4PL9A

Structure of the catalytic domain of etr1 from arabidopsis thaliana
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
176
structure length
150
Chain Sequence
SLQLELGTFNLHTLFREVLNLIKPIAVVKKLPITLNLAPDLPEFVVGDEKRLMQIILNIVGNAVKFSKQGSISVTALVTKSSHFYLRVKVKDSGAGINPQDIPKIFTKFSGLGLAISKRFVNLMEGNIWIESDGLGKGCTAIFDVKLGIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Model of the Cytosolic Domain of the Plant Ethylene Receptor 1 (ETR1).
pubmed doi rcsb
molecule keywords Ethylene receptor 1
molecule tags Transferase
source organism Arabidopsis thaliana
total genus 42
structure length 150
sequence length 176
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4pl9A00
2YEDA 4URLA 3GIGB 3B25A 4MPCA 5D6PA 1B62A 1QYEA 4CWFA 5BODA 4YKZA 3KE6A 3U2DA 3HZ5A 1ID0A 2C2AA 5FNDA 1I5CA 4GFNA 2YE9A 3T0HA 2HG1A 3EKRA 4HYPA 4EFUA 2WI5A 3K97A 4HZ5A 5FNFA 1YT1A 2Q8HA 4E01A 4CWTA 4MP7A 4KP4A 5IDJA 4EMVA 4KFGA 2VWCA 1Y4SA 2BZ5A 4U7OA 2YEGA 4XE2A 3A0TA 2WI7A 3O0IA 1UYMA 4LWHA 4CE1A 5CTUA 4V26A 3VHCA 4NH9A 2CCSA 1TC0A 2BRCA 2BYHA 4PU9A 3BM9A 3D36A 1UYLA 3OWDA 2ZDXA 3RLPA 2JKIA 3ZKDA 4MOTA 3A0YA 2WI1A 5IN9A 4MP2A 2ZBKB 4U93A 4JAVA 3GIFA 3RKZA 3HEKA 4HXZA 1UYCA 2BU2A 5M4NA 3FV5A 4WUBA 3G75A 3T2SA 2CH4A 1YETA 1B3QA 2O1VA 2YEBA 4CWRA 2YK2A 2CG9A 5D7RA 1I5BA 2WI3A 2YGEA 5CPHA 1UYDA 2BTZA 4EGHA 2BT0A 4MPEA 2XX2A 1THNA 4AWQA 2WI6A 4Q20A 2QFOA 3B26A 1I5DA 4EGIA 3INXA 2IWSA 4URMA 3EHFA 1UY9A 2WEPA 4L93A 1BGQA 1BYQA 3VADA 2XX5A 2XDKA 5CTWA 2IWUA 4MPNA 1B63A 2GQPA 1BXDA 2XHXA 1S14A 1AJ6A 4GT8A 3FT5A 4W7TA 4UROA 3VHDA 1UYEA 1I59A 4PL9A 2YKCA 3D2RA 2IWXA 3H80A 2XABA 4KQVA 4L90A 2VW5A 3HHUA 3U2KA 3T10A 3B28A 4O05A 3OWBA 2VCJA 2BU8A 5M4EA 4CWNA 1UYIA 4X9LA 5IDMA 4NH8A 3OMUA 4ASBA 2XD6A 2IORA 3TZ4A 4R3AA 4CWOA 3PEJA 4URNA 2XDLA 3T0ZA 1UY7A 3TZ5A 2YECA 4AS9A 4DUHA 2XCMA 2YEHA 1Y8NA 1NHJA 3Q5JA 1PVGA 4BIUA 4BAEA 3FT8A 2Q8FA 4CE3A 5GGZA 4GCZA 4XDMA 4WUDA 4L94A 4B6CA 4DZYA 2WI4A 3R91A 2ESAA 2QF6A 4XIQA 4PRVA 2O1WA 2BREA 3OW6A 4EEHA 2QG2A 3NMQA 3OPDA 3A0XA 4HYMA 1UY8A 4HY1A 4K4OA 4KTNA 2HCHA 3Q5LA 2BU5A 2UWDA 3R4MA 3BMYA 5M4MA 2JJCA 4E00A 4BIZA 3G7BA 3B24A 4GEEA 2VCIA 3IEDA 1GKXA 1UYHA 2FWZA 1TH8A 4HZ0A 4AWPA 2H8MA 5M4HA 4BQGA 2YE3A 3K99A 1Y4UA 1EA6A 2XHRA 1L0OA 3D0BA 4XD8A 3H4LA 3JZ3A 2XDUA 1JM6A 3TZ0A 4KSHA 4ASGA 3A0ZA 3CGZA 1QY8A 4CWPA 1S16A 1YC3A 3ZM7A 4FCPA 1Z5BA 4XKAA 4V25A 4MB9A 2EXLA 2PNRA 5BOCA 1TBWA 4YKYA 4YKWA 4AWOA 3SL2A 2YI5A 2YE2A 4I3HA 3T1KA 4EGKA 4JASA 4NH7A 1US7A 2YE5A 4P8OA 2YJWA 1AH6A 2K5BA 1H7UA 4KSGA 4CWSA 1ZW9A 4LWEA 3CWVA 4EFTA 3R92A 1Z5AA 1YESA 4B7PA 1ZWHA 5F3KA 4H85A 3WHAA 3ZXOA 4ASFA 2XHTA 3TUHA 3VHAA 1YERA 1H7SA 4I5SA 4YKTA 4YKXA 3TZ2A 1YT0A 2YE8A 3INWA 1A4HA 2YEEA 3B27A 4QPJA 2QG0A 1GKZA 3RLRA 2FWYA 4GQTA 3HYZA 3PEHA 2BSMA 5F5RA 2XDSA 2YEFA 2YKJA 1Z59A 4O07A 4H81A 2YJXA 2XX4A 1MU5A 2YGFA 3O2FA 2H55A 3C0EA 1UYFA 3C11A 1AH8A 2WI2A 4L8ZA 2YE6A 4LP0A 5D7DA 1U0ZA 2O1UA 2YEIA 4O09A 3R4PA 4ZVIA 4BXIA 3K98A 2XJXA 2YKEA 4CWQA 2XDXA 2XK2A 2CCTA 1NHHA 2BU6A 2CGFA 4XCLA 3O6OA 3LNUA 4U7NA 2CCUA 2BU7A 2YE7A 1ZXMA 1GJVA 4L91A 2YGAA 2Q2EB 2YEJA 4PRXA 2Q8GA 2WEQA 2YI7A 3U67A 4FCRA 2YEAA 3HZ1A 3ZXQA 1YSRA 1EI1A 4XCJA 4JQLA 4LWIA 4BQJA 3EHHA 