4PK1A

Structure of bamb fused to a bama potra domain fragment
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
640
structure length
494
Chain Sequence
b'EIQQINIVGNHAFTTDELISHFQLRDEQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRMSPLPTVENQFTPTTAWSTSVGSGIGNFYSNLHPALADNVVYAADRAGLVKALNADDGKEIWSVSLAEPALLSGGVTVSGGHVYIGSEKAQVYALNTSDGTVAWQTKVAGEALSRPVVSDGLVLIHTSNGQLQALNEADGAVKWTVNLDMPSLSLRGESAPTTAFGAAVVGGDNGRVSAVLMEQGQMIWQQRISSDVDTTPVVVNGVVFALAYNGNLTALDLRSGQIMWKRELGSVNDFIVDGNRIYLVDQNDRVMALTIDGGVTLWTQSDLLHRLLTSPVLYNGNLVVGDSEGYLHWINVEDGRFVAQQKVDSSGFQTEPVAADGKLLIQAKDGTVYSITR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chimera protein of Outer membrane protein assembly factors B
publication title Crystal Structure of BamB Bound to a Periplasmic Domain Fragment of BamA, the Central Component of the beta-Barrel Assembly Machine.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 93
structure length 494
sequence length 640
ec nomenclature
pdb deposition date 2014-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
A PF01011 PQQ PQQ enzyme repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4pk1A02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4pk1A01
4C4VA 2VH1A 4BZAA 4C4VB 3MC9A 3MC8A 2QDFA 2X8XX 2V9HA 4C00A 2MHJA 3Q6BA 2QCZA 3OG5A 4QAYA 4K3BA 3NJTA 4PK1A 4K3CA 2VH2A 3EFCA 4XGAB
chains in the Genus database with same CATH superfamily
3ZJUA 2ONQA 1ZE3D 3LJ3A 1WX8A 1J7AA 1AARA 1PGBA 2ZCCA 1HTQA 4TSSA 1E90A 3U8ZA 2J42A 3ALBA 1RFAA 5LXIB 4MH0E 2KT7A 3TJPA 2WXNA 1DOXA 3NVZA 4IWOA 3W2DA 2ICIA 1CZPA 3Q8EA 3SU8X 4A8XC 5TSSA 4BKSD 1UGJA 4BKGA 1F77A 1WM3A 4BFRA 2KQ7A 4XC2A 1NYRA 4HKZE 1C76A 2LJIA 2Z59B 1Z2MA 4OVZA 1WXQA 4C4VA 1BT0A 4US8A 2L1AA 3IAM1 1FRDA 1L6VA 2JWZA 3AEAB 3PO0A 3IAS1 5MPOA 1NENB 3Q8BA 3VR9B 3QK0A 2PE9A 4M02A 1J7CA 5AUKA 1R4NI 3P4SB 2D2QA 4P6VF 2K22A 3AE9B 4JE3B 1Z5SB 4EZKA 1N61A 3ZNZB 3ML9A 1IP9A 4GMVA 3BYTB 4W9IA 5GXGB 1WGYA 2J0KA 2YLMA 2KX3A 3U30A 2CJNA 3ZKJC 2L05A 5HHDG 1E7PB 4IDIA 1V1PA 4K7UA 2LGDA 4MDKE 2NBWB 3KWLA 1MHXA 2LRUA 3PLVA 3RZFA 3DVGX 5BYSA 1I4RA 1TS2A 4I6PA 3RNCC 3VTWA 2J0MA 3RPFC 1I35A 3MFGA 2FUHB 2INCC 5KHOA 3BVZA 3BYYB 1HZ5A 2KTRB 2KWDA 3VH4B 2C7NB 2O6VB 3Q2AC 1R4NB 1T5XD 2WX0A 4DDGD 1JMLA 4YTNB 2V0GA 3W1SA 2KAJA 1YJ1A 3ABVB 5H8YE 3HM6X 4G11A 4P1BC 2MA9B 3VRAB 2ZW0A 2G45B 3A9JA 3SR6A 3JSVB 2I1KA 3AI5A 2WXIA 5IO9A 1X1MA 4ZDVA 1XD3B 2RD0A 3VTVA 2FCSA 1N63A 4DBGA 3H9DA 3KVFB 2WQYB 2CJOA 4IWQA 2HD5B 4ARCA 1WXAA 3GE3C 4II2B 2ZZPB 4YWGG 4MJSA 1WX7A 3A9KB 2M19A 3NZ3A 3A4RA 1Q1OA 3AM9A 1J19A 2ON8A 3O65B 3Q69A 1T0YA 2IY1B 1JCKB 2AEHA 4MSQB 1IYFA 3Q3OC 5KHQA 3AEEB 1KLGD 4WH4A 5D6JB 5E6NA 4M0WA 2WXLA 1VZ7A 2DENB 1MPEA 3GOEA 4IW0A 3U52E 4UDUC 1HA5A 1B9RA 1FFUA 2Y5CA 2I2YA 1IGDA 1L6UA 3L08A 4HPPA 4KGRA 1TJEA 1YJJA 2CHZA 2PKOA 1RWSA 3ZDMC 2JXXA 2W3RA 4C4VB 3R2TA 3PV1A 1QQRA 4G0NB 2WS3B 3B9JA 1L4DB 1TZOA 1WMHA 3UINB 3VXWA 4JPSA 4HKQA 2INPE 1OTRB 4A6QA 3L13A 3NY5A 3QX1A 2D5GA 3U7ZA 4JL9A 4AP4C 1GNUA 2JZZA 2M4NA 3Q8AA 4NZLB 3I9V1 5IAAC 1ZW7A 2K0PA 3L0WB 4MEMA 1LGRA 1NI2A 4ZYSA 4R3DA 2ZVOA 4KIKB 2M8SA 1L7YA 1HXYD 3N30A 3Q3MC 2KD0A 3MTNB 4TMAB 2MJ3A 5IKCM 1ROEA 3FILA 3EA6A 5D7GA 1HQRD 1D6EC 1WGRA 2KDIA 4E71A 1V1PB 3MJ5A 3BZDB 2W3SA 2RPVA 4YSYB 2LHEA 4AS1A 4KSKC 4RM8A 1FCLA 1IBXA 2LVPA 2XN9C 1VZ8A 4WWNA 3RFZB 1XQQA 2NTSA 3NHEB 1I4GA 2H89B 3ZNID 3EGRA 4WURA 2LXAA 3T3OA 2WXJA 1WZ3A 2XEWA 3J9CA 4HK2A 4YT0B 1Y8RC 1SSNA 1WI0A 2MP2A 4FHJA 4JLCA 3V6CB 3B2FA 3A9JB 4ZRIA 3TUOA 5E6JA 4L2YA 2DZKA 4DXGA 2QILA 2BTEA 2MLBA 3AE7B 4LNFA 4M01A 2SAKA 2WXGA 1DYQA 1TBEA 1XLNA 4B9KA 1OQRA 4MJSB 5C23A 4HJGE 3WCQA 2KMCA 2IGDA 3VQIA 3WIMA 3U4EG 2LVOA 4YTPB 3Q8FA 1GC7A 2DHZA 4K1RB 1WYGA 1PUTA 