9ML 1KB9J 3LMJH 3AUVA 4HC1A 1MJ8H 5DD6A 1RZIB 3TJHC 3BP6B 4BZYA 3FHQA 2YPKB 1S7SB 3HZYA 3RL2A 3L95B 4PJEF 2B5IB 3P3YA 3E0GA 2ATKB 5E56A 3OBAA 2E7BA 1FZKB 1G7PB 3V4UL 4KZDL 2PETA 1F6AB 5TQ2L 4Y16D 3VFUA 3KXFA 2WNGA 5K9JH 4PP2A 1LO0L 2XKSA 4XZUA 1MCNA 2SEBB 2JK5B 4G8IA 3IGAB 2YA1A 4ONGL 4UV4H 4P4KC 2VXSL 4D8PB 2XIDA 4NKIL 3OQ3B 1ADQL 4NWUH 4XPTH 4YK4B 5T3ZE 5FECB 4N8CL 1GXEA 5F9OH 1A9EB 1BZ7B 1KPRB 2J8UA 3MXWL 1FE8H 4TOYL 5IF0B 1JV5A 5CCKH 1OB1A 1A7OH 4ZFZA 5FGBA 3IDYC 3KLHD 3WKML 1ZT1B 1Z5LB 3M1BB 5DYOB 3ZTNH 1M7XA 3O2DA 1HNGA 3MMEB 4HULB 5HY9B 3I50L 5EIIA 2C7UA 4U1HB 2YSSA 3G5XB 3Q1SL 5KS9F 3OG6B 5DD5L 1T0MA 5KSUB 1XF1A 4C56B 4I5BA 4BZ1L 2JCCF 5HDQL 4OI8A 3D85B 4BSWB 1IC4H 3D18B 2NNAB 4JFEE 4HXAH 4WI4A 5IB2A 3T3PF 1RZGB 1M7DA 2X4NB 4HEPG 4G3YH 3I2CH 4B7LA 2LQRA 4PYGA 3N1FC 1AD9B 2I9TA 4QLRA 1CD8A 5HGAA 4N9GA 4KJWD 1TJGL 1RK1B 3JV4A 3OAYK 4G8FA 4U31A 2QQKL 5BO1H 2C3HA 2RHEA 4I48B 5DJ8B 5CSZA 1K4DA 5ACZB 3TA3A 3U9UB 3V5DB 1RQ5A 1S9KC 4OLEA 1E4WH 1EO8L 4PTUA 4JFQA 5HYSG 3PQYB 5C2BH 1G7QB 2XWJB 2FL5B 3RRQA 2WW8A 1M71A 4LPYA 3KPRA 4NWTH 1MREL 5D2NA 5DEGA 5B38A 2HVKA 3ZL4H 4EXPX 5F6IC 5F8QC 1U95A 3L5JA 3MV9E 1YYMH 1XF3B 5MHSE 3BP5B 3GJFB 3L3GA 5T3XL 2BY1A 1T5XA 5DEFB 3PGDA 2BNUA 3IAPA 4YDIH 3LKNB 4HIHA 4NQVA 4NCDA 3OG4B 4FQXA 1PSKL 4UU9B 2F53A 3Q0HA 4KHTL 4QGYA 3X12B 1AR1D 4UBDC 3TIEA 4GAYA 5I2IB 3WLWD 4RA0C 4XX1G 1NGZB 2BVQA 2P5WA 1H8SA 1PKQB 3P4LA 1V8HA 3D2UB 4FQIL 4JFFD 4C56D 5L8KB 3U79A 4ZFGH 5EO1A 4NC1C 4BUHA 3TA3D 1G7LB 4A6YH 1MFEH 1U8OA 4K07A 2XPGB 4D3CH 3O11A 2F53B 3K1KC 4LKCB 4YDIL 2GAZB 1UQSA 3T8XA 1UENA 5L0QB 1RK0A 4AENA 4R96A 1SQ2N 3GK8L 3W9DB 5LCVH 3RZCB 1DFBH 4L5FL 3O41B 2FD6H 4Q6IC 3OKNA 4J3VA 3GMOB 3LRSA 3MODH 4APQD 1OAXL 3TT1L 3KDMA 5DS8B 1U3ZA 5JOEA 3LEXA 4YDJB 2V9QA 2IPKA 5D8JH 5DMJB 1MCKA 4R26L 1PFCA 3MMEA 4NO2B 2FR4A 4PB0H 5CEXB 1B0GB 5EU6B 2NLJB 1QUNA 2F74A 4P46A 3VA6A 3MOBH 4HDIB 1XGYL 3WUWG 1SEQH 2R29H 1CR9L 3OB0K 1CTNA 4JQVC 3M17A 2R2BB 5IFAL 2H2SC 1HNFA 5IB4B 1KB5A 1MREH 5DC9B 1U58B 4PYHA 4PLKC 5F21B 5ADOH 3I02B 3GK8H 1I3VA 2AJXH 5E0QA 3WE6A 2KQMA 5EUOA 4N8VA 3QA3A 5IB2B 2IBZX 1VSCA 1BQLH 2VLJB 2Y25A 4HGMA 5FKPA 4Z5RA 5ILTH 1N0XL 3I6LE 1KNOB 1NBVH 1CQKA 2WBKA 4NKOA 1P4IL 4S2SB 5ANMA 3DYPA 1VFAB 4Z7OF 1EZVY 1G7PA 3LQZB 2VDLL 2YS4A 5C0IB 5FOBB 4YAQA 4KKCD 4PTTA 3K4AA 4NGHL 2J2ZA 1DBAH 3QJFA 4H20H 1UB5B 2ZOKA 3MRRA 4HCRA 2AABH 4HS8L 5SX5K 4JZJA 3NAAL 1Q9WB 3MA7B 5KVEL 4PR5A 4KROB 2VXQL 5D2NB 2A74B 5I1CH 4L3EE 4S11A 3QDGD 4DZBA 4H26B 1M71B 3GSRB 3HC0A 3ES6B 5ISZB 4NRZB 1I1FA 4WW2A 4PJBE 1ZT7B 5AAMA 5HYQB 1J9CT 3WS6A 1CLYH 4RWHA 4DN4H 2IPUK 3P4OB 4XCFH 1FFQA 1PGRB 3GB7B 5DFVC 2FEEI 1XF5A 4DN3H 5BJTA 4FTVD 4NM8L 3TYGH 3OXSA 4QHUB 4KTEH 3DROA 3PNWB 2J3SA 4XI5C 3MNVB 