4PK1A

Structure of bamb fused to a bama potra domain fragment
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
640
structure length
494
Chain Sequence
EIQQINIVGNHAFTTDELISHFQLRDEQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRMSPLPTVENQFTPTTAWSTSVGSGIGNFYSNLHPALADNVVYAADRAGLVKALNADDGKEIWSVSLAEPALLSGGVTVSGGHVYIGSEKAQVYALNTSDGTVAWQTKVAGEALSRPVVSDGLVLIHTSNGQLQALNEADGAVKWTVNLDMPSLSLRGESAPTTAFGAAVVGGDNGRVSAVLMEQGQMIWQQRISSDVDTTPVVVNGVVFALAYNGNLTALDLRSGQIMWKRELGSVNDFIVDGNRIYLVDQNDRVMALTIDGGVTLWTQSDLLHRLLTSPVLYNGNLVVGDSEGYLHWINVEDGRFVAQQKVDSSGFQTEPVAADGKLLIQAKDGTVYSITR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chimera protein of Outer membrane protein assembly factors B
publication title Crystal Structure of BamB Bound to a Periplasmic Domain Fragment of BamA, the Central Component of the beta-Barrel Assembly Machine.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 93
structure length 494
sequence length 640
ec nomenclature
pdb deposition date 2014-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
A PF01011 PQQ PQQ enzyme repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4pk1A02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4pk1A01
2V9HA 3MC8A 4K3CA 3OG5A 2X8XX 4C4VB 2QDFA 4C4VA 2VH1A 4C00A 4K3BA 3EFCA 3NJTA 2MHJA 4XGAB 4BZAA 4QAYA 3Q6BA 2QCZA 2VH2A 4PK1A 3MC9A
chains in the Genus database with same CATH superfamily
1JRUA 5HKHA 4M0WA 4XWTA 2PMVA 2LEKA 1QQRA 1C79A 1KTKA 2INPE 2FCNA 1A70A 4BKSA 3PZ7A 1AARA 1WX8A 3N30A 1TYGB 2SAKA 3TCAA 4NY0A 1H4RA 2EMTA 4N9F4 3GE3C 1YX5B 2CS4A 1WRIA 1ZDVA 4P16A 2X8XX 1L6VA 3LB8C 1UNSA 3MJWA 1ISNA 5HHDG 2XBBC 2B76B 2IYDB 1XLOA 1C9FA 1NVID 1YQ3B 5G5HA 1V8CA 1ZP0B 2KWUB 2RGFA 3ZIMA 2JRHA 4MEMA 4USAA 1TTNA 1ET9A 2PKOA 4J3OD 1SXTA 2MBQA 3DBHB 1T0SC 4HLEA 2IO3B 4FADA 1IUEA 2INNE 1T6BX 1EO6A 5HFYA 2LVOA 2PVGC 3KWVA 1PUTA 4MDKE 2GBJA 2O6VA 2BWES 2LFIA 2OHFA 2I1KA 3IAM1 2IJ0A 2LWPA 3D32A 3S2AA 4JLCA 4DHJD 5IN7A 3OJ3A 3LYYA 3RNGC 3N20C 2BB5A 4C7ZA 2HTHA 3A1QA 3A4SC 1QILA 1JRPA 2DLBA 3NJTA 3AE9B 1FFUA 2NPTB 3AECB 3HHMA 4WWPA 5LLIA 3DBRB 2KQ7A 1S3SG 2C60A 1QT9A 5LXIB 2WU2B 1VCBA 1OEYA 1TKEA 1WGRA 1F2RI 1RYJA 2YLMA 1E8WA 2DENB 2Y5BB 1TS4A 4HXDA 3VVWB 1Q0WB 1PFDA 3P4SB 1IP9A 2EMSA 2C7NB 4EOYA 1E9MA 1VR9A 4WWOA 2FIDA 1V80A 3AE2B 4IC7B 3Q6BA 2KTRB 1GC6A 1IGDA 2ACZB 3NVWA 1KF6B 1ZXIA 2A5UA 2N1WA 2NVUI 2IO2B 2IPKD 1T0QC 2WXQA 3NZSA 4UDUC 3WAMA 5C3JB 4JGHB 3BVZA 4KDLB 4M02A 5KHQA 1DOXA 2SEBD 4D2KA 2JVCA 3PO0A 2K9XA 2JYTA 1Y8RC 4EZLA 3TJPA 4KKIA 4ICVA 1WE7A 3C19A 3R7RA 3KUZA 1YD8U 4K3CA 4BVUC 3P4RB 3R7QA 3UGBB 1I35A 1E8ZA 2K22A 2GI9A 3H7PA 4MH0E 4MSQB 2KAJA 5L83A 3VQIA 1L5PA 3VFKA 4WJPA 2WX0A 5D94A 4LNIA 2CHZA 2L05A 2WXMA 4PK1A 3DBLI 3ZXRA 2RMMA 3H6NA 3APCA 2BT6A 3R3MA 4P7IA 3TIXA 1JMLA 4NAWB 4BKSD 2Z8LA 4MJSA 2V4LA 2JRIB 2L76A 1NYQA 5JXVA 3VRBB 2KC1A 2KWDA 2HE7A 1L6UA 1L7YA 3CF6E 4GN1A 5AUKA 4FHJA 1C3TA 3ZUNA 1M4VA 4DWFA 1OQQA 4MM3A 3E56A 1WR1A 2FCQA 4BOZB 2BS3B 5GMVA 2MX2A 4A6QA 4N59A 4OVVA 2ZEQA 1ZW7A 1ZDXA 5BYSA 2DWQA 4DBGA 4K1RB 3HK0A 3AXCA 4HDOA 4HKQA 2XNAC 1R4NI 1FRDA 4RGMA 1RFKA 2K8BA 2WHIA 4KDIC 1SE3A 3EFUA 1V1OA 3ECIA 2WXFA 3Q3OC 3CSTA 2OEDA 3VDZA 1LO5D 2KQSA 3UF8A 4B9KA 1WSPA 4R3DA 1WXVA 2ONQA 2LGDA 2AL3A 3DVGX 4RGOS 3TUOA 1MI0A 3Q2AC 3VUXA 2QDFA 1C4CA 1QF6A 4C00A 2MW5A 4RF0A 3T3OA 5FKAC 1YIWA 3GB1A 2N7JA 2GOWA 4ZRPA 2HTME 3TL5A 4BAXA 4OVUA 2LXAA 2X38A 1YJ1A 2LMCA 1STEA 1VLBA 2FE8A 4KV2A 1SIFA 2LHDA 1PYWD 3J9CA 3PREA 5DPRA 4DXFA 4ZRQA 2RR9A 1UH6A 2M17A 3ZVVA 5H8YE 4US8A 1ZGUB 1GPXA 1SB3C 1C78A 1OQYA 3AE1B 2O2VB 1WGYA 3NG0A 3PTFC 4I6PA 3SR6A 4WWNA 2BS4B 3A4RA 5E6JA 1AYFA 1DOYA 3IT4B 2JPHA 1HZ5A 4RM8A 1SJHD 4LNFA 3NS8A 3N9YC 3ZNHB 2VRRB 