4PL9A

Structure of the catalytic domain of etr1 from arabidopsis thaliana
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
176
structure length
150
Chain Sequence
b'SLQLELGTFNLHTLFREVLNLIKPIAVVKKLPITLNLAPDLPEFVVGDEKRLMQIILNIVGNAVKFSKQGSISVTALVTKSSHFYLRVKVKDSGAGINPQDIPKIFTKFSGLGLAISKRFVNLMEGNIWIESDGLGKGCTAIFDVKLGIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ethylene receptor 1
publication title Structural Model of the Cytosolic Domain of the Plant Ethylene Receptor 1 (ETR1).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 42
structure length 150
sequence length 176
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4pl9A00
2ZDXA 2XJGA 5M4HA 3TUHA 4KTNA 1UYGA 4H7QA 4E00A 1I5BA 5M4MA 4WUDA 1MU5A 4EM7A 4XE2A 5IN9A 2YEJA 2BREA 2BYIA 4X9LA 4ASBA 2BU2A 5FNFA 3A0ZA 4E02A 2O1VA 2VCIA 1UY8A 5FNCA 3CRKA 3ZKBA 1YETA 4QPJA 1TBWA 3HYYA 1B3QA 2XX4A 4YKTA 4CWNA 3Q5LA 4EEHA 2CCUA 2XDXA 2YEIA 2FWYA 1NHHA 2WI3A 1PVGA 4YKWA 1UYIA 4EFTA 2CH4A 1YT0A 4MP7A 3B28A 2YK2A 1YC4A 2YJWA 4KFGA 2O1UA 2IOPA 3A0XA 4O09A 4W7TA 3RLQA 3GIGB 1B62A 1BYQA 3G7BA 3PEJA 5IDJA 2CG9A 2YI6A 3HZ1A 5CF0A 2FWZA 2YGFA 4ZVIA 3R92A 2BU6A 2WI5A 4LPBA 2HCHA 4R3AA 4V25A 3A0RA 2YEAA 3LPSA 4JAVA 4GT8A 4HXZA 4NH9A 4FCPA 1BKNA 4JAUA 2AKPA 1YS3A 2UWDA 4HZ0A 1NHIA 1Y4SA 5D7DA 4B7PA 2YECA 4L91A 4URMA 4KQVA 3PEHA 4ASAA 2Q2EB 1Z59A 2YEFA 3MNRP 1S16A 1UYDA 2GFDA 4XCJA 1AM1A 4XD8A 2YE7A 5IDMA 2XJXA 2VCJA 2XDKA 3B26A 4HYMA 2BU7A 3K60A 4CWQA 3FT8A 2PNRA 2Q8HA 2GQPA 2IWUA 3TZ5A 4PU9A 3ZXOA 1TC0A 4CWSA 4AWPA 5M4NA 4BIZA 3HZ5A 2CCTA 1I5AA 4BQJA 2XDUA 2HG1A 2BU5A 1S14A 4R3MA 4FCQA 1Z5AA 1YC3A 3KE6A 5C93A 1UYCA 3OMUA 3EKOA 4V26A 4O04A 4AWQA 2IWSA 4E01A 4HY1A 1EA6A 3TTZA 2H8MA 1BGQA 1TH8A 1Y4UA 3CWVA 3T2SA 4XKKA 4MPNA 3HHUA 5J71A 5CTUA 3OWBA 4CWRA 2Q8IA 2YI5A 1KIJA 4YKXA 1U2OA 3FV5A 4H81A 2Q8FA 4YKYA 1AMWA 3H4LA 2QFOA 4CE1A 1ZW9A 5D6QA 3ZKDA 2WI7A 5D7RA 1QY8A 2XX2A 5D6PA 4GEEA 2FXSA 4XDMA 1OSFA 4YKQA 1TC6A 2BTZA 4QPKA 2YI0A 2JJCA 2JKIA 1AH6A 1NHJA 2YKJA 4ASFA 3OW6A 4BQGA 2FYPA 3INWA 4NH8A 2XHRA 3G75A 3B25A 4GCZA 3K98A 2QG0A 4HZ5A 4I3HA 1KZNA 4KSGA 3R4OA 2E0AA 3OPDA 3EHHA 4AS9A 2WI1A 1ZWHA 4O05A 5F3KA 3QDDA 2YJXA 2ESAA 3CGZA 4EGIA 4L94A 3TZ4A 1H7UA 3O2FA 4ASGA 3VHCA 2YE9A 4GFNA 1GJVA 4R1FA 4XKAA 4HXWA 3RLPA 2IORA 2YE2A 3HYZA 2O1WA 2BSMA 5D7CA 4Q20A 3R4NA 2XABA 3FT5A 2Q8GA 1YERA 3R91A 2XHXA 4XIQA 4XIPA 4MB9A 1I59A 3SL2A 2HKJA 4LP0A 4UROA 1UYLA 2WEPA 4DZYA 1ID0A 2IOQA 4KSHA 4YKRA 1R62A 5CTXA 1ZXNA 4U7OA 3EHFA 2YK9A 4LWFA 4MPEA 4WUBA 3EKRA 3JZ3A 3BM9A 3TZ0A 1THNA 1Y8NA 4P8OA 5M4KA 2WERA 2WI2A 2XDLA 2XX5A 3Q5KA 3K97A 5FNDA 3VADA 1TILA 4CE3A 3EHJA 2XJJA 2YKIA 2ZBKB 2XCMA 2YEHA 2WI4A 2IWXA 2BRCA 4NH7A 3C11A 1JM6A 3D36A 4L8ZA 1UYHA 4XITA 4I5SA 3D2RA 1I58A 4O07A 1I5DA 4HY6A 4FMTA 2YE8A 3T0HA 2K5BA 4HYPA 2YE5A 1QZRA 4DUHA 4MOTA 3NMQA 2CCSA 3VHAA 2QG2A 3B27A 3U2KA 4B6CA 4JASA 3RLRA 3A0YA 1Z5BA 4LWIA 2YE4A 3O6OA 1US7A 5CPHA 3RKZA 2YGEA 2YI7A 2BZ5A 2VW5A 1U0ZA 1YESA 3INXA 3ZM7A 5L3JA 3GIGA 4CWPA 4U93A 2XD6A 1Y8PA 4H85A 3WHAA 3R4PA 2QF6A 1YT1A 1EI1A 4XTJA 3Q5JA 2ZDYA 2XK2A 4LWEA 4MP2A 4CWFA 2YEDA 4BIUA 4CWTA 3U67A 5FWKA 3O0IA 3A0TA 4LWHA 3TZ2A 2YKCA 3GIEA 4AWOA 3H80A 4EGKA 