4YBQC 4MMXC 3B9EA 5I1LB 3F7PC 3RVXD 5J13B 4P3WA 3OHXB 4HFUL 5L2JB 3ZKNC 1PLGH 2WQ8A 4DWHA 3U7YH 3BN9C 5CGYC 4TUOB 3KYKL 1MVFA 4U1SA 1RU9H 4JO4L 4EUPG 3ROLB 4LEOB 4O5LH 1FL5A 5GRVK 5KS9A 4PJGF 2HG5A 4W6YB 5F96H 1GHFH 1U0QA 1YEEH 4GW5B 4HV8B 1XZ0A 5C08E 1EXUA 1PYWB 5A2FA 1V7NH 4XP1H 3R06B 4K3DH 2YPVL 2WANA 4JO1L 3VDCA 1QSFB 1BIIA 4XT1C 2IH1B 1U3HD 3U46B 5IESL 4RMSA 5E5UB 4MXVE 2E7LA 1NBYA 3MRFB 4HFWB 4ODSL 5ECJE 3VXOA 1FNAA 43CAA 2F8XC 2VLMD 2HFGL 5CJQH 1PJ9A 2UY7A 1OAYL 4P23C 1FFNA 1NGXA 1QFWL 2VDRH 3OAZK 4UIMB 4OZIF 3MUGA 2BXZA 1QSFA 4NHCL 1KYOJ 4FQQA 1A22B 2OL3A 4O51B 4ZAKA 4NC2B 3QIWD 3MRQB 1NBQA 4TUKH 3ARBC 1A6AB 5J12C 2RIKA 2NY7L 4KHXH 5CMAB 3L3DB 1JWUA 4M1DL 4RFEA 1MFBL 4XVSH 2C1OA 3WSQL 2D9CA 1KTDA 1YUHB 3GMRA 1XIWB 5INDA 4PJIA 2OL3H 5JLZB 1S5HA 3QHZL 5IB3B 1F3DJ 1WC7A 1DN2A 5LQBH 3IJHA 4JG1H 2CIIB 3H0TA 4KJYA 2OL3B 4NKDB 3MV9A 1FNEB 5K9JL 1MI5E 2QL1A 3N1QC 2JLLA 3LB6C 5GS1B 4LL9A 5IQ9B 2NY6B 1S7RA 1X4YA 4NFCA 2VWEC 3RUGE 1S9VA 1A6TB 4U3XA 4KHXL 4Z7UA 1D5BB 1NDGA 2BZDA 3EGSA 2X4UB 3S9DB 3LSOB 4G42A 3THML 5C2UB 5LKNA 3LV3B 5GZOC 1H8OA 4LHUB 1NFKA 4LPWA 5FO9A 2UWEF 4YE4L 1UT9A 1LP9E 4UQ2A 1NGWB 2EEDA 3A6OA 5BJTB 1HSAB 5GS0H 4PGZA 3QXTA 4M02A 3VDBA 3RAJL 1GZQB 2A1WH 4U1JB 5AYQA 1ORQB 3M8OL 2AKRB 5HDQH 3HC4L 3X17A 4BZ1H 4X6CA 1WLHA 3P40A 2UZXB 4QKXB 3LKRB 1JWUB 4YHPA 1JIBA 5EOQH 2IBBA 4WENB 2YWYA 3O45B 4GKNA 2UZIL 1CU4L 3SGJA 3BGFB 5GZOD 1JZ6A 3S96A 4RGMB 2F8OA 3O8XC 5GRZA 3IDJA 2VLJA 3C6SA 1UKSA 1NGXB 3SPVB 1NAML 5IV2B 3MRKA 4C59B 5FFLA 5J57B 2JKXA 3EDEA 3FO0L 1RHFA 3L5HA 4XVSL 2OL3L 1MIMH 4K7PY 1R5IA 2E7CA 1ONQA 2X4SB 3N1MC 4FFVD 4N1EA 1ACYL 3WS6C 2OJEA 2ATKA 2IAND 3PWUA 3QO0B 4XHJC 5GRUL 1U8JA 4WEBH 1VESA 3PP4L 3QNZA 1CD1A 4ETYA 2E5EA 4HKXA 4QXGH 4MJ5B 4YFLI 4OFVA 3RWFB 3BP4B 5K9KA 4M6ML 2P8MB 4NQCA 3H6JA 5C08D 4OGAC 2XN9A 1YMMB 2NY0C 2H2SD 4NZTH 4GG8B 3HLAA 4Q9RH 3AS0A 2VL4A 5GS0C 3KPNB 4G8EA 3HCVB 4MNHB 5DEGB 3S5LG 3GSWA 1VADA 3ZDZF 5DMIL 4P5TA 3VWJC 3KNBB 1NCWL 2VABA 3M07A 1RJLB 5T1KA 1SY6H 2Z9TA 3U9PH 4HSQA 1I9EA 1MFCL 2UV3A 2DLIA 3OSKA 5K9KB 3VG0H 1LO4H 2X4QB 1WQVT 1FL6A 1G7JA 2YUVA 4AYFA 3S36H 3JWDC 1QVOB 4WFGE 4O5LL 2V5TA 3PWJA 5E9DB 3VXSD 4Y8AA 1U8PB 2DL9A 4YGVB 2AS5M 2CDFB 1OM3H 2EXWC 3K74B 1X9QA 3RY6C 5I73B 3P73B 4W6XB 3FO1A 4EDWH 3OKNB 4OZ4A 2I24N 5F3HB 1MEXH 5DMIH 4MXWL 3LEXB 4YDJA 1SEBB 1O7SA 4PGCA 2XG5A 1PZ5B 4UT6H 43C9B 3NCBB 2VB5A 4HIHB 3GSNB 5EWIL 2XA3A 1ZGLA 3NA4A 3VG9B 2ICEB 1UKTA 5CJBA 5EC1B 4IIQC 3FAWA 4RBPH 5J1TC 5EPMB 5FUZL 1ORQA 1T1YB 3UPRB 4NQCB 1KCVL 2XNAA 1MCIA 4L8BA 2J8UE 1FYTE 5FYJL 5KANI 1PKQA 4PRPD 2F5BH 4POYA 3X14B 4GBXB 1G0YR 4BH8B 4JHAH 4HLZG 3QCUL 4MNGB 5T1KD 3DX6A 4X5XB 3VFOA 1AGCB 4X9BA 3BYTA 3VCLA 2W0PA 2WIIB 4NZTL 5ID0B 1RVFL 3DNKA 3S3SA 