2V0GA 4WURA 3GZNB 2MH7A 2L83A 2NCNA 5FR3A 3M3JA 4M01A 1VZ7A 3PRPB 3R2IA 3AE6B 1SEBD 3FAHA 2L8JA 1V6EA 4FLHA 1L2NA 4FXCA 4DHJB 1FO4A 3NZ3A 4W9CA 3PLVA 4A3PA 1EU4A 2FNJB 4C4VB 4K7UA 1HE8A 1XLPA 1PDXA 1WRDB 2JSVX 1V1PB 4FA6A 5AZFA 4TKNA 2Y5CA 4W9IA 5AZHA 1TGZB 4GXBA 3PPAA 1ZPSA 2MBEA 2PLPA 2ZNVC 4LDTD 2N7DA 2MP2B 4B6WA 1HXYD 4ZHPA 2IO0B 2MEKA 5HG2A 3JVZX 4HRSA 3V61A 4C7YA 3BWUD 3B08A 3E9SA 1WX9A 1T0YA 2R2QA 3L17A 2OOBB 4NNJB 2MWSB 1FRRA 3RNAC 3Q14C 2EELA 1WGKA 1WXSA 1WXQA 1ZKHA 2M0XA 4GLSC 1YJIA 2LD9A 2V4IB 3AE7B 5IA7A 2BYVE 4RFBA 1J0GA 4IWPA 1HA5A 3DVGY 1ACCA 1L0YB 5BMIA 2HJ8A 3BYTB 4M8MA 2CU3A 4P1BC 3JSVA 4OZBA 1MG4A 2DZKA 3Q69A 4ARCA 2I1JA 5H92C 5EDSA 3NVZA 3BIID 1KLUD 3ZNGC 2QEJC 5T8IA 1E8XA 3W1SA 3WAPA 3BVMA 3A9JA 2C5LC 1SSNA 1WZ3A 1V97A 3P2BA 1LQBA 1VD2A 2MCNB 5C23A 4AP4C 4M0WB 1NYRA 2L3ZA 4YSYB 5DCNA 2W55A 3ML8A 3HIZA 1WJUA 3DHIC 4IM3A 1QLBB 2IY0B 4ZOHC 5G5GA 4ZYNA 3T9LA 4FN2A 4ZRKA 2KWCA 1TT5B 4TV3A 2L52A 2LUMA 5BYRA 1XEEA 3I5JC 4G0NB 3BK2A 1FCLA 5C2TB 3HM6X 4HJKA 4KGTA 4HROA 5D6JB 4C56C 5IO9A 1H8CA 2MBHA 3DVNV 3A33B 2ZVOA 1N60A 2W3SA 2K39A 1L0XB 2N9KA 1LGRA 1WFYA 2LVPA 3ZTDA 3B2GA 2MJ3A 4ZYSA 3EA6A 3ZO5B 4A55A 1XLQA 1FXAA 2IGGA 4LNKA 1GB4A 3RZWC 1FPYA 5LXHA 2C9WB 4QAYA 2XK5A 4ITKA 2G1EA 1FXTB 4W9LA 3AU5A 1UF0A 1FD6A 4RH6A 3L54A 1IGCA 4XC2A 1BT0A 4B0MA 1RM6C 1J19A 2PW9A 1AWDA 4YTMB 2BKRB 3P4QB 4TQ0A 4EZJA 3AM9A 1D5MC 2KFKA 3O65B 4RNAA 2BYTA 2IBIB 2KOXA 2KXJA 2IY1B 3CMMB 4HCNB 3V60A 2A4ZA 5JH5C 4YTPB 1SE9A 4XE0A 3A1QB 2GBMA 1M94A 4BKGA 2KO3A 1HTOA 2KACA 4DHZE 3L10B 2DYOA 4S0RA 3WALA 3IBEA 4G3XB 1QZEA 2MQJA 4BBNC 3RYTA 4S17A 2BQQA 3NY5A 3KYDD 2JF5A 2KQ4X 4RF1A 3ZXVA 4A3OA 3DVNU 1QKZA 4DDID 3RULA 1JW9D 2QILA 2LRUA 3Q3FA 2LI5A 1X1MA 2RDHA 3PLUA 2JWUA 1WGGA 1FXIA 4TSSA 2N9EB 4AWJA 1VJKA 5IOIA 5BO4B 2WS3B 3NZUA 2AL6A 2VZKB 3N3KB 4OVZA 4G11A 3AEGB 2ZNVB 1N62A 2KT7A 4NQKE 3DBSA 5JHBA 1MG8A 4ICUA 2QSDA 3RNEC 4IG7B 4WJNA 3WANA 2ZPYA 4FJYA 3AE5B 3L16A 4LK0M 3EECA 2V3SA 4L1BA 4IDIA 3VAWA 2WP9B 2ZPNA 3H7PB 3R8BA 1V49A 2B3AA 4MGIE 3ZDTA 2JUOA 2KVZA 1EF1A 1QOAA 1GC7A 2C7HA 3AE3B 3VTUA 1WXMA 3QJZA 4IM2A 5FR6A 1HTQA 3DCGA 4LCDE 3RFZB 1HQRD 2KYWA 3Q8BA 1I4RA 2Y3AA 2FBWB 3QQ8B 4K7SA 2JXXA 1GOZA 1UWMA 2JZPA 2KLCA 3IAS1 4B0EA 2GBNA 1V5TA 2N9XA 2HJ1A 4WAFA 4ZHOA 2NTTA 4HK2A 3X0WA 3P42A 1QOBA 4JQWC 1V5OA 3L0WB 2BF8B 1BUIC 1J7CA 2K0PA 2KN4A 4JL9A 1NENB 1P98A 2M4NA 4KGRA 4XYCA 1TIFA 4XWWA 1IBXA 2J42A 4MM3B 3L08A 1V2YA 3VTWA 2FUG1 4HVBA 1B1ZA 1YOVB 1F52A 3K9OB 3Q8EA 4FULA 4EZKA 2KMAA 4K3BA 3MTNB 4TQ1A 3OWEB 3HUIA 1P3QU 2BTEA 5BMGA 4PYZA 3AH7A 2N9PC 2N7EA 3ZW3A 3RZFA 4HPPA 1JQ4A 3W1SC 4A8XC 3U52E 2DZMA 4GB9A 4AS1A 1B9RA 3PHXB 1K51A 2L1AA 3MC0B 3Q3JA 3DDCB 4W9GA 4LJPB 2QC8A 3PZDA 5JZEB 3SFDB 1WF9A 1JROA 2AWTA 1WE6A 1Q1OA 1WMHA 3AULA 1C77A 4II3B 4BZAA 3DHGC 3QC8B 3AE4B 3A9KB 1KOTA 2UWQA 1F9JA 4IOIE 1R4MI 2KLGA 3VR9B 3AEFB 1L4ZB 4L23A 1S1QB 2MA9B 3Q3NC 3NRZA 3QX1A 3M95A 1YN3A 2JZZA 3P63A 1YJJA 4LJOB 3VHTC 1FM0D 1DYQA 3QA8A 3GP7A 3V6EB 1XT9B 4REZA 3VTVA 2INDC 3M62B 3VR8B 4AQ7A 4RMAA 3SFEB 3HVDA 3SD5A 2N0SB 3OAWA 4H2AA 2BW2A 1AN8A 2FUHB 2JU6X 4HDQA 4YSZB 3Q8CA 2KNBA 1XF5L 2KKCA 3I57A 2DZIA 4RCOA 3DWMA 4K7WA 4P6VF 3O13A 5L95C 4JWSC 1EF5A 1KJTA 2Z0EB 3CWIA 2NBWB 1GJZA 1C4AA 4IWOA 3W5UB 2R61A 3RNBC 3AEAB 2O6VD 1WXAA 4MELA 2WLBA 1WR6E 2D11A 2YEPB 1EWYC 1BMLC 1XO3A 2LXCA 1KFYB 1E8YA 5CHWA 2M19A 5D2MB 1K52A 2WDVB 1L4DB 4HWIB 2KD0A 3JW0X 3RI7C 1ZUD2 1F2RC 2MBOA 3EUB2 5G2NA 1GUAB 2GBKA 3SHQA 1FNVA 3BZDB 4YL8A 2ON8A 1P7FA 3DQVA 4W9HA 2QMTA 3ABVB 3GOEA 4MT5A 2I38A 2M56B 1HZ6A 1JWBD 2CHWA 3K9PB 1D6EC 5CHFA 2UYZB 1LXDA 2BS2B 2PVOD 3BYYB 4HPMB 1VRAB 5AEKB 2JT4B 3BVGA 3NVVA 4ZRIA 2J4XA 2GBRA 2WXGA 3UQAA 1E6EB 2KX0A 3MHZA 1F77A 2DAFA 