3RD2A 2LXCA 4M0WB 4GIVA 2L0TA 2LZ6A 2ZNVB 5BMHA 4K7WA 2OEDA 3BY4B 4LNNA 4PYZA 4XX5A 4FA6A 1SE2A 3QA8A 3MHZA 2OJWA 1XXGA 2IDYA 2FCMA 4RFBA 4IG7B 2V9HA 2VRRB 3DCGA 1EF5A 1VDVA 4GLSC 4A3OA 3JYUA 1KTKA 5GMVA 3AU5A 1WMHB 4F8CB 4GDKA 2CS4A 1K50A 1LQBA 2MJEA 2ZNVC 4OVUA 3WAOA 2WDRB 3W5VB 1SJHD 3ML8A 2IZVB 2N0SB 2BKRB 2REXA 2KACA 1D5XC 3TIXA 3V05A 2K6QA 2WGSA 1WR1A 4GXBA 2PTLA 3P4QB 2JF5A 3A33B 2ZPYA 4WJNA 5G2NA 4X57B 4XWTA 1GB1A 3FILB 2KNBA 2CHXA 2NR2A 3VUXA 2DWQA 1WGGA 1QKZA 3TL5A 1T0RC 1FNUA 5J18A 2GBMA 2R2QA 1F2RI 1OQQA 4TKNA 3AMZA 1DOYA 5L83A 1KJTA 4O1NA 4DQOC 2YEPF 4K3CA 4J6IA 1XLQA 2BYFA 3ENEA 1IBXB 1YD8U 2R2OA 3WAPA 2HTME 2FNJB 2PE6B 1LO5D 3AE8B 2JYEA 5FK9C 4OVVA 2WX1A 2QDFA 3DWGC 3K9PB 1D5ZC 3ZW3A 1QILA 1K53A 2KDEB 3KUZA 1WXMA 4KGSA 3WALA 4PS3A 3N9YC 1FCCC 2G4DB 2QSDA 4EE2A 3CMMB 5AEKB 2NVUI 3RCZA 2RDHA 3V3XA 2MP2B 3NRZA 1ZUD2 2MBQA 2L00B 3QC8B 4ZHOA 3PSEB 3C19A 3PS6A 1GB4A 4W9KA 2KTFA 2MRPA 2LGXA 3OLMD 5HKHA 1C77A 4XDCA 1CMXB 4HDOA 4AQ7A 1FRRA 1OQYA 1TTNA 2DAFA 3NZUA 2MW5A 5CHFA 2GBKA 2G1EA 3U2SC 2RGFA 3GP7A 3AXCA 4W9HA 1J7BA 2V4LA 3ZNGC 1E8XA 3AH7A 1R4MB 5EE3A 2K6DB 3AECB 1WY8A 3ZJVA 2LASA 1P9DU 3LB8C 5AZHA 4H2AA 3PLUA 4XYCA 3OJ3A 3P2BA 2O2VA 2NBVB 1YX5B 4OZBA 3MC8A 1SGHA 3L17A 2PEAA 3GZNB 3PPAA 2L8JA 1XEEA 1K51A 4HDQA 1JALA 1ZDXA 4WJOA 2KJ6A 4JIOU 4GDKB 3DPDA 3N1YC 4XDDA 3DVNV 2D3CA 2BS4B 2KFJA 4DHZE 3ZDTA 1YN5A 1XCTL 1L0YB 3NG0A 1TKYA 3T8MA 1P7EA 2W55A 4BVUC 3OAWA 5FR3A 4K81A 4RM9A 2MBHA 2V4IB 3APCA 3RMKC 4D2KA 1KH0A 3EFUA 3W9CB 1XCQL 3SFEB 1VRAB 1L2NA 2Q5WD 3ZXRA 1YMHE 1WSPA 1K52A 5BYRA 2BW2A 2JRIB 2J53A 2DX5B 4LJPB 2KC2A 3TCAA 1G6JA 1P98A 2OHFA 3AE5B 3AEDB 2OJRA 2VH2A 3DBSA 2ZEQA 1FXAA 3B2GA 3O13A 4YL8A 3UQAA 1FPYA 3RT3B 2D11A 4KGTA 1RM6C 2MCNB 3AE3B 4NNJB 4WIPA 3ZRCA 1CK1A 2JT4B 4YSZB 3AV8A 4N59A 3IFWB 1FXTB 4A90A 2RSUA 1V5TA 2FBWB 3M95A 1I4XA 3DVGY 3WA0A 4EKUA 3N1XC 2GLSA 3E9SA 3PZDA 1P7FA 2BYVE 2D3GA 3KH0A 3IXSA 2RDGA 2RPQA 2N7DA 3MC0B 1EF1A 3A1QA 3KYDD 4ACFA 2KDFB 2QCZA 4LLGM 3CSFA 1C4CA 2WXHA 2XNAC 1F0ZA 2FIFA 1P0RA 4OZCA 1S3SG 2EMTA 2L7RA 4OHJA 4OZAA 5G5HA 1E9MA 4GN1A 4W9CA 4ICUA 4A3PA 1UELA 2JXTA 3BINA 4RF0A 4IM3A 3TSSA 2RR9A 3UI3A 3SHQA 3IT4B 4KV2A 2JZ3B 4LDTD 1GUAB 2D3BA 1NI3A 1GAQB 1L5PA 3ZIMA 1E6EB 1KM7A 1TGZB 4FXCA 1UNSA 5I4DA 2RDBC 5AZFA 4WWMA 2L32A 4XE0A 3PHXB 4K3BA 4L23A 3M3JA 1M4VA 2Y3AA 5HFYA 1QZEA 4G3XB 2TSSA 4DK5A 4MM3A 3N1ZC 3QQ8B 1WGHA 2LJ5A 2CHWA 1PDXA 1STEA 3KLSX 2GBJA 2LRWA 1WF9A 2L76A 3TEYA 1VR9A 3N3KB 1TY2A 3ZJTA 2QEJC 2DYBA 4WQMA 1E0ZA 4WAAA 1KOTA 2GBRA 4M8NA 1FD6A 2Y5PA 1VZ6A 3RNBC 3M63B 3PREA 5E6OA 3UGBB 3R2IA 1FNWA 1SBBB 4IM2A 2V3SA 2C7HA 3ZUNA 5D2MB 1JQ4A 1GG3A 3DBRI 4E74A 2KWCA 2IPKD 4B6WA 4RCOA 1UGMA 1F9JA 4BBNF 4GOCA 4BBNC 4CQNA 4I6NB 3BVMA 2C7MB 4DHZB 2JUOA 1NEKB 3NVYA 4ZOHC 2KN5A 1V2YA 4BKTA 1SEBD 2N4FA 1PGXA 2RMMA 5G55A 1V81A 4I6LB 4F7ZA 3VFKA 4KSLC 4CYEA 3DBHI 4NQKE 1KRHA 3AEFB 2IGHA 4GSWA 5BMIA 2V3NA 2B76B 1QOGA 1UZXB 1MG4A 2WXPA 4A9AA 3A1QB 3RULA 4B0EA 2K9XA 3MHSD 4HCPB 2AWTA 2W54A 1ZXIA 1BUIC 3DBLB 3WANA 2KK8A 2DYOA 3B08A 3DBRB 1WXSA 4WWOA 2V3PA 3P42A 1ZXHA 5IP4D 3RNEC 3ZRFA 3ZGZA 2IO2B 4IOIE 4KKJA 1F52A 3TEXA 3IVFA 2BB6A 1FFVA 3L10B 4NJCA 2N9EB 4LJOB 1XLOA 2M17A 2L83A 3QIJA 1P3QU 1I42A 2HE7A 1FNVA 1WE7A 2NPTA 3VHTC 3OJ4B 1V86A 1CJEA 3DBHB 2LGYA 1R7SA 4ANVA 2HJ1A 4ICVA 2KJHB 4OW0A 3R3MA 4KZ0A 4MM3B 1EWCA 2WNMA 2KO3A 1LXDA 3TEZA 4E3CA 3QARA 4FN2A 3MP9A 5HG2A 1WR6E 3DDCB 4DHJB 4N9F4 1V49A 1NVID 1JRPA 1N5WA 4EEWA 1YQ3B 5D94A 4ZHPA 2BVCA 4KX6B 3NS8A 1RAXA 1TS5A 4DHJD 2HJ8A 4KZCA 2WDQB 4KDLB 3LDZE 1TKGA 1N60A 2CR5A 5DCNA 2LI5A 3I57A 4CO7A 4BAXA 3NOBA 3VVWB 4AOFA 4PS8A 3RN9C 3X0WA 2BQQA 1YQBA 1AYFA 4NQLB 2IO1B 2A5UA 2JWUA 4BZAA 3N20C 4KVGB 2K25A 1AWDA 