1Z5CA 2XDSA 3DGEA 3T1KA 1YC1A 4GQTA 1H7SA 2WI6A 3IEDA 4CWOA 4ZKIA 1MX0A 4XKOA 1GKZA 4L90A 1UYMA 4XIRA 4XCLA 4URNA 3WQ9A 3VHDA 4FCRA 1BXDA 3G7EA 3QTFA 5F5RA 1QYEA 4P7AA 3R4MA 2YEEA 3OWDA 2XHTA 4YKUA 2YEBA 3B24A 2BT0A 4BAEA 1UY9A 4WUCA 1ZXMA 3T0ZA 2WEQA 1I5CA 2VWCA 4MBCA 1Y8OA 4U7NA 4PRXA 1UYKA 3CGYA 2ZKJA 4KP4A 1UYFA 2YKEA 4PRVA 1UY7A 4EGHA 4CE2A 3LNUA 2YEGA 5J6AA 2H55A 3GIFA 4GGLA 4K4OA 5M4EA 3A0WA 5GGZA 1YT2A 1AH8A 2YE3A 1A4HA 4MPCA 3K99A 1UY6A 3D0BA 1YSRA 4PL9A 4JQLA 5M4PA 1AJ6A 2EXLA 5CTYA 4EMVA 4XC0A 3HEKA 2YE6A 4LWGA 3U2DA 4URLA 3T10A 2CGFA 3BMYA 2BU8A 5CTWA 4FPPA 4O0BA 5BOCA 1TIDA 3C0EA 3EHGA 4YKZA 2BYHA 5BODA 2C2AA 3CRLA 1B63A 2YKBA 4L93A 4EFUA 1GKXA 3ZXQA 4BXIA 1YSZA 2YGAA 1UYEA 1L0OA
chains in the Genus database with same CATH superfamily
2ZDXA 2XJGA 5M4HA 3TUHA 4KTNA 1UYGA 4H7QA 4E00A 1I5BA 5M4MA 4WUDA 1MU5A 4EM7A 4XE2A 5IN9A 2YEJA 2BREA 2BYIA 4X9LA 4ASBA 2BU2A 5FNFA 3A0ZA 4E02A 2O1VA 2VCIA 1UY8A 5FNCA 3CRKA 3ZKBA 1YETA 4QPJA 1TBWA 3HYYA 1B3QA 2XX4A 4YKTA 4CWNA 3Q5LA 4EEHA 2CCUA 2XDXA 2YEIA 2FWYA 1NHHA 2WI3A 1PVGA 4YKWA 1UYIA 4EFTA 2CH4A 1YT0A 4MP7A 3B28A 2YK2A 1YC4A 2YJWA 4KFGA 2O1UA 2IOPA 3A0XA 4O09A 4W7TA 3RLQA 3GIGB 1B62A 1BYQA 3G7BA 3PEJA 5IDJA 2CG9A 2YI6A 3HZ1A 5CF0A 2FWZA 2YGFA 4ZVIA 3R92A 2BU6A 2WI5A 4LPBA 2HCHA 4R3AA 4V25A 3A0RA 2YEAA 3LPSA 4JAVA 4GT8A 4HXZA 4NH9A 4FCPA 1BKNA 4JAUA 2AKPA 1YS3A 2UWDA 3CYGA 4HZ0A 1NHIA 1Y4SA 5D7DA 4B7PA 2YECA 4L91A 4URMA 4KQVA 3PEHA 4ASAA 2Q2EB 1Z59A 3LMMA 2YEFA 3MNRP 1S16A 1UYDA 2GFDA 4XCJA 1AM1A 4XD8A 2YE7A 5IDMA 2XJXA 2VCJA 2XDKA 3B26A 4HYMA 2BU7A 3K60A 4CWQA 3FT8A 2PNRA 2Q8HA 2GQPA 2IWUA 3TZ5A 4PU9A 3ZXOA 1TC0A 4CWSA 4AWPA 5M4NA 4BIZA 3HZ5A 2CCTA 1I5AA 4BQJA 2XDUA 2HG1A 2BU5A 1S14A 4R3MA 4FCQA 1Z5AA 1YC3A 3KE6A 5C93A 1UYCA 3OMUA 3EKOA 4V26A 4O04A 4AWQA 2IWSA 4E01A 4HY1A 1EA6A 3TTZA 2H8MA 1BGQA 1TH8A 1Y4UA 3CWVA 3T2SA 4XKKA 4MPNA 3HHUA 5J71A 2FTKA 5CTUA 3OWBA 4CWRA 2Q8IA 2YI5A 1KIJA 4YKXA 1U2OA 3FV5A 4H81A 2Q8FA 4YKYA 1AMWA 3H4LA 2QFOA 4CE1A 1ZW9A 5D6QA 3ZKDA 2WI7A 5D7RA 1QY8A 2XX2A 5D6PA 4GEEA 2FXSA 4XDMA 1OSFA 4YKQA 1TC6A 2BTZA 4QPKA 2YI0A 2JJCA 2JKIA 1AH6A 1NHJA 2YKJA 4ASFA 3OW6A 4BQGA 2FYPA 3INWA 4NH8A 2XHRA 3G75A 3B25A 4GCZA 3K98A 2QG0A 4HZ5A 4I3HA 1KZNA 4KSGA 3R4OA 2E0AA 3OPDA 3EHHA 4AS9A 2WI1A 1ZWHA 4O05A 5F3KA 3QDDA 2YJXA 2ESAA 3CGZA 4EGIA 4L94A 3TZ4A 1H7UA 3O2FA 4ASGA 3VHCA 2YE9A 4GFNA 1GJVA 4R1FA 1F51A 4XKAA 4HXWA 3RLPA 2IORA 2YE2A 3HYZA 2C1GA 2O1WA 2BSMA 5D7CA 4Q20A 3R4NA 2XABA 3S5TA 3FT5A 2Q8GA 1YERA 3R91A 2XHXA 4XIQA 4XIPA 4MB9A 1I59A 3SL2A 2HKJA 4LP0A 4UROA 1UYLA 2WEPA 4DZYA 1ID0A 1IXMA 2IOQA 4KSHA 4YKRA 1R62A 5CTXA 1ZXNA 4U7OA 3EHFA 2YK9A 4LWFA 4MPEA 4WUBA 3EKRA 3JZ3A 3BM9A 3TZ0A 1THNA 1Y8NA 4P8OA 5M4KA 2WERA 2WI2A 2XDLA 2XX5A 3Q5KA 3K97A 5FNDA 3VADA 1TILA 4CE3A 3EHJA 2XJJA 2YKIA 2ZBKB 2XCMA 2YEHA 2WI4A 2IWXA 2BRCA 4NH7A 3C11A 1JM6A 3D36A 4L8ZA 1UYHA 4XITA 4I5SA 3D2RA 1I58A 4O07A 1I5DA 4HY6A 4FMTA 2YE8A 3T0HA 2K5BA 4HYPA 2YE5A 1QZRA 4DUHA 4MOTA 3NMQA 2CCSA 3VHAA 2QG2A 3B27A 3U2KA 4B6CA 4JASA 3RLRA 3A0YA 5JENA 1Z5BA 4LWIA 2YE4A 3O6OA 1US7A 5CPHA 4E72A 3RKZA 2YGEA 2YI7A 2BZ5A 2VW5A 1U0ZA 1YESA 3INXA 3ZM7A 5L3JA 3GIGA 4CWPA 4U93A 2XD6A 1Y8PA 