3VFPB 1FVDA 4NJ9L 3RVUC 3BZEB 3FO2A 3E3QC 3CXDL 3MYZA 4L4TD 5EUKA 3RHWK 5M7QA 1RIUL 5DZLA 1J1OH 1IQWH 3AU1A 5HHXH 3PWNB 1FVCA 3EHBD 2WQRA 1KEGH 1BVKB 4YIQA 5BRZD 4CMMA 3WFBH 1UADC 3GSWB 2ZUUA 5GS2H 4NQDD 1TZGL 1DVFD 1N64L 3QIWC 3ARWA 1KN2H 2NY1C 5GISL 4M8QB 4MJID 1SEQL 2R29L 3K2UH 1QPPA 3QIUD 1IEBB 1M6OA 4WUKH 5J9PB 4X6DF 4PV8A 2QHRL 2FEDD 3L3IB 3FQXB 5I76A 1RZIA 5C6TL 4QHNA 2LABA 4MXQC 4HKZA 4D9RD 3EYSL 4P49A 3E8UL 2QSTA 5I18L 3OV6A 4PRIB 5GS0L 2G2RA 4OF7A 1IAOA 3T0EC 3FB5A 4HKJA 5JW3H 1VFMA 2PW2A 1MCQA 3IU4L 3MGAA 4M8QA 1B2WL 1EHLL 4PP2B 5D7SH 4F15C 5CINH 3HNSL 3H8NA 3NFPA 1RSFA 1JGLH 3OKKA 4Y4KC 3VRLF 3EKCA 3NH7H 4OBSA 3RVWD 1OGTA 2ARJQ 5EOTA 5D93B 3VXRD 3AROA 2X40A 4IJ3B 2Q87A 3ALXA 4KGLA 5C6TH 2Q3ZA 1T5WA 3HAEG 3KPLB 1KIRA 1L4IA 2DQDH 3DTXB 3HS0B 5HPOA 2G5RA 1NGQH 3SJVE 5EBWA 4WWID 4L9LA 2BC4A 1JNLL 5SV4A 4MQ7B 5T5FH 1XF2B 5FUCC 2EYTB 3DRTA 3S4SA 5HHOB 3ULVD 3FB7A 1ND0B 3ROLA 1CDUA 2WBJB 4ZO9A 4G6JH 1U6AL 3QDJE 3CXDH 3MFFB 4MCYA 1OD9A 4UIMA 2XNAB 3WJLA 1A6WH 3BOVA 4HAFA 2HRPH 2HA1A 1MCLA 1HE7A 2DQDL 3AB0C 4K94L 4UQ3B 4RFOH 2NY2B 1IGCL 5J13C 2DKUA 2FWOA 4ZO6A 2OXHA 4JHBA 5I1KL 5DK2B 5FYJU 1EFXD 4X4YB 3LB6D 4R6UA 5J7CC 4PRID 5SX4I 4G80A 3PWVA 3IFLH 2F5AL 1JGEB 4F33A 2ZKHL 1VDGA 3H42H 2VR5A 1BOYA 1ZLSH 3BAEH 2DMCA 2F54E 2A6IB 1OAUH 3PL6D 4ONGH 5TE6L 2GEEA 3IB4A 1UFUA 2WK2A 3NPSC 1QEWA 3QQ4B 4Q9QH 1TCRB 3MJ9A 5DMKA 2X4QA 1MWAA 5EU5A 4PJCB 5DD0L 3MJ8A 3GHEL 4OZHE 2YD6A 5ESAA 4O00A 2D31A 5F8RC 1JHKL 4LAQH 1T20A 4QO1A 4MHHG 4AK1A 2EYSB 2XTJB 4IIQA 4E41B 5BW7A 1QBAA 4MMZC 5D1QB 5KANG 5F9OL 1P6FA 3T65A 4H8WH 1AGFB 2VE6A 3TN0B 5I71B 1ZHKA 1FGVL 1TTFA 3HE7A 4JRYD 2GYSA 3QRGL 2E9WA 5AAWA 2ZJSH 1H8NA 2J8UF 3BW9A 3ZTNL 1QO3A 3KVQA 4MAYC 3UJTH 4JFYA 1J8HE 3V0VB 3LHPL 2JJUA 3RJQB 3AC0A 3WN5B 3U6RB 4GG6E 4NQDE 1U8LB 4YHZH 3HR5B 4MSWB 5E2UH 3QQ3B 1Y6KR 4EI6B 5E94A 4LLWA 3SDAD 4NQSA 2FRGP 4KTDL 5DSCA 3LS4L 3UPCA 3GI8L 4XMPL 1XF4B 2NY3B 3EJJX 2EKJA 5F1OB 5AD0B 1VB9A 3KPPA 4PJ7E 5GS1C 4EUPA 5IGXL 4P4KA 1NEUA 5DQ9A 1RK0B 5D9SB 1BP3B 2FHBA 2XA8H 1HHIA 3CLFH 5EOCL 3UZQA 4XCNA 3G08B 1AGBB 1FCCA 1MHPH 1VACA 4EUPH 3LHPH 2WM0A 3W9EB 4F2MA 4I3SL 5IMOA 5IJKA 4XXCC 4G9DA 5EBMA 5D4QA 1BZQK 4XNZB 3QWOA 4UILH 3MXVH 3ZT6A 1A4JB 4GXVL 1KLUB 3PDOB 4KH2A 3HI1A 4UB0L 4AZ8A 4GRWF 5F9WC 5C0EB 4PGEB 1LE5B 2LTQC 2P47B 4R7NA 1GAFL 3BT2H 4OF6A 1BJ8A 4YPGA 3V6FB 1RZFH 1AO7A 1UH4A 3LN5A 5SWZB 5C1MB 4FOMA 4PJBF 3U0PA 1RJLA 1E6JL 4WV1B 1MIEL 2DLTA 5DO2D 4K3JL 5CJOH 1OAKL 3NCEB 3RTQD 1QNZL 3QAZC 3IKCB 4AEIL 3BJLA 3BPNB 1PEWA 4QXTB 5JZ7D 5EU5B 4JFFB 1KGCE 4I1NB 4HLJA 1E4XL 4QRUB 2FSEA 4RX4A 4K3EL 2GAZA 2YUZA 1A6VL 3UJIL 5IFJB 2EXWD 3EJZD 3LAFA 1I9IH 5HVFB 4FZEL 3QNZB 4WIQA 3HR5A 1WBZB 2YKLL 4DFHA 1R24A 3RWHA 5DJ2B 4LASL 