4WAAA 3TSSA 3ALBA 1MVKA 3NHEB 3U7ZA 4CYEA 2K6QA 2AQ1B 2J0JA 4AJYB 3JSVB 1GAQB 2N1VA 2WQYB 1WIAA 3IHPC 1UUPA 3PZ8A 1GG3A 3C0RB 3ZKJC 3UIPB 1FIQA 2ZZPB 4NJ6A 2I2YA 2IO1B 1VZ8A 3PRZA 1YN4A 3A9JB 3B2FA 3Q3MC 3IG3A 2CHXA 4F1SA 1NI2A 2WYQA 3PGEA 4GOCA 1E90A 3IVFA 2K25A 1LFDA 3ZRFA 2Z0DB 2BYEA 1JWAD 3NOBA 3MC9A 3QK0A 1TS3A 3QARA 2MBBB 3P4PB 2GLSA 2CJOA 3UIOB 3OG5A 1WX7A 4EUTA 4A9AA 3T8MA 1RRBA 5EE0A 1EWCA 4W9FA 4I6NB 5TSSA 4JWUC 2K5PA 2LUEA 2EKEC 3B9JA 2FAZA 4LNOA 2M0AA 1E7VA 1Z5SB 3VUWA 5CTRC 1TBEA 4KSKC 2XK5B 3LXFA 3PSEB 4WIPA 1TS2A 4OW0A 4KVGB 3FILA 1SIJA 4W9KA 1QOFA 2FCSA 4KIKA 3PV1A 2D3CA 2DBYA 1NI3A 2MSED 2N9LA 3KW5B 2KHWB 1PGAA 3EHVA 2KFKB 5DPTA 1N6ZA 1N61A 4BKTA 1CMXB 3WAOA 2KVRA 3ZNZB 1V81A 3ZTCA 4MGKE 2AQ2B 2PTLA 2DHZA 3L4PA 2J7QB 3AEEB 3B0AA 3ZRCA 2BYFA 4C4VA 2VH1A 1MJDA 4GIVA 1TS5A 3AEDB 3AU4A 4BOSC 1CK1A 1V1PA 1KRHA 1XXGA 4GDLA 4GDKA 2ZCBA 2WU5B 1JWMD 4YSXB 2JX5A 1UGJA 1YMHE 1E5WA 2G45B 2JQRB 4KGSA 3PHWB 2K8CA 2LHEA 2MLBA 2K3UA 1XD3B 2D5GA 1SE2A 4WWMA 3ENEA 2MHJA 1FCCC 2W3RA 4KSLC 3VXWA 2LZ6A 4TMAB 1YQ4B 1JWUD 4HJGE 2KDIA 4XDCA 4AJWA 5E6NA 3DHHC 3M63B 1GNUA 1WZ0A 4NQLB 3UINB 2XN9C 4L2YA 4B95A 3OLMD 2MRPA 5D3DA 4JE3B 3PRMB 2O6VB 5BMHA 1DOIA 4P1CC 2OJRA 3AE8B 1D3ZA 2H88B 2ZW1A 3FC4A 4URKA 3ZLZA 4OHJA 2LVQA 3ZJVA 3I9V1 2RPQA 2AEHA 1T0RC 2D2QA 4GU2A 5IKCM 2IGHA 4PT5A 2DX5B 3DBLB 1R4MB 2CR5A 3KVFB 3EGRA 3ETRA 4IKGA 3QIJA 1UZXB 4M00A 5J18A 3H9DA 4W9DA 1V9JA 2D10A 2GMIC 2BB6A 3JYUA 4LTUA 1IBXB 1T5XD 2WXHA 5JHAA 4MACA 1RLFA 1D4BA 4JX1C 2JY6A 3GS2A 2LGIA 2KMMA 2NMQA 5GXGB 5J2RA 3AB5A 2FIFA 4ASWC 3RNFC 1LM8B 3EFCA 5EE3A 1WJ4A 1GB1A 1D5XC 2W82A 3CIRB 4WH4A 3FKYA 2XEWA 1R7SA 2LJ5A 2QCZA 2V9HA 4CO7A 1TKYA 3BINA 3QCAA 4YXDB 4OZAA 1Q5WB 4PYUA 2KDEB 1IPGA 4XX5A 2KDMA 1R4NB 2DNFA 5E6OA 1N63A 1WMHB 4I6LB 2M1MA 2L7RA 2WXKA 1YN5A 2WDTB 2LRWA 1T3QA 3MC8A 2RDBC 3KUCB 1N5WA 3MP9A 2PE9A 4IW0A 1WYWB 3HM3A 1D5ZC 4AOFA 1EUVB 2DYMA 2V1YA 5LNK1 4DK5A 2JWZA 2GB1A 4MJSB 1Q10A 2L0TA 2AYOB 2NBUA 2KANA 3ML9A 4E71A 3Q8AA 2WNMA 1G6JA 1SF0A 4LDTB 3U8ZA 1ROEA 1A5RA 1TJEA 1ESFA 2WXJA 1TY2A 3WA0A 3T3NA 4OZCA 4HPLB 3RPFC 3AI5A 1Z2MA 4WJOA 2J52A 5AUIA 5IAAC 1EU3A 1EM7A 4IWQA 2EKIA 4LNNA 4NZLB 2KDFB 1MPEA 2M8SA 4KKJA 4MGYE 4DHZB 2NR2A 3R2TA 3V62A 2RDGA 1OTRB 3PT2B 2WX1A 2KMCA 2ICIA 4YTNB 3DOWA 1OQRA 2PE6B 2RD0A 1WGHA 1KM7A 1XQQA 1TZ1A 3URYA 3QHTA 3W5VB 4EKUA 5I4DA 3CSFA 4PS7A 3VRAB 1I4HA 1PQSA 2G4SA 2BBCA 1ZXHA 2FCMA 1XCQL 3U30A 3APDA 3N1ZC 4MGZE 4A90A 4EE2A 3N1XC 3HVZA 2BVCA 2WXIA 4E3CA 2QHOA 1JWSD 3TEYA 2BWFA 2NPTA 5TR5A 3WCQA 3RNCC 3DWGC 4GMVA 2OJWA 3AMZA 2ZCCA 3V6CB 4FJVB 2REXA 2J0KA 1C1YB 2G3QB 3GE8C 3KH0A 3VUYA 3TEXA 2E6XA 3ZQ4A 3RUIB 2TSSA 1MHXA 3N1YC 3KWLA 4EEWA 2J0MA 4NJCA 3TEZA 1I42A 1KH0A 1CZPA 2KZRA 2AX5A 1RAXA 2KTRA 1SJED 4ANVA 1K50A 2KN5A 3DBHI 4MH8A 1DGJA 1ZE3D 4PS3A 1UWXA 2JXTA 3I3TB 3SEBA 3ZJTA 2D3AA 1WM3A 3I63C 1SBBB 1YQBA 2K1FA 1J7BA 5FK9C 1FFVA 2ZVNA 3MHSD 1HEZE 2D3GA 3RD2A 2KX3A 2N4FA 4PS8A 4BBNF 2Z59B 2INCC 2D3BA 4RGNA 1P1AA 1TKGA 2V3NA 2AQ3B 1KLGD 3LDZE 2H89B 4HKZE 3DBRI 5HI1A 4N6EB 4FBJB 3A9KA 3BY4B 2NBVB 3X23A 4GGQA 3SDLC 3L13A 4HCPB 4X57B 4F8CB 4JIOU 1NEKB 4NAWA 4NJ7A 2Y5PA 2PEAA 2NS5A 5CHVC 3ZJUA 2ASQA 2YEPF 2J53A 3TMPB 3U7DA 1PGXA 4G50A 4FHKA 1WWTA 2DZJA 3AV8A 4NPNA 1I4PA 3W1YA 3NS1A 3IFWB 1WYGA 3LJ3A 1N5XA 2WGSA 4YT0B 3R66C 4DQOC 1F0ZA 3KUDB 2C7MB 1J8CA 4CQNA 2BGFA 2VZKD 4JPSA 4LLGM 4ZRJA 1E7UA 4MSMB 4RM9A 2YVCA 4IM0A 5DPSA 2KK8A 1PGBA 3FILB 2LJIA 1FNUA 2KFJA 2PIAA 2G4DB 1JCKB 2WXLA 3EC8A 4XDDA 4KIKB 4W9JA 1JALA 1U4AA 2L00B 5G55A 3VH3B 2RSUA 2W9NA 1IYFA 2PPHA 3NUHB 3OJ4B 4EFOA 1BXTA 2UU7A 3U4EG 2BPSA 3APFA 3H8HA 1AW7A 1XCTL 2JZ3B 4KZ0A 4IUMB 3KYCD 2Q5WD 4DDGD 2K8HA 1UELA 3MFGA 2WWZA 1F1HA 3ZDMC 3SU8X 1FEHA 