4LPBA 2ZKJA 4FMTA 3R4NA 5L3JA 3A0RA 2IOQA 3MNRP 1TC6A 4R3MA 1Z5CA 3CGYA 4YKUA 5D6QA 1ZXNA 1YC4A 2IOPA 4ASAA 4CE2A 4EM7A 2GFDA 1U2OA 4FCQA 4XIRA 3TTZA 3R4OA 1UYKA 5M4KA 2ZDYA 3DGEA 3CRKA 1Y8OA 4XITA 4R1FA 4E02A 1AM1A 1OSFA 1UYGA 3G7EA 4YKQA 3A0WA 4ZKIA 5J71A 1BKNA 2XJGA 1AMWA 3Q5KA 1UY6A 2XJJA 3EKOA 4H7QA 3K60A 4QPKA 3WQ9A 4YKRA 1Y8PA 1YC1A 1YT2A 2WERA 1I5AA 5CF0A 2YE4A 4XIPA 4O04A 3EHJA 2HKJA 2E0AA 5C93A 2Q8IA 2YK9A 1KZNA 1TILA 4O0BA 3GIGA 1MX0A 3RLQA 4WUCA 3CRLA 3HYYA 4XKKA 5D7CA 2YI0A 2BYIA 2FXSA 5J6AA 4XC0A 4GGLA 2YKIA 3QTFA 4HXWA 1I58A 5FWKA 3LPSA 4LWGA 2FYPA 1R62A 1NHIA 5CTYA 4XKOA 1YS3A 5M4PA 2YI6A 4LWFA 1KIJA 2AKPA 2YKBA 5CTXA 3QDDA 4XTJA 4FPPA 4P7AA 4JAUA 3GIEA 4MBCA 3EHGA 1YSZA 4HY6A 1QZRA 1TIDA 3ZKBA 5FNCA
chains in the Genus database with same CATH superfamily
1F51A 4E72A 2YEDA 4URLA 3GIGB 3B25A 4MPCA 5D6PA 1B62A 1QYEA 4CWFA 5BODA 4YKZA 3KE6A 3U2DA 3HZ5A 1ID0A 2C2AA 5FNDA 1I5CA 4GFNA 2YE9A 3T0HA 2HG1A 3EKRA 4HYPA 4EFUA 2WI5A 3K97A 4HZ5A 5FNFA 1YT1A 2Q8HA 4E01A 4CWTA 3S5TA 4MP7A 4KP4A 5IDJA 4EMVA 4KFGA 2VWCA 1Y4SA 2BZ5A 4U7OA 2YEGA 4XE2A 3A0TA 2WI7A 3O0IA 1UYMA 4LWHA 4CE1A 5CTUA 4V26A 3VHCA 4NH9A 2CCSA 1TC0A 2BRCA 2BYHA 4PU9A 3BM9A 3D36A 1UYLA 3OWDA 2ZDXA 3RLPA 2JKIA 3ZKDA 4MOTA 3A0YA 2WI1A 5IN9A 4MP2A 2ZBKB 4U93A 4JAVA 3GIFA 3RKZA 3HEKA 4HXZA 1UYCA 2BU2A 5M4NA 3FV5A 4WUBA 3G75A 3T2SA 2CH4A 1YETA 1B3QA 2O1VA 2YEBA 4CWRA 2YK2A 2CG9A 5D7RA 1I5BA 2WI3A 2YGEA 5CPHA 1UYDA 2BTZA 4EGHA 2BT0A 4MPEA 2XX2A 1THNA 4AWQA 2WI6A 4Q20A 2QFOA 3B26A 1I5DA 4EGIA 3INXA 2IWSA 4URMA 3EHFA 1UY9A 2WEPA 4L93A 1BGQA 1BYQA 3VADA 2XX5A 2XDKA 5CTWA 2IWUA 4MPNA 1B63A 3CYGA 2GQPA 1BXDA 2XHXA 1S14A 1AJ6A 4GT8A 3FT5A 4W7TA 4UROA 3VHDA 1UYEA 1I59A 4PL9A 2YKCA 2HHIA 3D2RA 2IWXA 3H80A 2XABA 4KQVA 4L90A 2VW5A 3HHUA 3U2KA 3T10A 3B28A 4O05A 3OWBA 2VCJA 2BU8A 5M4EA 4CWNA 1UYIA 4X9LA 5IDMA 4NH8A 3OMUA 4ASBA 2XD6A 2IORA 3TZ4A 4R3AA 4CWOA 3PEJA 4URNA 2XDLA 3T0ZA 1UY7A 3TZ5A 2YECA 4AS9A 4DUHA 2XCMA 2YEHA 1Y8NA 1NHJA 3Q5JA 1PVGA 4BIUA 4BAEA 3FT8A 2Q8FA 4CE3A 5GGZA 4GCZA 4XDMA 4WUDA 4L94A 4B6CA 4DZYA 2WI4A 3R91A 2ESAA 2QF6A 4XIQA 4PRVA 2O1WA 2BREA 3OW6A 4EEHA 2QG2A 3NMQA 3OPDA 3A0XA 4HYMA 1UY8A 4HY1A 4K4OA 4KTNA 2HCHA 3Q5LA 2BU5A 2UWDA 3R4MA 3BMYA 5M4MA 2JJCA 4E00A 4BIZA 3G7BA 3B24A 4GEEA 2VCIA 3IEDA 1GKXA 1UYHA 2FWZA 1TH8A 4HZ0A 4AWPA 2H8MA 5M4HA 4BQGA 2YE3A 3K99A 1Y4UA 1EA6A 2XHRA 1L0OA 3D0BA 4XD8A 3H4LA 3JZ3A 2XDUA 1JM6A 3TZ0A 4KSHA 4ASGA 3A0ZA 3CGZA 1QY8A 4CWPA 1S16A 1YC3A 3ZM7A 4FCPA 1Z5BA 4XKAA 4V25A 4MB9A 2EXLA 2PNRA 5BOCA 1TBWA 4YKYA 4YKWA 4AWOA 3SL2A 2YI5A 2YE2A 4I3HA 3T1KA 4EGKA 4JASA 4NH7A 1US7A 2YE5A 4P8OA 2YJWA 1AH6A 2K5BA 1H7UA 4KSGA 4CWSA 1ZW9A 4LWEA 3CWVA 4EFTA 3R92A 1Z5AA 1YESA 4B7PA 1ZWHA 5F3KA 4H85A 3WHAA 3ZXOA 4ASFA 2XHTA 3TUHA 3VHAA 1YERA 1H7SA 4I5SA 4YKTA 4YKXA 3TZ2A 1YT0A 2YE8A 3INWA 2FTKA 3LMMA 1A4HA 2YEEA 3B27A 4QPJA 2QG0A 1GKZA 3RLRA 2FWYA 4GQTA 3HYZA 3PEHA 2BSMA 5F5RA 2XDSA 2YEFA 2YKJA 1Z59A 4O07A 4H81A 2YJXA 2XX4A 1MU5A 2YGFA 1IXMA 3O2FA 2H55A 3C0EA 1UYFA 3C11A 1AH8A 2WI2A 4L8ZA 2YE6A 4LP0A 5D7DA 1U0ZA 2O1UA 2YEIA 4O09A 3R4PA 4ZVIA 4BXIA 3K98A 2XJXA 2YKEA 4CWQA 2XDXA 2XK2A 2CCTA 1NHHA 2BU6A 2CGFA 4XCLA 3O6OA 3LNUA 