2Q7YA 3NCYP 4YHLL 2AP2A 4QRUA 5TF1H 4IMLA 4MCZA 4RQQA 4NZUL 1GRWA 1DLFH 2NLJA 3SGDI 4OUOA 3WIHA 4FQXC 4JFZH 4KUCD 3AXLA 1GC1H 5TGBB 4P5TB 1U8NA 2H41A 5MENB 4ODUB 4G9FA 2IPUG 1DL7L 1C1EL 4FQLH 2PTVA 1JF5A 5LXGL 3WIHH 2BERA 4K7PL 3BRDA 1CT8B 3A67L 2DQFA 3TVMB 4U1LA 3MYJA 5JHDB 2HTLC 5B39G 2OSLB 5AD0A 4BFIA 1H9VA 5I66B 2ZKHH 3CSBA 4JM2B 3R06A 1YEFH 4MZ3A 1N0LA 2VLKD 4JQXC 1R0AH 3EOTH 3EDJA 4Y4FB 1WCQA 5FYKD 1IKNA 3U82B 1ZA3B 5J6GB 3FTGB 3MSPA 3Q5OA 2NY5L 1A5FH 2A2QT 2CO7B 2YA2A 2Q20A 1QNZH 3DGGB 4HC1L 2R2EB 2HFFA 2H9GB 3BIAX 3ZT7A 3R1GL 4L3ED 2M1KA 4U1IA 5C3LD 1CVRA 4G8IB 2BSTA 2LVCA 3KHOA 4PRDB 5L6YH 1A6VH 3UBXI 1XCQB 2C3VB 2RFXA 1EEZB 5TH2B 1EHNA 1C8PA 3ULSA 3RI5F 2GK0B 4O4YH 1JNJA 4K3DL 3O4OC 4HCRL 3KHQA 5HHPB 1UEMA 4LVEA 4PLOB 4PJIB 4MZ2A 5DYOA 4JHWH 1RUAH 5CAYB 5IEHA 3SDYL 5CJXC 2OTUA 1K4CB 1GC1C 1A7OL 1OOAA 4F9PA 3SBWC 5SWSE 4RDQF 3UTZB 2C1PA 1A3RL 4JAMA 1WTLA 4FZ8H 3L5IA 3TCXA 5IROA 4WY7H 3STZB 3CCHB 4LCUB 2I9TB 1WT5A 2WP3O 5DJ0B 2X5PA 1JCKA 1U3HA 5F1NA 1U3JA 1EUUA 2X4UA 2AJYH 2OTWB 4WUUE 3OJMB 3MLRH 5KZCD 2MNUA 3BPCB 3ARYA 1MUJB 3MV01 3PP3H 3JUZA 4FQCL 4G6AD 2AEQH 4M6OH 2VKXA 4KRLB 4PJXB 1I8IA 5ABDE 1JPGA 5CJQL 1LE9A 4FFZL 4YQXL 1W0VB 1KJMA 3P0YL 4MCYB 2ESVE 2VN4A 2CK2A 3BD3A 3RNKA 2FIRT 4JPKL 2Q8AH 1WEJH 1HYRC 5ENWB 1SYVA 3UJJL 5GPRA 3O2VL 3TO2B 5DK3A 2EYTA 3DRTB 3RU8H 3S4SB 3FO9A 4R2GC 5EORL 1K85A 2X4TA 3QDHA 2DQFB 1JJUA 1MCCA 1T0PB 2E9JA 4WW1A 3VRIB 2P44B 4EXKA 4R0LB 4O2EA 4HF5H 2EXYC 2HFTA 4ZQKA 4ESKA 4ODVL 3ILPA 2DQEL 2V2TA 3GI9L 1YDPA 3WIIH 1CLOH 3UTPE 1A4KA 1SJHB 5BZDA 5IMMB 2PO6C 1MCHA 4Y5VC 4NQDA 3B9KD 4YHIB 4HIIA 5DHVH 3QUMA 5T5FL 3KPMB 5BRZA 3V7AG 1QQDA 3DVNB 3GIZH 5TE7L 4I2XB 5JW5B 1WITA 1LMKA 2IG2H 4AL8H 4WW2C 1G7LA 1OAZL 2M2DA 3SO3B 4C4KO 3RVWC 2COQA 2GFBA 4LP5A 5EU6A 3QNXA 1EGJL 1EEQA 3QDMD 2NY6D 1HWHB 2VH5H 5KVDH 2AEIT 5BZWB 1BBDL 1H5BB 4PJFF 3D87B 3B2VH 3JTSB 2ZCLH 1XT5A 2ICWI 2PO6D 5E8NA 5MEOA 4AM0B 4CN1A 3OPZL 3GSQA 4CN6A 1R5WA 1RUQL 4ZAKC 3MRPB 2P43B 2D2OA 5I17B 1HXMB 2ED7A 3KYAA 4XPBL 5D7IB 2PYEB 1BFOB 2CK0L 4OUUB 4PJBA 5EOQL 5EO9B 2PXYA 3OKYA 1IM3B 1J0HA 3CIQA 5F93C 5HYEA 1WJ3A 2HTLD 5C6PB 4YXKL 1ES0B 5LWYL 1IM9A 4LNRB 4OCXH 4XB8A 3QQ3A 4Z7WF 1NCBL 3SDCA 5J11C 3BVNA 3SDXE 3IT8D 4MNQA 5E9DA 5T3XH 4A2LA 3OB0H 3MLZL 4LLDA 3T1WA 5L9DL 3DYOA 3UTZA 3CFCL 4XXDB 4HWNA 4YHYB 1JPTH 3HE6A 1I7RA 5F7UA 2DQUH 1KYOK 3NPSB 1K6QH 2QEJA 4APQA 4GOSA 4G8GE 1H3TA 1RAMA 3EYUH 4OZFH 5DJYB 1XGYH 2CRZA 5BXFA 4Q9RL 3FN9A 2CLRA 2CIKB 1D6VH 4DVRH 1KCLA 5ICXA 4O02H 2XTJC 5JOFB 3UTQA 4JZJB 3T3MF 1KXTB 3N50A 1H0DB 2ZCKL 1QHOA 4U6VL 4IS6B 5KSBF 5E8NB 3RIAK 1B88A 2VITA 5KSAD 3TO2A 1NAMA 2P5WD 3TYFA 1EERB 3MFGB 1CICA 5ITBH 1BFVL 3KJ4B 5CJXA 1F4AA 4JPWL 2FX7L 2MQCA 5EZJA 4N1CA 1IKFL 1MY5A 