4W9EA 2QIEB 3V3XA 3IXSA 1SE4A 2E3TA 4WQMA 5DPWA 3ZGZA 1I4GA 1RWSA 3QWZB 4GDLB 4GDKB 4DXGA 1K53A 2KC2A 3IT6B 5D3IB 1RFAA 4F7ZA 2WXPA 4ACFA 4TUUA 3W2DA 1FNWA 3PS6A 3H7SA 4CHKA 2KWVB 4GSWA 1WJNA 2O2VA 3DPDA 1OFFA 5KHOA 1P7EA 1ZOYB 4ZDVA 5MPOA 1YX6B 3QAQA 4ARIA 4FJZA 3ZNID 4J6IA 2IGDA 2HD5B 1ET6A 1UBQA 1K8RB 2PJHA 1I4XA 2MJDA 1FMAD 3RCZA 1WGDA 3ZYYX 3ONSA 3TBLD 1MHHE 2RPVA 2W54A 4HEA1 4YWGG 2WXRA 2WXNA 1C4PA 2MJEA 3HRDD 2WDRB 3BK1A 2R2OA 1TY0A 4WJQA 2IDYA 2QJLA 2D07B 1E0ZA 2LGSA 4N58A 2CU1A 2K6DB 2L0FA 5J17A 4DXAB 3MJ5A 4RGTA 4O1NA 3PVLA 4US9A 3KQ4A 3B1LX 1P0RA 2KJ6A 2WXOA 2LASA 4Q2JA 3U2SC 2ZW0A 1C76A 1OGWA 2BKFA 2VH2A 1KLVA 1J7AA 5D7GA 3WIMA 1I7HA 1WI0A 5CX3A 4AUQC 3W9CB 1NDDA 1UD7A 1L0VB 2MP2A 4ANXA 3C8YA 2GRIA 2LGXA 2CKHB 3N32A 2V3PA 4M8NA 4BFRA 4KZCA 1V86A 5BYQA 2L32A 5EE9A 2DYBA 2HDEA 5IP4D 4A20A 3RN9C 4II2B 1P9DU 3KLSX 5EE1A 1NBFC 1WM2A 3VH4B 2DAJA 1CJEA 4E74A 1E10A 3UI3A 3GZNI 2KJHB 1UGMA 3Q8FA 1QOGA 2G9HD 2ZJDA 4XZ4A 3RMKC 2KJRA 1WJ6A 2NTSA 2WDQB 4ANUA 4XGAB 5C1ZA 1UBIA 5E6PA 1E7PB 1VDVA 1YNTE 4ANWA 2LGYA 1TZOA 1ENFA 1CQVA 4NAMA 2IZVB 1XLNA 2KDBA 3H1UA 1Y56A 2JYEA 3P1MA 1WY8A 4C80A 3AEBB 3AN1A 1SGHA 3RT3B 2KTFA 1WH3A 1VZ6A 5AZGA 3V05A 4K81A 3UQBA 4WQOB 3TEWA 1I4QA 2CJNA 4KX6B 1MFWA 1OEYJ 3NVYA
chains in the Genus database with same CATH topology
2V9HA 3MC8A 4K3CA 3OG5A 2X8XX 4C4VB 2QDFA 4C4VA 2VH1A 4C00A 4K3BA 3EFCA 3NJTA 2MHJA 4XGAB 4BZAA 4QAYA 3Q6BA 2QCZA 2VH2A 4PK1A 3MC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V9H A;  3MC8 A;  4K3C A;  3OG5 A;  2X8X X;  4C4V B;  2QDF A;  4C4V A;  2VH1 A;  4C00 A;  4K3B A;  3EFC A;  3NJT A;  2MHJ A;  4XGA B;  4BZA A;  4QAY A;  3Q6B A;  2QCZ A;  2VH2 A;  4PK1 A;  3MC9 A; 
#chains in the Genus database with same CATH topology
 1JRU A;  5HKH A;  4M0W A;  4XWT A;  2PMV A;  2LEK A;  1QQR A;  1C79 A;  1KTK A;  2INP E;  2FCN A;  1A70 A;  4BKS A;  3PZ7 A;  1AAR A;  1WX8 A;  3N30 A;  1TYG B;  2SAK A;  3TCA A;  4NY0 A;  1H4R A;  2EMT A;  4N9F 4;  3GE3 C;  1YX5 B;  2CS4 A;  1WRI A;  1ZDV A;  4P16 A;  2X8X X;  1L6V A;  3LB8 C;  1UNS A;  3MJW A;  1ISN A;  5HHD G;  2XBB C;  2B76 B;  2IYD B;  1XLO A;  1C9F A;  1NVI D;  1YQ3 B;  5G5H A;  1V8C A;  1ZP0 B;  2KWU B;  2RGF A;  3ZIM A;  2JRH A;  4MEM A;  4USA A;  1TTN A;  1ET9 A;  2PKO A;  4J3O D;  1SXT A;  2MBQ A;  3DBH B;  1T0S C;  4HLE A;  2IO3 B;  4FAD A;  1IUE A;  2INN E;  1T6B X;  1EO6 A;  5HFY A;  2LVO A;  2PVG C;  3KWV A;  1PUT A;  4MDK E;  2GBJ A;  2O6V A;  2BWE S;  2LFI A;  2OHF A;  2I1K A;  3IAM 1;  2IJ0 A;  2LWP A;  3D32 A;  3S2A A;  4JLC A;  4DHJ D;  5IN7 A;  3OJ3 A;  3LYY A;  3RNG C;  3N20 C;  2BB5 A;  4C7Z A;  2HTH A;  3A1Q A;  3A4S C;  1QIL A;  1JRP A;  2DLB A;  3NJT A;  3AE9 B;  1FFU A;  2NPT B;  3AEC B;  3HHM A;  4WWP A;  5LLI A;  3DBR B;  2KQ7 A;  1S3S G;  2C60 A;  1QT9 A;  5LXI B;  2WU2 B;  1VCB A;  1OEY A;  1TKE A;  1WGR A;  1F2R I;  1RYJ A;  2YLM A;  1E8W A;  2DEN B;  2Y5B B;  1TS4 A;  4HXD A;  3VVW B;  1Q0W B;  1PFD A;  3P4S B;  1IP9 A;  2EMS A;  2C7N B;  4EOY A;  1E9M A;  1VR9 A;  4WWO A;  2FID A;  1V80 A;  3AE2 B;  4IC7 B;  3Q6B A;  2KTR B;  1GC6 A;  1IGD A;  2ACZ B;  3NVW A;  1KF6 B;  1ZXI A;  2A5U A;  2N1W A;  2NVU I;  2IO2 B;  2IPK D;  1T0Q C;  2WXQ A;  3NZS A;  4UDU C;  3WAM A;  5C3J B;  4JGH B;  3BVZ A;  4KDL B;  4M02 A;  5KHQ A;  1DOX A;  2SEB D;  4D2K A;  2JVC A;  3PO0 A;  2K9X A;  2JYT A;  1Y8R C;  4EZL A;  3TJP A;  4KKI A;  4ICV A;  1WE7 A;  3C19 A;  3R7R A;  3KUZ A;  1YD8 U;  4K3C A;  4BVU C;  3P4R B;  3R7Q A;  3UGB B;  1I35 A;  1E8Z A;  2K22 A;  2GI9 A;  3H7P A;  4MH0 E;  4MSQ B;  2KAJ A;  5L83 A;  3VQI A;  1L5P A;  3VFK A;  4WJP A;  2WX0 A;  5D94 A;  4LNI A;  2CHZ A;  2L05 