4PLLA

Structure of the chromodaomain of mrg2 in complex with h3k36me3
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
HFEEGERVLAKHSDCFYEAKVLKVEFKDNEWKYFVHYIGWNKSWDEWIRLDCLLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords At1g02740
publication title Regulation of arabidopsis flowering by the histone mark readers MRG1/2 via interaction with CONSTANS to modulate FT expression.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription
total genus 12
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pllA00
3MO8A 3S6WA 4BE2A 2R5MA 3MP6A 4C5GA 5FRNA 2X35A 4C5EA 4BDZA 5IN1A 2BKDN 2L89A 3LH0A 4LD6A 1OYXA 4NS5A 3BDLA 2GFUA 3KUFA 3ME9A 4A4HA 4UC4A 3OMGA 4PLLA 3OA6A 3S3OA 3OYIA 2RJDA 3NTKA 4A4EA 3LLRA 2IG0A 2RHUA 3DB3A 5KH6A 3OYKA 2QQSA 2RJEA 2RO0A 4HCZA 4IUTA 3OYEA 1G5VA 5J26A 3OQ5A 2LDMA 4PLIA 4RG2A 3OS1A 3OYFA 5CIUA 5KE3A 5C0MA 3FDRA 2O4XA 2NLUA 3O8VA 3MP8A 3QKJA 3H6ZA 3S3NA 1H3ZA 2F5KA 2EQJA 4CRIA 2YRVA 2EQKA 3NTHA 3OYDA 2JTFA 3OB9A 1XNIA 2X4XA 2DAQA 3MEVA 3CEYA 5M9OA 3QJ6A 2RI2A 3L2VA 4E7KA 3UT1A 4PL6A 4IUVA 5KCOA 2BIVA 4Q5WA 3SD4A 3UWNA 3PMTA 3MEUA 4IUPA 4BACA 4E7HA 3OYCA 1OZ3A 3GOXA 4C5HA 2X4WA 4BDYA 4L59A 5KE2A 3L2WA 2R5AA 4N4GA 3OYLA 4N4HA 4A4FA 3PMIA 3OYGA 4FL6A 2GFAA 1KHCA 2L8DA 4IURA 3OYNA 3MEAA 4N4IA 4QQDA 2WACA 1N27A 2RI3A 3FEOA 2LRQA 2MWPA 4QQGA 1WJRA 3P8HA 4IUUA 2X4YA 3OYBA 3L2UA 4ZTJA 2R57A 2B8AA 4GY5A 4II1A 3OYMA 3NTIA 2RJCA 2LVMA 4A4GA 4IUQA 4B9XA 3L42A 3QIIA 2L3RA 5IAYA 1WJSA 2EQUA 3DLMA 3FLGA 2EFIA 2EQMA 2FHDA 4OVAA 2RHIA 5J39A 2M0OA 3ASKA 2RJFA 4B9WA 3ZEHA 3OY9A 2P0KA 3MEWA 3L2QA 3S3MA 1SSFA 4ZTFA 3E9GA 4E7LA 4C5IA 2LCCA 5FRMA 4FU6A 3OS0A 2D9TA 3PNWC 3FC3A 2RHYA 3Q1JA 2K3YA 1OI1A 2XDPA 3LGLA 2BUDA 3LX7A 4X34A 5KCHA 2DIGA 2VYTA 2GF7A 3M9QA 2E6NA 2LTOA 2PQWA 3OMCA 2K3XA 2RHXA 2DIQA 5FROA 4QW2A 3OYJA 3LYIA 2HQEA 3OYAA 3MP1A 3OYHA 3OS2A 2O4XB 3C4SA 3LGFA 1MHNA 5D6WA 4BD3A 5D6YA 2JZ2A 2M1HA 3P8DA 4BE1A 4Z02A 2E5QA 1OZ2A 2R58A 3META 4QQ6A 2RHZA 2MWOA 4EDUA 1RI0A 3H8ZA 3E9FA 2EKOA 3DB4A 2HQXA 2QQRA 4E7IA 2RI5A 3PFSA 3L2RA 3EAEA 3QBYA 4QVZA 4E7JA 2CKKA 1WJQA 2G3RA 1WGSA 2XK0A 5C6SA 3F70A 4BE0A 2M16A 4IKFA 5D6XA
chains in the Genus database with same CATH superfamily
2C0IA 4J6YA 1Q81U 2PUOB 3RUXA 1M90U 3JCMb 1UDLA 3GF5A 2F5TX 2EAYA 4D8KA 3OA6A 3TU4K 3NTKA 1QVGS 2DMOA 5KYNA 2LZ6B 4IUTA 1VQNQ 1F1BB 2Y90A 2XDBA 1R77A 1Y96B 1M3CA 1NEBA 1M1KR 2IVWA 3CC7Q 1ARKA 1WZOA 1TS9A 2C0TA 3E2UA 5CCAA 3CCEA 1VYTA 5A0DA 2A7YA 3JB9F 3I5SA 1RL2A 4WF2A 4A4FA 4HVUA 3CCRT 4IURA 1NZ9A 5CKDA 1R0CB 4RUGA 5FLXE 2V26A 2FL7A 2K3BA 3NTIA 5LJ5h 2FEIA 4V2SA 3OSVA 2H3JA 4M77E 3OY9A 3NGPA 1SSFA 3RBBB 1AT1B 3CBOA 1LPLA 5I2SA 2XDDA 4E7SA 5FU7C 2QA4A 5DLOA 3OYHA 3QYGB 2EVRA 1KC8R 1VQ6Q 3PTAA 1KD1C 2AZSA 3CMAT 5IHKA 5D6WA 4ANJA 3REAB 4JLGA 1NJIU 3EFSA 3M55A 1KJWA 3G71T 2DRKA 4O6JA 5I22A 2E41A 5HKCA 3CCSQ 3MHXA 2BTTA 1JJ2P 2BZYA 1WA7A 5GANd 3WXMB 4LDYA 4LN2A 3CCRA 4C5GA 4FW1A 2X35A 4RTUA 2FPDA 3GLXA 2L3SA 1PCXA 5GANf 1FX7A 3OYIA 2YRDA 1VQPQ 5C0MA 1LJOA 1QMCA 1W4SA 1NLPC 2LQKA 3PVQA 2F5KA 1VOMA 3G4SQ 5FU6B 2RI2A 3UT1A 4BI3A 2X51A 1G3SA 3SD4A 2MPXC 4J9GA 1YHQQ 2RNAA 1M30A 1Q7YU 4O5VA 2CUDA 1K9AA 4QQDA 2WACA 4PFPA 2LMJA 3I55A 5CQXA 2QDYB 3QO3A 3G71A 1TUDA 2JM9A 9ATCB 2RJCA 1TG0A 1Y0MA 2AT1B 4KGZB 4M7DG 1Y96A 1QKWA 2RHIA 3G1JA 4TVRA 1AWJA 2JJ9A 4B9WA 3QWXX 5CO7A 1EX4A 2DBKA 4M7DB 1PSFA 3E9GA 1BU1A 3J80E 2XDPA 1VIFA 5KCHA 2EW3A 1W6XA 1YI2T 4FW2A 2CREA 3QUIA 1WHGA 1KQSA 1T3LA 2GTJA 3JAME 3OS2A 1YNZA 2FRWA 4RTYA 1AZGB 3M0UA 3QHSA 3P8DA 4BE1A 4BY6B 1G3WA 1JBMA 4EDUA 1RI0A 3KXTA 4L6V5 2PUKB 3J7AF 2CH4A 2QDLA 1WJQA 1AOJA 3CCUQ 4JS5A 3JCMg 4C0DC 2VB6A 2F2VA 5FRNA 4LD6A 3VU3C 4A4HA 3MPUB 2DTHA 2I0NA 3DB3A 3QJYA 2JM8A 1G5VA 2EYXA 2OTJQ 1BIBA 4RG2A 2L3PA 3OW2P 4WTOB 1FXXA 3QKJA 2QEXT 3N5BB 2QXFA 3CMEQ 1IXDA 1ABOA 2NYSA 4BACA 4OP0A 2QQ9A 1VQ5T 3DLLA 1NLOC 3L1AA 2EYQA 2DO3A 2M0YA 2W0ZA 5LJ5j 3CD6T 1HJDA 1C1AA 3EG9B 4J7IA 3VRYA 1KHCA 1B07A 1N27A 1VQMA 2D0NA 1IRXA 1Q86U 2J7IA 1KIKA 4FIBA 1G8XA 4M75G 3I56T 1K8AC 1WJSA 3KBGA 2M02A 4M75B 2M0OA 5CK9A 2GTOA 4M7DF 5HCKA 4ZTFA 2LQNA 2DXCA 2FVUA 1GCQA 4JJBA 3VS4A 4C8QG 1FYNA 2E6NA 3VUBA 2DIQA 1TUGB 4C8QB 2QEXA 4HCCA 2HBPA 1CKBA 1JEGA 3DKMA 5AT1B 4QVDA 1UFFA 1VA7A 2EJFA 1OV3A 1TWBA 3META 5LJ3e 1VQ5A 1JQQA 2HQXA 3PFSA 2AK5A 4RCBA 2FYKA 4OGCA 1VQ4A 2G3RA 2MIOA 3CD6A 5L8RE 4XQ3A 2R5MA 3SDZA 4M7DA 1YJNT 2X9HA 3CCVA 2JTEA 1X27A 2VC8A 1BK2A 4Y28E 1N9SA 2FZKB 5LJ3d 3LLRA 2KQWA 4ME7A 2K9GA 5KH6A 2O88A 3EG0A 1XOVA 1D0ZA 2K6DA 4R55A 1IGUA 3SWNB 3OSSC 4J9DA 1R8OB 3RIRA 2DL8A 5LJ3f 3VS2A 1VQLQ 1I0CA 1JXOA 5CAIA 2XD0A 1TXQA 2L2PA 4PL6A 5CKFA 3ZFJA 3OS5A 2X3XD 2HD0A 4XTYA 1GCPA 1OX9A 5KE2A 1S72T 4GBQA 3V7SA 3C94A 1YJWT 3M58A 4F7UG 4FL6A 4DBFA 1VQ4Q 2OTLQ 5A0LA 5J3BA 3ZBDA 4F7UB 3CCJQ 5LJ5d 4PJNA 3OYMA 4IUQA 1BI1A 1K1ZA 3CCLT 3L42A 4PJOG 3QIIA 3M0RA 4M75F 2FHDA 2JUFA 4M7AG 1B7TA 5KYUB 1JXMA 2RPNA 5LJ5f 5L23A 1YJNA 4PJOB 3VS6A 1U5SA 4M7AB 3E19A 2YWWA 2NUTB 5GAMe 1CSKA 4EMKA 1Y07A 4M7DC 1B34B 3EG3A 4C8QF 3EG9A 1WHJA 1D0XA 4C92G 2E4HA 1WI7A 2O4XB 4ELYC 2OI3A 3M5AA 5D6YA 3TQ7P 4KUDK 4C92B 4QQ6A 3GPLA 3DB4A 4HT9A 2LP5A 1GL5A 3FRNA 4BY6C 2DLPA 4M75A 1WGSA 3G7ZA 1V29B 4FYXB 1S72A 1AVZC 2L3RA 1YJWA 3GP8A 1ZSZB 2K5IA 3HRTA 4RTTA 3ULRB 1RACB 2RQRA 1MGQA 4C0ZA 1OYXA 3G6ET 2GFUA 2E6ZA 2VVKA 4PLLA 3VV0A 2YXYA 2RQWA 2IG0A 2DTIA 2OX7A 4M7DD 2RH2A 4C8QA 3LW5E 1KD1U 3CCLA 4E47A 2DD4A 4A54A 1NEGA 3O8VA 2MCNA 1IZ6A 2PVGB 1OU8A 2XIDA 2KXCA 3OYDA 1XNIA 4KUIA 2F69A 2EGEA 1PNJA 2RD1A 2LCLA 2ZPIB 1M8MA 2QAZA 2ZPFB 2Y4YA 3URGA 2CSIA 3A8GB 4L5GA 3OYLA 3OYGA 3D7SB 1RAEB 3BFMA 2VKNA 2HKQB 4F7UF 4ORZA 2DILA 3P8HA 1K9MR 3TREA 4F17A 4JRPA 1VQ9Q 2RK2A 4XTWA 1ZA2B 4XU3A 2XG8D 1RAIB 3JSCA 1N5ZA 3ASKA 4PJOF 4M7AF 2JN0A 5LL6S 4E7LA 3JCMV 3CXCS 5FRMA 2J6FA 5GAN8 3CC2Q 3EG2A 1N8RR 1PRLC 1GRIA 5CR2A 2EBPA 4XTZA 3EFRA 1PM3A 2AIRB 4J5YA 2PVOB 1LVKA 4F7UA 4C92F 4C8QC 2M1HA 4M77G 2RMOA 4DQ2A 5IH2A 1GFDA 3QBYA 3FJ5A 5GAN6 4M77B 5KYUA 4RKUE 2BZXA 4PJOA 3MO8A 1SF9A 4M7AA 1PRMC 1WNLA 3CPWP 2D8JA 3CXCA 3KUFA 2WSEE 2CP7A 4UC4A 5GMKe 1M3BA 1XQHA 1B34A 2DM1A 3LH5A 3A1PA 4A4EA 3EH2A 4PLIA 1M1KC 1X6OA 2O4XA 2NLUA 3H0IA 2V8KA 1VQ6T 2RA2A 2MAMA 4C92A 4FM4B 1EZZB 2HZYA 3RESA 4C8QD 1PHTA 2DAQA 