4U7NA 2CCUA 2BU7A 2YE7A 1ZXMA 1GJVA 4L91A 2YGAA 2Q2EB 2YEJA 4PRXA 2Q8GA 2WEQA 2YI7A 3U67A 4FCRA 2YEAA 3HZ1A 3ZXQA 1YSRA 1EI1A 4XCJA 4JQLA 4LWIA 4BQJA 2C1GA 3EHHA 4LPBA 2ZKJA 4FMTA 3R4NA 5L3JA 3A0RA 2IOQA 3MNRP 1TC6A 4R3MA 5JENA 1Z5CA 3CGYA 4YKUA 5D6QA 1ZXNA 1YC4A 2IOPA 4ASAA 4CE2A 4EM7A 2GFDA 1U2OA 4FCQA 4XIRA 3TTZA 3R4OA 1UYKA 5M4KA 2ZDYA 3DGEA 3CRKA 1Y8OA 4XITA 4R1FA 4E02A 1AM1A 1OSFA 1UYGA 3G7EA 4YKQA 3A0WA 4ZKIA 5J71A 1BKNA 2XJGA 1AMWA 3Q5KA 1UY6A 2XJJA 3EKOA 4H7QA 3K60A 4QPKA 3WQ9A 4YKRA 1Y8PA 1YC1A 1YT2A 2WERA 1I5AA 5CF0A 2YE4A 4XIPA 4O04A 3EHJA 2HKJA 2E0AA 5C93A 2Q8IA 2YK9A 1KZNA 1TILA 4O0BA 3GIGA 2C1IA 1MX0A 3RLQA 4WUCA 3CRLA 3HYYA 4XKKA 5D7CA 2YI0A 2BYIA 2FXSA 5J6AA 4XC0A 4GGLA 2YKIA 3QTFA 4HXWA 1I58A 5FWKA 3LPSA 4LWGA 2FYPA 1R62A 1NHIA 5CTYA 4XKOA 1YS3A 5M4PA 2YI6A 4LWFA 1KIJA 2AKPA 2YKBA 5CTXA 3QDDA 4XTJA 4FPPA 4P7AA 4JAUA 3GIEA 4MBCA 3EHGA 1YSZA 4HY6A 1QZRA 1TIDA 3ZKBA 5FNCA
chains in the Genus database with same CATH topology
2YEDA 4URLA 3GIGB 3B25A 4MPCA 5D6PA 1B62A 1QYEA 4CWFA 5BODA 4YKZA 3KE6A 3U2DA 3HZ5A 1ID0A 2C2AA 5FNDA 1I5CA 4GFNA 2YE9A 3T0HA 2HG1A 3EKRA 4HYPA 4EFUA 2WI5A 3K97A 4HZ5A 5FNFA 1YT1A 2Q8HA 4E01A 4CWTA 4MP7A 4KP4A 5IDJA 4EMVA 4KFGA 2VWCA 1Y4SA 2BZ5A 4U7OA 2YEGA 4XE2A 3A0TA 2WI7A 3O0IA 1UYMA 4LWHA 4CE1A 5CTUA 4V26A 3VHCA 4NH9A 2CCSA 1TC0A 2BRCA 2BYHA 4PU9A 3BM9A 3D36A 1UYLA 3OWDA 2ZDXA 3RLPA 2JKIA 3ZKDA 4MOTA 3A0YA 2WI1A 5IN9A 4MP2A 2ZBKB 4U93A 4JAVA 3GIFA 3RKZA 3HEKA 4HXZA 1UYCA 2BU2A 5M4NA 3FV5A 4WUBA 3G75A 3T2SA 2CH4A 1YETA 1B3QA 2O1VA 2YEBA 4CWRA 2YK2A 2CG9A 5D7RA 1I5BA 2WI3A 2YGEA 5CPHA 1UYDA 2BTZA 4EGHA 2BT0A 4MPEA 2XX2A 1THNA 4AWQA 2WI6A 4Q20A 2QFOA 3B26A 1I5DA 4EGIA 3INXA 2IWSA 4URMA 3EHFA 1UY9A 2WEPA 4L93A 1BGQA 1BYQA 3VADA 2XX5A 2XDKA 5CTWA 2IWUA 4MPNA 1B63A 2GQPA 1BXDA 2XHXA 1S14A 1AJ6A 4GT8A 3FT5A 4W7TA 4UROA 3VHDA 1UYEA 1I59A 4PL9A 2YKCA 3D2RA 2IWXA 3H80A 2XABA 4KQVA 4L90A 2VW5A 3HHUA 3U2KA 3T10A 3B28A 4O05A 3OWBA 2VCJA 2BU8A 5M4EA 4CWNA 1UYIA 4X9LA 5IDMA 4NH8A 3OMUA 4ASBA 2XD6A 2IORA 3TZ4A 4R3AA 4CWOA 3PEJA 4URNA 2XDLA 3T0ZA 1UY7A 3TZ5A 2YECA 4AS9A 4DUHA 2XCMA 2YEHA 1Y8NA 1NHJA 3Q5JA 1PVGA 4BIUA 4BAEA 3FT8A 2Q8FA 4CE3A 5GGZA 4GCZA 4XDMA 4WUDA 4L94A 4B6CA 4DZYA 2WI4A 3R91A 2ESAA 2QF6A 4XIQA 4PRVA 2O1WA 2BREA 3OW6A 4EEHA 2QG2A 3NMQA 3OPDA 3A0XA 4HYMA 1UY8A 4HY1A 4K4OA 4KTNA 2HCHA 3Q5LA 2BU5A 2UWDA 3R4MA 3BMYA 5M4MA 2JJCA 4E00A 4BIZA 3G7BA 3B24A 4GEEA 2VCIA 3IEDA 1GKXA 1UYHA 2FWZA 1TH8A 4HZ0A 4AWPA 2H8MA 5M4HA 4BQGA 2YE3A 3K99A 1Y4UA 1EA6A 2XHRA 1L0OA 3D0BA 4XD8A 3H4LA 3JZ3A 2XDUA 1JM6A 3TZ0A 4KSHA 4ASGA 3A0ZA 3CGZA 1QY8A 4CWPA 1S16A 1YC3A 3ZM7A 4FCPA 1Z5BA 4XKAA 4V25A 4MB9A 2EXLA 2PNRA 5BOCA 1TBWA 4YKYA 4YKWA 4AWOA 3SL2A 2YI5A 2YE2A 4I3HA 3T1KA 4EGKA 4JASA 4NH7A 1US7A 2YE5A 4P8OA 2YJWA 1AH6A 2K5BA 1H7UA 4KSGA 4CWSA 1ZW9A 4LWEA 3CWVA 4EFTA 3R92A 1Z5AA 1YESA 4B7PA 1ZWHA 5F3KA 4H85A 3WHAA 3ZXOA 4ASFA 2XHTA 3TUHA 3VHAA 1YERA 1H7SA 4I5SA 4YKTA 4YKXA 3TZ2A 1YT0A 2YE8A 3INWA 1A4HA 2YEEA 3B27A 4QPJA 2QG0A 1GKZA 3RLRA 2FWYA 4GQTA 3HYZA 3PEHA 2BSMA 5F5RA 2XDSA 2YEFA 2YKJA 1Z59A 4O07A 4H81A 2YJXA 2XX4A 1MU5A 2YGFA 3O2FA 2H55A 3C0EA 1UYFA 3C11A 1AH8A 2WI2A 4L8ZA 2YE6A 4LP0A 5D7DA 