4H85A 3WHAA 3R4PA 2QF6A 1YT1A 1EI1A 4XTJA 3Q5JA 2ZDYA 2XK2A 4LWEA 4MP2A 4CWFA 2YEDA 4BIUA 4CWTA 3U67A 5FWKA 3O0IA 3A0TA 4LWHA 3TZ2A 2C1IA 2YKCA 3GIEA 4AWOA 3H80A 4EGKA 1Z5CA 2XDSA 3DGEA 3T1KA 1YC1A 4GQTA 1H7SA 2WI6A 3IEDA 4CWOA 4ZKIA 1MX0A 4XKOA 1GKZA 4L90A 1UYMA 4XIRA 4XCLA 4URNA 3WQ9A 3VHDA 4FCRA 1BXDA 3G7EA 3QTFA 5F5RA 1QYEA 4P7AA 3R4MA 2YEEA 3OWDA 2XHTA 4YKUA 2YEBA 3B24A 2BT0A 4BAEA 1UY9A 4WUCA 1ZXMA 3T0ZA 2WEQA 1I5CA 2VWCA 4MBCA 1Y8OA 4U7NA 4PRXA 1UYKA 3CGYA 2ZKJA 4KP4A 1UYFA 2YKEA 4PRVA 1UY7A 4EGHA 4CE2A 3LNUA 2YEGA 5J6AA 2H55A 3GIFA 2HHIA 4GGLA 4K4OA 5M4EA 3A0WA 5GGZA 1YT2A 1AH8A 2YE3A 1A4HA 4MPCA 3K99A 1UY6A 3D0BA 1YSRA 4PL9A 4JQLA 5M4PA 1AJ6A 2EXLA 5CTYA 4EMVA 4XC0A 3HEKA 2YE6A 4LWGA 3U2DA 4URLA 3T10A 2CGFA 3BMYA 2BU8A 5CTWA 4FPPA 4O0BA 5BOCA 1TIDA 3C0EA 3EHGA 4YKZA 2BYHA 5BODA 2C2AA 3CRLA 1B63A 2YKBA 4L93A 4EFUA 1GKXA 3ZXQA 4BXIA 1YSZA 2YGAA 1UYEA 1L0OA
chains in the Genus database with same CATH topology
2ZDXA 2XJGA 5M4HA 3TUHA 4KTNA 1UYGA 4H7QA 4E00A 1I5BA 5M4MA 4WUDA 1MU5A 4EM7A 4XE2A 5IN9A 2YEJA 2BREA 2BYIA 4X9LA 4ASBA 2BU2A 5FNFA 3A0ZA 4E02A 2O1VA 2VCIA 1UY8A 5FNCA 3CRKA 3ZKBA 1YETA 4QPJA 1TBWA 3HYYA 1B3QA 2XX4A 4YKTA 4CWNA 3Q5LA 4EEHA 2CCUA 2XDXA 2YEIA 2FWYA 1NHHA 2WI3A 1PVGA 4YKWA 1UYIA 4EFTA 2CH4A 1YT0A 4MP7A 3B28A 2YK2A 1YC4A 2YJWA 4KFGA 2O1UA 2IOPA 3A0XA 4O09A 4W7TA 3RLQA 3GIGB 1B62A 1BYQA 3G7BA 3PEJA 5IDJA 2CG9A 2YI6A 3HZ1A 5CF0A 2FWZA 2YGFA 4ZVIA 3R92A 2BU6A 2WI5A 4LPBA 2HCHA 4R3AA 4V25A 3A0RA 2YEAA 3LPSA 4JAVA 4GT8A 4HXZA 4NH9A 4FCPA 1BKNA 4JAUA 2AKPA 1YS3A 2UWDA 4HZ0A 1NHIA 1Y4SA 5D7DA 4B7PA 2YECA 4L91A 4URMA 4KQVA 3PEHA 4ASAA 2Q2EB 1Z59A 2YEFA 3MNRP 1S16A 1UYDA 2GFDA 4XCJA 1AM1A 4XD8A 2YE7A 5IDMA 2XJXA 2VCJA 2XDKA 3B26A 4HYMA 2BU7A 3K60A 4CWQA 3FT8A 2PNRA 2Q8HA 2GQPA 2IWUA 3TZ5A 4PU9A 3ZXOA 1TC0A 4CWSA 4AWPA 5M4NA 4BIZA 3HZ5A 2CCTA 1I5AA 4BQJA 2XDUA 2HG1A 2BU5A 1S14A 4R3MA 4FCQA 1Z5AA 1YC3A 3KE6A 5C93A 1UYCA 3OMUA 3EKOA 4V26A 4O04A 4AWQA 2IWSA 4E01A 4HY1A 1EA6A 3TTZA 2H8MA 1BGQA 1TH8A 1Y4UA 3CWVA 3T2SA 4XKKA 4MPNA 3HHUA 5J71A 5CTUA 3OWBA 4CWRA 2Q8IA 2YI5A 1KIJA 4YKXA 1U2OA 3FV5A 4H81A 2Q8FA 4YKYA 1AMWA 3H4LA 2QFOA 4CE1A 1ZW9A 5D6QA 3ZKDA 2WI7A 5D7RA 1QY8A 2XX2A 5D6PA 4GEEA 2FXSA 4XDMA 1OSFA 4YKQA 1TC6A 2BTZA 4QPKA 2YI0A 2JJCA 2JKIA 1AH6A 1NHJA 2YKJA 4ASFA 3OW6A 4BQGA 2FYPA 3INWA 4NH8A 2XHRA 3G75A 3B25A 4GCZA 3K98A 2QG0A 4HZ5A 4I3HA 1KZNA 4KSGA 3R4OA 2E0AA 3OPDA 3EHHA 4AS9A 2WI1A 1ZWHA 4O05A 5F3KA 3QDDA 2YJXA 2ESAA 3CGZA 4EGIA 4L94A 3TZ4A 1H7UA 3O2FA 4ASGA 3VHCA 2YE9A 4GFNA 1GJVA 4R1FA 4XKAA 4HXWA 3RLPA 2IORA 2YE2A 3HYZA 2O1WA 2BSMA 5D7CA 4Q20A 3R4NA 2XABA 3FT5A 2Q8GA 1YERA 3R91A 2XHXA 4XIQA 4XIPA 4MB9A 1I59A 3SL2A 2HKJA 4LP0A 4UROA 1UYLA 2WEPA 4DZYA 1ID0A 2IOQA 4KSHA 4YKRA 1R62A 5CTXA 1ZXNA 4U7OA 3EHFA 2YK9A 4LWFA 4MPEA 4WUBA 3EKRA 3JZ3A 3BM9A 3TZ0A 1THNA 1Y8NA 4P8OA 5M4KA 2WERA 2WI2A 2XDLA 2XX5A 3Q5KA 3K97A 5FNDA 3VADA 1TILA 4CE3A 3EHJA 2XJJA 2YKIA 2ZBKB 2XCMA 2YEHA 2WI4A 2IWXA 2BRCA 4NH7A 3C11A 1JM6A 3D36A 4L8ZA 1UYHA 4XITA 4I5SA 3D2RA 1I58A 4O07A 1I5DA 4HY6A 4FMTA 2YE8A 3T0HA 2K5BA 4HYPA 2YE5A 1QZRA 4DUHA 4MOTA 3NMQA 2CCSA 3VHAA 2QG2A 3B27A 3U2KA 4B6CA 4JASA 3RLRA 3A0YA 1Z5BA 