A;  2WXM A;  4PK1 A;  3DBL I;  3ZXR A;  2RMM A;  3H6N A;  3APC A;  2BT6 A;  3R3M A;  4P7I A;  3TIX A;  1JML A;  4NAW B;  4BKS D;  2Z8L A;  4MJS A;  2V4L A;  2JRI B;  2L76 A;  1NYQ A;  5JXV A;  3VRB B;  2KC1 A;  2KWD A;  2HE7 A;  1L6U A;  1L7Y A;  3CF6 E;  4GN1 A;  5AUK A;  4FHJ A;  1C3T A;  3ZUN A;  1M4V A;  4DWF A;  1OQQ A;  4MM3 A;  3E56 A;  1WR1 A;  2FCQ A;  4BOZ B;  2BS3 B;  5GMV A;  2MX2 A;  4A6Q A;  4N59 A;  4OVV A;  2ZEQ A;  1ZW7 A;  1ZDX A;  5BYS A;  2DWQ A;  4DBG A;  4K1R B;  3HK0 A;  3AXC A;  4HDO A;  4HKQ A;  2XNA C;  1R4N I;  1FRD A;  4RGM A;  1RFK A;  2K8B A;  2WHI A;  4KDI C;  1SE3 A;  3EFU A;  1V1O A;  3ECI A;  2WXF A;  3Q3O C;  3CST A;  2OED A;  3VDZ A;  1LO5 D;  2KQS A;  3UF8 A;  4B9K A;  1WSP A;  4R3D A;  1WXV A;  2ONQ A;  2LGD A;  2AL3 A;  3DVG X;  4RGO S;  3TUO A;  1MI0 A;  3Q2A C;  3VUX A;  2QDF A;  1C4C A;  1QF6 A;  4C00 A;  2MW5 A;  4RF0 A;  3T3O A;  5FKA C;  1YIW A;  3GB1 A;  2N7J A;  2GOW A;  4ZRP A;  2HTM E;  3TL5 A;  4BAX A;  4OVU A;  2LXA A;  2X38 A;  1YJ1 A;  2LMC A;  1STE A;  1VLB A;  2FE8 A;  4KV2 A;  1SIF A;  2LHD A;  1PYW D;  3J9C A;  3PRE A;  5DPR A;  4DXF A;  4ZRQ A;  2RR9 A;  1UH6 A;  2M17 A;  3ZVV A;  5H8Y E;  4US8 A;  1ZGU B;  1GPX A;  1SB3 C;  1C78 A;  1OQY A;  3AE1 B;  2O2V B;  1WGY A;  3NG0 A;  3PTF C;  4I6P A;  3SR6 A;  4WWN A;  2BS4 B;  3A4R A;  5E6J A;  1AYF A;  1DOY A;  3IT4 B;  2JPH A;  1HZ5 A;  4RM8 A;  1SJH D;  4LNF A;  3NS8 A;  3N9Y C;  3ZNH B;  2VRR B;  2V0G A;  4WUR A;  3GZN B;  2MH7 A;  2L83 A;  2NCN A;  5FR3 A;  3M3J A;  4M01 A;  1VZ7 A;  3PRP B;  3R2I A;  3AE6 B;  1SEB D;  3FAH A;  2L8J A;  1V6E A;  4FLH A;  1L2N A;  4FXC A;  4DHJ B;  1FO4 A;  3NZ3 A;  4W9C A;  3PLV A;  4A3P A;  1EU4 A;  2FNJ B;  4C4V B;  4K7U A;  1HE8 A;  1XLP A;  1PDX A;  1WRD B;  2JSV X;  1V1P B;  4FA6 A;  5AZF A;  4TKN A;  2Y5C A;  4W9I A;  5AZH A;  1TGZ B;  4GXB A;  3PPA A;  1ZPS A;  2MBE A;  2PLP A;  2ZNV C;  4LDT D;  2N7D A;  2MP2 B;  4B6W A;  1HXY D;  4ZHP A;  2IO0 B;  2MEK A;  5HG2 A;  3JVZ X;  4HRS A;  3V61 A;  4C7Y A;  3BWU D;  3B08 A;  3E9S A;  1WX9 A;  1T0Y A;  2R2Q A;  3L17 A;  2OOB B;  4NNJ B;  2MWS B;  1FRR A;  3RNA C;  3Q14 C;  2EEL A;  1WGK A;  1WXS A;  1WXQ A;  1ZKH A;  2M0X A;  4GLS C;  1YJI A;  2LD9 A;  2V4I B;  3AE7 B;  5IA7 A;  2BYV E;  4RFB A;  1J0G A;  4IWP A;  1HA5 A;  3DVG Y;  1ACC A;  1L0Y B;  5BMI A;  2HJ8 A;  3BYT B;  4M8M A;  2CU3 A;  4P1B C;  3JSV A;  4OZB A;  1MG4 A;  2DZK A;  3Q69 A;  4ARC A;  2I1J A;  5H92 C;  5EDS A;  3NVZ A;  3BII D;  1KLU D;  3ZNG C;  2QEJ C;  5T8I A;  1E8X A;  3W1S A;  3WAP A;  3BVM A;  3A9J A;  2C5L C;  1SSN A;  1WZ3 A;  1V97 A;  3P2B A;  1LQB A;  1VD2 A;  2MCN B;  5C23 A;  4AP4 C;  4M0W B;  1NYR A;  2L3Z A;  4YSY B;  5DCN A;  2W55 A;  3ML8 A;  3HIZ A;  1WJU A;  3DHI C;  4IM3 A;  1QLB B;  2IY0 B;  4ZOH C;  5G5G A;  4ZYN A;  3T9L A;  4FN2 A;  4ZRK A;  2KWC A;  1TT5 B;  4TV3 A;  2L52 A;  2LUM A;  5BYR A;  1XEE A;  3I5J C;  4G0N B;  3BK2 A;  1FCL A;  5C2T B;  3HM6 X;  4HJK A;  4KGT A;  4HRO A;  5D6J B;  4C56 C;  5IO9 A;  1H8C A;  2MBH A;  3DVN V;  3A33 B;  2ZVO A;  1N60 A;  2W3S A;  2K39 A;  1L0X B;  2N9K A;  1LGR A;  1WFY A;  2LVP A;  3ZTD A;  3B2G A;  2MJ3 A;  4ZYS A;  3EA6 A;  3ZO5 B;  4A55 A;  1XLQ A;  1FXA A;  2IGG A;  4LNK A;  1GB4 A;  3RZW C;  1FPY A;  5LXH A;  2C9W B;  4QAY A;  2XK5 A;  4ITK A;  2G1E A;  1FXT B;  4W9L A;  3AU5 A;  1UF0 A;  1FD6 A;  4RH6 A;  3L54 A;  1IGC A;  4XC2 A;  1BT0 A;  4B0M A;  1RM6 C;  1J19 A;  2PW9 A;  1AWD A;  4YTM B;  2BKR B;  3P4Q B;  4TQ0 A;  4EZJ A;  3AM9 A;  1D5M C;  2KFK A;  3O65 B;  4RNA A;  2BYT A;  2IBI B;  2KOX A;  2KXJ A;  2IY1 B;  3CMM B;  4HCN B;  3V60 A;  2A4Z A;  5JH5 C;  