1U0ZA 2O1UA 2YEIA 4O09A 3R4PA 4ZVIA 4BXIA 3K98A 2XJXA 2YKEA 4CWQA 2XDXA 2XK2A 2CCTA 1NHHA 2BU6A 2CGFA 4XCLA 3O6OA 3LNUA 4U7NA 2CCUA 2BU7A 2YE7A 1ZXMA 1GJVA 4L91A 2YGAA 2Q2EB 2YEJA 4PRXA 2Q8GA 2WEQA 2YI7A 3U67A 4FCRA 2YEAA 3HZ1A 3ZXQA 1YSRA 1EI1A 4XCJA 4JQLA 4LWIA 4BQJA 3EHHA 4LPBA 2ZKJA 4FMTA 3R4NA 5L3JA 3A0RA 2IOQA 3MNRP 1TC6A 4R3MA 1Z5CA 3CGYA 4YKUA 5D6QA 1ZXNA 1YC4A 2IOPA 4ASAA 4CE2A 4EM7A 2GFDA 1U2OA 4FCQA 4XIRA 3TTZA 3R4OA 1UYKA 5M4KA 2ZDYA 3DGEA 3CRKA 1Y8OA 4XITA 4R1FA 4E02A 1AM1A 1OSFA 1UYGA 3G7EA 4YKQA 3A0WA 4ZKIA 5J71A 1BKNA 2XJGA 1AMWA 3Q5KA 1UY6A 2XJJA 3EKOA 4H7QA 3K60A 4QPKA 3WQ9A 4YKRA 1Y8PA 1YC1A 1YT2A 2WERA 1I5AA 5CF0A 2YE4A 4XIPA 4O04A 3EHJA 2HKJA 2E0AA 5C93A 2Q8IA 2YK9A 1KZNA 1TILA 4O0BA 3GIGA 1MX0A 3RLQA 4WUCA 3CRLA 3HYYA 4XKKA 5D7CA 2YI0A 2BYIA 2FXSA 5J6AA 4XC0A 4GGLA 2YKIA 3QTFA 4HXWA 1I58A 5FWKA 3LPSA 4LWGA 2FYPA 1R62A 1NHIA 5CTYA 4XKOA 1YS3A 5M4PA 2YI6A 4LWFA 1KIJA 2AKPA 2YKBA 5CTXA 3QDDA 4XTJA 4FPPA 4P7AA 4JAUA 3GIEA 4MBCA 3EHGA 1YSZA 4HY6A 1QZRA 1TIDA 3ZKBA 5FNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YED A;  4URL A;  3GIG B;  3B25 A;  4MPC A;  5D6P A;  1B62 A;  1QYE A;  4CWF A;  5BOD A;  4YKZ A;  3KE6 A;  3U2D A;  3HZ5 A;  1ID0 A;  2C2A A;  5FND A;  1I5C A;  4GFN A;  2YE9 A;  3T0H A;  2HG1 A;  3EKR A;  4HYP A;  4EFU A;  2WI5 A;  3K97 A;  4HZ5 A;  5FNF A;  1YT1 A;  2Q8H A;  4E01 A;  4CWT A;  4MP7 A;  4KP4 A;  5IDJ A;  4EMV A;  4KFG A;  2VWC A;  1Y4S A;  2BZ5 A;  4U7O A;  2YEG A;  4XE2 A;  3A0T A;  2WI7 A;  3O0I A;  1UYM A;  4LWH A;  4CE1 A;  5CTU A;  4V26 A;  3VHC A;  4NH9 A;  2CCS A;  1TC0 A;  2BRC A;  2BYH A;  4PU9 A;  3BM9 A;  3D36 A;  1UYL A;  3OWD A;  2ZDX A;  3RLP A;  2JKI A;  3ZKD A;  4MOT A;  3A0Y A;  2WI1 A;  5IN9 A;  4MP2 A;  2ZBK B;  4U93 A;  4JAV A;  3GIF A;  3RKZ A;  3HEK A;  4HXZ A;  1UYC A;  2BU2 A;  5M4N A;  3FV5 A;  4WUB A;  3G75 A;  3T2S A;  2CH4 A;  1YET A;  1B3Q A;  2O1V A;  2YEB A;  4CWR A;  2YK2 A;  2CG9 A;  5D7R A;  1I5B A;  2WI3 A;  2YGE A;  5CPH A;  1UYD A;  2BTZ A;  4EGH A;  2BT0 A;  4MPE A;  2XX2 A;  1THN A;  4AWQ A;  2WI6 A;  4Q20 A;  2QFO A;  3B26 A;  1I5D A;  4EGI A;  3INX A;  2IWS A;  4URM A;  3EHF A;  1UY9 A;  2WEP A;  4L93 A;  1BGQ A;  1BYQ A;  3VAD A;  2XX5 A;  2XDK A;  5CTW A;  2IWU A;  4MPN A;  1B63 A;  2GQP A;  1BXD A;  2XHX A;  1S14 A;  1AJ6 A;  4GT8 A;  3FT5 A;  4W7T A;  4URO A;  3VHD A;  1UYE A;  1I59 A;  4PL9 A;  2YKC A;  3D2R A;  2IWX A;  3H80 A;  2XAB A;  4KQV A;  4L90 A;  2VW5 A;  3HHU A;  3U2K A;  3T10 A;  3B28 A;  4O05 A;  3OWB A;  2VCJ A;  2BU8 A;  5M4E A;  4CWN A;  1UYI A;  4X9L A;  5IDM A;  4NH8 A;  3OMU A;  4ASB A;  2XD6 A;  2IOR A;  3TZ4 A;  4R3A A;  4CWO A;  3PEJ A;  4URN A;  2XDL A;  3T0Z A;  1UY7 A;  3TZ5 A;  2YEC A;  4AS9 A;  4DUH A;  2XCM A;  2YEH A;  1Y8N A;  1NHJ A;  3Q5J A;  1PVG A;  4BIU A;  4BAE A;  3FT8 A;  2Q8F A;  4CE3 A;  5GGZ A;  4GCZ A;  4XDM A;  4WUD A;  4L94 A;  4B6C A;  4DZY A;  2WI4 A;  3R91 A;  2ESA A;  2QF6 A;  4XIQ A;  4PRV A;  2O1W A;  2BRE A;  3OW6 A;  4EEH A;  2QG2 A;  3NMQ A;  3OPD A;  3A0X A;  4HYM A;  1UY8 A;  4HY1 A;  4K4O A;  4KTN A;  2HCH A;  3Q5L A;  2BU5 A;  2UWD A;  3R4M A;  3BMY A;  5M4M A;  