3KWVA 5LNK1 3HIZA 2AL3A 4P1CC 3IBEA 2WU2B 3FC4A 1S1QB 2BGFA 2GOWA 2JVCA 3W1YA 1E8WA 4MH8A 3U7DA 1V9JA 2EMSA 2PJHA 1T3QA 3NVWA 3DHIC 4KDIC 1E7VA 2J0JA 3JW0X 1HE8A 1ZKHA 4MGKE 4PT5A 4MGZE 4JGHB 1WXVA 2L52A 1VJKA 2ASQA 2YEPB 3EFCA 2WU5B 2KC1A 3Q3JA 3P4RB 4ZRPA 2D07B 1RRBA 2WHIA 1FEHA 2FAZA 2NTTA 3VUYA 1YNTE 4EZJA 2GRIA 2VZKD 3GS2A 1C78A 3TEWA 4M8MA 4Q2JA 3TMPB 4WQOB 3Q3NC 1ACCA 1YN3A 1LM8B 5CHWA 2HTHA 2MJDA 1ZGUB 3Q3FA 1R4MI 3QHTA 4ZYNA 1PFDA 1CQVA 4RH6A 4C00A 3OG5A 1Q5WB 5C3JB 1SIJA 2QIEB 3NZSA 5AUIA 2R61A 2OOBB 4MSMB 2INDC 2BT6A 4EUTA 3GZNI 4ANWA 3BVGA 2KMAA 2BBCA 4W9EA 3NUHB 2KYWA 1SE3A 2K5PA 4NJ7A 1TIFA 2J7QB 2LEKA 1IPGA 3GB1A 1JWAD 3L4PA 1D3ZA 1SE9A 2E6XA 3UQBA 2JPHA 4EFOA 4EZLA 4HJKA 5EDSA 2KANA 1WYWB 3PVLA 3ZTDA 1J8CA 3FKYA 3VH3B 4FJZA 5C1ZA 2MBOA 4RMAA 4ITKA 3PT2B 1E5WA 3AE2B 2V1YA 4C56C 1T6BX 1WIAA 2PLPA 3H7SA 3PZ7A 2K1FA 2MBBB 1ZPSA 1TZ1A 3VUWA 3QWZB 2K39A 4NY0A 5FKAC 1WZ0A 3T9LA 4USAA 2YVCA 5H92C 4K7SA 4NAMA 5T8IA 1HTOA 3BWUD 5EE0A 3ZLZA 4HVBA 3VTUA 5BMGA 5C2TB 1GC6A 1T0QC 2PPHA 2WWZA 4HRSA 2DNFA 4WJPA 2MX2A 4MELA 1WJNA 1PYWD 3B1LX 3SD5A 1IUEA 2WP9B 2C9WB 1MG8A 2WDTB 3DHHC 1QOFA 2WXRA 3SFDB 5L95C 1C4PA 4LNIA 4ANUA 3AEGB 1H4RA 3AEBB 2A4ZA 1TS4A 2DBYA 1XO3A 4C80A 3QCAA 2LMCA 3IHPC 3BK2A 1C4AA 2PVGC 2PMVA 3JSVA 4DXFA 3M62B 1QT9A 1E8YA 1XLPA 3W5UB 4TQ0A 5G5GA 2N7EA 1KFYB 1NBFC 3KYCD 3VDZA 3A9KA 2KN4A 4LNKA 2UYZB 1I4QA 4IKGA 2CU1A 2JZPA 2D10A 2HDEA 1MFWA 4N58A 2N9XA 1TT5B 2Y5BB 3MC9A 4KKIA 1BXTA 3EHVA 4MT5A 2BYEA 4IC7B 2BYTA 1WRDB 3T3NA 3KUDB 2WLBA 2KZRA 3R7QA 2AL6A 3RNAC 3VRBB 3AU4A 2GB1A 2KOXA 2EKEC 3KUCB 2ZVNA 1KF6B 1EUVB 3KW5B 2WXOA 3FAHA 4GU2A 4YXDB 3Q8CA 1QLBB 4YTMB 4LNOA 3C0RB 3I63C 1SE4A 1OFFA 1XT9B 4BOSC 3NJTA 2XBBC 3H6NA 2EKIA 3RNGC 1L0XB 1U4AA 3KQ4A 2G4SA 1ISNA 4LDTB 2KVZA 2JRHA 1C1YB 1E10A 3SEBA 1I7HA 2PW9A 4KIKA 2IO3B 3CIRB 4RGTA 1LFDA 1ZOYB 4BOZB 1Q0WB 2BWES 3AE4B 2IGGA 2ZJDA 3RUIB 2AQ2B 2GBNA 5FR6A 3AE6B 2IJ0A 3DOWA 3P1MA 4GDLA 1FM0D 5JH5C 1UUPA 2K3UA 1FMAD 1V6EA 4FLHA 3RI7C 2KQ4X 1K8RB 1OEYJ 4M00A 3V61A 3P4PB 1OGWA 4FHKA 4AJWA 2O2VB 3IG3A 2JX5A 1MVKA 4LK0M 2GMIC 1WFYA 1UBIA 3ZNHB 4HWIB 4G50A 2BS2B 2WXMA 4WAFA 2KVRA 2AQ3B 3V6EB 2MH7A 3P63A 1AN8A 4FBJB 1VCBA 2VH1A 4REZA 4DXAB 1OEYA 3HVDA 1JWSD 2N1WA 1N5XA 1WRIA 2AQ1B 3APDA 3E56A 1E7UA 2BKFA 2H88B 2J52A 5IA7A 2LGIA 1L0VB 1JWUD 2DAJA 1N6ZA 1B1ZA 1FXIA 5EE9A 4NJ6A 1PQSA 4JQWC 2INNE 1KLVA 2DZJA 2O6VD 1WE6A 2QHOA 2BB5A 1EO6A 2WXKA 4MGYE 4JX1C 5JHAA 2W9NA 3VAWA 3DBLI 5EE1A 1RYJA 2JSVX 2L3ZA 2KLGA 2I1JA 2SEBD 3PZ8A 1MJDA 1YN4A 1NYQA 4MGIE 1D5MC 4FJVB 5E6PA 3UIOB 3PRPB 2KX0A 4HCNB 1IGCA 4AUQC 1Q10A 1WGDA 2E3TA 4W9GA 4FJYA 3URYA 2PIAA 1I4PA 1A70A 2KKCA 2C5LC 2I38A 5CTRC 1WWTA 4LTUA 2N7JA 3EC8A 1JW9D 4W9JA 4WWPA 3PRZA 4RGMA 2CKHB 2IY0B 3R7RA 1JWMD 3CSTA 3EECA 3PRMB 4C7ZA 1ET6A 2MSED 2K8BA 1UBQA 2DYMA 1GJZA 2FCQA 1ZP0B 3CWIA 4TUUA 1H8CA 1ENFA 2KMMA 1V8CA 5J17A 5HI1A 1VLBA 2N9KA 4ZRQA 4URKA 4HPMB 4HPLB 2NBUA 2MQJA 3RYTA 1L4ZB 3HHMA 2N9PC 1TKEA 1NDDA 3ZYYX 1DOIA 3Q6BA 3ZXVA 3QJZA 2FCNA 4ANXA 1TY0A 4XZ4A 3UF8A 4WJQA 1SF0A 3WAMA 3Q14C 4GDLB 2LUEA 2NCNA 2BPSA 1UD7A 2LVQA 1V1OA 2WDVB 3APFA 1QF6A 2JU6X 4A55A 5LLIA 3ZO5B 1QOBA 2KJRA 5BO4B 1SB3C 2MBEA 4RF1A 4S0RA 1BMLC 3PGEA 3MJWA 3H7PA 3ZQ4A 2ZCBA 5DPWA 2JYTA 2Z8LA 5DPSA 2G3QB 4RGNA 5D3DA 3OWEB 4C7YA 1WH3A 2J4XA 5D3IB 2NMQA 4HXDA 2DZIA 2MHJA 1YQ4B 5AZGA 2KHWB 4XGAB 3K9OB 3HVZA 3HRDD 2JY6A 3ONSA 1F1HA 5JZEB 1ESFA 1YJIA 2DZMA 1TYGB 2AYOB 5LXHA 2CU3A 1QOAA 4LCDE 2K8HA 5IN7A 2X38A 3PTFC 1TS3A 2UWQA 1UWMA 1C3TA 1N62A 2Z0EB 3W1SC 4FADA 1XF5L 4ZRJA 4ARIA 5CX3A 3IT6B 5BYQA 2KDBA 3A4SC 3SDLC 4W9LA 2XK5A 2M0XA 4NPNA 5DPRA 1MI0A 2ZW1A 3AB5A 1KLUD 1FIQA 2KWVB 2MWSB 1YOVB 2L0FA 3DWMA 4DWFA 1Y56A 2G9HD 2M1MA 