4YTP B;  1SE9 A;  4XE0 A;  3A1Q B;  2GBM A;  1M94 A;  4BKG A;  2KO3 A;  1HTO A;  2KAC A;  4DHZ E;  3L10 B;  2DYO A;  4S0R A;  3WAL A;  3IBE A;  4G3X B;  1QZE A;  2MQJ A;  4BBN C;  3RYT A;  4S17 A;  2BQQ A;  3NY5 A;  3KYD D;  2JF5 A;  2KQ4 X;  4RF1 A;  3ZXV A;  4A3O A;  3DVN U;  1QKZ A;  4DDI D;  3RUL A;  1JW9 D;  2QIL A;  2LRU A;  3Q3F A;  2LI5 A;  1X1M A;  2RDH A;  3PLU A;  2JWU A;  1WGG A;  1FXI A;  4TSS A;  2N9E B;  4AWJ A;  1VJK A;  5IOI A;  5BO4 B;  2WS3 B;  3NZU A;  2AL6 A;  2VZK B;  3N3K B;  4OVZ A;  4G11 A;  3AEG B;  2ZNV B;  1N62 A;  2KT7 A;  4NQK E;  3DBS A;  5JHB A;  1MG8 A;  4ICU A;  2QSD A;  3RNE C;  4IG7 B;  4WJN A;  3WAN A;  2ZPY A;  4FJY A;  3AE5 B;  3L16 A;  4LK0 M;  3EEC A;  2V3S A;  4L1B A;  4IDI A;  3VAW A;  2WP9 B;  2ZPN A;  3H7P B;  3R8B A;  1V49 A;  2B3A A;  4MGI E;  3ZDT A;  2JUO A;  2KVZ A;  1EF1 A;  1QOA A;  1GC7 A;  2C7H A;  3AE3 B;  3VTU A;  1WXM A;  3QJZ A;  4IM2 A;  5FR6 A;  1HTQ A;  3DCG A;  4LCD E;  3RFZ B;  1HQR D;  2KYW A;  3Q8B A;  1I4R A;  2Y3A A;  2FBW B;  3QQ8 B;  4K7S A;  2JXX A;  1GOZ A;  1UWM A;  2JZP A;  2KLC A;  3IAS 1;  4B0E A;  2GBN A;  1V5T A;  2N9X A;  2HJ1 A;  4WAF A;  4ZHO A;  2NTT A;  4HK2 A;  3X0W A;  3P42 A;  1QOB A;  4JQW C;  1V5O A;  3L0W B;  2BF8 B;  1BUI C;  1J7C A;  2K0P A;  2KN4 A;  4JL9 A;  1NEN B;  1P98 A;  2M4N A;  4KGR A;  4XYC A;  1TIF A;  4XWW A;  1IBX A;  2J42 A;  4MM3 B;  3L08 A;  1V2Y A;  3VTW A;  2FUG 1;  4HVB A;  1B1Z A;  1YOV B;  1F52 A;  3K9O B;  3Q8E A;  4FUL A;  4EZK A;  2KMA A;  4K3B A;  3MTN B;  4TQ1 A;  3OWE B;  3HUI A;  1P3Q U;  2BTE A;  5BMG A;  4PYZ A;  3AH7 A;  2N9P C;  2N7E A;  3ZW3 A;  3RZF A;  4HPP A;  1JQ4 A;  3W1S C;  4A8X C;  3U52 E;  2DZM A;  4GB9 A;  4AS1 A;  1B9R A;  3PHX B;  1K51 A;  2L1A A;  3MC0 B;  3Q3J A;  3DDC B;  4W9G A;  4LJP B;  2QC8 A;  3PZD A;  5JZE B;  3SFD B;  1WF9 A;  1JRO A;  2AWT A;  1WE6 A;  1Q1O A;  1WMH A;  3AUL A;  1C77 A;  4II3 B;  4BZA A;  3DHG C;  3QC8 B;  3AE4 B;  3A9K B;  1KOT A;  2UWQ A;  1F9J A;  4IOI E;  1R4M I;  2KLG A;  3VR9 B;  3AEF B;  1L4Z B;  4L23 A;  1S1Q B;  2MA9 B;  3Q3N C;  3NRZ A;  3QX1 A;  3M95 A;  1YN3 A;  2JZZ A;  3P63 A;  1YJJ A;  4LJO B;  3VHT C;  1FM0 D;  1DYQ A;  3QA8 A;  3GP7 A;  3V6E B;  1XT9 B;  4REZ A;  3VTV A;  2IND C;  3M62 B;  3VR8 B;  4AQ7 A;  4RMA A;  3SFE B;  3HVD A;  3SD5 A;  2N0S B;  3OAW A;  4H2A A;  2BW2 A;  1AN8 A;  2FUH B;  2JU6 X;  4HDQ A;  4YSZ B;  3Q8C A;  2KNB A;  1XF5 L;  2KKC A;  3I57 A;  2DZI A;  4RCO A;  3DWM A;  4K7W A;  4P6V F;  3O13 A;  5L95 C;  4JWS C;  1EF5 A;  1KJT A;  2Z0E B;  3CWI A;  2NBW B;  1GJZ A;  1C4A A;  4IWO A;  3W5U B;  2R61 A;  3RNB C;  3AEA B;  2O6V D;  1WXA A;  4MEL A;  2WLB A;  1WR6 E;  2D11 A;  2YEP B;  1EWY C;  1BML C;  1XO3 A;  2LXC A;  1KFY B;  1E8Y A;  5CHW A;  2M19 A;  5D2M B;  1K52 A;  2WDV B;  1L4D B;  4HWI B;  2KD0 A;  3JW0 X;  3RI7 C;  1ZUD 2;  1F2R C;  2MBO A;  3EUB 2;  5G2N A;  1GUA B;  2GBK A;  3SHQ A;  1FNV A;  3BZD B;  4YL8 A;  2ON8 A;  1P7F A;  3DQV A;  4W9H A;  2QMT A;  3ABV B;  3GOE A;  4MT5 A;  2I38 A;  2M56 B;  1HZ6 A;  1JWB D;  2CHW A;  3K9P B;  1D6E C;  5CHF A;  2UYZ B;  1LXD A;  2BS2 B;  2PVO D;  3BYY B;  4HPM B;  1VRA B;  5AEK B;  2JT4 B;  3BVG A;  3NVV A;  4ZRI A;  2J4X A;  2GBR A;  2WXG A;  3UQA A;  1E6E B;  2KX0 A;  3MHZ A;  1F77 A;  2DAF A;  4WAA A;  3TSS A;  3ALB A;  1MVK A;  3NHE B;  3U7Z A;  4CYE A;  2K6Q A;  2AQ1 B;  2J0J A;  4AJY B;  3JSV B;  1GAQ B;  2N1V A;  2WQY B;  1WIA A;  3IHP C;  1UUP A;  3PZ8 A;  1GG3 A;  3C0R B;  3ZKJ C;  3UIP B;  1FIQ A;  2ZZP B;  4NJ6 A;  2I2Y A;  2IO1 B;  1VZ8 A;  3PRZ A;  1YN4 A;  3A9J B;  3B2F A;  3Q3M C;  3IG3 A;  2CHX A;  4F1S A;  1NI2 A;  2WYQ A;  3PGE