2JJC A;  4E00 A;  4BIZ A;  3G7B A;  3B24 A;  4GEE A;  2VCI A;  3IED A;  1GKX A;  1UYH A;  2FWZ A;  1TH8 A;  4HZ0 A;  4AWP A;  2H8M A;  5M4H A;  4BQG A;  2YE3 A;  3K99 A;  1Y4U A;  1EA6 A;  2XHR A;  1L0O A;  3D0B A;  4XD8 A;  3H4L A;  3JZ3 A;  2XDU A;  1JM6 A;  3TZ0 A;  4KSH A;  4ASG A;  3A0Z A;  3CGZ A;  1QY8 A;  4CWP A;  1S16 A;  1YC3 A;  3ZM7 A;  4FCP A;  1Z5B A;  4XKA A;  4V25 A;  4MB9 A;  2EXL A;  2PNR A;  5BOC A;  1TBW A;  4YKY A;  4YKW A;  4AWO A;  3SL2 A;  2YI5 A;  2YE2 A;  4I3H A;  3T1K A;  4EGK A;  4JAS A;  4NH7 A;  1US7 A;  2YE5 A;  4P8O A;  2YJW A;  1AH6 A;  2K5B A;  1H7U A;  4KSG A;  4CWS A;  1ZW9 A;  4LWE A;  3CWV A;  4EFT A;  3R92 A;  1Z5A A;  1YES A;  4B7P A;  1ZWH A;  5F3K A;  4H85 A;  3WHA A;  3ZXO A;  4ASF A;  2XHT A;  3TUH A;  3VHA A;  1YER A;  1H7S A;  4I5S A;  4YKT A;  4YKX A;  3TZ2 A;  1YT0 A;  2YE8 A;  3INW A;  1A4H A;  2YEE A;  3B27 A;  4QPJ A;  2QG0 A;  1GKZ A;  3RLR A;  2FWY A;  4GQT A;  3HYZ A;  3PEH A;  2BSM A;  5F5R A;  2XDS A;  2YEF A;  2YKJ A;  1Z59 A;  4O07 A;  4H81 A;  2YJX A;  2XX4 A;  1MU5 A;  2YGF A;  3O2F A;  2H55 A;  3C0E A;  1UYF A;  3C11 A;  1AH8 A;  2WI2 A;  4L8Z A;  2YE6 A;  4LP0 A;  5D7D A;  1U0Z A;  2O1U A;  2YEI A;  4O09 A;  3R4P A;  4ZVI A;  4BXI A;  3K98 A;  2XJX A;  2YKE A;  4CWQ A;  2XDX A;  2XK2 A;  2CCT A;  1NHH A;  2BU6 A;  2CGF A;  4XCL A;  3O6O A;  3LNU A;  4U7N A;  2CCU A;  2BU7 A;  2YE7 A;  1ZXM A;  1GJV A;  4L91 A;  2YGA A;  2Q2E B;  2YEJ A;  4PRX A;  2Q8G A;  2WEQ A;  2YI7 A;  3U67 A;  4FCR A;  2YEA A;  3HZ1 A;  3ZXQ A;  1YSR A;  1EI1 A;  4XCJ A;  4JQL A;  4LWI A;  4BQJ A;  3EHH A;  4LPB A;  2ZKJ A;  4FMT A;  3R4N A;  5L3J A;  3A0R A;  2IOQ A;  3MNR P;  1TC6 A;  4R3M A;  1Z5C A;  3CGY A;  4YKU A;  5D6Q A;  1ZXN A;  1YC4 A;  2IOP A;  4ASA A;  4CE2 A;  4EM7 A;  2GFD A;  1U2O A;  4FCQ A;  4XIR A;  3TTZ A;  3R4O A;  1UYK A;  5M4K A;  2ZDY A;  3DGE A;  3CRK A;  1Y8O A;  4XIT A;  4R1F A;  4E02 A;  1AM1 A;  1OSF A;  1UYG A;  3G7E A;  4YKQ A;  3A0W A;  4ZKI A;  5J71 A;  1BKN A;  2XJG A;  1AMW A;  3Q5K A;  1UY6 A;  2XJJ A;  3EKO A;  4H7Q A;  3K60 A;  4QPK A;  3WQ9 A;  4YKR A;  1Y8P A;  1YC1 A;  1YT2 A;  2WER A;  1I5A A;  5CF0 A;  2YE4 A;  4XIP A;  4O04 A;  3EHJ A;  2HKJ A;  2E0A A;  5C93 A;  2Q8I A;  2YK9 A;  1KZN A;  1TIL A;  4O0B A;  3GIG A;  1MX0 A;  3RLQ A;  4WUC A;  3CRL A;  3HYY A;  4XKK A;  5D7C A;  2YI0 A;  2BYI A;  2FXS A;  5J6A A;  4XC0 A;  4GGL A;  2YKI A;  3QTF A;  4HXW A;  1I58 A;  5FWK A;  3LPS A;  4LWG A;  2FYP A;  1R62 A;  1NHI A;  5CTY A;  4XKO A;  1YS3 A;  5M4P A;  2YI6 A;  4LWF A;  1KIJ A;  2AKP A;  2YKB A;  5CTX A;  3QDD A;  4XTJ A;  4FPP A;  4P7A A;  4JAU A;  3GIE A;  4MBC A;  3EHG A;  1YSZ A;  4HY6 A;  1QZR A;  1TID A;  3ZKB A;  5FNC A; 
#chains in the Genus database with same CATH topology