4LWIA 2YE4A 3O6OA 1US7A 5CPHA 3RKZA 2YGEA 2YI7A 2BZ5A 2VW5A 1U0ZA 1YESA 3INXA 3ZM7A 5L3JA 3GIGA 4CWPA 4U93A 2XD6A 1Y8PA 4H85A 3WHAA 3R4PA 2QF6A 1YT1A 1EI1A 4XTJA 3Q5JA 2ZDYA 2XK2A 4LWEA 4MP2A 4CWFA 2YEDA 4BIUA 4CWTA 3U67A 5FWKA 3O0IA 3A0TA 4LWHA 3TZ2A 2YKCA 3GIEA 4AWOA 3H80A 4EGKA 1Z5CA 2XDSA 3DGEA 3T1KA 1YC1A 4GQTA 1H7SA 2WI6A 3IEDA 4CWOA 4ZKIA 1MX0A 4XKOA 1GKZA 4L90A 1UYMA 4XIRA 4XCLA 4URNA 3WQ9A 3VHDA 4FCRA 1BXDA 3G7EA 3QTFA 5F5RA 1QYEA 4P7AA 3R4MA 2YEEA 3OWDA 2XHTA 4YKUA 2YEBA 3B24A 2BT0A 4BAEA 1UY9A 4WUCA 1ZXMA 3T0ZA 2WEQA 1I5CA 2VWCA 4MBCA 1Y8OA 4U7NA 4PRXA 1UYKA 3CGYA 2ZKJA 4KP4A 1UYFA 2YKEA 4PRVA 1UY7A 4EGHA 4CE2A 3LNUA 2YEGA 5J6AA 2H55A 3GIFA 4GGLA 4K4OA 5M4EA 3A0WA 5GGZA 1YT2A 1AH8A 2YE3A 1A4HA 4MPCA 3K99A 1UY6A 3D0BA 1YSRA 4PL9A 4JQLA 5M4PA 1AJ6A 2EXLA 5CTYA 4EMVA 4XC0A 3HEKA 2YE6A 4LWGA 3U2DA 4URLA 3T10A 2CGFA 3BMYA 2BU8A 5CTWA 4FPPA 4O0BA 5BOCA 1TIDA 3C0EA 3EHGA 4YKZA 2BYHA 5BODA 2C2AA 3CRLA 1B63A 2YKBA 4L93A 4EFUA 1GKXA 3ZXQA 4BXIA 1YSZA 2YGAA 1UYEA 1L0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZDX A;  2XJG A;  5M4H A;  3TUH A;  4KTN A;  1UYG A;  4H7Q A;  4E00 A;  1I5B A;  5M4M A;  4WUD A;  1MU5 A;  4EM7 A;  4XE2 A;  5IN9 A;  2YEJ A;  2BRE A;  2BYI A;  4X9L A;  4ASB A;  2BU2 A;  5FNF A;  3A0Z A;  4E02 A;  2O1V A;  2VCI A;  1UY8 A;  5FNC A;  3CRK A;  3ZKB A;  1YET A;  4QPJ A;  1TBW A;  3HYY A;  1B3Q A;  2XX4 A;  4YKT A;  4CWN A;  3Q5L A;  4EEH A;  2CCU A;  2XDX A;  2YEI A;  2FWY A;  1NHH A;  2WI3 A;  1PVG A;  4YKW A;  1UYI A;  4EFT A;  2CH4 A;  1YT0 A;  4MP7 A;  3B28 A;  2YK2 A;  1YC4 A;  2YJW A;  4KFG A;  2O1U A;  2IOP A;  3A0X A;  4O09 A;  4W7T A;  3RLQ A;  3GIG B;  1B62 A;  1BYQ A;  3G7B A;  3PEJ A;  5IDJ A;  2CG9 A;  2YI6 A;  3HZ1 A;  5CF0 A;  2FWZ A;  2YGF A;  4ZVI A;  3R92 A;  2BU6 A;  2WI5 A;  4LPB A;  2HCH A;  4R3A A;  4V25 A;  3A0R A;  2YEA A;  3LPS A;  4JAV A;  4GT8 A;  4HXZ A;  4NH9 A;  4FCP A;  1BKN A;  4JAU A;  2AKP A;  1YS3 A;  2UWD A;  4HZ0 A;  1NHI A;  1Y4S A;  5D7D A;  4B7P A;  2YEC A;  4L91 A;  4URM A;  4KQV A;  3PEH A;  4ASA A;  2Q2E B;  1Z59 A;  2YEF A;  3MNR P;  1S16 A;  1UYD A;  2GFD A;  4XCJ A;  1AM1 A;  4XD8 A;  2YE7 A;  5IDM A;  2XJX A;  2VCJ A;  2XDK A;  3B26 A;  4HYM A;  2BU7 A;  3K60 A;  4CWQ A;  3FT8 A;  2PNR A;  2Q8H A;  2GQP A;  2IWU A;  3TZ5 A;  4PU9 A;  3ZXO A;  1TC0 A;  4CWS A;  4AWP A;  5M4N A;  4BIZ A;  3HZ5 A;  2CCT A;  1I5A A;  4BQJ A;  2XDU A;  2HG1 A;  2BU5 A;  1S14 A;  4R3M A;  4FCQ A;  1Z5A A;  1YC3 A;  3KE6 A;  5C93 A;  1UYC A;  3OMU A;  3EKO A;  4V26 A;  4O04 A;  4AWQ A;  2IWS A;  4E01 A;  4HY1 A;  1EA6 A;  3TTZ A;  2H8M A;  1BGQ A;  1TH8 A;  1Y4U A;  3CWV A;  3T2S A;  4XKK A;  4MPN A;  3HHU A;  5J71 A;  5CTU A;  3OWB A;  4CWR A;  2Q8I A;  2YI5 A;  1KIJ A;  4YKX A;  1U2O A;  3FV5 A;  4H81 A;  2Q8F A;  4YKY A;  1AMW A;  3H4L A;  2QFO A;  4CE1 A;  1ZW9 A;  5D6Q A;  3ZKD A;  2WI7 A;  5D7R A;  1QY8 A;  2XX2 A;  5D6P A;  4GEE A;  2FXS A;  4XDM A;  1OSF A;  4YKQ A;  1TC6 A;  2BTZ A;  4QPK A;  2YI0 A;  2JJC A;  2JKI A;  1AH6 A;  1NHJ A;  2YKJ A;  4ASF A;  3OW6 A;  4BQG A;  2FYP A;  3INW A;  4NH8 A;  2XHR A;  3G75 A;  3B25 A;  4GCZ A;  3K98 A;  