A;  4GOC A;  1E90 A;  3IVF A;  2K25 A;  1LFD A;  3ZRF A;  2Z0D B;  2BYE A;  1JWA D;  3NOB A;  3MC9 A;  3QK0 A;  1TS3 A;  3QAR A;  2MBB B;  3P4P B;  2GLS A;  2CJO A;  3UIO B;  3OG5 A;  1WX7 A;  4EUT A;  4A9A A;  3T8M A;  1RRB A;  5EE0 A;  1EWC A;  4W9F A;  4I6N B;  5TSS A;  4JWU C;  2K5P A;  2LUE A;  2EKE C;  3B9J A;  2FAZ A;  4LNO A;  2M0A A;  1E7V A;  1Z5S B;  3VUW A;  5CTR C;  1TBE A;  4KSK C;  2XK5 B;  3LXF A;  3PSE B;  4WIP A;  1TS2 A;  4OW0 A;  4KVG B;  3FIL A;  1SIJ A;  4W9K A;  1QOF A;  2FCS A;  4KIK A;  3PV1 A;  2D3C A;  2DBY A;  1NI3 A;  2MSE D;  2N9L A;  3KW5 B;  2KHW B;  1PGA A;  3EHV A;  2KFK B;  5DPT A;  1N6Z A;  1N61 A;  4BKT A;  1CMX B;  3WAO A;  2KVR A;  3ZNZ B;  1V81 A;  3ZTC A;  4MGK E;  2AQ2 B;  2PTL A;  2DHZ A;  3L4P A;  2J7Q B;  3AEE B;  3B0A A;  3ZRC A;  2BYF A;  4C4V A;  2VH1 A;  1MJD A;  4GIV A;  1TS5 A;  3AED B;  3AU4 A;  4BOS C;  1CK1 A;  1V1P A;  1KRH A;  1XXG A;  4GDL A;  4GDK A;  2ZCB A;  2WU5 B;  1JWM D;  4YSX B;  2JX5 A;  1UGJ A;  1YMH E;  1E5W A;  2G45 B;  2JQR B;  4KGS A;  3PHW B;  2K8C A;  2LHE A;  2MLB A;  2K3U A;  1XD3 B;  2D5G A;  1SE2 A;  4WWM A;  3ENE A;  2MHJ A;  1FCC C;  2W3R A;  4KSL C;  3VXW A;  2LZ6 A;  4TMA B;  1YQ4 B;  1JWU D;  4HJG E;  2KDI A;  4XDC A;  4AJW A;  5E6N A;  3DHH C;  3M63 B;  1GNU A;  1WZ0 A;  4NQL B;  3UIN B;  2XN9 C;  4L2Y A;  4B95 A;  3OLM D;  2MRP A;  5D3D A;  4JE3 B;  3PRM B;  2O6V B;  5BMH A;  1DOI A;  4P1C C;  2OJR A;  3AE8 B;  1D3Z A;  2H88 B;  2ZW1 A;  3FC4 A;  4URK A;  3ZLZ A;  4OHJ A;  2LVQ A;  3ZJV A;  3I9V 1;  2RPQ A;  2AEH A;  1T0R C;  2D2Q A;  4GU2 A;  5IKC M;  2IGH A;  4PT5 A;  2DX5 B;  3DBL B;  1R4M B;  2CR5 A;  3KVF B;  3EGR A;  3ETR A;  4IKG A;  3QIJ A;  1UZX B;  4M00 A;  5J18 A;  3H9D A;  4W9D A;  1V9J A;  2D10 A;  2GMI C;  2BB6 A;  3JYU A;  4LTU A;  1IBX B;  1T5X D;  2WXH A;  5JHA A;  4MAC A;  1RLF A;  1D4B A;  4JX1 C;  2JY6 A;  3GS2 A;  2LGI A;  2KMM A;  2NMQ A;  5GXG B;  5J2R A;  3AB5 A;  2FIF A;  4ASW C;  3RNF C;  1LM8 B;  3EFC A;  5EE3 A;  1WJ4 A;  1GB1 A;  1D5X C;  2W82 A;  3CIR B;  4WH4 A;  3FKY A;  2XEW A;  1R7S A;  2LJ5 A;  2QCZ A;  2V9H A;  4CO7 A;  1TKY A;  3BIN A;  3QCA A;  4YXD B;  4OZA A;  1Q5W B;  4PYU A;  2KDE B;  1IPG A;  4XX5 A;  2KDM A;  1R4N B;  2DNF A;  5E6O A;  1N63 A;  1WMH B;  4I6L B;  2M1M A;  2L7R A;  2WXK A;  1YN5 A;  2WDT B;  2LRW A;  1T3Q A;  3MC8 A;  2RDB C;  3KUC B;  1N5W A;  3MP9 A;  2PE9 A;  4IW0 A;  1WYW B;  3HM3 A;  1D5Z C;  4AOF A;  1EUV B;  2DYM A;  2V1Y A;  5LNK 1;  4DK5 A;  2JWZ A;  2GB1 A;  4MJS B;  1Q10 A;  2L0T A;  2AYO B;  2NBU A;  2KAN A;  3ML9 A;  4E71 A;  3Q8A A;  2WNM A;  1G6J A;  1SF0 A;  4LDT B;  3U8Z A;  1ROE A;  1A5R A;  1TJE A;  1ESF A;  2WXJ A;  1TY2 A;  3WA0 A;  3T3N A;  4OZC A;  4HPL B;  3RPF C;  3AI5 A;  1Z2M A;  4WJO A;  2J52 A;  5AUI A;  5IAA C;  1EU3 A;  1EM7 A;  4IWQ A;  2EKI A;  4LNN A;  4NZL B;  2KDF B;  1MPE A;  2M8S A;  4KKJ A;  4MGY E;  4DHZ B;  2NR2 A;  3R2T A;  3V62 A;  2RDG A;  1OTR B;  3PT2 B;  2WX1 A;  2KMC A;  2ICI A;  4YTN B;  3DOW A;  1OQR A;  2PE6 B;  2RD0 A;  1WGH A;  1KM7 A;  1XQQ A;  1TZ1 A;  3URY A;  3QHT A;  3W5V B;  4EKU A;  5I4D A;  3CSF A;  4PS7 A;  3VRA B;  1I4H A;  1PQS A;  2G4S A;  2BBC A;  1ZXH A;  2FCM A;  1XCQ L;  3U30 A;  3APD A;  3N1Z C;  4MGZ E;  4A90 A;  4EE2 A;  3N1X C;  3HVZ A;  2BVC A;  2WXI A;  4E3C A;  2QHO A;  1JWS D;  3TEY A;  2BWF A;  2NPT A;  5TR5 A;  3WCQ A;  3RNC C;  3DWG C;  4GMV A;  2OJW A;  3AMZ A;  2ZCC A;  3V6C B;  4FJV B;  2REX A;  2J0K A;  1C1Y B;  2G3Q B;  3GE8 C;  3KH0 A;  3VUY A;  3TEX A;  2E6X A;  3ZQ4 A;  3RUI B;  2TSS A;  1MHX A;  3N1Y C;  3KWL A;  4EEW A;  2J0M A;  4NJC A;  3TEZ A;  1I42 A;  1KH0 A;  