 1F51 A;  4E72 A;  2YED A;  4URL A;  3GIG B;  3B25 A;  4MPC A;  5D6P A;  1B62 A;  1QYE A;  4CWF A;  5BOD A;  4YKZ A;  3KE6 A;  3U2D A;  3HZ5 A;  1ID0 A;  2C2A A;  5FND A;  1I5C A;  4GFN A;  2YE9 A;  3T0H A;  2HG1 A;  3EKR A;  4HYP A;  4EFU A;  2WI5 A;  3K97 A;  4HZ5 A;  5FNF A;  1YT1 A;  2Q8H A;  4E01 A;  4CWT A;  3S5T A;  4MP7 A;  4KP4 A;  5IDJ A;  4EMV A;  4KFG A;  2VWC A;  1Y4S A;  2BZ5 A;  4U7O A;  2YEG A;  4XE2 A;  3A0T A;  2WI7 A;  3O0I A;  1UYM A;  4LWH A;  4CE1 A;  5CTU A;  4V26 A;  3VHC A;  4NH9 A;  2CCS A;  1TC0 A;  2BRC A;  2BYH A;  4PU9 A;  3BM9 A;  3D36 A;  1UYL A;  3OWD A;  2ZDX A;  3RLP A;  2JKI A;  3ZKD A;  4MOT A;  3A0Y A;  2WI1 A;  5IN9 A;  4MP2 A;  2ZBK B;  4U93 A;  4JAV A;  3GIF A;  3RKZ A;  3HEK A;  4HXZ A;  1UYC A;  2BU2 A;  5M4N A;  3FV5 A;  4WUB A;  3G75 A;  3T2S A;  2CH4 A;  1YET A;  1B3Q A;  2O1V A;  2YEB A;  4CWR A;  2YK2 A;  2CG9 A;  5D7R A;  1I5B A;  2WI3 A;  2YGE A;  5CPH A;  1UYD A;  2BTZ A;  4EGH A;  2BT0 A;  4MPE A;  2XX2 A;  1THN A;  4AWQ A;  2WI6 A;  4Q20 A;  2QFO A;  3B26 A;  1I5D A;  4EGI A;  3INX A;  2IWS A;  4URM A;  3EHF A;  1UY9 A;  2WEP A;  4L93 A;  1BGQ A;  1BYQ A;  3VAD A;  2XX5 A;  2XDK A;  5CTW A;  2IWU A;  4MPN A;  1B63 A;  3CYG A;  2GQP A;  1BXD A;  2XHX A;  1S14 A;  1AJ6 A;  4GT8 A;  3FT5 A;  4W7T A;  4URO A;  3VHD A;  1UYE A;  1I59 A;  4PL9 A;  2YKC A;  2HHI A;  3D2R A;  2IWX A;  3H80 A;  2XAB A;  4KQV A;  4L90 A;  2VW5 A;  3HHU A;  3U2K A;  3T10 A;  3B28 A;  4O05 A;  3OWB A;  2VCJ A;  2BU8 A;  5M4E A;  4CWN A;  1UYI A;  4X9L A;  5IDM A;  4NH8 A;  3OMU A;  4ASB A;  2XD6 A;  2IOR A;  3TZ4 A;  4R3A A;  4CWO A;  3PEJ A;  4URN A;  2XDL A;  3T0Z A;  1UY7 A;  3TZ5 A;  2YEC A;  4AS9 A;  4DUH A;  2XCM A;  2YEH A;  1Y8N A;  1NHJ A;  3Q5J A;  1PVG A;  4BIU A;  4BAE A;  3FT8 A;  2Q8F A;  4CE3 A;  5GGZ A;  4GCZ A;  4XDM A;  4WUD A;  4L94 A;  4B6C A;  4DZY A;  2WI4 A;  3R91 A;  2ESA A;  2QF6 A;  4XIQ A;  4PRV A;  2O1W A;  2BRE A;  3OW6 A;  4EEH A;  2QG2 A;  3NMQ A;  3OPD A;  3A0X A;  4HYM A;  1UY8 A;  4HY1 A;  4K4O A;  4KTN A;  2HCH A;  3Q5L A;  2BU5 A;  2UWD A;  3R4M A;  3BMY A;  5M4M A;  2JJC A;  4E00 A;  4BIZ A;  3G7B A;  3B24 A;  4GEE A;  2VCI A;  3IED A;  1GKX A;  1UYH A;  2FWZ A;  1TH8 A;  4HZ0 A;  4AWP A;  2H8M A;  5M4H A;  4BQG A;  2YE3 A;  3K99 A;  1Y4U A;  1EA6 A;  2XHR A;  1L0O A;  3D0B A;  4XD8 A;  3H4L A;  3JZ3 A;  2XDU A;  1JM6 A;  3TZ0 A;  4KSH A;  4ASG A;  3A0Z A;  3CGZ A;  1QY8 A;  4CWP A;  1S16 A;  1YC3 A;  3ZM7 A;  4FCP A;  1Z5B A;  4XKA A;  4V25 A;  4MB9 A;  2EXL A;  2PNR A;  5BOC A;  1TBW A;  4YKY A;  4YKW A;  4AWO A;  3SL2 A;  2YI5 A;  2YE2 A;  4I3H A;  3T1K A;  4EGK A;  4JAS A;  4NH7 A;  1US7 A;  2YE5 A;  4P8O A;  2YJW A;  1AH6 A;  2K5B A;  1H7U A;  4KSG A;  4CWS A;  1ZW9 A;  4LWE A;  3CWV A;  4EFT A;  3R92 A;  1Z5A A;  1YES A;  4B7P A;  1ZWH A;  5F3K A;  4H85 A;  3WHA A;  3ZXO A;  4ASF A;  2XHT A;  3TUH A;  3VHA A;  1YER A;  1H7S A;  4I5S A;  4YKT A;  4YKX A;  3TZ2 A;  1YT0 A;  2YE8 A;  3INW A;  2FTK A;  3LMM A;  1A4H A;  2YEE A;  3B27 A;  4QPJ A;  2QG0 A;  1GKZ A;  3RLR A;  2FWY A;  4GQT A;  3HYZ A;  3PEH A;  2BSM A;  5F5R A;  2XDS A;  2YEF A;  2YKJ A;  1Z59 A;  4O07 A;  4H81 A;  2YJX A;  2XX4 A;  1MU5 A;  2YGF A;  1IXM A;  3O2F A;  2H55 A;  3C0E A;  1UYF A;  3C11 A;  1AH8 A;  2WI2 A;  4L8Z A;  2YE6 A;  4LP0 A;  5D7D A;  1U0Z A;  2O1U A;  2YEI A;  4O09 A;  3R4P A;  4ZVI A;  4BXI A;  3K98 A;  2XJX A;  2YKE A;  4CWQ A;  2XDX A;  2XK2 A;  2CCT A;  1NHH A;  2BU6 A;  2CGF A;  4XCL A;  3O6O A;  3LNU