3H8HA 3EUB2 1AW7A 4NAWA 2M0AA 4IM0A 2ZPNA 3V60A 1C79A 2KFKA 2KLCA 4HROA 1YIWA 1I4HA 2NS5A 2W82A 1UWXA 2DLBA 2N9LA 2ACZB 2X8XX 4JWSC 3GE8C 1VD2A 3DVNU 3ZTCA 3R8BA 2VZKB 3HUIA 4W9FA 4JWUC 1V5OA 4GGQA 2JQRB 2WXFA 3H1UA 4W9DA 2N1VA 3L54A 2KQSA 4DDID 2UU7A 4RGOS 1DGJA 5JXVA 2M56B 2LUMA 4II3B 2KWUB 1WM2A 2B3AA 5DPTA 4HEA1 4TV3A 4PYUA 1E8ZA 3PHWB 2MEKA 2FIDA 4J3OD 4PK1A 1T0SC 1SJED 4BKSA 1WX9A 3S2AA 2LD9A 1D4BA 3DQVA 5J2RA 1YX6B 4N6EB 4IWPA 1J0GA 1GOZA 1UH6A 2D3AA 1JWBD 3RZWC 1C9FA 4ZRKA 4GB9A 2LHDA 2IYDB 2KDMA 4QAYA 2LGSA 3I3TB 3N32A 4MACA 2AX5A 2NPTB 1HZ6A 1WJ6A 1EM7A 1EU4A 4YSXB 2K8CA 1V97A 4P16A 3H7PB 4HLEA 3DHGC 4US9A 4FULA 1SIFA 1FO4A 2QC8A 5IOIA 3D32A 5TR5A 2WYQA 5JHBA 2LWPA 2FUG1 3ECIA 3AULA 4A20A 4B95A 2QJLA 2BS3B 3B0AA 1M94A 4IUMB 4PS7A 2C60A 4P7IA 2Z0DB 3NS1A 3R66C 4EOYA 2BWFA 3L16A 2BF8B 3C8YA 2PVOD 3BK1A 3NVVA 3V62A 2QMTA 1JROA 3CF6E 4TQ1A 1V80A 2GI9A 1WJUA 3HM3A 2KXJA 3AE1B 2LFIA 2FE8A 3ZVVA 5CHVC 4XWWA 3JVZX 1P1AA 4B0MA 4AWJA 1A5RA 1GPXA 1RFKA 3TBLD 3X23A 2XK5B 3ETRA 2EELA 3I5JC 4S17A 3QAQA 4F1SA 1ZDVA 2IO0B 1WGKA 3LYYA 4RNAA 3LXFA 2IBIB 1EWYC 1HEZE 2KTRA 4NAWB 1SXTA 4L1BA 1F2RC 2KFKB 1ET9A 2O6VA 4AJYB 4ASWC 3VR8B 3RNFC 4CHKA 1EU3A 3HK0A 1UF0A 3AN1A 3BIID 3UIPB 1MHHE 1WJ4A 1JRUA 2WXQA 1RLFA 1PGAA
chains in the Genus database with same CATH topology
4C4VA 2VH1A 4BZAA 4C4VB 3MC9A 3MC8A 2QDFA 2X8XX 2V9HA 4C00A 2MHJA 3Q6BA 2QCZA 3OG5A 4QAYA 4K3BA 3NJTA 4PK1A 4K3CA 2VH2A 3EFCA 4XGAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C4V A;  2VH1 A;  4BZA A;  4C4V B;  3MC9 A;  3MC8 A;  2QDF A;  2X8X X;  2V9H A;  4C00 A;  2MHJ A;  3Q6B A;  2QCZ A;  3OG5 A;  4QAY A;  4K3B A;  3NJT A;  4PK1 A;  4K3C A;  2VH2 A;  3EFC A;  4XGA B; 
#chains in the Genus database with same CATH topology
 3ZJU A;  2ONQ A;  1ZE3 D;  3LJ3 A;  1WX8 A;  1J7A A;  1AAR A;  1PGB A;  2ZCC A;  1HTQ A;  4TSS A;  1E90 A;  3U8Z A;  2J42 A;  3ALB A;  1RFA A;  5LXI B;  4MH0 E;  2KT7 A;  3TJP A;  2WXN A;  1DOX A;  3NVZ A;  4IWO A;  3W2D A;  2ICI A;  1CZP A;  3Q8E A;  3SU8 X;  4A8X C;  5TSS A;  4BKS D;  1UGJ A;  4BKG A;  1F77 A;  1WM3 A;  4BFR A;  2KQ7 A;  4XC2 A;  1NYR A;  4HKZ E;  1C76 A;  2LJI A;  2Z59 B;  1Z2M A;  4OVZ A;  1WXQ A;  4C4V A;  1BT0 A;  4US8 A;  2L1A A;  3IAM 1;  1FRD A;  1L6V A;  2JWZ A;  3AEA B;  3PO0 A;  3IAS 1;  5MPO A;  1NEN B;  3Q8B A;  3VR9 B;  3QK0 A;  2PE9 A;  4M02 A;  1J7C A;  5AUK A;  1R4N I;  3P4S B;  2D2Q A;  4P6V F;  2K22 A;  3AE9 B;  4JE3 B;  1Z5S B;  4EZK A;  1N61 A;  3ZNZ B;  3ML9 A;  1IP9 A;  4GMV A;  3BYT B;  4W9I A;  5GXG B;  1WGY A;  2J0K A;  2YLM A;  2KX3 A;  3U30 A;  2CJN A;  3ZKJ C;  2L05 A;  5HHD G;  1E7P B;  4IDI A;  1V1P A;  4K7U A;  2LGD A;  4MDK E;  2NBW B;  3KWL A;  1MHX A;  2LRU A;  3PLV A;  3RZF A;  3DVG X;  5BYS A;  1I4R A;  1TS2 A;  4I6P A;  3RNC C;  3VTW A;  2J0M A;  3RPF C;  1I35 A;  3MFG A;  2FUH B;  2INC C;  5KHO A;  3BVZ A;  3BYY B;  1HZ5 A;  2KTR B;  2KWD A;  3VH4 B;  2C7N B;  2O6V B;  3Q2A C;  1R4N B;  1T5X D;  2WX0 A;  4DDG D;  1JML A;  4YTN B;  2V0G A;  3W1S A;  2KAJ A;  1YJ1 A;  3ABV B;  5H8Y E;  3HM6 X;  4G11 A;  4P1B C;  2MA9 B;  3VRA B;  2ZW0 A;  2G45 B;  3A9J A;  3SR6 A;  3JSV B;  2I1K A;  3AI5 A;  2WXI A;  5IO9 A;  1X1M A;  4ZDV A;  1XD3 B;  2RD0 A;  3VTV A;  2FCS A;  1N63 A;  4DBG A;  3H9D A;  3KVF B;  2WQY B;  2CJO A;  4IWQ A;  2HD5 B;  4ARC A;  1WXA A;  3GE3 C;  4II2 B;  2ZZP B;  4YWG G;  4MJS A;  1WX7 A;  3A9K B;  2M19 A;  3NZ3 A;  3A4R A;  1Q1O A;  3AM9 A;  1J19 A;  2ON8 A;  3O65 B;  3Q69 A;  1T0Y A;  2IY1 B;  1JCK B;  2AEH A;  4MSQ B;  1IYF A;  3Q3O C;  5KHQ A;  3AEE B;  1KLG D;  4WH4 A;  5D6J B;  5E6N A;  4M0W A;  2WXL A;  1VZ7 A;  2DEN B;  1MPE A;  3GOE A;  4IW0 