3SWNC 4Y91A 2O01E 1BI3A 1PC0A 1U06A 3R6NA 3CCQQ 1SHFA 3MEUA 4MMLA 1FWZA 1MMGA 3HSBA 1MV3A 1ZSZA 4OMQA 4N4HA 2GFAA 1Q82C 1YFNA 5CKBA 1AHJB 2E3HA 2MK5A 3EGUA 4IUUA 3OYBA 4RTVA 1ZUKA 1KG1A 1W2BP 1VQKQ 3BE3A 4M78G 2LVMA 1WX6A 2RM4A 2CP3A 2C0OA 2JMAA 1X2KA 3DLMA 2K7AA 1QP3A 1X6GA 4JZ3A 3PT9A 5J39A 2EGAA 4DEXA 4M78B 4WCIA 2KT1A 2DJQA 2P0KA 4BUGA 1X75C 1RAAB 2LCCA 2NUPB 2ESWA 4FU6A 4PJOC 4X34A 4JRQA 2ZZDA 1U3OA 1KC8C 4M7AC 4Z8AA 1WHMA 3CQTA 4GLKA 4PFZA 3R6OA 1QVGA 1Q82R 2K3XA 4Z88A 1XTDA 2A3LA 1TU0B 2KT8A 4JJCA 3HFNA 2FG0A 4FCYA 3VS5A 2JZ2A 1SG5A 1OZ2A 3VRZA 3NHNA 1IB8A 1K8AU 3SEMA 5HK3A 1ZQ1A 2QQBA 4M77F 4C92C 1UHCA 3RDVA 4IKFA 3RERA 5GANe 4BE2A 4Y92A 3WVEB 1A0NB 2VGMA 3HHTB 3CCEQ 1VQ8T 3BDLA 2DZ9A 1D09B 1ZSZC 4HVWA 3O5ZA 5EC7A 4PJOD 5IXFA 4HCZA 3M59A 3M54A 4NL2A 1UGQB 1RI9A 4J6XA 2P0PA 2LJ0A 4HKEA 3JCMQ 4CRIA 2YRVA 5FWBA 4JLIA 3JCMe 3L2VA 1X2QA 2CZ0B 2ENMA 2QK0A 4IUVA 3M0QA 2E64A 2BIVA 2VXEA 5I21A 4M77A 3QYHB 1FMWA 4C92D 4HXJA 3MCAB 5GMKi 3JCMP 1YITT 1TOVA 3QG1A 1Z9QA 1M1FA 1QVGP 5GAMh 3H0HA 3OYNA 3MEAA 1KSWA 3EHQA 1UECA 3FEOA 2RQTA 3JCMd 1S1NA 1UGVA 5ECAA 2QA4Q 2P4RA 4ZTJA 2RQVA 2R57A 3IQLA 2V8IA 2OTJT 3JCMf 5FW9A 4M78F 3OW2S 2HL3A 3A98A 3V7CA 1MMAA 2E70A 1G2BA 1VQ8A 3CMET 2ZPEB 2CP0A 2QI2A 3CMAA 3JV3A 3FC3A 2DD5A 2ED0A 4J9FA 3TCJA 3LX7A 4FYVB 2V8JA 2GF7A 3BW1A 4JZ4A 3CCRQ 2D0QB 1WQWA 4HVVA 3U23A 2JMCA 1PWTA 1PG5B 3PVLA 1G83A 4XTVA 2O9VA 1UJYA 5GAOp 4JRKA 4KRTA 2MWOA 2LJ3A 2EKOA 2K5LA 2VUBA 4QVZA 2HSEB 4ZN1A 4M78A 1YITA 4J8OA 2DXBA 4JJDA 2YUNA 1UHFA 2PNIA 4M77C 5IN1A 2NUPA 1O9SA 2E65A 1Z9ZA 1PKSA 3S3OA 2QTVA 3JB9D 2DXTA 4J9CA 1NPPA 4AFUC 3EHRA 3QDRB 1N9RA 4LDVA 2YUOA 5GAOm 3I55Q 3CPFA 3CCMT 3E1SA 3G71Q 4J9EA 3MEVA 4FT2A 3THKA 1I5OB 1KQ1A 3GIBA 3RNJA 1YIJT 2YLCA 1JB0E 1N6AA 3L2WA 2DJZA 1RAHB 3HRUA 1H8KA 4X1VA 4RG8A 8ATCB 1BB9A 2COYA 4A53A 2XHCA 2E10A 2LNVA 4QQGA 1I8FA 4ZGDB 3X28B 4CC3A 1NG2A 2EQUA 1WXTA 1YI2A 2V1QA 4EMKB 2COWA 1VQLT 1HK9A 4OMPA 1TTHB 1C6VX 1BI2A 4M78C 2RHYA 1OPLA 1KQSP 1U1SA 1K73R 5KYWA 3HL8A 3M9QA 2A0FB 4PK4A 1Q81R 2PQWA 1M90R 1RAGB 4K11A 3OYYA 1ZX6A 3CCMA 2F2WA 5IXBA 2RK1A 1MMDA 3JCMW 2OTLT 1O75A 3H8ZA 2L5QA 2X4JA 2W10A 3I9QA 3CCJT 1NE8A 1YIJA 1E7OA 2KRMA 2CT3A 2MMPA 4AMCA 5GJWB 2J05A 3S6WA 7AT1B 3J81E 2K79A 4Z89A 1TUCA 3I35A 5GAN3 4M78D 4ATOA 4IIMA 2HEQA 1WXUA 5J26A 3LWIA 3V7RA 1VQMQ 3TVTA 4YTLA 2EYWA 3QJ6A 5GAMj 1JRIA 1SHGA 3QZ5B 4KGXB 5CKEA 4EPCA 1YCYA 1QVFS 2HDAA 4X9DA 3QWYA 1P92A 3PMIA 3I56A 3JB9H 1VQ7T 2LRQA 1FMKA 2XICA 4MMKA 3SHWA 1M1KU 1RABB 4OB3B 2QEXQ 4XK8E 4A4GA 1IREB 2EKHA 3REBB 2FRYA 5LJ5e 2LT4A 4A4KA 5FU6C 2DXUA 2KI7A 3SB2A 1H641 2RJFA 1VQ5Q 3ZEHA 5DLQE 3MEWA 1NBEB 1GCQC 2OAUA 3OS0A 2XMFA 4OB0B 3CD6Q 2LTOA 1SSHA 3VUZA 3CCVQ 2BE7D 2CP6A 3X25B 1E6GA 4CC7A 3LGFA 1I4K1 4OMOA 2QGGA 3X26B 1YP5A 1VQOT 4X9CA 5A0GA 2KMTA 2NWMA 1WQ7A 2FZGB 2JT4A 4DOVA 1D1CA 1TH7A 1UUEA 5GAN2 4EMHA 4J9IA 3MP6A 4J6WA 2L89A 4LDWA 3LH0A 1VQ7A 1KC8U 2DYIA 2LQ8A 2YUQA 1Q7YR 2LX7A 1QKXA 2Z0WA 5GAOl 2VASA 3CC4T 1Y57A 1MNEA 3HP9A 4HA8A 1SEMA 2HL5C 2HNIA 3BY7A 2COZA 2J6OA 2BE9B 3X24B 4N0AA 3EGXB 2EPDA 1KQ2A 4NOYA 2CH4W 2DVJA 1ZBXA 3OYCA 1YJNQ 4BDYA 4L59A 3H9NA 4JJNK 2CS7A 3VYGA 1K9MC 3KFVA 3OBYA 2F1LA 1VQOA 2MWPA 1ZLMA 4RTWA 1M9SA 1B3QA 4QT7A 1YJ9T 2FO0A 1M2VB 1VYVA 1MUZA 1QCFA 4OVAA 4AT1B 2JTMA 2RF0A 2MI6A 1U8RA 1N8RC 1ZHIA 4FSSA 2B86A 4EMKC 2D1XA 3Q1JA 5FWCA 3LGLA 1S72Q 4XU1A 4MZMA 1YJWQ 2QG9B 5AYFA 1WHHA 3PIPA 2KK4A 3CC4A 1ZBJA 3MP1A 4HT8A 1VQNT 3UPUA 2DA9A 3OBWA 2ABLA 1WHKA 1LOJA 5A2QE 2RHZA 3CCLQ 4F7UE 2KROA 1IO6A 2CGHA 2QQRA 3G6EA 3CC7T 1VUBA 4M75C 2K5FA 4ESRA 4XU0A 5C6SA 1QQJA 2M9UA 2LT1A 2K57A 2MOXA 2M16A 2GQVA 1OOTA 2DL4A 2GBQA 4N0AC 1IGQA 4C5EA 4BDZA 2LJ1A 3JCMc 2DEQA 3C12A 4AG1C 1X6BA 1LCKA 3OMGA 4OF1A 1I07A 5CQYA 2SEMA 1YJ9A 1QWEA 4KT0E 1X69A 3OQ5A 3OYFA 5CIUA 2ZPBB 5GAMg 2HKNA 3MP8A 5GAN4 1Q86R 2YLBA 2OJ2A 2EQKA 3OB9A 2X4XA 1R0BG 3V8JA 1YBYA 5GAOn 1GXIE 4KH1B 5KCOA 1W70A 3PMTA 4PKCC 4VUBA 4M75D 3NPFA 4KBMB 2C06A 2KXDA 4RTXA 4C5HA 1BCMA 2YDLA 1VQNA 2ROLA 3MJXA 3A8MB 2DL7A 2KSSA 3EH1A 2ZPHB 4DA4A 1AEYA 3RR6A 2H3EB 2MF2A 3CC7A 4J83A 4F04B 4GY5A 1IHVA 2J6KA 2I2LA 4MDWA 4JPBW 2VGNA 2EWNA 3VS7A 1GFCA 1WXBA 3CCST 4LDXA 3RMQA 1KK7A 2A28A 3VS1A 3WVDB 2KEAA 1JJ2S 3S3MA 3JRZA 3VYHB 4BB7A 3EGXA 2D9TA 1SRLA 2QGFB 3OMCA 4E2FB 3LYIA 1W1FA 2QYZA 4JUVA 1VQPT 1G3YA 4ZN3A 2WSCE 3UA6A 1OQKA 5LJ3h 2FB7A 3QPHA 5IT9E 2ECZA 3GNFB 2KRNA 4ZGEB 2QA4T 4E7IA 3G4ST 1M2VA 2RI5A 1Y7XA 2DPPB 2O2OA 2ZAEA 2ZGWA 2WSFE 3ZL7C 3CXCP 1ZUUA 2GNCA 2KE9A 4LUEA 4AFZC 4R0KA 4LUDA 1YHQT 1JJ2A 1WHLA 2BKDN 2HQHA 3QSUA 2X3WD 3ME9A 1VQ6A 2BZ8A 1YN8A 2KAFA 1M2OA 4NL3A 1T0JA 2AHJB 3UATA 3BDUA 3PIOA 5KE3A 6AT1B 3M4YA 3L2ZA 5KYXB 3CCSA 2DL3A 3AT1B 2DK3A 2JTFA 4E7KA 3A8OB 4XU2A 2DTOA 2DE0X 2JS0A 3EFOB 2YRCA 1ABQA 4Q5WA 2RQUA 1CKAA 2LQWA 3AHUA 2EYYA 4IUPA 1HYOA 1XJWB 1OZ3A 5IHIA 3SFMA 2CSQA 4BI4A 4XAXB 2M51A 4N4GA 4M7AD 1VYUA 2GGRA 2IPOB 1VQPA 3UDCA 1GBQA 2JOYA 3QZ9B 2JNGA 1MNDA 2X4YA 3G4SA 4PJLA 4RCCA 1RUWA 4IIOA 3I5RA 3MKDA 4A63B 3M4GA 1M5Q1 4MZPA 1YHQA 3TSWA 3I55T 2VXFA 5KYWB 4FYWB 1BI0A 1UGPB 4FSXA 4OMMA 3CCUT 2E3IA 4DOWA 3UF4A 3VJPA 3QDFA 5GMKm 2JVVA 3EG1A 4QVCA 1YCSB 2VYTA 1TSFA 4FT4A 1BIAA 1UGRB 5DY9A 2E1HA 2HQEA 1OX8A 2KYMA 2ZPGB 2G6FX 4PJMA 1M4ZA 4QKUA 1J3TA 2F2XA 1KD1R 1D0YA 2CKKA 4J9HA 2GCXA 4LXCA 2DFUA 1X01A 2DF6A 2A37A 4M78E 4OB2B 4EMGA 1AZEA 2AKKA 3EGDB 2RJDA 2CZ1B 3M0SA 2KGTA 2DBMA 1UTIA 3M0PA 3OYEA 4AFSC 1KQSS 1KFZA 2JS2A 3S3NA 5KYYB 1H3ZA 1OU9A 2HSPA 3OW2A 3CCUA 1BBZA 5M9OA 2DL5A 2V1RA 3HPWA 2GQIA 4C0GA 5CVIA 3UWNA 1UEBA 1VQ8Q 3JCMX 2DRMA 2OTJA 3CMAQ 5HK0A 4KH0B 2D8HA 5GANg 1D1BA 2CP5A 3CMEA 2CYZB 3L2UA 2ROTA 1G3TA 4II1A 3CBPA 1X43A 3PE0A 4FYYB 5EG2A 5KYXA 4OMNA 3A8LB 3H0FA 3PGGA 2EFIA 2DERA 2NUZA 4BI8B 3RKYA 2YUPA 1VQMT 1QP2A 3EFOA 1K73C 4RMOA 1Q81C 1M90C 4EIKA 4M77D 5LJ3j 1RAFB 1YITQ 2P84A 2CZ6B 5FROA 3V8KA 2LCSA 5DM7R 4QW2A 1K9MU 4ELZC 2KY9A 1K4US 5GAN7 2KNBB 3C4SA 2IIMA 1MHNA 3QXEB 3HTRA 2R58A 2VV5A 2PVDB 3A8HB 1VIEA 1BYMA 1PSEA 1N8RU 3F70A 4J9BA 1JU5C 3NFCA 1ZUYA 1K76A 3NMZC 1MMNA 2OAWA 3C95A 5GMKh 1VQ4T 2KVQG 2RHUA 2EYZA 2QQSA 3HRSA 2YHTA 2KDSA 2K2VA 3A5ZB 3OS1A 2ATCB 3CCVT 1D1AA 1EIFA 1WDXA 1C0MA 4D8DA 2HCKA 3CEYA 3TEEA 1PD1A 3HFOA 3RKWA 5HY6A 4M7DE 