2QG0 A;  4HZ5 A;  4I3H A;  1KZN A;  4KSG A;  3R4O A;  2E0A A;  3OPD A;  3EHH A;  4AS9 A;  2WI1 A;  1ZWH A;  4O05 A;  5F3K A;  3QDD A;  2YJX A;  2ESA A;  3CGZ A;  4EGI A;  4L94 A;  3TZ4 A;  1H7U A;  3O2F A;  4ASG A;  3VHC A;  2YE9 A;  4GFN A;  1GJV A;  4R1F A;  4XKA A;  4HXW A;  3RLP A;  2IOR A;  2YE2 A;  3HYZ A;  2O1W A;  2BSM A;  5D7C A;  4Q20 A;  3R4N A;  2XAB A;  3FT5 A;  2Q8G A;  1YER A;  3R91 A;  2XHX A;  4XIQ A;  4XIP A;  4MB9 A;  1I59 A;  3SL2 A;  2HKJ A;  4LP0 A;  4URO A;  1UYL A;  2WEP A;  4DZY A;  1ID0 A;  2IOQ A;  4KSH A;  4YKR A;  1R62 A;  5CTX A;  1ZXN A;  4U7O A;  3EHF A;  2YK9 A;  4LWF A;  4MPE A;  4WUB A;  3EKR A;  3JZ3 A;  3BM9 A;  3TZ0 A;  1THN A;  1Y8N A;  4P8O A;  5M4K A;  2WER A;  2WI2 A;  2XDL A;  2XX5 A;  3Q5K A;  3K97 A;  5FND A;  3VAD A;  1TIL A;  4CE3 A;  3EHJ A;  2XJJ A;  2YKI A;  2ZBK B;  2XCM A;  2YEH A;  2WI4 A;  2IWX A;  2BRC A;  4NH7 A;  3C11 A;  1JM6 A;  3D36 A;  4L8Z A;  1UYH A;  4XIT A;  4I5S A;  3D2R A;  1I58 A;  4O07 A;  1I5D A;  4HY6 A;  4FMT A;  2YE8 A;  3T0H A;  2K5B A;  4HYP A;  2YE5 A;  1QZR A;  4DUH A;  4MOT A;  3NMQ A;  2CCS A;  3VHA A;  2QG2 A;  3B27 A;  3U2K A;  4B6C A;  4JAS A;  3RLR A;  3A0Y A;  1Z5B A;  4LWI A;  2YE4 A;  3O6O A;  1US7 A;  5CPH A;  3RKZ A;  2YGE A;  2YI7 A;  2BZ5 A;  2VW5 A;  1U0Z A;  1YES A;  3INX A;  3ZM7 A;  5L3J A;  3GIG A;  4CWP A;  4U93 A;  2XD6 A;  1Y8P A;  4H85 A;  3WHA A;  3R4P A;  2QF6 A;  1YT1 A;  1EI1 A;  4XTJ A;  3Q5J A;  2ZDY A;  2XK2 A;  4LWE A;  4MP2 A;  4CWF A;  2YED A;  4BIU A;  4CWT A;  3U67 A;  5FWK A;  3O0I A;  3A0T A;  4LWH A;  3TZ2 A;  2YKC A;  3GIE A;  4AWO A;  3H80 A;  4EGK A;  1Z5C A;  2XDS A;  3DGE A;  3T1K A;  1YC1 A;  4GQT A;  1H7S A;  2WI6 A;  3IED A;  4CWO A;  4ZKI A;  1MX0 A;  4XKO A;  1GKZ A;  4L90 A;  1UYM A;  4XIR A;  4XCL A;  4URN A;  3WQ9 A;  3VHD A;  4FCR A;  1BXD A;  3G7E A;  3QTF A;  5F5R A;  1QYE A;  4P7A A;  3R4M A;  2YEE A;  3OWD A;  2XHT A;  4YKU A;  2YEB A;  3B24 A;  2BT0 A;  4BAE A;  1UY9 A;  4WUC A;  1ZXM A;  3T0Z A;  2WEQ A;  1I5C A;  2VWC A;  4MBC A;  1Y8O A;  4U7N A;  4PRX A;  1UYK A;  3CGY A;  2ZKJ A;  4KP4 A;  1UYF A;  2YKE A;  4PRV A;  1UY7 A;  4EGH A;  4CE2 A;  3LNU A;  2YEG A;  5J6A A;  2H55 A;  3GIF A;  4GGL A;  4K4O A;  5M4E A;  3A0W A;  5GGZ A;  1YT2 A;  1AH8 A;  2YE3 A;  1A4H A;  4MPC A;  3K99 A;  1UY6 A;  3D0B A;  1YSR A;  4PL9 A;  4JQL A;  5M4P A;  1AJ6 A;  2EXL A;  5CTY A;  4EMV A;  4XC0 A;  3HEK A;  2YE6 A;  4LWG A;  3U2D A;  4URL A;  3T10 A;  2CGF A;  3BMY A;  2BU8 A;  5CTW A;  4FPP A;  4O0B A;  5BOC A;  1TID A;  3C0E A;  3EHG A;  4YKZ A;  2BYH A;  5BOD A;  2C2A A;  3CRL A;  1B63 A;  2YKB A;  4L93 A;  4EFU A;  1GKX A;  3ZXQ A;  4BXI A;  1YSZ A;  2YGA A;  1UYE A;  1L0O A; 
#chains in the Genus database with same CATH topology