1CZP A;  2KZR A;  2AX5 A;  1RAX A;  2KTR A;  1SJE D;  4ANV A;  1K50 A;  2KN5 A;  3DBH I;  4MH8 A;  1DGJ A;  1ZE3 D;  4PS3 A;  1UWX A;  2JXT A;  3I3T B;  3SEB A;  3ZJT A;  2D3A A;  1WM3 A;  3I63 C;  1SBB B;  1YQB A;  2K1F A;  1J7B A;  5FK9 C;  1FFV A;  2ZVN A;  3MHS D;  1HEZ E;  2D3G A;  3RD2 A;  2KX3 A;  2N4F A;  4PS8 A;  4BBN F;  2Z59 B;  2INC C;  2D3B A;  4RGN A;  1P1A A;  1TKG A;  2V3N A;  2AQ3 B;  1KLG D;  3LDZ E;  2H89 B;  4HKZ E;  3DBR I;  5HI1 A;  4N6E B;  4FBJ B;  3A9K A;  3BY4 B;  2NBV B;  3X23 A;  4GGQ A;  3SDL C;  3L13 A;  4HCP B;  4X57 B;  4F8C B;  4JIO U;  1NEK B;  4NAW A;  4NJ7 A;  2Y5P A;  2PEA A;  2NS5 A;  5CHV C;  3ZJU A;  2ASQ A;  2YEP F;  2J53 A;  3TMP B;  3U7D A;  1PGX A;  4G50 A;  4FHK A;  1WWT A;  2DZJ A;  3AV8 A;  4NPN A;  1I4P A;  3W1Y A;  3NS1 A;  3IFW B;  1WYG A;  3LJ3 A;  1N5X A;  2WGS A;  4YT0 B;  3R66 C;  4DQO C;  1F0Z A;  3KUD B;  2C7M B;  1J8C A;  4CQN A;  2BGF A;  2VZK D;  4JPS A;  4LLG M;  4ZRJ A;  1E7U A;  4MSM B;  4RM9 A;  2YVC A;  4IM0 A;  5DPS A;  2KK8 A;  1PGB A;  3FIL B;  2LJI A;  1FNU A;  2KFJ A;  2PIA A;  2G4D B;  1JCK B;  2WXL A;  3EC8 A;  4XDD A;  4KIK B;  4W9J A;  1JAL A;  1U4A A;  2L00 B;  5G55 A;  3VH3 B;  2RSU A;  2W9N A;  1IYF A;  2PPH A;  3NUH B;  3OJ4 B;  4EFO A;  1BXT A;  2UU7 A;  3U4E G;  2BPS A;  3APF A;  3H8H A;  1AW7 A;  1XCT L;  2JZ3 B;  4KZ0 A;  4IUM B;  3KYC D;  2Q5W D;  4DDG D;  2K8H A;  1UEL A;  3MFG A;  2WWZ A;  1F1H A;  3ZDM C;  3SU8 X;  1FEH A;  4W9E A;  2QIE B;  3V3X A;  3IXS A;  1SE4 A;  2E3T A;  4WQM A;  5DPW A;  3ZGZ A;  1I4G A;  1RWS A;  3QWZ B;  4GDL B;  4GDK B;  4DXG A;  1K53 A;  2KC2 A;  3IT6 B;  5D3I B;  1RFA A;  4F7Z A;  2WXP A;  4ACF A;  4TUU A;  3W2D A;  1FNW A;  3PS6 A;  3H7S A;  4CHK A;  2KWV B;  4GSW A;  1WJN A;  2O2V A;  3DPD A;  1OFF A;  5KHO A;  1P7E A;  1ZOY B;  4ZDV A;  5MPO A;  1YX6 B;  3QAQ A;  4ARI A;  4FJZ A;  3ZNI D;  4J6I A;  2IGD A;  2HD5 B;  1ET6 A;  1UBQ A;  1K8R B;  2PJH A;  1I4X A;  2MJD A;  1FMA D;  3RCZ A;  1WGD A;  3ZYY X;  3ONS A;  3TBL D;  1MHH E;  2RPV A;  2W54 A;  4HEA 1;  4YWG G;  2WXR A;  2WXN A;  1C4P A;  2MJE A;  3HRD D;  2WDR B;  3BK1 A;  2R2O A;  1TY0 A;  4WJQ A;  2IDY A;  2QJL A;  2D07 B;  1E0Z A;  2LGS A;  4N58 A;  2CU1 A;  2K6D B;  2L0F A;  5J17 A;  4DXA B;  3MJ5 A;  4RGT A;  4O1N A;  3PVL A;  4US9 A;  3KQ4 A;  3B1L X;  1P0R A;  2KJ6 A;  2WXO A;  2LAS A;  4Q2J A;  3U2S C;  2ZW0 A;  1C76 A;  1OGW A;  2BKF A;  2VH2 A;  1KLV A;  1J7A A;  5D7G A;  3WIM A;  1I7H A;  1WI0 A;  5CX3 A;  4AUQ C;  3W9C B;  1NDD A;  1UD7 A;  1L0V B;  2MP2 A;  4ANX A;  3C8Y A;  2GRI A;  2LGX A;  2CKH B;  3N32 A;  2V3P A;  4M8N A;  4BFR A;  4KZC A;  1V86 A;  5BYQ A;  2L32 A;  5EE9 A;  2DYB A;  2HDE A;  5IP4 D;  4A20 A;  3RN9 C;  4II2 B;  1P9D U;  3KLS X;  5EE1 A;  1NBF C;  1WM2 A;  3VH4 B;  2DAJ A;  1CJE A;  4E74 A;  1E10 A;  3UI3 A;  3GZN I;  2KJH B;  1UGM A;  3Q8F A;  1QOG A;  2G9H D;  2ZJD A;  4XZ4 A;  3RMK C;  2KJR A;  1WJ6 A;  2NTS A;  2WDQ B;  4ANU A;  4XGA B;  5C1Z A;  1UBI A;  5E6P A;  1E7P B;  1VDV A;  1YNT E;  4ANW A;  2LGY A;  1TZO A;  1ENF A;  1CQV A;  4NAM A;  2IZV B;  1XLN A;  2KDB A;  3H1U A;  1Y56 A;  2JYE A;  3P1M A;  1WY8 A;  4C80 A;  3AEB B;  3AN1 A;  1SGH A;  3RT3 B;  2KTF A;  1WH3 A;  1VZ6 A;  5AZG A;  3V05 A;  4K81 A;  3UQB A;  4WQO B;  3TEW A;  1I4Q A;  2CJN A;  4KX6 B;  1MFW A;  1OEY J;  3NVY A; 
#chains in the Genus database with same CATH homology
 2V9H A;  3MC8 A;  4K3C A;  3OG5 A;  2X8X X;  4C4V B;  2QDF A;  4C4V A;  2VH1 A;  4C00 A;  4K3B A;  3EFC A;  3NJT A;  2MHJ A;  4XGA B;  4BZA A;  4QAY A;  3Q6B A;  2QCZ A;  2VH2 A;  4PK1 A;  3MC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...