3X20B 1V76A 1YI2Q 2L3QA 2DZCA 3TSZA 1AWOA 4E7ZA 2CT4A 1QW1A 4C0FA 4N4IA 3EGDA 4OB1B 2KR3A 1IHWA 3CBMA 5GJVB 1VQLA 1WJRA 4XTXA 3FJPA 3VS0A 2EJ9A 1QCOA 1NJIC 1ZA1B 2HAXA 3CCMQ 4B9XA 3VKIA 5KYYA 3FIFA 4JRIA 3INZA 4CC4B 4LDUA 5GMKl 1K8AR 3L2QA 2DKGA 2EQIA 2EIFA 1YIJQ 2YSQA 1OI1A 2OTLA 1QWFA 3FB9A 4E6RA 4LNPA 1I1JA 3CCJA 4OMLA 2DETA 4AFQC 1K0XA 1BKBA 3H41A 1H92A 2K4YA 3T9NA 4BD3A 2AZVA 1BCOA 1NJIR 4Z02A 4AG2C 3JB9I 3E9FA 1I5LA 2D6FA 1JO8A 1OPKA 1PD0A 1PKTA 2J06A 4E7JA 1YWOA 1NYFA 2MYSA 4BE0A 1M8VA 5D6XA 5GANh 3VS3A 2EJGA 4LE9A 1QVFA 1Q82U 2QQAA 2QASA 1AD5A 4NS5A 1Q7YC 3HKSA 2ED1A 1V1CA 3LWHA 4KGVB 2RO0A 4D6WA 2LDMA 3I56Q 5CKHA 4OGEA 1H3HA 2Y4XA 1D3BB 2EGCA 4DBQA 3H6ZA 1LNXA 2K2MA 1FMVA 4MDXA 1VQ9T 4CI0C 2XKOC 3JCMh 3NTHA 1SPKA 4M75E 4HCKA 3UA7A 4F16A 4JS4A 5GAN5 2DEUA 1HD3A 2HBWA 3CC2T 2X4WA 3RMSA 1SRMA 1KHIA 2R5AA 2KRSA 1WIEA 4C8QE 5IHNA 1UG1A 2CZ7B 5GAOq 2LC4A 2PU9B 1QLYA 3C0CA 4PJJA 5I2MA 4HCBA 4F14A 2P4TA 4CC2A 3FLGA 3GBQA 5D7UA 2EQMA 1AWXA 4P5NA 2P0QA 5LJ3g 1UJ0A 1NYGA 5GAMd 5FU7B 1Y71A 4C5IA 4DBHA 2L0AA 3JCMJ 1QVFP 3PNWC 2H8HA 3V8LA 1EFNA 2BUDA 2DIGA 4PFOA 1M3AA 3CPWS 5GAOr 5GAMf 2PZ1A 1VQ7Q 3RKXA 1VQ9A 2O31A 2KYBA 2FPFA 1WLPB 5GMKj 3L2RA 1M1GA 3JB9J 1NM7A 3CC2A 1T0HA 2LNHB 3CCQT 4J7FA 4XTUA 2HMAA 5LJ5g 2E5KA 4B6MA 1UE9A 4RTZA 2FPEA 2SRCA 4LD9K 1GBRA 1ACMB 2QTXA 1WFWA 4OMFB 1ZSGA 3CPWA 1QVPA 3OYKA 2RJEA 1HXDA 1Q86C 3FDRA 1VQOQ 1VQKT 2VWFA 2CDTA 1W2BS 2EQJA 1RLQC 1MV0B 1QCNA 3SWNA 1WPYA 2ZCFB 4PJOE 3JB9G 1RADB 4M7AE 2O9SA 2LX9A 2YT6A 4E7HA 3GNGA 3GOXA 8AT1B 2A36A 1OULA 3M57A 2L8DA 4KULA 1UB4A 2AKLA 2RI3A 4M4ZA 1M27C 2KBTA 3CC4Q 1DJ7B 1RLPC 2B8AA 2A08A 1D3BA 2CP2A 4C92E 4MZTA 5IAYA 2PTKA 4PNOA 3CCQA 4ZGJB 1W2BA 2E12A 4R56A 2RN8A 4JDSA 3M0TA 2FZCB 3G6EQ 1I81A 2K3YA 3CCET 3ER0A 2CUBA 2DX1A 3OYJA 2RHXA 3OYAA 2XI9A 3P8BB 2JXBA 4GLMA 1VQKA 2NUTA 1OEBA 1Q95G 1WYXA 4ZNXA 1UGSB 1YWPA 1NPRA 2XU8A 1U1TA 5GANj 1T3SA 1K0SA 1YJ9Q 2DYBA 2E5QA 3M53A 2DNUA 1HSQA 2DVEA 1AWWA 4C0DB 4DEYA 5I11A 3EAEA 2RB6A 2JW4A 1SKUB 2XK0A 3M56A 1E6HA 1K73U 4DBRA
chains in the Genus database with same CATH topology
3GP8A 3S6WA 2K5IA 4M78E 3HRTA 4OB2B 4J6YA 4EMGA 2PUOB 1Q81U 3RUXA 1M90U 3J81E 1MGQA 4C0ZA 1OYXA 3JCMb 3G6ET 2GFUA 3GF5A 5GAN3 2E6ZA 2F5TX 2EAYA 4M78D 4PLLA 3VV0A 3OA6A 3TU4K 4ATOA 2RJDA 3NTKA 2CZ1B 1QVGS 2IG0A 2DTIA 4M7DD 4IUTA 3OYEA 5J26A 3LWIA 2RH2A 4C8QA 3LW5E 1KD1U 1KQSS 4E47A 3CCLA 2DD4A 4A54A 3O8VA 1IZ6A 2Y90A 3S3NA 2PVGB 3V7RA 2XIDA 2XDBA 1Y96B 1H3ZA 2IVWA 3OW2A 3OYDA 3CCUA 4YTLA 1XNIA 5M9OA 4KUIA 5GAMj 3QJ6A 1JRIA 5CCAA 3QZ5B 3HPWA 2F69A 3CCEA 5CKEA 4EPCA 2RD1A 5A0DA 2LCLA 4C0GA 2ZPIB 1YCYA 2A7YA 5CVIA 3UWNA 1UEBA 2ZPFB 2Y4YA 3URGA 3JB9F 1RL2A 1QVFS 3JCMX 3A8GB 4X9DA 4L5GA 4WF2A 3OYLA 2OTJA 4A4FA 1P92A 3PMIA 3OYGA 3I56A 3CCRT 3BFMA 3JB9H 4IURA 5HK0A 1NZ9A 1VQ7T 5CKDA 4F7UF 2LRQA 5GANg 5FLXE 2XICA 3P8HA 4MMKA 3CMEA 2CYZB 1M1KU 3L2UA 3TREA 1G3TA 2FL7A 4II1A 3CBPA 4OB3B 3NTIA 4XK8E 4A4GA 1IREB 5LJ5h 5LJ5e 2LT4A 5EG2A 4JRPA 2RK2A 4V2SA 4XTWA 3A8LB 3PGGA 4A4KA 2EFIA 4XU3A 2XG8D 5FU6C 3JSCA 4BI8B 2DXUA 3RKYA 3OSVA 3SB2A 3ASKA 1H641 2H3JA 2RJFA 4PJOF 1VQMT 4M77E 3ZEHA 3OY9A 5DLQE 4M7AF 3MEWA 1QP2A 2JN0A 1SSFA 5LL6S 1K73C 4RMOA 4E7LA 3JCMV 3CXCS 5FRMA 2OAUA 3OS0A 3CBOA 1Q81C 1M90C 5GAN8 4M77D 4OB0B 5I2SA 2XDDA 5LJ3j 5CR2A 5FU7C 2LTOA 4XTZA 2QA4A 2CZ6B 5FROA 3V8KA 3EFRA 3VUZA 4QW2A 5DM7R 5DLOA 3OYHA 1K9MU 4ELZC 3QYGB 4J5YA 2KY9A 3X25B 5GAN7 3PTAA 1KD1C 2PVOB 3CMAT 3C4SA 3LGFA 1I4K1 1MHNA 5D6WA 3X26B 3QXEB 4F7UA 4C92F 4JLGA 4C8QC 2M1HA 1NJIU 3EFSA 2R58A 1VQOT 2VV5A 3M55A 4X9CA 4M77G 5A0GA 2PVDB 4DQ2A 3G71T 2KMTA 4O6JA 3A8HB 1WQ7A 2E41A 5HKCA 1VIEA 3QBYA 4DOVA 1BYMA 3MHXA 1PSEA 5GAN6 1TH7A 4M77B 5GANd 4RKUE 1N8RU 3WXMB 3F70A 4LDYA 5GAN2 3NFCA 4EMHA 4PJOA 3MO8A 3MP6A 3CCRA 4C5GA 4J6WA 2X35A 4M7AA 1WNLA 2L89A 3GLXA 3LH0A 4LDWA 1VQ7A 3CXCA 3C95A 3KUFA 1KC8U 2WSEE 5GANf 4UC4A 5GMKh 1FX7A 5GMKe 1VQ4T 3OYIA 2LQ8A 1XQHA 1B34A 4A4EA 2KVQG 2RHUA 2QQSA 3HRSA 2YHTA 5GAOl 2KDSA 2K2VA 4PLIA 3A5ZB 3OS1A 1M1KC 5C0MA 1X6OA 1LJOA 3CC4T 3HP9A 1W4SA 3CCVT 2O4XA 1EIFA 2NLUA 4HA8A 2LQKA 2V8KA 1VQ6T 2RA2A 2F5KA 2MAMA 4C92A 2HNIA 4FM4B 3BY7A 5FU6B 3RESA 4C8QD 3SWNC 2DAQA 4Y91A 3CEYA 3TEEA 2RI2A 3UT1A 3HFOA 3RKWA 4BI3A 2O01E 5HY6A 1BI3A 3X24B 4N0AA 3JB9D 1G3SA 3SD4A 1KQ2A 4NOYA 3X20B 3MEUA 4M7DE 4MMLA 1FWZA 1ZBXA 2DZCA 3OYCA 3HSBA 4BDYA 4L59A 4N4HA 1Q7YU 4JJNK 2CS7A 1QW1A 2GFAA 4O5VA 3VYGA 4C0FA 1Q82C 1K9MC 3OBYA 4N4IA 4QQDA 2WACA 4OB1B 5CKBA 1VQOA 1AHJB 2MWPA 3CBMA 5CQXA 3I55A 1VQLA 1WJRA 2QDYB 3FJPA 4XTXA 3QO3A 4IUUA 3G71A 3OYBA 2EJ9A 1M9SA 1KG1A 1NJIC 1YJ9T 2HAXA 4M78G 2RJCA 2LVMA 2RM4A 4B9XA 3VKIA 3DLMA 3PT9A 1QP3A 4M7DG 1Y96A 3FIFA 4OVAA 2RHIA 4TVRA 5J39A 2JTMA 4JRIA 3INZA 4M78B 4LDUA 4B9WA 5GMKl 2MI6A 1U8RA 5CO7A 1N8RC 1ZHIA 2P0KA 4BUGA 2DKGA 1X75C 3L2QA 1PSFA 4M7DB 3E9GA 2LCCA 4FU6A 2EIFA 4EMKC 3J80E 3Q1JA 1OI1A 2XDPA 3LGLA 4PJOC 1VIFA 4X34A 5KCHA 4XU1A 4MZMA 4JRQA 2ZZDA 1KC8C 2OTLA 1YI2T 4M7AC 5AYFA 3FB9A 4GLKA 3R6OA 1QVGA 3PIPA 2K3XA 2KK4A 3CC4A 1XTDA 3CCJA 3MP1A 2A3LA 3QUIA 4HT8A 1KQSA 3HFNA 1BKBA 3JAME 3OS2A 1VQNT 3UPUA 2K4YA 3T9NA 4BD3A 3OBWA 3QHSA 2JZ2A 3P8DA 4BE1A 4Z02A 1LOJA 1OZ2A 1G3WA 4BY6B 3JB9I 1JBMA 2RHZA 4EDUA 4F7UE 1RI0A 5A2QE 3E9FA 3KXTA 1I5LA 2CGHA 2D6FA 2QQRA 1K8AU 4L6V5 3G6EA 3CC7T 1VUBA 2PUKB 3J7AF 5HK3A 1ZQ1A 2QQBA 4M75C 4M77F 4C92C 4E7JA 2K5FA 1WJQA 4XU0A 5C6SA 2M9UA 2LT1A 2K57A 4BE0A 4JS5A 2M16A 2GQVA 3JCMg 4IKFA 5D6XA 4C0DC 5GANh 3RERA 1M8VA 5GANe 4BE2A 4N0AC 2EJGA 3WVEB 5FRNA 4C5EA 4BDZA 1QVFA 1Q82U 2VGMA 3HHTB 2QQAA 3JCMc 2DEQA 1VQ8T 4LD6A 3C12A 4NS5A 3BDLA 2DZ9A 3VU3C 3CPWA 1Q7YC 3HKSA 4A4HA 3OMGA 4OF1A 5CQYA 2DTHA 3LWHA 4PJOD 1YJ9A 3DB3A 3QJYA 4HCZA 2RO0A 3M59A 4KT0E 1G5VA 4D6WA 1BIBA 3OQ5A 2LDMA 3M54A 4RG2A 3OYFA 5CKHA 4OGEA 5CIUA 4NL2A 2ZPBB 1UGQB 1D3BB 2Y4XA 5GAMg 4J6XA 1FXXA 2P0PA 3MP8A 3QKJA 3H6ZA 4HKEA 3JCMQ 1LNXA 3N5BB 2QEXT 5GAN4 2YLBA 2QXFA 4CRIA 2YRVA 1VQ9T 4MDXA 4CI0C 2XKOC 3JCMh 2EQKA 3NTHA 4JLIA 3JCMe 4BACA 3OB9A 2X4XA 3L2VA 4OP0A 2QQ9A 4M75E 3V8JA 1YBYA 5GAOn 2CZ0B 4JS4A 4IUVA 1VQ5T 1GXIE 5KCOA 3DLLA 2E64A 5GAN5 2BIVA 2VXEA 5I21A 3L1AA 2EYQA 3PMTA 4M77A 4PKCC 4VUBA 3QYHB 4M75D 2DO3A 4C92D 4KBMB 2C06A 3MCAB 3CC2T 4C5HA 5GMKi 2X4WA 3RMSA 