 2ZDX A;  2XJG A;  5M4H A;  3TUH A;  4KTN A;  1UYG A;  4H7Q A;  4E00 A;  1I5B A;  5M4M A;  4WUD A;  1MU5 A;  4EM7 A;  4XE2 A;  5IN9 A;  2YEJ A;  2BRE A;  2BYI A;  4X9L A;  4ASB A;  2BU2 A;  5FNF A;  3A0Z A;  4E02 A;  2O1V A;  2VCI A;  1UY8 A;  5FNC A;  3CRK A;  3ZKB A;  1YET A;  4QPJ A;  1TBW A;  3HYY A;  1B3Q A;  2XX4 A;  4YKT A;  4CWN A;  3Q5L A;  4EEH A;  2CCU A;  2XDX A;  2YEI A;  2FWY A;  1NHH A;  2WI3 A;  1PVG A;  4YKW A;  1UYI A;  4EFT A;  2CH4 A;  1YT0 A;  4MP7 A;  3B28 A;  2YK2 A;  1YC4 A;  2YJW A;  4KFG A;  2O1U A;  2IOP A;  3A0X A;  4O09 A;  4W7T A;  3RLQ A;  3GIG B;  1B62 A;  1BYQ A;  3G7B A;  3PEJ A;  5IDJ A;  2CG9 A;  2YI6 A;  3HZ1 A;  5CF0 A;  2FWZ A;  2YGF A;  4ZVI A;  3R92 A;  2BU6 A;  2WI5 A;  4LPB A;  2HCH A;  4R3A A;  4V25 A;  3A0R A;  2YEA A;  3LPS A;  4JAV A;  4GT8 A;  4HXZ A;  4NH9 A;  4FCP A;  1BKN A;  4JAU A;  2AKP A;  1YS3 A;  2UWD A;  3CYG A;  4HZ0 A;  1NHI A;  1Y4S A;  5D7D A;  4B7P A;  2YEC A;  4L91 A;  4URM A;  4KQV A;  3PEH A;  4ASA A;  2Q2E B;  1Z59 A;  3LMM A;  2YEF A;  3MNR P;  1S16 A;  1UYD A;  2GFD A;  4XCJ A;  1AM1 A;  4XD8 A;  2YE7 A;  5IDM A;  2XJX A;  2VCJ A;  2XDK A;  3B26 A;  4HYM A;  2BU7 A;  3K60 A;  4CWQ A;  3FT8 A;  2PNR A;  2Q8H A;  2GQP A;  2IWU A;  3TZ5 A;  4PU9 A;  3ZXO A;  1TC0 A;  4CWS A;  4AWP A;  5M4N A;  4BIZ A;  3HZ5 A;  2CCT A;  1I5A A;  4BQJ A;  2XDU A;  2HG1 A;  2BU5 A;  1S14 A;  4R3M A;  4FCQ A;  1Z5A A;  1YC3 A;  3KE6 A;  5C93 A;  1UYC A;  3OMU A;  3EKO A;  4V26 A;  4O04 A;  4AWQ A;  2IWS A;  4E01 A;  4HY1 A;  1EA6 A;  3TTZ A;  2H8M A;  1BGQ A;  1TH8 A;  1Y4U A;  3CWV A;  3T2S A;  4XKK A;  4MPN A;  3HHU A;  5J71 A;  2FTK A;  5CTU A;  3OWB A;  4CWR A;  2Q8I A;  2YI5 A;  1KIJ A;  4YKX A;  1U2O A;  3FV5 A;  4H81 A;  2Q8F A;  4YKY A;  1AMW A;  3H4L A;  2QFO A;  4CE1 A;  1ZW9 A;  5D6Q A;  3ZKD A;  2WI7 A;  5D7R A;  1QY8 A;  2XX2 A;  5D6P A;  4GEE A;  2FXS A;  4XDM A;  1OSF A;  4YKQ A;  1TC6 A;  2BTZ A;  4QPK A;  2YI0 A;  2JJC A;  2JKI A;  1AH6 A;  1NHJ A;  2YKJ A;  4ASF A;  3OW6 A;  4BQG A;  2FYP A;  3INW A;  4NH8 A;  2XHR A;  3G75 A;  3B25 A;  4GCZ A;  3K98 A;  2QG0 A;  4HZ5 A;  4I3H A;  1KZN A;  4KSG A;  3R4O A;  2E0A A;  3OPD A;  3EHH A;  4AS9 A;  2WI1 A;  1ZWH A;  4O05 A;  5F3K A;  3QDD A;  2YJX A;  2ESA A;  3CGZ A;  4EGI A;  4L94 A;  3TZ4 A;  1H7U A;  3O2F A;  4ASG A;  3VHC A;  2YE9 A;  4GFN A;  1GJV A;  4R1F A;  1F51 A;  4XKA A;  4HXW A;  3RLP A;  2IOR A;  2YE2 A;  3HYZ A;  2C1G A;  2O1W A;  2BSM A;  5D7C A;  4Q20 A;  3R4N A;  2XAB A;  3S5T A;  3FT5 A;  2Q8G A;  1YER A;  3R91 A;  2XHX A;  4XIQ A;  4XIP A;  4MB9 A;  1I59 A;  3SL2 A;  2HKJ A;  4LP0 A;  4URO A;  1UYL A;  2WEP A;  4DZY A;  1ID0 A;  1IXM A;  2IOQ A;  4KSH A;  4YKR A;  1R62 A;  5CTX A;  1ZXN A;  4U7O A;  3EHF A;  2YK9 A;  4LWF A;  4MPE A;  4WUB A;  3EKR A;  3JZ3 A;  3BM9 A;  3TZ0 A;  1THN A;  1Y8N A;  4P8O A;  5M4K A;  2WER A;  2WI2 A;  2XDL A;  2XX5 A;  3Q5K A;  3K97 A;  5FND A;  3VAD A;  1TIL A;  4CE3 A;  3EHJ A;  2XJJ A;  2YKI A;  2ZBK B;  2XCM A;  2YEH A;  2WI4 A;  2IWX A;  2BRC A;  4NH7 A;  3C11 A;  1JM6 A;  3D36 A;  4L8Z A;  1UYH A;  4XIT A;  4I5S A;  3D2R A;  1I58 A;  4O07 A;  1I5D A;  4HY6 A;  4FMT A;  2YE8 A;  3T0H A;  2K5B A;  4HYP A;  2YE5 A;  1QZR A;  4DUH A;  4MOT A;  3NMQ A;  2CCS A;  3VHA A;  2QG2 A;  3B27 A;  3U2K A;  4B6C A;  4JAS A;  3RLR A;  3A0Y A;  5JEN A;  1Z5B A;  4LWI A;  2YE4 A;  3O6O A;  1US7 A;  5CPH A;  4E72 A;  3RKZ A;  2YGE A;  2YI7 A;  2BZ5 A;  2VW5 A;  1U0Z A;  1YES A;  3INX A;  3ZM7 A;  5L3J A;  3GIG A;  4CWP