A;  4U7N A;  2CCU A;  2BU7 A;  2YE7 A;  1ZXM A;  1GJV A;  4L91 A;  2YGA A;  2Q2E B;  2YEJ A;  4PRX A;  2Q8G A;  2WEQ A;  2YI7 A;  3U67 A;  4FCR A;  2YEA A;  3HZ1 A;  3ZXQ A;  1YSR A;  1EI1 A;  4XCJ A;  4JQL A;  4LWI A;  4BQJ A;  2C1G A;  3EHH A;  4LPB A;  2ZKJ A;  4FMT A;  3R4N A;  5L3J A;  3A0R A;  2IOQ A;  3MNR P;  1TC6 A;  4R3M A;  5JEN A;  1Z5C A;  3CGY A;  4YKU A;  5D6Q A;  1ZXN A;  1YC4 A;  2IOP A;  4ASA A;  4CE2 A;  4EM7 A;  2GFD A;  1U2O A;  4FCQ A;  4XIR A;  3TTZ A;  3R4O A;  1UYK A;  5M4K A;  2ZDY A;  3DGE A;  3CRK A;  1Y8O A;  4XIT A;  4R1F A;  4E02 A;  1AM1 A;  1OSF A;  1UYG A;  3G7E A;  4YKQ A;  3A0W A;  4ZKI A;  5J71 A;  1BKN A;  2XJG A;  1AMW A;  3Q5K A;  1UY6 A;  2XJJ A;  3EKO A;  4H7Q A;  3K60 A;  4QPK A;  3WQ9 A;  4YKR A;  1Y8P A;  1YC1 A;  1YT2 A;  2WER A;  1I5A A;  5CF0 A;  2YE4 A;  4XIP A;  4O04 A;  3EHJ A;  2HKJ A;  2E0A A;  5C93 A;  2Q8I A;  2YK9 A;  1KZN A;  1TIL A;  4O0B A;  3GIG A;  2C1I A;  1MX0 A;  3RLQ A;  4WUC A;  3CRL A;  3HYY A;  4XKK A;  5D7C A;  2YI0 A;  2BYI A;  2FXS A;  5J6A A;  4XC0 A;  4GGL A;  2YKI A;  3QTF A;  4HXW A;  1I58 A;  5FWK A;  3LPS A;  4LWG A;  2FYP A;  1R62 A;  1NHI A;  5CTY A;  4XKO A;  1YS3 A;  5M4P A;  2YI6 A;  4LWF A;  1KIJ A;  2AKP A;  2YKB A;  5CTX A;  3QDD A;  4XTJ A;  4FPP A;  4P7A A;  4JAU A;  3GIE A;  4MBC A;  3EHG A;  1YSZ A;  4HY6 A;  1QZR A;  1TID A;  3ZKB A;  5FNC A; 
#chains in the Genus database with same CATH homology
 2YED A;  4URL A;  3GIG B;  3B25 A;  4MPC A;  5D6P A;  1B62 A;  1QYE A;  4CWF A;  5BOD A;  4YKZ A;  3KE6 A;  3U2D A;  3HZ5 A;  1ID0 A;  2C2A A;  5FND A;  1I5C A;  4GFN A;  2YE9 A;  3T0H A;  2HG1 A;  3EKR A;  4HYP A;  4EFU A;  2WI5 A;  3K97 A;  4HZ5 A;  5FNF A;  1YT1 A;  2Q8H A;  4E01 A;  4CWT A;  4MP7 A;  4KP4 A;  5IDJ A;  4EMV A;  4KFG A;  2VWC A;  1Y4S A;  2BZ5 A;  4U7O A;  2YEG A;  4XE2 A;  3A0T A;  2WI7 A;  3O0I A;  1UYM A;  4LWH A;  4CE1 A;  5CTU A;  4V26 A;  3VHC A;  4NH9 A;  2CCS A;  1TC0 A;  2BRC A;  2BYH A;  4PU9 A;  3BM9 A;  3D36 A;  1UYL A;  3OWD A;  2ZDX A;  3RLP A;  2JKI A;  3ZKD A;  4MOT A;  3A0Y A;  2WI1 A;  5IN9 A;  4MP2 A;  2ZBK B;  4U93 A;  4JAV A;  3GIF A;  3RKZ A;  3HEK A;  4HXZ A;  1UYC A;  2BU2 A;  5M4N A;  3FV5 A;  4WUB A;  3G75 A;  3T2S A;  2CH4 A;  1YET A;  1B3Q A;  2O1V A;  2YEB A;  4CWR A;  2YK2 A;  2CG9 A;  5D7R A;  1I5B A;  2WI3 A;  2YGE A;  5CPH A;  1UYD A;  2BTZ A;  4EGH A;  2BT0 A;  4MPE A;  2XX2 A;  1THN A;  4AWQ A;  2WI6 A;  4Q20 A;  2QFO A;  3B26 A;  1I5D A;  4EGI A;  3INX A;  2IWS A;  4URM A;  3EHF A;  1UY9 A;  2WEP A;  4L93 A;  1BGQ A;  1BYQ A;  3VAD A;  2XX5 A;  2XDK A;  5CTW A;  2IWU A;  4MPN A;  1B63 A;  2GQP A;  1BXD A;  2XHX A;  1S14 A;  1AJ6 A;  4GT8 A;  3FT5 A;  4W7T A;  4URO A;  3VHD A;  1UYE A;  1I59 A;  4PL9 A;  2YKC A;  3D2R A;  2IWX A;  3H80 A;  2XAB A;  4KQV A;  4L90 A;  2VW5 A;  3HHU A;  3U2K A;  3T10 A;  3B28 A;  4O05 A;  3OWB A;  2VCJ A;  2BU8 A;  5M4E A;  4CWN A;  1UYI A;  4X9L A;  5IDM A;  4NH8 A;  3OMU A;  4ASB A;  2XD6 A;  2IOR A;  3TZ4 A;  4R3A A;  4CWO A;  3PEJ A;  4URN A;  2XDL A;  3T0Z A;  1UY7 A;  3TZ5 A;  2YEC A;  4AS9 A;  4DUH A;  2XCM A;  2YEH A;  1Y8N A;  1NHJ A;  