5LJ5j 3CD6T 3JCMP 2R5AA 1KHIA 1YITT 3QG1A 1M1FA 1VQNA 4J7IA 5GAMh 1KHCA 3OYNA 3MEAA 3A8MB 1N27A 4C8QE 3FEOA 2KSSA 2ZPHB 3JCMd 4DA4A 1VQMA 2CZ7B 5GAOq 2MF2A 2LC4A 2PU9B 1Q86U 5I2MA 3CC7A 4FIBA 4HCBA 4ZTJA 4J83A 2R57A 4GY5A 4M75G 2V8IA 2OTJT 2P4TA 3I56T 2I2LA 1K8AC 1WJSA 3FLGA 4MDWA 2VGNA 3JCMf 2EQMA 2EWNA 3KBGA 4M78F 3OW2S 4P5NA 2P0QA 4M75B 2M0OA 3CCST 4LDXA 3RMQA 3V7CA 5CK9A 5LJ3g 2E70A 3WVDB 1VQ8A 4M7DF 3CMET 2ZPEB 4ZTFA 3S3MA 1JJ2S 3JRZA 5FU7B 3VYHB 5GAMd 1Y71A 2DXCA 2QI2A 4C5IA 4BB7A 3CMAA 3JCMJ 2D9TA 3PNWC 3FC3A 2FVUA 2DD5A 3TCJA 3V8LA 3LX7A 2BUDA 4C8QG 2DIGA 2V8JA 2GF7A 3CPWS 2E6NA 3BW1A 5GAOr 2D0QB 5GAMf 3OMCA 3VUBA 2DIQA 1WQWA 3LYIA 4C8QB 3RKXA 2QEXA 4HCCA 2HBPA 4JUVA 1VQ9A 4XTVA 1VQPT 3DKMA 1G3YA 4ZN3A 4QVDA 2WSCE 2EJFA 5GAOp 5LJ3h 3META 4JRKA 2FB7A 5LJ3e 2MWOA 3QPHA 5IT9E 1VQ5A 2EKOA 2HQXA 3GNFB 4ZGEB 2QA4T 4E7IA 2K5LA 3G4ST 2VUBA 2RI5A 3PFSA 1Y7XA 5GMKj 3L2RA 2DPPB 4QVZA 1M1GA 2FYKA 2ZGWA 2WSFE 4OGCA 4RCBA 3JB9J 2G3RA 4ZN1A 1VQ4A 3CC2A 4M78A 3CD6A 5L8RE 4XQ3A 3CCQT 4J7FA 1YITA 4J8OA 2DXBA 4XTUA 2R5MA 3SDZA 4M7DA 1YHQT 1JJ2A 5LJ5g 4M77C 5IN1A 1YJNT 2BKDN 3CCVA 3QSUA 1O9SA 4LD9K 3ME9A 2VC8A 1VQ6A 4Y28E 2E65A 2QTXA 4OMFB 1N9SA 3S3OA 5LJ3d 3LLRA 2KAFA 2KQWA 1QVPA 2DXTA 4ME7A 5KH6A 4NL3A 2RJEA 1HXDA 3OYKA 1NPPA 1XOVA 2AHJB 4R55A 1Q86C 3BDUA 3PIOA 5KE3A 3QDRB 1N9RA 4LDVA 3FDRA 3M4YA 3L2ZA 3SWNB 3OSSC 1R8OB 1VQKT 3CCSA 3RIRA 5LJ3f 5GAOm 3CPFA 1W2BS 3CCMT 2EQJA 3E1SA 2DK3A 5CAIA 2XD0A 2JTFA 3MEVA 4E7KA 3A8OB 4XU2A 4FT2A 2DTOA 3SWNA 1WPYA 4PL6A 5CKFA 3ZFJA 2ZCFB 4PJOE 3JB9G 4Q5WA 3OS5A 1KQ1A 3GIBA 3AHUA 4M7AE 4IUPA 2LX9A 2HD0A 4XTYA 4E7HA 1YIJT 1OZ3A 3GNGA 3SFMA 3GOXA 4BI4A 2YLCA 1JB0E 1N6AA 4XAXB 5KE2A 3L2WA 1S72T 3V7SA 3C94A 2DJZA 4N4GA 1YJWT 4M7AD 3M58A 4F7UG 3HRUA 3M57A 4FL6A 1VQPA 2L8DA 3UDCA 4RG8A 4KULA 1UB4A 2JOYA 2RI3A 4A53A 5A0LA 5J3BA 2XHCA 2E10A 2LNVA 3ZBDA 4QQGA 1I8FA 4F7UB 3X28B 4ZGDB 3QZ9B 2JNGA 2X4YA 3G4SA 1DJ7B 5LJ5d 2B8AA 4RCCA 3OYMA 1D3BA 4C92E 4IUQA 1BI1A 4MZTA 3CCLT 3L42A 4PJOG 3QIIA 5IAYA 3M4GA 2EQUA 1M5Q1 4PNOA 3CCQA 4M75F 2FHDA 2JUFA 4MZPA 1YI2A 4ZGJB 4M7AG 1W2BA 2E12A 4EMKB 4R56A 1YHQA 3I55T 2VXFA 5LJ5f 1YJNA 1VQLT 4PJOB 1BI0A 1HK9A 1UGPB 4JDSA 4FSXA 3CCUT 4M7AB 3E19A 4DOWA 1I81A 3VJPA 1BI2A 4M78C 5GMKm 2RHYA 5GAMe 2K3YA 3CCET 2JVVA 4EMKA 4QVCA 1Y07A 1U1SA 2VYTA 3ER0A 4M7DC 3HL8A 3M9QA 4FT4A 1B34B 1BIAA 1UGRB 2PQWA 3OYJA 2RHXA 5DY9A 4C8QF 2E1HA 3OYAA 2HQEA 2XI9A 3P8BB 2ZPGB 3OYYA 1VQKA 4C92G 1M4ZA 3CCMA 1UGSB 2O4XB 1NPRA 2XU8A 4ELYC 1U1TA 5GANj 3M5AA 5D6YA 2RK1A 3JCMW 2OTLT 4KUDK 2E5QA 4C92B 3M53A 4QQ6A 3GPLA 1O75A 3H8ZA 2DVEA 2L5QA 2X4JA 3DB4A 3CCJT 4C0DB 1NE8A 3EAEA 2RB6A 3FRNA 1YIJA 4BY6C 2CKKA 2GCXA 1WGSA 2MMPA 2XK0A 3G7ZA 3M56A 4M75A 1V29B 1S72A 4HT9A 1X01A 2L3RA 1YJWA 1K73U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MO8 A;  3S6W A;  4BE2 A;  2R5M A;  3MP6 A;  4C5G A;  5FRN A;  2X35 A;  4C5E A;  4BDZ A;  5IN1 A;  2BKD N;  2L89 A;  3LH0 A;  4LD6 A;  1OYX A;  4NS5 A;  3BDL A;  2GFU A;  3KUF A;  3ME9 A;  4A4H A;  4UC4 A;  3OMG A;  4PLL A;  3OA6 A;  3S3O A;  3OYI A;  2RJD A;  3NTK A;  4A4E A;  3LLR A;  2IG0 A;  2RHU A;  3DB3 A;  5KH6 A;  3OYK A;  2QQS A;  2RJE A;  2RO0 A;  4HCZ A;  4IUT A;  3OYE A;  1G5V A;  5J26 A;  3OQ5 A;  2LDM A;  4PLI A;  4RG2 A;  3OS1 A;  3OYF A;  5CIU A;  5KE3 A;  5C0M A;  3FDR A;  2O4X A;  2NLU A;  3O8V A;  3MP8 A;  3QKJ A;  3H6Z A;  3S3N A;  1H3Z A;  2F5K A;  2EQJ A;  4CRI A;  2YRV A;  2EQK A;  3NTH A;  3OYD A;  2JTF A;  3OB9 A;  1XNI A;  2X4X A;  2DAQ A;  3MEV A;  3CEY A;  5M9O A;  3QJ6 A;  2RI2 A;  3L2V A;  4E7K A;  3UT1 A;  4PL6 A;  4IUV A;  5KCO A;  2BIV A;  4Q5W A;  3SD4 A;  3UWN A;  3PMT A;  3MEU A;  4IUP A;  4BAC A;  4E7H A;  3OYC A;  1OZ3 A;  3GOX A;  4C5H A;  2X4W A;  4BDY A;  4L59 A;  5KE2 A;  3L2W A;  2R5A A;  4N4G A;  3OYL A;  4N4H A;  4A4F A;  3PMI A;  3OYG A;  4FL6 A;  2GFA A;  1KHC A;  2L8D A;  4IUR A;  3OYN A;  3MEA A;  4N4I A;  4QQD A;  2WAC A;  1N27 A;  2RI3 A;  3FEO A;  2LRQ A;  2MWP A;  4QQG A;  1WJR A;  3P8H A;  4IUU A;  2X4Y A;  3OYB A;  3L2U A;  4ZTJ A;  2R57 A;  2B8A A;  4GY5 A;  4II1 A;  3OYM A;  3NTI A;  2RJC A;  2LVM A;  4A4G A;  4IUQ A;  4B9X A;  3L42 A;  3QII A;  2L3R A;  5IAY A;  1WJS A;  2EQU A;  3DLM A;  3FLG A;  2EFI A;  2EQM A;  2FHD A;  4OVA A;  2RHI A;  5J39 A;  2M0O A;  3ASK A;  2RJF A;  4B9W A;  3ZEH A;  3OY9 A;  2P0K A;  3MEW A;  3L2Q A;  3S3M A;  1SSF A;  4ZTF A;  3E9G A;  4E7L A;  4C5I A;  2LCC A;  5FRM A;  4FU6 A;  3OS0 A;  2D9T A;  3PNW C;  3FC3 A;  2RHY A;  3Q1J A;  2K3Y A;  1OI1 A;  2XDP A;  3LGL A;  2BUD A;  3LX7 A;  4X34 A;  5KCH A;  2DIG A;  2VYT A;  2GF7 A;  3M9Q A;  2E6N A;  2LTO A;  2PQW A;  3OMC A;  2K3X A;  2RHX A;  2DIQ A;  5FRO A;  4QW2 A;  3OYJ A;  3LYI A;  2HQE A;  3OYA A;  3MP1 A;  3OYH A;  3OS2 A;  2O4X B;  3C4S A;  3LGF A;  1MHN A;  5D6W A;  4BD3 A;  5D6Y A;  2JZ2 A;  2M1H A;  3P8D A;  4BE1 A;  4Z02 A;  2E5Q A;  1OZ2 A;  2R58 A;  3MET A;  4QQ6 A;  2RHZ A;  2MWO A;  4EDU A;  1RI0 A;  3H8Z A;  3E9F A;  2EKO A;  3DB4 A;  2HQX A;  2QQR A;  4E7I A;  2RI5 A;  3PFS A;  3L2R A;  3EAE A;  3QBY A;  4QVZ A;  4E7J A;  2CKK A;  1WJQ A;  2G3R A;  1WGS A;  2XK0 A;  5C6S A;  3F70 A;  4BE0 A;  2M16 A;  4IKF A;  5D6X A; 
#chains in the Genus database with same CATH topology