A;  4U93 A;  2XD6 A;  1Y8P A;  4H85 A;  3WHA A;  3R4P A;  2QF6 A;  1YT1 A;  1EI1 A;  4XTJ A;  3Q5J A;  2ZDY A;  2XK2 A;  4LWE A;  4MP2 A;  4CWF A;  2YED A;  4BIU A;  4CWT A;  3U67 A;  5FWK A;  3O0I A;  3A0T A;  4LWH A;  3TZ2 A;  2C1I A;  2YKC A;  3GIE A;  4AWO A;  3H80 A;  4EGK A;  1Z5C A;  2XDS A;  3DGE A;  3T1K A;  1YC1 A;  4GQT A;  1H7S A;  2WI6 A;  3IED A;  4CWO A;  4ZKI A;  1MX0 A;  4XKO A;  1GKZ A;  4L90 A;  1UYM A;  4XIR A;  4XCL A;  4URN A;  3WQ9 A;  3VHD A;  4FCR A;  1BXD A;  3G7E A;  3QTF A;  5F5R A;  1QYE A;  4P7A A;  3R4M A;  2YEE A;  3OWD A;  2XHT A;  4YKU A;  2YEB A;  3B24 A;  2BT0 A;  4BAE A;  1UY9 A;  4WUC A;  1ZXM A;  3T0Z A;  2WEQ A;  1I5C A;  2VWC A;  4MBC A;  1Y8O A;  4U7N A;  4PRX A;  1UYK A;  3CGY A;  2ZKJ A;  4KP4 A;  1UYF A;  2YKE A;  4PRV A;  1UY7 A;  4EGH A;  4CE2 A;  3LNU A;  2YEG A;  5J6A A;  2H55 A;  3GIF A;  2HHI A;  4GGL A;  4K4O A;  5M4E A;  3A0W A;  5GGZ A;  1YT2 A;  1AH8 A;  2YE3 A;  1A4H A;  4MPC A;  3K99 A;  1UY6 A;  3D0B A;  1YSR A;  4PL9 A;  4JQL A;  5M4P A;  1AJ6 A;  2EXL A;  5CTY A;  4EMV A;  4XC0 A;  3HEK A;  2YE6 A;  4LWG A;  3U2D A;  4URL A;  3T10 A;  2CGF A;  3BMY A;  2BU8 A;  5CTW A;  4FPP A;  4O0B A;  5BOC A;  1TID A;  3C0E A;  3EHG A;  4YKZ A;  2BYH A;  5BOD A;  2C2A A;  3CRL A;  1B63 A;  2YKB A;  4L93 A;  4EFU A;  1GKX A;  3ZXQ A;  4BXI A;  1YSZ A;  2YGA A;  1UYE A;  1L0O A; 
#chains in the Genus database with same CATH homology
 2ZDX A;  2XJG A;  5M4H A;  3TUH A;  4KTN A;  1UYG A;  4H7Q A;  4E00 A;  1I5B A;  5M4M A;  4WUD A;  1MU5 A;  4EM7 A;  4XE2 A;  5IN9 A;  2YEJ A;  2BRE A;  2BYI A;  4X9L A;  4ASB A;  2BU2 A;  5FNF A;  3A0Z A;  4E02 A;  2O1V A;  2VCI A;  1UY8 A;  5FNC A;  3CRK A;  3ZKB A;  1YET A;  4QPJ A;  1TBW A;  3HYY A;  1B3Q A;  2XX4 A;  4YKT A;  4CWN A;  3Q5L A;  4EEH A;  2CCU A;  2XDX A;  2YEI A;  2FWY A;  1NHH A;  2WI3 A;  1PVG A;  4YKW A;  1UYI A;  4EFT A;  2CH4 A;  1YT0 A;  4MP7 A;  3B28 A;  2YK2 A;  1YC4 A;  2YJW A;  4KFG A;  2O1U A;  2IOP A;  3A0X A;  4O09 A;  4W7T A;  3RLQ A;  3GIG B;  1B62 A;  1BYQ A;  3G7B A;  3PEJ A;  5IDJ A;  2CG9 A;  2YI6 A;  3HZ1 A;  5CF0 A;  2FWZ A;  2YGF A;  4ZVI A;  3R92 A;  2BU6 A;  2WI5 A;  4LPB A;  2HCH A;  4R3A A;  4V25 A;  3A0R A;  2YEA A;  3LPS A;  4JAV A;  4GT8 A;  4HXZ A;  4NH9 A;  4FCP A;  1BKN A;  4JAU A;  2AKP A;  1YS3 A;  2UWD A;  4HZ0 A;  1NHI A;  1Y4S A;  5D7D A;  4B7P A;  2YEC A;  4L91 A;  4URM A;  4KQV A;  3PEH A;  4ASA A;  2Q2E B;  1Z59 A;  2YEF A;  3MNR P;  1S16 A;  1UYD A;  2GFD A;  4XCJ A;  1AM1 A;  4XD8 A;  2YE7 A;  5IDM A;  2XJX A;  2VCJ A;  2XDK A;  3B26 A;  4HYM A;  2BU7 A;  3K60 A;  4CWQ A;  3FT8 A;  2PNR A;  2Q8H A;  2GQP A;  2IWU A;  3TZ5 A;  4PU9 A;  3ZXO A;  1TC0 A;  4CWS A;  4AWP A;  5M4N A;  4BIZ A;  3HZ5 A;  2CCT A;  1I5A A;  4BQJ A;  2XDU A;  2HG1 A;  2BU5 A;  1S14 A;  4R3M A;  4FCQ A;  1Z5A A;  1YC3 A;  3KE6 A;  5C93 A;  1UYC A;  3OMU A;  3EKO A;  4V26 A;  4O04 A;  4AWQ A;  2IWS A;  4E01 A;  4HY1 A;  1EA6 A;  3TTZ A;  2H8M A;  1BGQ A;  1TH8 A;  1Y4U A;  3CWV A;  3T2S A;  4XKK A;  4MPN A;  3HHU A;  5J71 A;  5CTU A;  3OWB A;  4CWR A;  2Q8I A;  2YI5 A;  1KIJ A;  4YKX A;  1U2O A;  3FV5 