1K4DB 1KJ3L 4V2CB 2HN7A 3OJ2C 4ZTPL 3JV4B 5GRWA 1QSEE 3MJ9H 2FX9L 5IVXA 5IT2L 3O3UN 2UVFA 1MJJB 3D5OF 4JFOB 2QTEA 2XZZA 3F58H 3HI5L 2AXFA 4YHIA 1JI1A 2NY3C 1T66D 2EDJA 2WIMA 2ZCKH 3BKJH 3MNZB 5EIQA 2VE6B 3TN0A 3H3KA 1IARB 3LQAC 4GRLA 4QF1B 3TJEL 4H20L 4HIIB 5MP6H 2R8SL 1JFQH 1HH6A 3MRPA 3FOLA 1N2RA 3KLAA 1VKXB 1YQ2A 1QA9A 1MELA 2BVPA 5K9QG 4QNPE 4H25A 5DZOA 4ZUVA 1B4JL 3VFNA 1EO7A 3QCUH 2EDHA 1YEGL 5BZWA 1BD2A 5GRVL 4NQXB 2AEWA 1MLCA 4YHNA 4R90L 1D6EA 2YPLB 4P3DB 4WGWB 4UZGA 4RGND 4RQQB 3UTPD 2YPKA 3BEWA 3EUUA 4TSCL 4J12A 5SV3A 2P48B 3P0YH 2DL2A 4S1DD 1IQWL 4TNVF 5DMGC 5EUOE 4Z0BH 1XH3A 3BKYL 3WJJC 2FECL 4M03A 5IJVB 4ZXBD 4XWOC 3JWNC 2E27H 5T3ZH 3ZE0F 1OGAB 1YPZE 2DQCL 1RZGA 3N85L 1JNNL 4MVBD 2XACC 4I3GA 2CQVA 4Y4HD 2J88L 3PG2A 5HI5D 4LLYB 5IBLD 4J1UB 4NRXB 5LJYH 1EZVX 4U1MA 1S7RB 3CFBB 2R1XB 1TPXC 3CVIL 5FF6B 3OX8B 3W0WE 4Y5YA 3S35L 3HUJA 1HDMA 4ZO7A 2EDXA 4LLUA 1RIUH 1N3NB 2GSGB 5IFHH 4M43L 5A3ID 4G6MH 4FQ2L 3L7EA 2CIIA 5DC0A 1UB6A 4Z78A 4GKNB 5L2KA 1FNEA 4Z0BL 1MRCL 5DTFA 4HAGA 4LCWE 4S1RH 2CLRB 4PV9A 1FFPB 4PJDF 5D70L 4L4TE 4UDUB 2WUBL 1KPVA 1S5IH 1T7VA 1D9KB 3QFJE 4KDTA 3S98A 1Z3GH 2DMBA 3DPBA 3UX9B 1B4RA 2IADA 4O58L 5BVPL 3RFZC 3D25B 4YHKL 5TE4L 3G6JF 1FJ1B 2H26B 5TH2A 3ECBB 1HH6B 3SE9L 1GIGL 4KWUA 5FGCB 4P5TC 5I19L 2LFGA 1DVFA 1FYTA 4ZDHB 1J8HA 3VFVB 1P4LB 3EGSB 4XBEH 1PEZA 4LEXH 3O8XB 3FQUA 2HFFB 3QR2A 1ZLVH 4WDIA 4HPOL 4OQTH 5DF0A 3ULUH 1RIVL 1BF2A 2DRUA 3QDMA 1KBGL 1TCRA 1MCJA 3GM0A 2I27N 1YECL 3EYVA 5K9OA 1R0AL 4H26A 3GDBA 3GJEA 1UM5L 2HFEA 1YMHB 3BESR 1FGNH 5GGRA 4OQTA 5TQ0H 3KR3H 1ZHNA 3NMEA 2DQCH 4F3FA 2GITA 4Y4FC 5EZIL 1A9BA 3GFUA 2DYPA 1ORSA 4MXQD 2FATH 4I0KA 3KPRE 4NOFA 1TTGA 1FYTD 5D6CB 2VL5A 4X7SL 2NZ9D 3C5ZC 3LEYL 4PJAA 1KJ2L 5JXAL 1BQUA 1MNUH 4U1NA 5DUML 2Z8VC 2OJZL 3EJYD 1E28A 4MA1B 1CD9B 1T22A 3SJVA 1F42A 5D7JB 3SOBL 2UZIH 3STZA 1JGVL 3OAUH 4YR6B 4NYLA 1WICA 5I1LA 4Q2ZA 4L4JA 4W4NA 2Q8BL 1UYWL 4JKMA 5IB4A 5IVZB 3INUL 1CFTB 1RPQA 3DSFH 3VWJB 4L8CB 4F9LC 2YBRB 4JREC 2MHAA 3DMMA 2X6MA 4UDUA 2ENSA 3HR6A 1J7VR 4NNPL 1GL4B 4PJCF 4ZPTA 5BS0B 1VGKB 1JGVH 4Y5YB 3L7EB 1MQKH 4ZFGL 4PRDA 4QTIH 1L7IL 3MRRB 1NH6A 4F8QA 4D9RE 1OTUC 4L3AA 1EEZA 2ED9A 1KTLA 1U2HA 4HK3N 3VXTB 1T2XA 3K2MC 2EZ0D 3P9MA 1YNLL 4PGCB 2F54D 1MUJA 5JIKA 3WNMA 2APXA 4OM1L 3RNQA 1MCFA 3A6BH 4DAGH 4ZO8A 2NY1D 3ARSA 4U6HA 3ARUA 1NLDL 3HFMH 1IAKB 2B4CC 2I07B 3BQUD 2X10A 5D1XA 2DLFH 3KPSD 3QHFL 4GQ9L 3S8WA 4QRTB 4Q97A 1TLKA 3E6HA 1JWMA 3KR3L 1FO0L 4DOHB 5JA8B 3TH4T 5C0AE 1U58A 4MQXC 2C3WA 4XPGL 3PWJB 3UEZA 1S7WB 1OTUD 4HH9A 4KVNH 4ZOEA 2Q7NA 4YHNB 1TNMA 3REVA 5F7DB 5JXAH 4LEOA 4LLAA 5ALCL 1P1ZA 2K1MA 1FVEB 5D7JD 4Y5XC 2DQGH 2P5EA 2RBLA 3F6LA 2VDNH 2DIJA 3GSXB 4ZNEA 2IQAA 3GMLB 1HKFA 4AG4L 3DXAE 2OS7A 4DK3A 