 2C0I A;  4J6Y A;  1Q81 U;  2PUO B;  3RUX A;  1M90 U;  3JCM b;  1UDL A;  3GF5 A;  2F5T X;  2EAY A;  4D8K A;  3OA6 A;  3TU4 K;  3NTK A;  1QVG S;  2DMO A;  5KYN A;  2LZ6 B;  4IUT A;  1VQN Q;  1F1B B;  2Y90 A;  2XDB A;  1R77 A;  1Y96 B;  1M3C A;  1NEB A;  1M1K R;  2IVW A;  3CC7 Q;  1ARK A;  1WZO A;  1TS9 A;  2C0T A;  3E2U A;  5CCA A;  3CCE A;  1VYT A;  5A0D A;  2A7Y A;  3JB9 F;  3I5S A;  1RL2 A;  4WF2 A;  4A4F A;  4HVU A;  3CCR T;  4IUR A;  1NZ9 A;  5CKD A;  1R0C B;  4RUG A;  5FLX E;  2V26 A;  2FL7 A;  2K3B A;  3NTI A;  5LJ5 h;  2FEI A;  4V2S A;  3OSV A;  2H3J A;  4M77 E;  3OY9 A;  3NGP A;  1SSF A;  3RBB B;  1AT1 B;  3CBO A;  1LPL A;  5I2S A;  2XDD A;  4E7S A;  5FU7 C;  2QA4 A;  5DLO A;  3OYH A;  3QYG B;  2EVR A;  1KC8 R;  1VQ6 Q;  3PTA A;  1KD1 C;  2AZS A;  3CMA T;  5IHK A;  5D6W A;  4ANJ A;  3REA B;  4JLG A;  1NJI U;  3EFS A;  3M55 A;  1KJW A;  3G71 T;  2DRK A;  4O6J A;  5I22 A;  2E41 A;  5HKC A;  3CCS Q;  3MHX A;  2BTT A;  1JJ2 P;  2BZY A;  1WA7 A;  5GAN d;  3WXM B;  4LDY A;  4LN2 A;  3CCR A;  4C5G A;  4FW1 A;  2X35 A;  4RTU A;  2FPD A;  3GLX A;  2L3S A;  1PCX A;  5GAN f;  1FX7 A;  3OYI A;  2YRD A;  1VQP Q;  5C0M A;  1LJO A;  1QMC A;  1W4S A;  1NLP C;  2LQK A;  3PVQ A;  2F5K A;  1VOM A;  3G4S Q;  5FU6 B;  2RI2 A;  3UT1 A;  4BI3 A;  2X51 A;  1G3S A;  3SD4 A;  2MPX C;  4J9G A;  1YHQ Q;  2RNA A;  1M30 A;  1Q7Y U;  4O5V A;  2CUD A;  1K9A A;  4QQD A;  2WAC A;  4PFP A;  2LMJ A;  3I55 A;  5CQX A;  2QDY B;  3QO3 A;  3G71 A;  1TUD A;  2JM9 A;  9ATC B;  2RJC A;  1TG0 A;  1Y0M A;  2AT1 B;  4KGZ B;  4M7D G;  1Y96 A;  1QKW A;  2RHI A;  3G1J A;  4TVR A;  1AWJ A;  2JJ9 A;  4B9W A;  3QWX X;  5CO7 A;  1EX4 A;  2DBK A;  4M7D B;  1PSF A;  3E9G A;  1BU1 A;  3J80 E;  2XDP A;  1VIF A;  5KCH A;  2EW3 A;  1W6X A;  1YI2 T;  4FW2 A;  2CRE A;  3QUI A;  1WHG A;  1KQS A;  1T3L A;  2GTJ A;  3JAM E;  3OS2 A;  1YNZ A;  2FRW A;  4RTY A;  1AZG B;  3M0U A;  3QHS A;  3P8D A;  4BE1 A;  4BY6 B;  1G3W A;  1JBM A;  4EDU A;  1RI0 A;  3KXT A;  4L6V 5;  2PUK B;  3J7A F;  2CH4 A;  2QDL A;  1WJQ A;  1AOJ A;  3CCU Q;  4JS5 A;  3JCM g;  4C0D C;  2VB6 A;  2F2V A;  5FRN A;  4LD6 A;  3VU3 C;  4A4H A;  3MPU B;  2DTH A;  2I0N A;  3DB3 A;  3QJY A;  2JM8 A;  1G5V A;  2EYX A;  2OTJ Q;  1BIB A;  4RG2 A;  2L3P A;  3OW2 P;  4WTO B;  1FXX A;  3QKJ A;  2QEX T;  3N5B B;  2QXF A;  3CME Q;  1IXD A;  1ABO A;  2NYS A;  4BAC A;  4OP0 A;  2QQ9 A;  1VQ5 T;  3DLL A;  1NLO C;  3L1A A;  2EYQ A;  2DO3 A;  2M0Y A;  2W0Z A;  5LJ5 j;  3CD6 T;  1HJD A;  1C1A A;  3EG9 B;  4J7I A;  3VRY A;  1KHC A;  1B07 A;  1N27 A;  1VQM A;  2D0N A;  1IRX A;  1Q86 U;  2J7I A;  1KIK A;  4FIB A;  1G8X A;  4M75 G;  3I56 T;  1K8A C;  1WJS A;  3KBG A;  2M02 A;  4M75 B;  2M0O A;  5CK9 A;  2GTO A;  4M7D F;  5HCK A;  4ZTF A;  2LQN A;  2DXC A;  2FVU A;  1GCQ A;  4JJB A;  3VS4 A;  4C8Q G;  1FYN A;  2E6N A;  3VUB A;  2DIQ A;  1TUG B;  4C8Q B;  2QEX A;  4HCC A;  2HBP A;  1CKB A;  1JEG A;  3DKM A;  5AT1 B;  4QVD A;  1UFF A;  1VA7 A;  2EJF A;  1OV3 A;  1TWB A;  3MET A;  5LJ3 e;  1VQ5 A;  1JQQ A;  2HQX A;  3PFS A;  2AK5 A;  4RCB A;  2FYK A;  4OGC A;  1VQ4 A;  2G3R A;  2MIO A;  3CD6 A;  5L8R E;  4XQ3 A;  2R5M A;  3SDZ A;  4M7D A;  1YJN T;  2X9H A;  3CCV A;  2JTE A;  1X27 A;  2VC8 A;  1BK2 A;  4Y28 E;  1N9S A;  2FZK B;  5LJ3 d;  3LLR A;  2KQW A;  4ME7 A;  2K9G A;  5KH6 A;  2O88 A;  3EG0 A;  1XOV A;  1D0Z A;  2K6D A;  4R55 A;  1IGU A;  3SWN B;  3OSS C;  4J9D A;  1R8O B;  3RIR A;  2DL8 A;  5LJ3 f;  3VS2 A;  1VQL Q;  1I0C A;  1JXO A;  5CAI A;  2XD0 A;  1TXQ A;  2L2P A;  4PL6 A;  5CKF A;  3ZFJ A;  3OS5 A;  2X3X D;  2HD0 A;  4XTY A;  1GCP A;  1OX9 A;  5KE2 A;  1S72 T;  4GBQ A;  3V7S A;  3C94 A;  1YJW T;  3M58 A;  4F7U G;  4FL6 A;  4DBF A;  1VQ4 Q;  2OTL Q;  5A0L A;  5J3B A;  3ZBD A;  4F7U B;  3CCJ Q;  5LJ5 d;  4PJN A;  3OYM A;  4IUQ A;  1BI1 A;  1K1Z A;  3CCL T;  3L42 A;  4PJO G;  3QII A;  3M0R A;  4M75 F;  2FHD A;  2JUF A;  4M7A G;  1B7T A;  5KYU B;  1JXM A;  2RPN A;  5LJ5 f;  5L23 A;  1YJN A;  4PJO B;  3VS6 A;  1U5S A;  4M7A B;  3E19 A;  2YWW A;  2NUT B;  5GAM e;  1CSK A;  4EMK A;  1Y07 A;  4M7D C;  1B34 B;  3EG3 A;  4C8Q F;  3EG9 A;  1WHJ A;  1D0X A;  4C92 G;  2E4H A;  1WI7 A;  2O4X B;  4ELY C;  2OI3 A;  3M5A A;  5D6Y A;  3TQ7 P;  4KUD K;  4C92 B;  4QQ6 A;  3GPL A;  3DB4 A;  4HT9 A;  2LP5 A;  1GL5 A;  3FRN A;  4BY6 C;  2DLP A;  4M75 A;  1WGS A;  3G7Z A;  1V29 B;  4FYX B;  1S72 A;  1AVZ C;  2L3R A;  1YJW A;  3GP8 A;  1ZSZ B;  2K5I A;  3HRT A;  4RTT A;  3ULR B;  1RAC B;  2RQR A;  1MGQ A;  4C0Z A;  1OYX A;  3G6E T;  2GFU A;  2E6Z A;  2VVK A;  4PLL A;  3VV0 A;  2YXY A;  2RQW A;  2IG0 A;  2DTI A;  2OX7 A;  4M7D D;  2RH2 A;  4C8Q A;  3LW5 E;  1KD1 U;  3CCL A;  4E47 A;  2DD4 A;  4A54 A;  1NEG A;  3O8V A;  2MCN A;  1IZ6 A;  2PVG B;  1OU8 A;  2XID A;  2KXC A;  3OYD A;  1XNI A;  4KUI A;  2F69 A;  2EGE A;  1PNJ A;  2RD1 A;  2LCL A;  2ZPI B;  1M8M A;  2QAZ A;  2ZPF B;  2Y4Y A;  3URG A;  2CSI A;  3A8G B;  4L5G A;  3OYL A;  3OYG A;  3D7S B;  1RAE B;  3BFM A;  2VKN A;  2HKQ B;  4F7U F;  4ORZ A;  2DIL A;  3P8H A;  1K9M R;  3TRE A;  4F17 A;  4JRP A;  1VQ9 Q;  2RK2 A;  4XTW A;  1ZA2 B;  4XU3 A;  2XG8 D;  1RAI B;  3JSC A;  1N5Z A;  3ASK A;  4PJO F;  4M7A F;  2JN0 A;  5LL6 S;  4E7L A;  3JCM V;  3CXC S;  5FRM A;  2J6F A;  5GAN 8;  3CC2 Q;  3EG2 A;  1N8R R;  1PRL C;  1GRI A;  5CR2 A;  2EBP A;  4XTZ A;  3EFR A;  1PM3 A;  2AIR B;  4J5Y A;  2PVO B;  1LVK A;  4F7U A;  4C92 F;  4C8Q C;  2M1H A;  4M77 G;  2RMO A;  4DQ2 A;  5IH2 A;  1GFD A;  3QBY A;  3FJ5 A;  5GAN 6;  4M77 B;  5KYU A;  4RKU E;  2BZX A;  4PJO A;  3MO8 A;  1SF9 A;  4M7A A;  1PRM C;  1WNL A;  3CPW P;  2D8J A;  3CXC A;  3KUF A;  2WSE E;  2CP7 A;  4UC4 A;  5GMK e;  1M3B A;  1XQH A;  1B34 A;  2DM1 A;  3LH5 A;  3A1P A;  4A4E A;  3EH2 A;  4PLI A;  1M1K C;  1X6O A;  2O4X A;  2NLU A;  3H0I A;  2V8K A;  1VQ6 T;  2RA2 A;  2MAM A;  4C92 A;  4FM4 B;  1EZZ B;  2HZY A;  3RES A;  4C8Q D;  1PHT A;  2DAQ A;  3SWN C;  4Y91 A;  2O01 E;  1BI3 A;  1PC0 A;  1U06 A;  3R6N A;  3CCQ Q;  1SHF A;  3MEU A;  4MML A;  1FWZ A;  1MMG A;  3HSB A;  1MV3 A;  1ZSZ A;  4OMQ A;  4N4H A;  2GFA A;  1Q82 C;  1YFN A;  5CKB A;  1AHJ B;  2E3H A;  2MK5 A;  3EGU A;  4IUU A;  3OYB A;  4RTV A;  1ZUK A;  1KG1 A;  1W2B P;  1VQK Q;  3BE3 A;  4M78 G;  2LVM A;  1WX6 A;  2RM4 A;  2CP3 A;  2C0O A;  2JMA A;  1X2K A;  3DLM A;  2K7A A;  1QP3 A;  1X6G A;  4JZ3 A;  3PT9 A;  5J39 A;  2EGA A;  4DEX A;  4M78 B;  4WCI A;  2KT1 A;  2DJQ A;  2P0K A;  4BUG A;  1X75 C;  1RAA B;  2LCC A;  2NUP B;  2ESW A;  4FU6 A;  4PJO C;  4X34 A;  4JRQ A;  2ZZD A;  1U3O A;  1KC8 C;  4M7A C;  4Z8A A;  1WHM A;  3CQT A;  4GLK A;  4PFZ A;  3R6O A;  1QVG A;  1Q82 R;  2K3X A;  4Z88 A;  1XTD A;  2A3L A;  1TU0 B;  2KT8 A;  4JJC A;  3HFN A;  2FG0 A;  4FCY A;  3VS5 A;  2JZ2 A;  1SG5 A;  1OZ2 A;  3VRZ A;  3NHN A;  1IB8 A;  1K8A U;  3SEM A;  5HK3 A;  1ZQ1 A;  2QQB A;  4M77 F;  4C92 C;  1UHC A;  3RDV A;  4IKF A;  3RER A;  5GAN e;  4BE2 A;  4Y92 A;  3WVE B;  1A0N B;  2VGM A;  3HHT B;  3CCE Q;  1VQ8 T;  3BDL A;  2DZ9 A;  1D09 B;  1ZSZ C;  4HVW A;  