A;  3U52 E;  4UDU C;  1HA5 A;  1B9R A;  1FFU A;  2Y5C A;  2I2Y A;  1IGD A;  1L6U A;  3L08 A;  4HPP A;  4KGR A;  1TJE A;  1YJJ A;  2CHZ A;  2PKO A;  1RWS A;  3ZDM C;  2JXX A;  2W3R A;  4C4V B;  3R2T A;  3PV1 A;  1QQR A;  4G0N B;  2WS3 B;  3B9J A;  1L4D B;  1TZO A;  1WMH A;  3UIN B;  3VXW A;  4JPS A;  4HKQ A;  2INP E;  1OTR B;  4A6Q A;  3L13 A;  3NY5 A;  3QX1 A;  2D5G A;  3U7Z A;  4JL9 A;  4AP4 C;  1GNU A;  2JZZ A;  2M4N A;  3Q8A A;  4NZL B;  3I9V 1;  5IAA C;  1ZW7 A;  2K0P A;  3L0W B;  4MEM A;  1LGR A;  1NI2 A;  4ZYS A;  4R3D A;  2ZVO A;  4KIK B;  2M8S A;  1L7Y A;  1HXY D;  3N30 A;  3Q3M C;  2KD0 A;  3MTN B;  4TMA B;  2MJ3 A;  5IKC M;  1ROE A;  3FIL A;  3EA6 A;  5D7G A;  1HQR D;  1D6E C;  1WGR A;  2KDI A;  4E71 A;  1V1P B;  3MJ5 A;  3BZD B;  2W3S A;  2RPV A;  4YSY B;  2LHE A;  4AS1 A;  4KSK C;  4RM8 A;  1FCL A;  1IBX A;  2LVP A;  2XN9 C;  1VZ8 A;  4WWN A;  3RFZ B;  1XQQ A;  2NTS A;  3NHE B;  1I4G A;  2H89 B;  3ZNI D;  3EGR A;  4WUR A;  2LXA A;  3T3O A;  2WXJ A;  1WZ3 A;  2XEW A;  3J9C A;  4HK2 A;  4YT0 B;  1Y8R C;  1SSN A;  1WI0 A;  2MP2 A;  4FHJ A;  4JLC A;  3V6C B;  3B2F A;  3A9J B;  4ZRI A;  3TUO A;  5E6J A;  4L2Y A;  2DZK A;  4DXG A;  2QIL A;  2BTE A;  2MLB A;  3AE7 B;  4LNF A;  4M01 A;  2SAK A;  2WXG A;  1DYQ A;  1TBE A;  1XLN A;  4B9K A;  1OQR A;  4MJS B;  5C23 A;  4HJG E;  3WCQ A;  2KMC A;  2IGD A;  3VQI A;  3WIM A;  3U4E G;  2LVO A;  4YTP B;  3Q8F A;  1GC7 A;  2DHZ A;  4K1R B;  1WYG A;  1PUT A;  3RD2 A;  2LXC A;  4M0W B;  4GIV A;  2L0T A;  2LZ6 A;  2ZNV B;  5BMH A;  4K7W A;  2OED A;  3BY4 B;  4LNN A;  4PYZ A;  4XX5 A;  4FA6 A;  1SE2 A;  3QA8 A;  3MHZ A;  2OJW A;  1XXG A;  2IDY A;  2FCM A;  4RFB A;  4IG7 B;  2V9H A;  2VRR B;  3DCG A;  1EF5 A;  1VDV A;  4GLS C;  4A3O A;  3JYU A;  1KTK A;  5GMV A;  3AU5 A;  1WMH B;  4F8C B;  4GDK A;  2CS4 A;  1K50 A;  1LQB A;  2MJE A;  2ZNV C;  4OVU A;  3WAO A;  2WDR B;  3W5V B;  1SJH D;  3ML8 A;  2IZV B;  2N0S B;  2BKR B;  2REX A;  2KAC A;  1D5X C;  3TIX A;  3V05 A;  2K6Q A;  2WGS A;  1WR1 A;  4GXB A;  2PTL A;  3P4Q B;  2JF5 A;  3A33 B;  2ZPY A;  4WJN A;  5G2N A;  4X57 B;  4XWT A;  1GB1 A;  3FIL B;  2KNB A;  2CHX A;  2NR2 A;  3VUX A;  2DWQ A;  1WGG A;  1QKZ A;  3TL5 A;  1T0R C;  1FNU A;  5J18 A;  2GBM A;  2R2Q A;  1F2R I;  1OQQ A;  4TKN A;  3AMZ A;  1DOY A;  5L83 A;  1KJT A;  4O1N A;  4DQO C;  2YEP F;  4K3C A;  4J6I A;  1XLQ A;  2BYF A;  3ENE A;  1IBX B;  1YD8 U;  2R2O A;  3WAP A;  2HTM E;  2FNJ B;  2PE6 B;  1LO5 D;  3AE8 B;  2JYE A;  5FK9 C;  4OVV A;  2WX1 A;  2QDF A;  3DWG C;  3K9P B;  1D5Z C;  3ZW3 A;  1QIL A;  1K53 A;  2KDE B;  3KUZ A;  1WXM A;  4KGS A;  3WAL A;  4PS3 A;  3N9Y C;  1FCC C;  2G4D B;  2QSD A;  4EE2 A;  3CMM B;  5AEK B;  2NVU I;  3RCZ A;  2RDH A;  3V3X A;  2MP2 B;  3NRZ A;  1ZUD 2;  2MBQ A;  2L00 B;  3QC8 B;  4ZHO A;  3PSE B;  3C19 A;  3PS6 A;  1GB4 A;  4W9K A;  2KTF A;  2MRP A;  2LGX A;  3OLM D;  5HKH A;  1C77 A;  4XDC A;  1CMX B;  4HDO A;  4AQ7 A;  1FRR A;  1OQY A;  1TTN A;  2DAF A;  3NZU A;  2MW5 A;  5CHF A;  2GBK A;  2G1E A;  3U2S C;  2RGF A;  3GP7 A;  3AXC A;  4W9H A;  1J7B A;  2V4L A;  3ZNG C;  1E8X A;  3AH7 A;  1R4M B;  5EE3 A;  2K6D B;  3AEC B;  1WY8 A;  3ZJV A;  2LAS A;  1P9D U;  3LB8 C;  5AZH A;  4H2A A;  3PLU A;  4XYC A;  3OJ3 A;  3P2B A;  2O2V A;  2NBV B;  1YX5 B;  4OZB A;  3MC8 A;  1SGH A;  3L17 A;  2PEA A;  3GZN B;  3PPA A;  2L8J A;  1XEE A;  1K51 A;  4HDQ A;  1JAL A;  1ZDX A;  4WJO A;  2KJ6 A;  4JIO U;  4GDK B;  3DPD A;  3N1Y C;  4XDD A;  3DVN V;  2D3C A;  2BS4 B;  2KFJ A;  4DHZ E;  3ZDT A;  1YN5 A;  1XCT L;  1L0Y B;  3NG0 A;  1TKY A;  3T8M A;  1P7E A;  2W55 A;  4BVU C;  3OAW A;  5FR3 A;  4K81 A;  4RM9 A;  2MBH A;  2V4I B;  