4KQ4H 4KKNA 1ADQH 4NWUL 4XPTL 3HE7D 4JRYA 5EC1A 4LBEA 2HP4A 4PRHD 3HLAB 5E08L 5I1HL 4H5SB 4U1MB 2F58H 5FO8A 2ZUVA 3AAZA 4MB4A 1S7TB 2OLDA 5IEKA 3TH3T 3MCLH 4IRJA 1GOFA 3TA3B 3NCJL 4HXBH 2VQUA 2K7QA 4NKMB 1QACA 3I3EA 3GGWA 4UQ2B 4UDTA 2WBWB 4O02L 5HSFA 3E6FB 3BWAB 2R0LH 2Y36H 3VMPA 1H5BC 5J1AB 3FN0H 3IFOA 3MLSL 3H2WA 4KMTH 7CGTA 1R3KA 5DD5H 5E2TH 4HIEB 3IFPB 5B8CB 1YEDB 5GS3A 2HLFD 1ZLVK 3ULUC 2Y72A 3RDTD 4I13B 2A6KB 4KVCL 5GHWH 1I1CA 1KTLB 3VXTA 2MKLC 3P0VH 2P5ED 1D5ZA 2BDNL 2DAVA 1U8KA 1PG7L 2HVKB 1ZLWH 4K9EC 4FN0A 3S5LB 4X9GA 5DHVA 4J2XA 1JYWA 5D93C 3QULA 4OKVB 1IVLA 3S37L 3UTOA 3BMVA 3ARGC 1FFOB 1P9MA 2VTFA 4IOIA 3TT3H 5GS0D 4RZCA 3BKJL 3TO4C 2CD0A 1AE6L 2DI9A 3TIDB 1DANU 4LGRB 1PQZA 2O5ZL 4CRPA 3WDJA 4BH8A 3PWVB 2JJSC 3ARBD 4G8FB 1IAKA 4R4BA 1A1OB 5HPMA 5HGAB 1F90H 3EW3B 2R0WL 1RIHL 1JK8A 5DJXB 5C0CA 3NACH 1XCTA 5IESH 4P5KA 2KZWA 4JFPB 3VXUE 4JHZA 1N7MH 5ALBH 4X6DE 2JTDA 2CKNA 3P9LB 4RFNB 3C8DA 3CXHJ 2V7NA 2NY2C 2EE3A 5IM7B 1AE6H 2NX5E 1FNSL 3S96B 5ID1B 3VFGH 5T1MB 1BM3H 1GGCL 3GSXA 1HXYA 1IAIM 3SDDC 1QFUH 1TIUA 3I85A 4Q9BA 5I1EH 4FTVB 4ZG1A 1V3MA 3KYKH 3MV11 1NANI 1KJVB 4KC3B 3LIZH 2EH8L 1TMCB 3RGVA 3VGEA 2Z92B 4ZOAA 3D69A 4HIXL 2CGRH 2PCPA 4GRWE 1CDCA 1NMCC 4NRYB 1J87A 1JRHL 1S7XA 1ODAA 4M5ZH 3WFDL 2DDQH 4M4PA 2YEZA 5DWUL 3DV4B 4YEEA 1DQML 4GFTB 3GSOB 5F1SA 4FQ2H 3W2DL 3GZKA 1KB5H 3MRIA 5IP4A 3KGRA 2DTML 3OKKB 2XRAL 5JNYB 4YBQD 1QFOA 4PB0L 1K3ZA 3UROR 5FA4A 3TGXA 3A6CH 4M62H 2ZCHL 4KKAC 5DK0A 5D1QC 1AR1C 1OP3K 4OV6F 4PJCA 3A6BL 2A83A 2O5ZH 4MYWB 3B6SA 4UNUA 3UAJD 1CXLA 2DBLL 4Y19B 3QHTC 4OD2A 1L9MA 4YE4H 5ENWA 3WO3B 4BYHA 1ZLSL 4Y89A 1JI2A 1U92B 1PBYA 4PGDA 1JNNH 3IS0X 1QLFB 4X99B 4U1KB 4ZODA 4PRNA 3VE0A 1MFNA 3W2DH 2LU3A 1TJIH 4JRXD 1VFBA 5CS7A 1NCDL 1XR9A 3H7BB 4NNXA 4NN5C 2QJDA 1MRDL 4N0UE 3T0EE 4X4XA 5EU4A 4MNQE 3WNNA 3RL1B 1WIUA 4XVTH 4AIXA 2R0ZL 4QHUA 4YHMH 4Z7NF 4PPTA 2W0FA 1MLBA 3MX0A 2A9NH 3MNVA 5DRZB 4JAMB 2IAMB 1AXTL 3STLB 4XCYA 1U8PA 4WTXA 1DQLL 4PJDB 5EO0A 4PJ5E 3MRDA 3CSGA 4XCEA 1DBJL 5LG1A 1IKNC 5DD0H 4JKWA 2PKDA 3PL6A 1II4E 5JPMB 1AP2B 4OSUL 4FTVA 2VR9A 4G6FB 4P5MB 4Z7UE 1KIPB 4PS4H 4Z8FH 3FJTA 3DLQR 1KJVA 4UUJB 4P2OC 4P2QE 4HWBL 1D9KC 1Q9WA 3MA7A 4KRMB 2A74A 4OM0L 3L3JA 2J12B 1F5WA 1JVKA 2FYYA 4LKXB 2LTQB 5FA3A 3CFDA 4Y4HA 4YNYA 1A2YA 1Q9OA 3TCLA 4QEGA 3VXOB 5HYJE 5B4MC 3PHOB 2A6KA 5DC4B 4PJ8B 2VQ1A 5FYKE 4X80L 2FO1A 4OV5A 1CIDA 1VFBB 3V0WH 2QADC 3CX2A 1QLRB 3PIQA 3SKJH 2BOCA 2AQ1A 2I60L 4J3SA 5B39A 1M7IB 2H8PB 1IRAY 1MRFH 3V5KB 5GGSY 3V6FA 4NZRH 3PP3K 4GW1B 1BAFH 2ZSWB 5J8OA 3L7FA 3VWKD 5JQ6L 1AC0A 2H2PC 2JJTC 4LPUA 4KV5E 1CFSA 4FABH 3ARFB 1XIWA 1X4XA 4OF3A 2CK0H 1V05A 4HWEH 4J23A 5F7KC 3PWPA 1XF3A 3ULVF 5BQ7B 5C0GA 5C09D 3RWJB 3FCTB 4NHCH 4E42B 4IOFD 