3O5Z A;  5EC7 A;  4PJO D;  5IXF A;  4HCZ A;  3M59 A;  3M54 A;  4NL2 A;  1UGQ B;  1RI9 A;  4J6X A;  2P0P A;  2LJ0 A;  4HKE A;  3JCM Q;  4CRI A;  2YRV A;  5FWB A;  4JLI A;  3JCM e;  3L2V A;  1X2Q A;  2CZ0 B;  2ENM A;  2QK0 A;  4IUV A;  3M0Q A;  2E64 A;  2BIV A;  2VXE A;  5I21 A;  4M77 A;  3QYH B;  1FMW A;  4C92 D;  4HXJ A;  3MCA B;  5GMK i;  3JCM P;  1YIT T;  1TOV A;  3QG1 A;  1Z9Q A;  1M1F A;  1QVG P;  5GAM h;  3H0H A;  3OYN A;  3MEA A;  1KSW A;  3EHQ A;  1UEC A;  3FEO A;  2RQT A;  3JCM d;  1S1N A;  1UGV A;  5ECA A;  2QA4 Q;  2P4R A;  4ZTJ A;  2RQV A;  2R57 A;  3IQL A;  2V8I A;  2OTJ T;  3JCM f;  5FW9 A;  4M78 F;  3OW2 S;  2HL3 A;  3A98 A;  3V7C A;  1MMA A;  2E70 A;  1G2B A;  1VQ8 A;  3CME T;  2ZPE B;  2CP0 A;  2QI2 A;  3CMA A;  3JV3 A;  3FC3 A;  2DD5 A;  2ED0 A;  4J9F A;  3TCJ A;  3LX7 A;  4FYV B;  2V8J A;  2GF7 A;  3BW1 A;  4JZ4 A;  3CCR Q;  2D0Q B;  1WQW A;  4HVV A;  3U23 A;  2JMC A;  1PWT A;  1PG5 B;  3PVL A;  1G83 A;  4XTV A;  2O9V A;  1UJY A;  5GAO p;  4JRK A;  4KRT A;  2MWO A;  2LJ3 A;  2EKO A;  2K5L A;  2VUB A;  4QVZ A;  2HSE B;  4ZN1 A;  4M78 A;  1YIT A;  4J8O A;  2DXB A;  4JJD A;  2YUN A;  1UHF A;  2PNI A;  4M77 C;  5IN1 A;  2NUP A;  1O9S A;  2E65 A;  1Z9Z A;  1PKS A;  3S3O A;  2QTV A;  3JB9 D;  2DXT A;  4J9C A;  1NPP A;  4AFU C;  3EHR A;  3QDR B;  1N9R A;  4LDV A;  2YUO A;  5GAO m;  3I55 Q;  3CPF A;  3CCM T;  3E1S A;  3G71 Q;  4J9E A;  3MEV A;  4FT2 A;  3THK A;  1I5O B;  1KQ1 A;  3GIB A;  3RNJ A;  1YIJ T;  2YLC A;  1JB0 E;  1N6A A;  3L2W A;  2DJZ A;  1RAH B;  3HRU A;  1H8K A;  4X1V A;  4RG8 A;  8ATC B;  1BB9 A;  2COY A;  4A53 A;  2XHC A;  2E10 A;  2LNV A;  4QQG A;  1I8F A;  4ZGD B;  3X28 B;  4CC3 A;  1NG2 A;  2EQU A;  1WXT A;  1YI2 A;  2V1Q A;  4EMK B;  2COW A;  1VQL T;  1HK9 A;  4OMP A;  1TTH B;  1C6V X;  1BI2 A;  4M78 C;  2RHY A;  1OPL A;  1KQS P;  1U1S A;  1K73 R;  5KYW A;  3HL8 A;  3M9Q A;  2A0F B;  4PK4 A;  1Q81 R;  2PQW A;  1M90 R;  1RAG B;  4K11 A;  3OYY A;  1ZX6 A;  3CCM A;  2F2W A;  5IXB A;  2RK1 A;  1MMD A;  3JCM W;  2OTL T;  1O75 A;  3H8Z A;  2L5Q A;  2X4J A;  2W10 A;  3I9Q A;  3CCJ T;  1NE8 A;  1YIJ A;  1E7O A;  2KRM A;  2CT3 A;  2MMP A;  4AMC A;  5GJW B;  2J05 A;  3S6W A;  7AT1 B;  3J81 E;  2K79 A;  4Z89 A;  1TUC A;  3I35 A;  5GAN 3;  4M78 D;  4ATO A;  4IIM A;  2HEQ A;  1WXU A;  5J26 A;  3LWI A;  3V7R A;  1VQM Q;  3TVT A;  4YTL A;  2EYW A;  3QJ6 A;  5GAM j;  1JRI A;  1SHG A;  3QZ5 B;  4KGX B;  5CKE A;  4EPC A;  1YCY A;  1QVF S;  2HDA A;  4X9D A;  3QWY A;  1P92 A;  3PMI A;  3I56 A;  3JB9 H;  1VQ7 T;  2LRQ A;  1FMK A;  2XIC A;  4MMK A;  3SHW A;  1M1K U;  1RAB B;  4OB3 B;  2QEX Q;  4XK8 E;  4A4G A;  1IRE B;  2EKH A;  3REB B;  2FRY A;  5LJ5 e;  2LT4 A;  4A4K A;  5FU6 C;  2DXU A;  2KI7 A;  3SB2 A;  1H64 1;  2RJF A;  1VQ5 Q;  3ZEH A;  5DLQ E;  3MEW A;  1NBE B;  1GCQ C;  2OAU A;  3OS0 A;  2XMF A;  4OB0 B;  3CD6 Q;  2LTO A;  1SSH A;  3VUZ A;  3CCV Q;  2BE7 D;  2CP6 A;  3X25 B;  1E6G A;  4CC7 A;  3LGF A;  1I4K 1;  4OMO A;  2QGG A;  3X26 B;  1YP5 A;  1VQO T;  4X9C A;  5A0G A;  2KMT A;  2NWM A;  1WQ7 A;  2FZG B;  2JT4 A;  4DOV A;  1D1C A;  1TH7 A;  1UUE A;  5GAN 2;  4EMH A;  4J9I A;  3MP6 A;  4J6W A;  2L89 A;  4LDW A;  3LH0 A;  1VQ7 A;  1KC8 U;  2DYI A;  2LQ8 A;  2YUQ A;  1Q7Y R;  2LX7 A;  1QKX A;  2Z0W A;  5GAO l;  2VAS A;  3CC4 T;  1Y57 A;  1MNE A;  3HP9 A;  4HA8 A;  1SEM A;  2HL5 C;  2HNI A;  3BY7 A;  2COZ A;  2J6O A;  2BE9 B;  3X24 B;  4N0A A;  3EGX B;  2EPD A;  1KQ2 A;  4NOY A;  2CH4 W;  2DVJ A;  1ZBX A;  3OYC A;  1YJN Q;  4BDY A;  4L59 A;  3H9N A;  4JJN K;  2CS7 A;  3VYG A;  1K9M C;  3KFV A;  3OBY A;  2F1L A;  1VQO A;  2MWP A;  1ZLM A;  4RTW A;  1M9S A;  1B3Q A;  4QT7 A;  1YJ9 T;  2FO0 A;  1M2V B;  1VYV A;  1MUZ A;  1QCF A;  4OVA A;  4AT1 B;  2JTM A;  2RF0 A;  2MI6 A;  1U8R A;  1N8R C;  1ZHI A;  4FSS A;  2B86 A;  4EMK C;  2D1X A;  3Q1J A;  5FWC A;  3LGL A;  1S72 Q;  4XU1 A;  4MZM A;  1YJW Q;  2QG9 B;  5AYF A;  1WHH A;  3PIP A;  2KK4 A;  3CC4 A;  1ZBJ A;  3MP1 A;  4HT8 A;  1VQN T;  3UPU A;  2DA9 A;  3OBW A;  2ABL A;  1WHK A;  1LOJ A;  5A2Q E;  2RHZ A;  3CCL Q;  4F7U E;  2KRO A;  1IO6 A;  2CGH A;  2QQR A;  3G6E A;  3CC7 T;  1VUB A;  4M75 C;  2K5F A;  4ESR A;  4XU0 A;  5C6S A;  1QQJ A;  2M9U A;  2LT1 A;  2K57 A;  2MOX A;  2M16 A;  2GQV A;  1OOT A;  2DL4 A;  2GBQ A;  4N0A C;  1IGQ A;  4C5E A;  4BDZ A;  2LJ1 A;  3JCM c;  2DEQ A;  3C12 A;  4AG1 C;  1X6B A;  1LCK A;  3OMG A;  4OF1 A;  1I07 A;  5CQY A;  2SEM A;  1YJ9 A;  1QWE A;  4KT0 E;  1X69 A;  3OQ5 A;  3OYF A;  5CIU A;  2ZPB B;  5GAM g;  2HKN A;  3MP8 A;  5GAN 4;  1Q86 R;  2YLB A;  2OJ2 A;  2EQK A;  3OB9 A;  2X4X A;  1R0B G;  3V8J A;  1YBY A;  5GAO n;  1GXI E;  4KH1 B;  5KCO A;  1W70 A;  3PMT A;  4PKC C;  4VUB A;  4M75 D;  3NPF A;  4KBM B;  2C06 A;  2KXD A;  4RTX A;  4C5H A;  1BCM A;  2YDL A;  1VQN A;  2ROL A;  3MJX A;  3A8M B;  2DL7 A;  2KSS A;  3EH1 A;  2ZPH B;  4DA4 A;  1AEY A;  3RR6 A;  2H3E B;  2MF2 A;  3CC7 A;  4J83 A;  4F04 B;  4GY5 A;  1IHV A;  2J6K A;  2I2L A;  4MDW A;  4JPB W;  2VGN A;  2EWN A;  3VS7 A;  1GFC A;  1WXB A;  3CCS T;  4LDX A;  3RMQ A;  1KK7 A;  2A28 A;  3VS1 A;  3WVD B;  2KEA A;  1JJ2 S;  3S3M A;  3JRZ A;  3VYH B;  4BB7 A;  3EGX A;  2D9T A;  1SRL A;  2QGF B;  3OMC A;  4E2F B;  3LYI A;  1W1F A;  2QYZ A;  4JUV A;  1VQP T;  1G3Y A;  4ZN3 A;  2WSC E;  3UA6 A;  1OQK A;  5LJ3 h;  2FB7 A;  3QPH A;  5IT9 E;  2ECZ A;  3GNF B;  2KRN A;  4ZGE B;  2QA4 T;  4E7I A;  3G4S T;  1M2V A;  2RI5 A;  1Y7X A;  2DPP B;  2O2O A;  2ZAE A;  2ZGW A;  2WSF E;  3ZL7 C;  3CXC P;  1ZUU A;  2GNC A;  2KE9 A;  4LUE A;  4AFZ C;  4R0K A;  4LUD A;  1YHQ T;  1JJ2 A;  1WHL A;  2BKD N;  2HQH A;  3QSU A;  2X3W D;  3ME9 A;  1VQ6 A;  2BZ8 A;  1YN8 A;  2KAF A;  1M2O A;  4NL3 A;  1T0J A;  2AHJ B;  3UAT A;  3BDU A;  3PIO A;  5KE3 A;  6AT1 B;  3M4Y A;  3L2Z A;  5KYX B;  3CCS A;  2DL3 A;  3AT1 B;  2DK3 A;  2JTF A;  4E7K A;  3A8O B;  4XU2 A;  2DTO A;  2DE0 X;  2JS0 A;  3EFO B;  2YRC A;  1ABQ A;  4Q5W A;  2RQU A;  1CKA A;  2LQW A;  3AHU A;  2EYY A;  4IUP A;  1HYO A;  1XJW B;  1OZ3 A;  5IHI A;  3SFM A;  2CSQ A;  4BI4 A;  4XAX B;  2M51 A;  4N4G A;  4M7A D;  1VYU A;  2GGR A;  2IPO B;  1VQP A;  