3APC A;  3RMK C;  4D2K A;  1KH0 A;  3EFU A;  3W9C B;  1XCQ L;  3SFE B;  1VRA B;  1L2N A;  2Q5W D;  3ZXR A;  1YMH E;  1WSP A;  1K52 A;  5BYR A;  2BW2 A;  2JRI B;  2J53 A;  2DX5 B;  4LJP B;  2KC2 A;  3TCA A;  1G6J A;  1P98 A;  2OHF A;  3AE5 B;  3AED B;  2OJR A;  2VH2 A;  3DBS A;  2ZEQ A;  1FXA A;  3B2G A;  3O13 A;  4YL8 A;  3UQA A;  1FPY A;  3RT3 B;  2D11 A;  4KGT A;  1RM6 C;  2MCN B;  3AE3 B;  4NNJ B;  4WIP A;  3ZRC A;  1CK1 A;  2JT4 B;  4YSZ B;  3AV8 A;  4N59 A;  3IFW B;  1FXT B;  4A90 A;  2RSU A;  1V5T A;  2FBW B;  3M95 A;  1I4X A;  3DVG Y;  3WA0 A;  4EKU A;  3N1X C;  2GLS A;  3E9S A;  3PZD A;  1P7F A;  2BYV E;  2D3G A;  3KH0 A;  3IXS A;  2RDG A;  2RPQ A;  2N7D A;  3MC0 B;  1EF1 A;  3A1Q A;  3KYD D;  4ACF A;  2KDF B;  2QCZ A;  4LLG M;  3CSF A;  1C4C A;  2WXH A;  2XNA C;  1F0Z A;  2FIF A;  1P0R A;  4OZC A;  1S3S G;  2EMT A;  2L7R A;  4OHJ A;  4OZA A;  5G5H A;  1E9M A;  4GN1 A;  4W9C A;  4ICU A;  4A3P A;  1UEL A;  2JXT A;  3BIN A;  4RF0 A;  4IM3 A;  3TSS A;  2RR9 A;  3UI3 A;  3SHQ A;  3IT4 B;  4KV2 A;  2JZ3 B;  4LDT D;  1GUA B;  2D3B A;  1NI3 A;  1GAQ B;  1L5P A;  3ZIM A;  1E6E B;  1KM7 A;  1TGZ B;  4FXC A;  1UNS A;  5I4D A;  2RDB C;  5AZF A;  4WWM A;  2L32 A;  4XE0 A;  3PHX B;  4K3B A;  4L23 A;  3M3J A;  1M4V A;  2Y3A A;  5HFY A;  1QZE A;  4G3X B;  2TSS A;  4DK5 A;  4MM3 A;  3N1Z C;  3QQ8 B;  1WGH A;  2LJ5 A;  2CHW A;  1PDX A;  1STE A;  3KLS X;  2GBJ A;  2LRW A;  1WF9 A;  2L76 A;  3TEY A;  1VR9 A;  3N3K B;  1TY2 A;  3ZJT A;  2QEJ C;  2DYB A;  4WQM A;  1E0Z A;  4WAA A;  1KOT A;  2GBR A;  4M8N A;  1FD6 A;  2Y5P A;  1VZ6 A;  3RNB C;  3M63 B;  3PRE A;  5E6O A;  3UGB B;  3R2I A;  1FNW A;  1SBB B;  4IM2 A;  2V3S A;  2C7H A;  3ZUN A;  5D2M B;  1JQ4 A;  1GG3 A;  3DBR I;  4E74 A;  2KWC A;  2IPK D;  4B6W A;  4RCO A;  1UGM A;  1F9J A;  4BBN F;  4GOC A;  4BBN C;  4CQN A;  4I6N B;  3BVM A;  2C7M B;  4DHZ B;  2JUO A;  1NEK B;  3NVY A;  4ZOH C;  2KN5 A;  1V2Y A;  4BKT A;  1SEB D;  2N4F A;  1PGX A;  2RMM A;  5G55 A;  1V81 A;  4I6L B;  4F7Z A;  3VFK A;  4KSL C;  4CYE A;  3DBH I;  4NQK E;  1KRH A;  3AEF B;  2IGH A;  4GSW A;  5BMI A;  2V3N A;  2B76 B;  1QOG A;  1UZX B;  1MG4 A;  2WXP A;  4A9A A;  3A1Q B;  3RUL A;  4B0E A;  2K9X A;  3MHS D;  4HCP B;  2AWT A;  2W54 A;  1ZXI A;  1BUI C;  3DBL B;  3WAN A;  2KK8 A;  2DYO A;  3B08 A;  3DBR B;  1WXS A;  4WWO A;  2V3P A;  3P42 A;  1ZXH A;  5IP4 D;  3RNE C;  3ZRF A;  3ZGZ A;  2IO2 B;  4IOI E;  4KKJ A;  1F52 A;  3TEX A;  3IVF A;  2BB6 A;  1FFV A;  3L10 B;  4NJC A;  2N9E B;  4LJO B;  1XLO A;  2M17 A;  2L83 A;  3QIJ A;  1P3Q U;  1I42 A;  2HE7 A;  1FNV A;  1WE7 A;  2NPT A;  3VHT C;  3OJ4 B;  1V86 A;  1CJE A;  3DBH B;  2LGY A;  1R7S A;  4ANV A;  2HJ1 A;  4ICV A;  2KJH B;  4OW0 A;  3R3M A;  4KZ0 A;  4MM3 B;  1EWC A;  2WNM A;  2KO3 A;  1LXD A;  3TEZ A;  4E3C A;  3QAR A;  4FN2 A;  3MP9 A;  5HG2 A;  1WR6 E;  3DDC B;  4DHJ B;  4N9F 4;  1V49 A;  1NVI D;  1JRP A;  1N5W A;  4EEW A;  1YQ3 B;  5D94 A;  4ZHP A;  2BVC A;  4KX6 B;  3NS8 A;  1RAX A;  1TS5 A;  4DHJ D;  2HJ8 A;  4KZC A;  2WDQ B;  4KDL B;  3LDZ E;  1TKG A;  1N60 A;  2CR5 A;  5DCN A;  2LI5 A;  3I57 A;  4CO7 A;  4BAX A;  3NOB A;  3VVW B;  4AOF A;  4PS8 A;  3RN9 C;  3X0W A;  2BQQ A;  1YQB A;  1AYF A;  4NQL B;  2IO1 B;  2A5U A;  2JWU A;  4BZA A;  3N20 C;  4KVG B;  2K25 A;  1AWD A;  3KWV A;  5LNK 1;  3HIZ A;  2AL3 A;  4P1C C;  3IBE A;  2WU2 B;  3FC4 A;  1S1Q B;  2BGF A;  2GOW A;  2JVC A;  3W1Y A;  1E8W A;  4MH8 A;  3U7D A;  1V9J A;  2EMS A;  2PJH A;  1T3Q A;  3NVW A;  3DHI C;  4KDI C;  1E7V A;  2J0J A;  3JW0 X;  1HE8 A;  1ZKH A;  4MGK E;  4PT5 A;  4MGZ E;  4JGH B;  1WXV A;  2L52 A;  1VJK A;  2ASQ A;  2YEP B;  3EFC A;  2WU5 B;  2KC1 