3VFMA 1A7PH 2ZCLL 4EOWL 1MHCB 3OAYH 1KC5H 1T66C 4G6FD 3NBNA 1I9RH 2DF3A 5DVMA 3ARFA 3MOQA 1QSZA 5JMRA 4XPBH 2Q7YB 4ENEC 4AEIH 3QI9A 4ZFOL 3FMGH 4IMLB 4MCZB 4MNGA 3ULUD 5AZ2L 4WRLA 3FFCD 1OAXH 2MQ0A 3TT1H 1NCWH 1G9EA 2VDML 5KVEH 1F11B 5F97E 4F9PC 5EDXA 4UT7L 5GGSA 3D3VB 4J3XA 3SE3A 3UYRL 5C0EA 1Q8MA 4UINL 1MCBA 2PTTA 2BHZA 2ZOLB 2C4FT 3P4MB 1M05A 3C5SA 4R4ND 4E5XA 4X6FA 3QXDA 4LSUL 3QP3A 4S1QL 1FRGL 1I9RL 4ODWB 3DX8A 1S3KL 1UWXH 3KYOA 2JIXA 5H2BB 3IDJB 3MRKB 1MAKA 3QIBC 5CD5D 1BQSA 5D1QA 3GJFA 2IQAB 4N5UA 1DEEB 4KTEL 5AEAA 4PRBA 1U95B 4JRXE 3U1SH 3AS1A 4GG8A 5EU3A 2NR6D 3PNWA 5IB5A 4FQLL 4EI5D 2NW3B 4UNVA 4DKEL 4MNQD 1C08A 4X5LA 2WINA 3V0VA 1WZ1H 4PG2A 1EDQA 4NM4L 5DURD 4L4VE 3JVGA 3TJEH 1FC1A 1IAII 5H94B 4P99A 4DGYL 3PWLB 4XPAL 1ZVHA 3PIQB 4GXUN 3FQRA 1EAPB 5LCVL 4BSJA 1IC5L 5EZJB 3VDAA 2P5WE 4NJAL 4P4KD 2BCKB 5E6IB 2ITCA 3WFHA 2PO6A 4JFHD 3V6OA 1QRNA 3SDCC 3FO0H 5DDHA 4EVNB 3GBNH 3HNSH 2XN9B 4F7CB 2P46B 2IH1A 4ODSH 4NZDA 1HHIB 2AKRA 3RVVC 2CRYA 3HB3D 2Z35B 3R1GH 1UC6A 1DSFH 4E41A 3CJJA 4DUVA 5IHBA 4KMLB 4I9WE 1B3JA 1A7BA 1DL7H 3PWPB 4D0CB 1F6FB 1XEDA 4QRQB 3VXMB 4GSDH 4TUJA 3ZHKA 2KKQA 1LE5A 3M17B 5KSBE 2IWGA 5E03A 4MLIA 3B2UD 5KW9H 3WNPA 1QVOA 5BRZB 4BA8A 3UP1A 2H6PA 5C9KA 2R8SH 1C08B 1B0RB 1U6AH 3QEGH 2FHFA 1IE5A 1I75A 2EO1A 2PW1B 2X89A 2FJGB 1OP5H 3S35H 3SQBA 1UJ3A 2ICWJ 5IHZB 2FHCA 3F7YA 1LWRA 4EI5B 3CFDB 4XRCB 6FABL 4PBWD 1DEEA 4JN1L 4RAVB 3ZYIA 1O5DT 1WBYA 3HA0A 1A3QA 1T2JA 4QHKI 4KRPC 3TFKD 5GRJL 1DZBA 4XCCL 3LIZL 4X80H 3ARGB 1R5WB 5IIEA 2NYYD 2JJTA 1CLYL 1PX4A 1P4BL 4S1SL 4L1DA 1M05B 3C5SB 4IDJH 4F3FB 4GRLC 2DDQL 5T1MA 4IOFC 3SO3C 5M94B 4KK9C 5C86A 3OR7A 1DQTA 5JTWA 4MAYD 2ZG1A 4KFZC 3F6IA 1TVDA 2BFVH 4LSPL 3QHZH 1BMGA 3ARQA 3V4PH 2AJ3B 2EC9U 1IAIH 3IAQA 4N68A 5E70A 1PDKA 3MV8B 3OXSB 2YEZB 5ADPH 3AU1B 2H3NB 1B0RA 2DM7A 1WFOA 2CDFA 1JRHI 1TENA 4OI7A 3KLDA 3OL2A 1J8HD 3TIDA 2I5YH 2VZTA 4N0FB 5IOPA 3WJJA 2CLZB 4XX1E 1BBJA 2MHAB 3S37X 4C56E 1JTPA 3RGVB 5KS9B 5HHVL 5HHQB 1U41A 1N4XL 4JFEB 1ZEAH 4PRIA 4QWWC 1KBGH 3TBTA 4BQ6A 5F44A 4Y19A 2AERT 1T0NA 5ADPL 4L8BB 1KB9K 1RMFL 5I8OH 4PJEA 5DD1H 1WEJL 4I4WB 4X8JA 4N9GB 5EOTB 2GTZB 4BFEA 4Z0XA 2VDKH 2YRPA 1BQHA 3DIFB 2B4CL 1NCUA 3INUH 2D7MA 3LSOA 5T3XD 4OCMC 1NBYB 3MRFA 3V95A 2AGJH 2AK4D 3C8KA 4HKBA 4LVHB 2R4SH 3RX5A 3MO1B 5D2LB 5EOCH 4HF5L 4HG4J 3PQYD 1F4HA 5KVDL 3MRJB 4PREA 1I8MB 2BNRB 3ARTA 1NUFA 4JFHE 3BZEA 2FJGA 3NCMA 3RDTA 3L3JB 5AG9A 4R7NB 3ZKSD 1FNGA 1BEYH 3LEYH 3T4YA 3MLZH 5I6XB 5IB3A 5DO2C 1K8IA 1TETL 3FB7B 3GMRB 2YUWA 5INDB 5EIVA 4M6NH 3IDMB 4LCWD 3LPFA 1E0OB 5I8CB 3SE4C 4AH2B 4NN5B 2R0ZH 2W59A 1QFWH 2VDRL 2BX5A 1RZJC 1I7UA 3QI9D 3UTTB 1JGDA 3AM8A 4DGVH 5CD3B 2FBJL 3RZCC 4YX2H 4CUCA 4ZOBA 4Q6IB 3WD5L 3OPZH 2F8VA 5B3JE 1NFDF 