3UDC A;  1GBQ A;  2JOY A;  3QZ9 B;  2JNG A;  1MND A;  2X4Y A;  3G4S A;  4PJL A;  4RCC A;  1RUW A;  4IIO A;  3I5R A;  3MKD A;  4A63 B;  3M4G A;  1M5Q 1;  4MZP A;  1YHQ A;  3TSW A;  3I55 T;  2VXF A;  5KYW B;  4FYW B;  1BI0 A;  1UGP B;  4FSX A;  4OMM A;  3CCU T;  2E3I A;  4DOW A;  3UF4 A;  3VJP A;  3QDF A;  5GMK m;  2JVV A;  3EG1 A;  4QVC A;  1YCS B;  2VYT A;  1TSF A;  4FT4 A;  1BIA A;  1UGR B;  5DY9 A;  2E1H A;  2HQE A;  1OX8 A;  2KYM A;  2ZPG B;  2G6F X;  4PJM A;  1M4Z A;  4QKU A;  1J3T A;  2F2X A;  1KD1 R;  1D0Y A;  2CKK A;  4J9H A;  2GCX A;  4LXC A;  2DFU A;  1X01 A;  2DF6 A;  2A37 A;  4M78 E;  4OB2 B;  4EMG A;  1AZE A;  2AKK A;  3EGD B;  2RJD A;  2CZ1 B;  3M0S A;  2KGT A;  2DBM A;  1UTI A;  3M0P A;  3OYE A;  4AFS C;  1KQS S;  1KFZ A;  2JS2 A;  3S3N A;  5KYY B;  1H3Z A;  1OU9 A;  2HSP A;  3OW2 A;  3CCU A;  1BBZ A;  5M9O A;  2DL5 A;  2V1R A;  3HPW A;  2GQI A;  4C0G A;  5CVI A;  3UWN A;  1UEB A;  1VQ8 Q;  3JCM X;  2DRM A;  2OTJ A;  3CMA Q;  5HK0 A;  4KH0 B;  2D8H A;  5GAN g;  1D1B A;  2CP5 A;  3CME A;  2CYZ B;  3L2U A;  2ROT A;  1G3T A;  4II1 A;  3CBP A;  1X43 A;  3PE0 A;  4FYY B;  5EG2 A;  5KYX A;  4OMN A;  3A8L B;  3H0F A;  3PGG A;  2EFI A;  2DER A;  2NUZ A;  4BI8 B;  3RKY A;  2YUP A;  1VQM T;  1QP2 A;  3EFO A;  1K73 C;  4RMO A;  1Q81 C;  1M90 C;  4EIK A;  4M77 D;  5LJ3 j;  1RAF B;  1YIT Q;  2P84 A;  2CZ6 B;  5FRO A;  3V8K A;  2LCS A;  5DM7 R;  4QW2 A;  1K9M U;  4ELZ C;  2KY9 A;  1K4U S;  5GAN 7;  2KNB B;  3C4S A;  2IIM A;  1MHN A;  3QXE B;  3HTR A;  2R58 A;  2VV5 A;  2PVD B;  3A8H B;  1VIE A;  1BYM A;  1PSE A;  1N8R U;  3F70 A;  4J9B A;  1JU5 C;  3NFC A;  1ZUY A;  1K76 A;  3NMZ C;  1MMN A;  2OAW A;  3C95 A;  5GMK h;  1VQ4 T;  2KVQ G;  2RHU A;  2EYZ A;  2QQS A;  3HRS A;  2YHT A;  2KDS A;  2K2V A;  3A5Z B;  3OS1 A;  2ATC B;  3CCV T;  1D1A A;  1EIF A;  1WDX A;  1C0M A;  4D8D A;  2HCK A;  3CEY A;  3TEE A;  1PD1 A;  3HFO A;  3RKW A;  5HY6 A;  4M7D E;  3X20 B;  1V76 A;  1YI2 Q;  2L3Q A;  2DZC A;  3TSZ A;  1AWO A;  4E7Z A;  2CT4 A;  1QW1 A;  4C0F A;  4N4I A;  3EGD A;  4OB1 B;  2KR3 A;  1IHW A;  3CBM A;  5GJV B;  1VQL A;  1WJR A;  4XTX A;  3FJP A;  3VS0 A;  2EJ9 A;  1QCO A;  1NJI C;  1ZA1 B;  2HAX A;  3CCM Q;  4B9X A;  3VKI A;  5KYY A;  3FIF A;  4JRI A;  3INZ A;  4CC4 B;  4LDU A;  5GMK l;  1K8A R;  3L2Q A;  2DKG A;  2EQI A;  2EIF A;  1YIJ Q;  2YSQ A;  1OI1 A;  2OTL A;  1QWF A;  3FB9 A;  4E6R A;  4LNP A;  1I1J A;  3CCJ A;  4OML A;  2DET A;  4AFQ C;  1K0X A;  1BKB A;  3H41 A;  1H92 A;  2K4Y A;  3T9N A;  4BD3 A;  2AZV A;  1BCO A;  1NJI R;  4Z02 A;  4AG2 C;  3JB9 I;  3E9F A;  1I5L A;  2D6F A;  1JO8 A;  1OPK A;  1PD0 A;  1PKT A;  2J06 A;  4E7J A;  1YWO A;  1NYF A;  2MYS A;  4BE0 A;  1M8V A;  5D6X A;  5GAN h;  3VS3 A;  2EJG A;  4LE9 A;  1QVF A;  1Q82 U;  2QQA A;  2QAS A;  1AD5 A;  4NS5 A;  1Q7Y C;  3HKS A;  2ED1 A;  1V1C A;  3LWH A;  4KGV B;  2RO0 A;  4D6W A;  2LDM A;  3I56 Q;  5CKH A;  4OGE A;  1H3H A;  2Y4X A;  1D3B B;  2EGC A;  4DBQ A;  3H6Z A;  1LNX A;  2K2M A;  1FMV A;  4MDX A;  1VQ9 T;  4CI0 C;  2XKO C;  3JCM h;  3NTH A;  1SPK A;  4M75 E;  4HCK A;  3UA7 A;  4F16 A;  4JS4 A;  5GAN 5;  2DEU A;  1HD3 A;  2HBW A;  3CC2 T;  2X4W A;  3RMS A;  1SRM A;  1KHI A;  2R5A A;  2KRS A;  1WIE A;  4C8Q E;  5IHN A;  1UG1 A;  2CZ7 B;  5GAO q;  2LC4 A;  2PU9 B;  1QLY A;  3C0C A;  4PJJ A;  5I2M A;  4HCB A;  4F14 A;  2P4T A;  4CC2 A;  3FLG A;  3GBQ A;  5D7U A;  2EQM A;  1AWX A;  4P5N A;  2P0Q A;  5LJ3 g;  1UJ0 A;  1NYG A;  5GAM d;  5FU7 B;  1Y71 A;  4C5I A;  4DBH A;  2L0A A;  3JCM J;  1QVF P;  3PNW C;  2H8H A;  3V8L A;  1EFN A;  2BUD A;  2DIG A;  4PFO A;  1M3A A;  3CPW S;  5GAO r;  5GAM f;  2PZ1 A;  1VQ7 Q;  3RKX A;  1VQ9 A;  2O31 A;  2KYB A;  2FPF A;  1WLP B;  5GMK j;  3L2R A;  1M1G A;  3JB9 J;  1NM7 A;  3CC2 A;  1T0H A;  2LNH B;  3CCQ T;  4J7F A;  4XTU A;  2HMA A;  5LJ5 g;  2E5K A;  4B6M A;  1UE9 A;  4RTZ A;  2FPE A;  2SRC A;  4LD9 K;  1GBR A;  1ACM B;  2QTX A;  1WFW A;  4OMF B;  1ZSG A;  3CPW A;  1QVP A;  3OYK A;  2RJE A;  1HXD A;  1Q86 C;  3FDR A;  1VQO Q;  1VQK T;  2VWF A;  2CDT A;  1W2B S;  2EQJ A;  1RLQ C;  1MV0 B;  1QCN A;  3SWN A;  1WPY A;  2ZCF B;  4PJO E;  3JB9 G;  1RAD B;  4M7A E;  2O9S A;  2LX9 A;  2YT6 A;  4E7H A;  3GNG A;  3GOX A;  8AT1 B;  2A36 A;  1OUL A;  3M57 A;  2L8D A;  4KUL A;  1UB4 A;  2AKL A;  2RI3 A;  4M4Z A;  1M27 C;  2KBT A;  3CC4 Q;  1DJ7 B;  1RLP C;  2B8A A;  2A08 A;  1D3B A;  2CP2 A;  4C92 E;  4MZT A;  5IAY A;  2PTK A;  4PNO A;  3CCQ A;  4ZGJ B;  1W2B A;  2E12 A;  4R56 A;  2RN8 A;  4JDS A;  3M0T A;  2FZC B;  3G6E Q;  1I81 A;  2K3Y A;  3CCE T;  3ER0 A;  2CUB A;  2DX1 A;  3OYJ A;  2RHX A;  3OYA A;  2XI9 A;  3P8B B;  2JXB A;  4GLM A;  1VQK A;  2NUT A;  1OEB A;  1Q95 G;  1WYX A;  4ZNX A;  1UGS B;  1YWP A;  1NPR A;  2XU8 A;  1U1T A;  5GAN j;  1T3S A;  1K0S A;  1YJ9 Q;  2DYB A;  2E5Q A;  3M53 A;  2DNU A;  1HSQ A;  2DVE A;  1AWW A;  4C0D B;  4DEY A;  5I11 A;  3EAE A;  2RB6 A;  2JW4 A;  1SKU B;  2XK0 A;  3M56 A;  1E6H A;  1K73 U;  4DBR A; 
#chains in the Genus database with same CATH homology
 3GP8 A;  3S6W A;  2K5I A;  4M78 E;  3HRT A;  4OB2 B;  4J6Y A;  4EMG A;  2PUO B;  1Q81 U;  3RUX A;  1M90 U;  3J81 E;  1MGQ A;  4C0Z A;  1OYX A;  3JCM b;  3G6E T;  2GFU A;  3GF5 A;  5GAN 3;  2E6Z A;  2F5T X;  2EAY A;  4M78 D;  4PLL A;  3VV0 A;  3OA6 A;  3TU4 K;  4ATO A;  2RJD A;  3NTK A;  2CZ1 B;  1QVG S;  2IG0 A;  2DTI A;  4M7D D;  4IUT A;  3OYE A;  5J26 A;  3LWI A;  2RH2 A;  4C8Q A;  3LW5 E;  1KD1 U;  1KQS S;  4E47 A;  3CCL A;  2DD4 A;  4A54 A;  3O8V A;  1IZ6 A;  2Y90 A;  3S3N A;  2PVG B;  3V7R A;  2XID A;  2XDB A;  1Y96 B;  1H3Z A;  2IVW A;  3OW2 A;  3OYD A;  3CCU A;  4YTL A;  1XNI A;  5M9O A;  4KUI A;  5GAM j;  3QJ6 A;  1JRI A;  5CCA A;  3QZ5 B;  3HPW A;  2F69 A;  3CCE A;  5CKE A;  4EPC A;  2RD1 A;  5A0D A;  2LCL A;  4C0G A;  2ZPI B;  1YCY A;  2A7Y A;  5CVI A;  3UWN A;  1UEB A;  2ZPF B;  2Y4Y A;  3URG A;  3JB9 F;  1RL2 A;  1QVF S;  3JCM X;  3A8G B;  4X9D A;  4L5G A;  4WF2 A;  3OYL A;  2OTJ A;  4A4F A;  1P92 A;  3PMI A;  3OYG A;  3I56 A;  3CCR T;  3BFM A;  3JB9 H;  4IUR A;  5HK0 A;  1NZ9 A;  1VQ7 T;  5CKD A;  4F7U F;  2LRQ A;  5GAN g;  5FLX E;  