A;  4H81 A;  2Q8F A;  4YKY A;  1AMW A;  3H4L A;  2QFO A;  4CE1 A;  1ZW9 A;  5D6Q A;  3ZKD A;  2WI7 A;  5D7R A;  1QY8 A;  2XX2 A;  5D6P A;  4GEE A;  2FXS A;  4XDM A;  1OSF A;  4YKQ A;  1TC6 A;  2BTZ A;  4QPK A;  2YI0 A;  2JJC A;  2JKI A;  1AH6 A;  1NHJ A;  2YKJ A;  4ASF A;  3OW6 A;  4BQG A;  2FYP A;  3INW A;  4NH8 A;  2XHR A;  3G75 A;  3B25 A;  4GCZ A;  3K98 A;  2QG0 A;  4HZ5 A;  4I3H A;  1KZN A;  4KSG A;  3R4O A;  2E0A A;  3OPD A;  3EHH A;  4AS9 A;  2WI1 A;  1ZWH A;  4O05 A;  5F3K A;  3QDD A;  2YJX A;  2ESA A;  3CGZ A;  4EGI A;  4L94 A;  3TZ4 A;  1H7U A;  3O2F A;  4ASG A;  3VHC A;  2YE9 A;  4GFN A;  1GJV A;  4R1F A;  4XKA A;  4HXW A;  3RLP A;  2IOR A;  2YE2 A;  3HYZ A;  2O1W A;  2BSM A;  5D7C A;  4Q20 A;  3R4N A;  2XAB A;  3FT5 A;  2Q8G A;  1YER A;  3R91 A;  2XHX A;  4XIQ A;  4XIP A;  4MB9 A;  1I59 A;  3SL2 A;  2HKJ A;  4LP0 A;  4URO A;  1UYL A;  2WEP A;  4DZY A;  1ID0 A;  2IOQ A;  4KSH A;  4YKR A;  1R62 A;  5CTX A;  1ZXN A;  4U7O A;  3EHF A;  2YK9 A;  4LWF A;  4MPE A;  4WUB A;  3EKR A;  3JZ3 A;  3BM9 A;  3TZ0 A;  1THN A;  1Y8N A;  4P8O A;  5M4K A;  2WER A;  2WI2 A;  2XDL A;  2XX5 A;  3Q5K A;  3K97 A;  5FND A;  3VAD A;  1TIL A;  4CE3 A;  3EHJ A;  2XJJ A;  2YKI A;  2ZBK B;  2XCM A;  2YEH A;  2WI4 A;  2IWX A;  2BRC A;  4NH7 A;  3C11 A;  1JM6 A;  3D36 A;  4L8Z A;  1UYH A;  4XIT A;  4I5S A;  3D2R A;  1I58 A;  4O07 A;  1I5D A;  4HY6 A;  4FMT A;  2YE8 A;  3T0H A;  2K5B A;  4HYP A;  2YE5 A;  1QZR A;  4DUH A;  4MOT A;  3NMQ A;  2CCS A;  3VHA A;  2QG2 A;  3B27 A;  3U2K A;  4B6C A;  4JAS A;  3RLR A;  3A0Y A;  1Z5B A;  4LWI A;  2YE4 A;  3O6O A;  1US7 A;  5CPH A;  3RKZ A;  2YGE A;  2YI7 A;  2BZ5 A;  2VW5 A;  1U0Z A;  1YES A;  3INX A;  3ZM7 A;  5L3J A;  3GIG A;  4CWP A;  4U93 A;  2XD6 A;  1Y8P A;  4H85 A;  3WHA A;  3R4P A;  2QF6 A;  1YT1 A;  1EI1 A;  4XTJ A;  3Q5J A;  2ZDY A;  2XK2 A;  4LWE A;  4MP2 A;  4CWF A;  2YED A;  4BIU A;  4CWT A;  3U67 A;  5FWK A;  3O0I A;  3A0T A;  4LWH A;  3TZ2 A;  2YKC A;  3GIE A;  4AWO A;  3H80 A;  4EGK A;  1Z5C A;  2XDS A;  3DGE A;  3T1K A;  1YC1 A;  4GQT A;  1H7S A;  2WI6 A;  3IED A;  4CWO A;  4ZKI A;  1MX0 A;  4XKO A;  1GKZ A;  4L90 A;  1UYM A;  4XIR A;  4XCL A;  4URN A;  3WQ9 A;  3VHD A;  4FCR A;  1BXD A;  3G7E A;  3QTF A;  5F5R A;  1QYE A;  4P7A A;  3R4M A;  2YEE A;  3OWD A;  2XHT A;  4YKU A;  2YEB A;  3B24 A;  2BT0 A;  4BAE A;  1UY9 A;  4WUC A;  1ZXM A;  3T0Z A;  2WEQ A;  1I5C A;  2VWC A;  4MBC A;  1Y8O A;  4U7N A;  4PRX A;  1UYK A;  3CGY A;  2ZKJ A;  4KP4 A;  1UYF A;  2YKE A;  4PRV A;  1UY7 A;  4EGH A;  4CE2 A;  3LNU A;  2YEG A;  5J6A A;  2H55 A;  3GIF A;  4GGL A;  4K4O A;  5M4E A;  3A0W A;  5GGZ A;  1YT2 A;  1AH8 A;  2YE3 A;  1A4H A;  4MPC A;  3K99 A;  1UY6 A;  3D0B A;  1YSR A;  4PL9 A;  4JQL A;  5M4P A;  1AJ6 A;  2EXL A;  5CTY A;  4EMV A;  4XC0 A;  3HEK A;  2YE6 A;  4LWG A;  3U2D A;  4URL A;  3T10 A;  2CGF A;  3BMY A;  2BU8 A;  5CTW A;  4FPP A;  4O0B A;  5BOC A;  1TID A;  3C0E A;  3EHG A;  4YKZ A;  2BYH A;  5BOD A;  2C2A A;  3CRL A;  1B63 A;  2YKB A;  4L93 A;  4EFU A;  1GKX A;  3ZXQ A;  4BXI A;  1YSZ A;  2YGA A;  1UYE A;  1L0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...