1P84K 2QR0B 2IAMC 5ICYA 4RWYH 4TYUA 3CLFL 2R4RL 2F53E 3RAJH 1CL7I 3NFPB 3RWDA 2AXFB 3T4AB 3M8OH 1BWMA 2NY3D 3RIFK 4PJHF 1HSAA 1CZ8L 3PGFH 1NLDH 1EA9C 4DGIL 1KIQA 3D1MC 4KKLD 1OD7A 2X7LB 4P2OB 5CIPH 5C07B 5C0ND 3VXMA 3K4ZA 4PUBL 3JUYA 4FXGA 2D03H 2AW2A 1QSVA 3GNML 1T04B 3DURA 4TVPE 1P7QD 5HVWA 4LOUD 1DVFC 3VGBA 1LQSR 3GKWL 4NO2A 2V2XB 1BD2B 1AO7D 3QRFM 3KLSA 3S36X 1HHJB 4M93B 3BQUA 1D6VL 4Z7WE 4JPWH 3UCRA 4HIJB 1X5AA 4XTRC 2B0SL 2FX8H 4NZRL 3TBTB 4OGXH 3T04D 3CGTA 1KEGL 2AQ2A 4FQIH 5EUKB 5AWNH 3P73A 3EFDL 4WI5A 3HI5H 1RUPL 4GS7B 1R5IB 3QI9B 3TH2T 4WUKL 3UTTD 4PJXF 1YY8A 3GKWH 3RPIB 5ANME 2E6QA 3VJ6B 4RMWA 1H15B 3SGEH 3DX9B 4NBXB 5DD3H 5F7EL 5IVXE 5FM8A 3G6JB 3O2WL 3GBLA 5SWQA 5FCUH 3QISA 3D85D 1QLRA 1I7UB 5IHUL 1T89C 1VACB 1A5FL 4HMEA 5ISZE 5EPMA 2RGSA 4PJBB 2W9EH 3SDAA 2D31B 1X5KA 4QRSA 3ET9F 1PD6A 2PXYD 1MFAL 4JO3L 4Y7MA 4Z7OE 2MSPA 2D7PA 3KXFD 1S7UA 4XGZA 2NY4D 5C70A 4AH2A 3IVKB 1X44A 4Y5XA 2B1AH 5FO7A 1UZ8B 2DWEB 4LLMB 3GSNH 3NZHH 4AMKL 2AK4E 5DD3L 5F7EH 4NO3B 5IW6A 3GEWB 1MEXL 1ZVYA 2P5EE 5HD8C 5E5MA 2GJZB 4X6CE 3QZWB 5DUBB 2VZUA 3IDUA 2ZUQB 2AJUL 1ED3B 1CFTA 1TJHH 3F7VB 4MD5A 3MBXL 1MQ8A 3PGDB 3KPMA 4ZTOH 1XGPB 4ELME 3NTCH 1OTSD 1O0VA 4Y1AA 1FNSH 5IB1B 3CK0H 1E28B 4P57A 3IU4H 2XY2A 4JM2D 3L9RB 4HH8A 2F5BL 1PZUB 2K3TA 5K59E 1P53A 5HGDB 3LKPA 1DLHA 4C56A 3NACL 1YN7A 3WMSA 5I17A 2EC8A 4XBEL 3LQMA 3IAGC 2V2WB 4IRZL 3GMMB 3ARBB 1W0WB 5LAXA 5KVFH 5H35B 5D6CA 3THMH 5HBBA 3U0WH 4WI2A 3VWJA 4PRHE 3OF6A 1E4XI 3ZLQC 4XPAH 3BE1L 3QSKB 1BX2A 1UXSA 1HIMH 3QWRA 1IC5H 1FYHB 5IM7A 5C0JA 1RUMH 2DI7A 3AMLA 3WYRA 5CSZB 4PG9A 4HMCA 1OARL 4S0SD 1IILE 4HMDA 3BIBX 2BSTB 1DBMH 4OLUL 3P30L 3AREA 2BHYA 1FIGL 3A6CL 1KT2A 3SY0A 5EU7C 5IVZA 4OZIB 3RZCD 2IPTH 4XP9L 3W39B 2P24B 2IAMA 3FAXA 2DD8L 5F6HJ 2ITDB 3HZKA 12E8L 4HHAA 4K23L 1NFIA 2FLRT 5DQJA 3WHXB 3MNWA 2DJSA 2Z8WC 3H0TB 5CJ8A 5D7IF 4RFOL 2J5LB 3C09C 5IR1B 1QG3A 2FATL 2JJSA 3CC5B 3TNNB 1KIPA 4X7SH 4OCNC 4WHCA 4YDLB 4W6WB 3EYVB 3KJ6L 4JVPA 4R3SB 3V4UH 4Y16C 2GCYA 4ZSOB 3WS3A 3EJYC 4BH7A 3MLYH 4UTBL 4MWFB 3IDGB 3WHXA 1NKOA 4P9MH 1WCBA 4GRMA 4J3OC 2WWMC 1MCEA 3B6SB 5CKGA 3CFEB 1QKZL 2Y06L 1LP9B 2G5BA 4JGMA 5HDBE 3BGFC 2OI9B 1FFRA 4RAUA 3UJJH 3LS4H 3FB6A 4NRXA 3SKNB 3N06B 3N1GC 2R1XA 1M1SA 4U1IB 1ZTXL 1NCDH 3U4AA 4Y19D 3IRZA 5FK9B 3S3JA 3D0VA 3QWRD 5KVFL 2H9GA 1I1YB 5EFIB 1AC6A 1F6AA 2JCCE 3C6LB 1KOAA 3SE8H 1CL7H 3T2NH 2W0LA 2NMSA 4ZUWA 1LP9A 2G5BB 1QLEH 1BGXH 1WZLA 3VXSE 4DEPC 1MF2L 3QIWA 1GGIH 3O9WA 4Z7WA 2IJ0C 2WLZA 1BX2B 2ZJSL 4MJ6A 1A1MB 3REWA 3MXVL 5HVHC 5F6HI 3VU2A 4U1LB 5JHDA 1H3VA 2A9ML 4XNYH 4YPJA 1D6EB 4P3DA 2R56L 1F97A 2DQIL 3ZSTA 3KS0H 3S4SG 4POZC 4D9LH 4Y1AD 3MYJB 1YY9C 3IYLW 5IF0A 1NANH 4WNQA 5FOJA 2FGWH 3BKMH 4X9FA 5KSAC 3VFNB 5CGMA 5DJAB