3Q5J A;  1PVG A;  4BIU A;  4BAE A;  3FT8 A;  2Q8F A;  4CE3 A;  5GGZ A;  4GCZ A;  4XDM A;  4WUD A;  4L94 A;  4B6C A;  4DZY A;  2WI4 A;  3R91 A;  2ESA A;  2QF6 A;  4XIQ A;  4PRV A;  2O1W A;  2BRE A;  3OW6 A;  4EEH A;  2QG2 A;  3NMQ A;  3OPD A;  3A0X A;  4HYM A;  1UY8 A;  4HY1 A;  4K4O A;  4KTN A;  2HCH A;  3Q5L A;  2BU5 A;  2UWD A;  3R4M A;  3BMY A;  5M4M A;  2JJC A;  4E00 A;  4BIZ A;  3G7B A;  3B24 A;  4GEE A;  2VCI A;  3IED A;  1GKX A;  1UYH A;  2FWZ A;  1TH8 A;  4HZ0 A;  4AWP A;  2H8M A;  5M4H A;  4BQG A;  2YE3 A;  3K99 A;  1Y4U A;  1EA6 A;  2XHR A;  1L0O A;  3D0B A;  4XD8 A;  3H4L A;  3JZ3 A;  2XDU A;  1JM6 A;  3TZ0 A;  4KSH A;  4ASG A;  3A0Z A;  3CGZ A;  1QY8 A;  4CWP A;  1S16 A;  1YC3 A;  3ZM7 A;  4FCP A;  1Z5B A;  4XKA A;  4V25 A;  4MB9 A;  2EXL A;  2PNR A;  5BOC A;  1TBW A;  4YKY A;  4YKW A;  4AWO A;  3SL2 A;  2YI5 A;  2YE2 A;  4I3H A;  3T1K A;  4EGK A;  4JAS A;  4NH7 A;  1US7 A;  2YE5 A;  4P8O A;  2YJW A;  1AH6 A;  2K5B A;  1H7U A;  4KSG A;  4CWS A;  1ZW9 A;  4LWE A;  3CWV A;  4EFT A;  3R92 A;  1Z5A A;  1YES A;  4B7P A;  1ZWH A;  5F3K A;  4H85 A;  3WHA A;  3ZXO A;  4ASF A;  2XHT A;  3TUH A;  3VHA A;  1YER A;  1H7S A;  4I5S A;  4YKT A;  4YKX A;  3TZ2 A;  1YT0 A;  2YE8 A;  3INW A;  1A4H A;  2YEE A;  3B27 A;  4QPJ A;  2QG0 A;  1GKZ A;  3RLR A;  2FWY A;  4GQT A;  3HYZ A;  3PEH A;  2BSM A;  5F5R A;  2XDS A;  2YEF A;  2YKJ A;  1Z59 A;  4O07 A;  4H81 A;  2YJX A;  2XX4 A;  1MU5 A;  2YGF A;  3O2F A;  2H55 A;  3C0E A;  1UYF A;  3C11 A;  1AH8 A;  2WI2 A;  4L8Z A;  2YE6 A;  4LP0 A;  5D7D A;  1U0Z A;  2O1U A;  2YEI A;  4O09 A;  3R4P A;  4ZVI A;  4BXI A;  3K98 A;  2XJX A;  2YKE A;  4CWQ A;  2XDX A;  2XK2 A;  2CCT A;  1NHH A;  2BU6 A;  2CGF A;  4XCL A;  3O6O A;  3LNU A;  4U7N A;  2CCU A;  2BU7 A;  2YE7 A;  1ZXM A;  1GJV A;  4L91 A;  2YGA A;  2Q2E B;  2YEJ A;  4PRX A;  2Q8G A;  2WEQ A;  2YI7 A;  3U67 A;  4FCR A;  2YEA A;  3HZ1 A;  3ZXQ A;  1YSR A;  1EI1 A;  4XCJ A;  4JQL A;  4LWI A;  4BQJ A;  3EHH A;  4LPB A;  2ZKJ A;  4FMT A;  3R4N A;  5L3J A;  3A0R A;  2IOQ A;  3MNR P;  1TC6 A;  4R3M A;  1Z5C A;  3CGY A;  4YKU A;  5D6Q A;  1ZXN A;  1YC4 A;  2IOP A;  4ASA A;  4CE2 A;  4EM7 A;  2GFD A;  1U2O A;  4FCQ A;  4XIR A;  3TTZ A;  3R4O A;  1UYK A;  5M4K A;  2ZDY A;  3DGE A;  3CRK A;  1Y8O A;  4XIT A;  4R1F A;  4E02 A;  1AM1 A;  1OSF A;  1UYG A;  3G7E A;  4YKQ A;  3A0W A;  4ZKI A;  5J71 A;  1BKN A;  2XJG A;  1AMW A;  3Q5K A;  1UY6 A;  2XJJ A;  3EKO A;  4H7Q A;  3K60 A;  4QPK A;  3WQ9 A;  4YKR A;  1Y8P A;  1YC1 A;  1YT2 A;  2WER A;  1I5A A;  5CF0 A;  2YE4 A;  4XIP A;  4O04 A;  3EHJ A;  2HKJ A;  2E0A A;  5C93 A;  2Q8I A;  2YK9 A;  1KZN A;  1TIL A;  4O0B A;  3GIG A;  1MX0 A;  3RLQ A;  4WUC A;  3CRL A;  3HYY A;  4XKK A;  5D7C A;  2YI0 A;  2BYI A;  2FXS A;  5J6A A;  4XC0 A;  4GGL A;  2YKI A;  3QTF A;  4HXW A;  1I58 A;  5FWK A;  3LPS A;  4LWG A;  2FYP A;  1R62 A;  1NHI A;  5CTY A;  4XKO A;  1YS3 A;  5M4P A;  2YI6 A;  4LWF A;  1KIJ A;  2AKP A;  2YKB A;  5CTX A;  3QDD A;  4XTJ A;  4FPP A;  4P7A A;  4JAU A;  3GIE A;  4MBC A;  3EHG A;  1YSZ A;  4HY6 A;  1QZR A;  1TID A;  3ZKB A;  5FNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...