A;  3Q3J A;  3P4R B;  4ZRP A;  2D07 B;  1RRB A;  2WHI A;  1FEH A;  2FAZ A;  2NTT A;  3VUY A;  1YNT E;  4EZJ A;  2GRI A;  2VZK D;  3GS2 A;  1C78 A;  3TEW A;  4M8M A;  4Q2J A;  3TMP B;  4WQO B;  3Q3N C;  1ACC A;  1YN3 A;  1LM8 B;  5CHW A;  2HTH A;  2MJD A;  1ZGU B;  3Q3F A;  1R4M I;  3QHT A;  4ZYN A;  1PFD A;  1CQV A;  4RH6 A;  4C00 A;  3OG5 A;  1Q5W B;  5C3J B;  1SIJ A;  2QIE B;  3NZS A;  5AUI A;  2R61 A;  2OOB B;  4MSM B;  2IND C;  2BT6 A;  4EUT A;  3GZN I;  4ANW A;  3BVG A;  2KMA A;  2BBC A;  4W9E A;  3NUH B;  2KYW A;  1SE3 A;  2K5P A;  4NJ7 A;  1TIF A;  2J7Q B;  2LEK A;  1IPG A;  3GB1 A;  1JWA D;  3L4P A;  1D3Z A;  1SE9 A;  2E6X A;  3UQB A;  2JPH A;  4EFO A;  4EZL A;  4HJK A;  5EDS A;  2KAN A;  1WYW B;  3PVL A;  3ZTD A;  1J8C A;  3FKY A;  3VH3 B;  4FJZ A;  5C1Z A;  2MBO A;  4RMA A;  4ITK A;  3PT2 B;  1E5W A;  3AE2 B;  2V1Y A;  4C56 C;  1T6B X;  1WIA A;  2PLP A;  3H7S A;  3PZ7 A;  2K1F A;  2MBB B;  1ZPS A;  1TZ1 A;  3VUW A;  3QWZ B;  2K39 A;  4NY0 A;  5FKA C;  1WZ0 A;  3T9L A;  4USA A;  2YVC A;  5H92 C;  4K7S A;  4NAM A;  5T8I A;  1HTO A;  3BWU D;  5EE0 A;  3ZLZ A;  4HVB A;  3VTU A;  5BMG A;  5C2T B;  1GC6 A;  1T0Q C;  2PPH A;  2WWZ A;  4HRS A;  2DNF A;  4WJP A;  2MX2 A;  4MEL A;  1WJN A;  1PYW D;  3B1L X;  3SD5 A;  1IUE A;  2WP9 B;  2C9W B;  1MG8 A;  2WDT B;  3DHH C;  1QOF A;  2WXR A;  3SFD B;  5L95 C;  1C4P A;  4LNI A;  4ANU A;  3AEG B;  1H4R A;  3AEB B;  2A4Z A;  1TS4 A;  2DBY A;  1XO3 A;  4C80 A;  3QCA A;  2LMC A;  3IHP C;  3BK2 A;  1C4A A;  2PVG C;  2PMV A;  3JSV A;  4DXF A;  3M62 B;  1QT9 A;  1E8Y A;  1XLP A;  3W5U B;  4TQ0 A;  5G5G A;  2N7E A;  1KFY B;  1NBF C;  3KYC D;  3VDZ A;  3A9K A;  2KN4 A;  4LNK A;  2UYZ B;  1I4Q A;  4IKG A;  2CU1 A;  2JZP A;  2D10 A;  2HDE A;  1MFW A;  4N58 A;  2N9X A;  1TT5 B;  2Y5B B;  3MC9 A;  4KKI A;  1BXT A;  3EHV A;  4MT5 A;  2BYE A;  4IC7 B;  2BYT A;  1WRD B;  3T3N A;  3KUD B;  2WLB A;  2KZR A;  3R7Q A;  2AL6 A;  3RNA C;  3VRB B;  3AU4 A;  2GB1 A;  2KOX A;  2EKE C;  3KUC B;  2ZVN A;  1KF6 B;  1EUV B;  3KW5 B;  2WXO A;  3FAH A;  4GU2 A;  4YXD B;  3Q8C A;  1QLB B;  4YTM B;  4LNO A;  3C0R B;  3I63 C;  1SE4 A;  1OFF A;  1XT9 B;  4BOS C;  3NJT A;  2XBB C;  3H6N A;  2EKI A;  3RNG C;  1L0X B;  1U4A A;  3KQ4 A;  2G4S A;  1ISN A;  4LDT B;  2KVZ A;  2JRH A;  1C1Y B;  1E10 A;  3SEB A;  1I7H A;  2PW9 A;  4KIK A;  2IO3 B;  3CIR B;  4RGT A;  1LFD A;  1ZOY B;  4BOZ B;  1Q0W B;  2BWE S;  3AE4 B;  2IGG A;  2ZJD A;  3RUI B;  2AQ2 B;  2GBN A;  5FR6 A;  3AE6 B;  2IJ0 A;  3DOW A;  3P1M A;  4GDL A;  1FM0 D;  5JH5 C;  1UUP A;  2K3U A;  1FMA D;  1V6E A;  4FLH A;  3RI7 C;  2KQ4 X;  1K8R B;  1OEY J;  4M00 A;  3V61 A;  3P4P B;  1OGW A;  4FHK A;  4AJW A;  2O2V B;  3IG3 A;  2JX5 A;  1MVK A;  4LK0 M;  2GMI C;  1WFY A;  1UBI A;  3ZNH B;  4HWI B;  4G50 A;  2BS2 B;  2WXM A;  4WAF A;  2KVR A;  2AQ3 B;  3V6E B;  2MH7 A;  3P63 A;  1AN8 A;  4FBJ B;  1VCB A;  2VH1 A;  4REZ A;  4DXA B;  1OEY A;  3HVD A;  1JWS D;  2N1W A;  1N5X A;  1WRI A;  2AQ1 B;  3APD A;  3E56 A;  1E7U A;  2BKF A;  2H88 B;  2J52 A;  5IA7 A;  2LGI A;  1L0V B;  1JWU D;  2DAJ A;  1N6Z A;  1B1Z A;  1FXI A;  5EE9 A;  4NJ6 A;  1PQS A;  4JQW C;  2INN E;  1KLV A;  2DZJ A;  2O6V D;  1WE6 A;  2QHO A;  2BB5 A;  1EO6 A;  2WXK A;  4MGY E;  4JX1 C;  5JHA A;  2W9N A;  3VAW A;  3DBL I;  5EE1 A;  1RYJ A;  2JSV X;  2L3Z A;  2KLG A;  2I1J A;  2SEB D;  3PZ8 A;  1MJD A;  1YN4 A;  1NYQ A;  4MGI E;  1D5M C;  4FJV B;  5E6P A;  3UIO B;  3PRP B;  2KX0 A;  4HCN B;  1IGC A;  4AUQ C;  1Q10 A;  1WGD A;  2E3T A;  4W9G A;  4FJY A;  3URY A;  2PIA A;  1I4P A;  1A70 A;  2KKC A;  2C5L C;  2I38 A;  5CTR C;  1WWT A;  4LTU A;  2N7J A;  3EC8 A;  1JW9 D;  4W9J A;  4WWP A;  3PRZ A;  4RGM A;  2CKH B;  2IY0 B;  3R7R A;  1JWM D;  3CST A;  3EEC A;  3PRM B;  4C7Z A;  1ET6 A;  2MSE D;  2K8B A;  1UBQ A;  2DYM A;  1GJZ A;  2FCQ A;  1ZP0 B;  3CWI A;  4TUU A;  1H8C A;  1ENF A;  2KMM A;  1V8C A;  5J17 A;  5HI1 A;  1VLB A;  2N9K A;  4ZRQ A;  4URK A;  4HPM B;  4HPL B;  2NBU A;  2MQJ A;  3RYT A;  1L4Z B;  3HHM A;  2N9P C;  1TKE A;  1NDD A;  3ZYY X;  1DOI A;  3Q6B A;  3ZXV A;  3QJZ A;  2FCN A;  4ANX A;  1TY0 A;  4XZ4 A;  3UF8 A;  4WJQ A;  1SF0 A;  3WAM A;  3Q14 C;  4GDL B;  2LUE A;  2NCN A;  2BPS A;  1UD7 A;  2LVQ A;  1V1O A;  2WDV B;  3APF A;  1QF6 A;  2JU6 X;  4A55 A;  5LLI A;  3ZO5 B;  1QOB A;  2KJR A;  5BO4 B;  1SB3 C;  2MBE A;  4RF1 A;  4S0R A;  1BML C;  3PGE A;  3MJW A;  3H7P A;  3ZQ4 A;  2ZCB A;  5DPW A;  2JYT A;  2Z8L A;  5DPS A;  2G3Q B;  4RGN A;  5D3D A;  3OWE B;  4C7Y A;  1WH3 A;  2J4X A;  5D3I B;  2NMQ A;  4HXD A;  2DZI A;  2MHJ A;  1YQ4 B;  5AZG A;  2KHW B;  4XGA B;  3K9O B;  3HVZ A;  3HRD D;  2JY6 A;  3ONS A;  1F1H A;  5JZE B;  1ESF A;  1YJI A;  2DZM A;  1TYG B;  2AYO B;  5LXH A;  2CU3 A;  1QOA A;  4LCD E;  2K8H A;  5IN7 A;  2X38 A;  3PTF C;  1TS3 A;  2UWQ A;  1UWM A;  1C3T A;  1N62 A;  2Z0E B;  3W1S C;  4FAD A;  1XF5 L;  4ZRJ A;  4ARI A;  5CX3 A;  3IT6 B;  5BYQ A;  2KDB A;  3A4S C;  3SDL C;  4W9L A;  2XK5 A;  2M0X A;  4NPN A;  5DPR A;  1MI0 A;  2ZW1 A;  3AB5 A;  1KLU D;  1FIQ A;  2KWV B;  2MWS B;  1YOV B;  2L0F A;  3DWM A;  4DWF A;  1Y56 A;  2G9H D;  2M1M A;  3H8H A;  3EUB 2;  1AW7 A;  4NAW A;  2M0A A;  4IM0 A;  2ZPN A;  3V60 A;  1C79 A;  2KFK A;  2KLC A;  4HRO A;  1YIW A;  1I4H A;  2NS5 A;  2W82 A;  1UWX A;  2DLB A;  2N9L A;  2ACZ B;  2X8X X;  4JWS C;  3GE8 C;  1VD2 A;  3DVN U;  3ZTC A;  3R8B A;  2VZK B;  3HUI A;  4W9F A;  4JWU C;  1V5O A;  4GGQ A;  2JQR B;  2WXF A;  3H1U A;  4W9D A;  2N1V A;  3L54 A;  2KQS A;  4DDI D;  2UU7 A;  4RGO S;  1DGJ A;  5JXV A;  2M56 B;  2LUM A;  4II3 B;  2KWU B;  1WM2 A;  2B3A A;  5DPT A;  4HEA 1;  4TV3 A;  4PYU A;  1E8Z A;  3PHW B;  2MEK A;  2FID A;  4J3O D;  4PK1 A;  1T0S C;  1SJE D;  4BKS A;  1WX9 A;  3S2A A;  2LD9 A;  1D4B A;  3DQV A;  5J2R A;  1YX6 B;  4N6E B;  4IWP A;  1J0G A;  1GOZ A;  1UH6 A;  2D3A A;  1JWB D;  3RZW C;  1C9F A;  4ZRK A;  4GB9 A;  2LHD A;  2IYD B;  2KDM A;  4QAY A;  2LGS A;  3I3T B;  3N32 A;  4MAC A;  2AX5 A;  2NPT B;  1HZ6 A;  1WJ6 A;  1EM7 A;  1EU4 A;  4YSX B;  2K8C A;  1V97 A;  4P16 A;  3H7P B;  4HLE A;  3DHG C;  4US9 A;  4FUL A;  1SIF A;  1FO4 A;  2QC8 A;  5IOI A;  3D32 A;  5TR5 A;  2WYQ A;  5JHB A;  2LWP A;  2FUG 1;  3ECI A;  3AUL A;  4A20 A;  4B95 A;  2QJL A;  2BS3 B;  3B0A A;  1M94 A;  4IUM B;  4PS7 A;  2C60 A;  4P7I A;  2Z0D B;  3NS1 A;  3R66 C;  4EOY A;  2BWF A;  3L16 A;  2BF8 B;  3C8Y A;  2PVO D;  3BK1 A;  3NVV A;  3V62 A;  2QMT A;  1JRO A;  3CF6 E;  4TQ1 A;  1V80 A;  2GI9 A;  1WJU A;  3HM3 A;  2KXJ A;  3AE1 B;  2LFI A;  2FE8 A;  3ZVV A;  5CHV C;  4XWW A;  3JVZ X;  1P1A A;  4B0M A;  4AWJ A;  1A5R A;  1GPX A;  1RFK A;  3TBL D;  3X23 A;  2XK5 B;  3ETR A;  2EEL A;  3I5J C;  4S17 A;  3QAQ A;  4F1S A;  1ZDV A;  2IO0 B;  1WGK A;  3LYY A;  4RNA A;  3LXF A;  2IBI B;  1EWY C;  1HEZ E;  2KTR A;  4NAW B;  1SXT A;  4L1B A;  1F2R C;  2KFK B;  1ET9 A;  2O6V A;  4AJY B;  4ASW C;  3VR8 B;  3RNF C;  4CHK A;  1EU3 A;  3HK0 A;  1UF0 A;  3AN1 A;  3BII D;  3UIP B;  1MHH E;  1WJ4 A;  1JRU A;  2WXQ A;  1RLF A;  1PGA A; 
#chains in the Genus database with same CATH homology
 4C4V A;  2VH1 A;  4BZA A;  4C4V B;  3MC9 A;  3MC8 A;  2QDF A;  2X8X X;  2V9H A;  4C00 A;  2MHJ A;  3Q6B A;  2QCZ A;  3OG5 A;  4QAY A;  4K3B A;  3NJT A;  4PK1 A;  4K3C A;  2VH2 A;  3EFC A;  4XGA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...