2XIC A;  3P8H A;  4MMK A;  3CME A;  2CYZ B;  1M1K U;  3L2U A;  3TRE A;  1G3T A;  2FL7 A;  4II1 A;  3CBP A;  4OB3 B;  3NTI A;  4XK8 E;  4A4G A;  1IRE B;  5LJ5 h;  5LJ5 e;  2LT4 A;  5EG2 A;  4JRP A;  2RK2 A;  4V2S A;  4XTW A;  3A8L B;  3PGG A;  4A4K A;  2EFI A;  4XU3 A;  2XG8 D;  5FU6 C;  3JSC A;  4BI8 B;  2DXU A;  3RKY A;  3OSV A;  3SB2 A;  3ASK A;  1H64 1;  2H3J A;  2RJF A;  4PJO F;  1VQM T;  4M77 E;  3ZEH A;  3OY9 A;  5DLQ E;  4M7A F;  3MEW A;  1QP2 A;  2JN0 A;  1SSF A;  5LL6 S;  1K73 C;  4RMO A;  4E7L A;  3JCM V;  3CXC S;  5FRM A;  2OAU A;  3OS0 A;  3CBO A;  1Q81 C;  1M90 C;  5GAN 8;  4M77 D;  4OB0 B;  5I2S A;  2XDD A;  5LJ3 j;  5CR2 A;  5FU7 C;  2LTO A;  4XTZ A;  2QA4 A;  2CZ6 B;  5FRO A;  3V8K A;  3EFR A;  3VUZ A;  4QW2 A;  5DM7 R;  5DLO A;  3OYH A;  1K9M U;  4ELZ C;  3QYG B;  4J5Y A;  2KY9 A;  3X25 B;  5GAN 7;  3PTA A;  1KD1 C;  2PVO B;  3CMA T;  3C4S A;  3LGF A;  1I4K 1;  1MHN A;  5D6W A;  3X26 B;  3QXE B;  4F7U A;  4C92 F;  4JLG A;  4C8Q C;  2M1H A;  1NJI U;  3EFS A;  2R58 A;  1VQO T;  2VV5 A;  3M55 A;  4X9C A;  4M77 G;  5A0G A;  2PVD B;  4DQ2 A;  3G71 T;  2KMT A;  4O6J A;  3A8H B;  1WQ7 A;  2E41 A;  5HKC A;  1VIE A;  3QBY A;  4DOV A;  1BYM A;  3MHX A;  1PSE A;  5GAN 6;  1TH7 A;  4M77 B;  5GAN d;  4RKU E;  1N8R U;  3WXM B;  3F70 A;  4LDY A;  5GAN 2;  3NFC A;  4EMH A;  4PJO A;  3MO8 A;  3MP6 A;  3CCR A;  4C5G A;  4J6W A;  2X35 A;  4M7A A;  1WNL A;  2L89 A;  3GLX A;  3LH0 A;  4LDW A;  1VQ7 A;  3CXC A;  3C95 A;  3KUF A;  1KC8 U;  2WSE E;  5GAN f;  4UC4 A;  5GMK h;  1FX7 A;  5GMK e;  1VQ4 T;  3OYI A;  2LQ8 A;  1XQH A;  1B34 A;  4A4E A;  2KVQ G;  2RHU A;  2QQS A;  3HRS A;  2YHT A;  5GAO l;  2KDS A;  2K2V A;  4PLI A;  3A5Z B;  3OS1 A;  1M1K C;  5C0M A;  1X6O A;  1LJO A;  3CC4 T;  3HP9 A;  1W4S A;  3CCV T;  2O4X A;  1EIF A;  2NLU A;  4HA8 A;  2LQK A;  2V8K A;  1VQ6 T;  2RA2 A;  2F5K A;  2MAM A;  4C92 A;  2HNI A;  4FM4 B;  3BY7 A;  5FU6 B;  3RES A;  4C8Q D;  3SWN C;  2DAQ A;  4Y91 A;  3CEY A;  3TEE A;  2RI2 A;  3UT1 A;  3HFO A;  3RKW A;  4BI3 A;  2O01 E;  5HY6 A;  1BI3 A;  3X24 B;  4N0A A;  3JB9 D;  1G3S A;  3SD4 A;  1KQ2 A;  4NOY A;  3X20 B;  3MEU A;  4M7D E;  4MML A;  1FWZ A;  1ZBX A;  2DZC A;  3OYC A;  3HSB A;  4BDY A;  4L59 A;  4N4H A;  1Q7Y U;  4JJN K;  2CS7 A;  1QW1 A;  2GFA A;  4O5V A;  3VYG A;  4C0F A;  1Q82 C;  1K9M C;  3OBY A;  4N4I A;  4QQD A;  2WAC A;  4OB1 B;  5CKB A;  1VQO A;  1AHJ B;  2MWP A;  3CBM A;  5CQX A;  3I55 A;  1VQL A;  1WJR A;  2QDY B;  3FJP A;  4XTX A;  3QO3 A;  4IUU A;  3G71 A;  3OYB A;  2EJ9 A;  1M9S A;  1KG1 A;  1NJI C;  1YJ9 T;  2HAX A;  4M78 G;  2RJC A;  2LVM A;  2RM4 A;  4B9X A;  3VKI A;  3DLM A;  3PT9 A;  1QP3 A;  4M7D G;  1Y96 A;  3FIF A;  4OVA A;  2RHI A;  4TVR A;  5J39 A;  2JTM A;  4JRI A;  3INZ A;  4M78 B;  4LDU A;  4B9W A;  5GMK l;  2MI6 A;  1U8R A;  5CO7 A;  1N8R C;  1ZHI A;  2P0K A;  4BUG A;  2DKG A;  1X75 C;  3L2Q A;  1PSF A;  4M7D B;  3E9G A;  2LCC A;  4FU6 A;  2EIF A;  4EMK C;  3J80 E;  3Q1J A;  1OI1 A;  2XDP A;  3LGL A;  4PJO C;  1VIF A;  4X34 A;  5KCH A;  4XU1 A;  4MZM A;  4JRQ A;  2ZZD A;  1KC8 C;  2OTL A;  1YI2 T;  4M7A C;  5AYF A;  3FB9 A;  4GLK A;  3R6O A;  1QVG A;  3PIP A;  2K3X A;  2KK4 A;  3CC4 A;  1XTD A;  3CCJ A;  3MP1 A;  2A3L A;  3QUI A;  4HT8 A;  1KQS A;  3HFN A;  1BKB A;  3JAM E;  3OS2 A;  1VQN T;  3UPU A;  2K4Y A;  3T9N A;  4BD3 A;  3OBW A;  3QHS A;  2JZ2 A;  3P8D A;  4BE1 A;  4Z02 A;  1LOJ A;  1OZ2 A;  1G3W A;  4BY6 B;  3JB9 I;  1JBM A;  2RHZ A;  4EDU A;  4F7U E;  1RI0 A;  5A2Q E;  3E9F A;  3KXT A;  1I5L A;  2CGH A;  2D6F A;  2QQR A;  1K8A U;  4L6V 5;  3G6E A;  3CC7 T;  1VUB A;  2PUK B;  3J7A F;  5HK3 A;  1ZQ1 A;  2QQB A;  4M75 C;  4M77 F;  4C92 C;  4E7J A;  2K5F A;  1WJQ A;  4XU0 A;  5C6S A;  2M9U A;  2LT1 A;  2K57 A;  4BE0 A;  4JS5 A;  2M16 A;  2GQV A;  3JCM g;  4IKF A;  5D6X A;  4C0D C;  5GAN h;  3RER A;  1M8V A;  5GAN e;  4BE2 A;  4N0A C;  2EJG A;  3WVE B;  5FRN A;  4C5E A;  4BDZ A;  1QVF A;  1Q82 U;  2VGM A;  3HHT B;  2QQA A;  3JCM c;  2DEQ A;  1VQ8 T;  4LD6 A;  3C12 A;  4NS5 A;  3BDL A;  2DZ9 A;  3VU3 C;  3CPW A;  1Q7Y C;  3HKS A;  4A4H A;  3OMG A;  4OF1 A;  5CQY A;  2DTH A;  3LWH A;  4PJO D;  1YJ9 A;  3DB3 A;  3QJY A;  4HCZ A;  2RO0 A;  3M59 A;  4KT0 E;  1G5V A;  4D6W A;  1BIB A;  3OQ5 A;  2LDM A;  3M54 A;  4RG2 A;  3OYF A;  5CKH A;  4OGE A;  5CIU A;  4NL2 A;  2ZPB B;  1UGQ B;  1D3B B;  2Y4X A;  5GAM g;  4J6X A;  1FXX A;  2P0P A;  3MP8 A;  3QKJ A;  3H6Z A;  4HKE A;  3JCM Q;  1LNX A;  3N5B B;  2QEX T;  5GAN 4;  2YLB A;  2QXF A;  4CRI A;  2YRV A;  1VQ9 T;  4MDX A;  4CI0 C;  2XKO C;  3JCM h;  2EQK A;  3NTH A;  4JLI A;  3JCM e;  4BAC A;  3OB9 A;  2X4X A;  3L2V A;  4OP0 A;  2QQ9 A;  4M75 E;  3V8J A;  1YBY A;  5GAO n;  2CZ0 B;  4JS4 A;  4IUV A;  1VQ5 T;  1GXI E;  5KCO A;  3DLL A;  2E64 A;  5GAN 5;  2BIV A;  2VXE A;  5I21 A;  3L1A A;  2EYQ A;  3PMT A;  4M77 A;  4PKC C;  4VUB A;  3QYH B;  4M75 D;  2DO3 A;  4C92 D;  4KBM B;  2C06 A;  3MCA B;  3CC2 T;  4C5H A;  5GMK i;  2X4W A;  3RMS A;  5LJ5 j;  3CD6 T;  3JCM P;  2R5A A;  1KHI A;  1YIT T;  3QG1 A;  1M1F A;  1VQN A;  4J7I A;  5GAM h;  1KHC A;  3OYN A;  3MEA A;  3A8M B;  1N27 A;  4C8Q E;  3FEO A;  2KSS A;  2ZPH B;  3JCM d;  4DA4 A;  1VQM A;  2CZ7 B;  5GAO q;  2MF2 A;  2LC4 A;  2PU9 B;  1Q86 U;  5I2M A;  3CC7 A;  4FIB A;  4HCB A;  4ZTJ A;  4J83 A;  2R57 A;  4GY5 A;  4M75 G;  2V8I A;  2OTJ T;  2P4T A;  3I56 T;  2I2L A;  1K8A C;  1WJS A;  3FLG A;  4MDW A;  2VGN A;  3JCM f;  2EQM A;  2EWN A;  3KBG A;  4M78 F;  3OW2 S;  4P5N A;  2P0Q A;  4M75 B;  2M0O A;  3CCS T;  4LDX A;  3RMQ A;  3V7C A;  5CK9 A;  5LJ3 g;  2E70 A;  3WVD B;  1VQ8 A;  4M7D F;  3CME T;  2ZPE B;  4ZTF A;  3S3M A;  1JJ2 S;  3JRZ A;  5FU7 B;  3VYH B;  5GAM d;  1Y71 A;  2DXC A;  2QI2 A;  4C5I A;  4BB7 A;  3CMA A;  3JCM J;  2D9T A;  3PNW C;  3FC3 A;  2FVU A;  2DD5 A;  3TCJ A;  3V8L A;  3LX7 A;  2BUD A;  4C8Q G;  2DIG A;  2V8J A;  2GF7 A;  3CPW S;  2E6N A;  3BW1 A;  5GAO r;  2D0Q B;  5GAM f;  3OMC A;  3VUB A;  2DIQ A;  1WQW A;  3LYI A;  4C8Q B;  3RKX A;  2QEX A;  4HCC A;  2HBP A;  4JUV A;  1VQ9 A;  4XTV A;  1VQP T;  3DKM A;  1G3Y A;  4ZN3 A;  4QVD A;  2WSC E;  2EJF A;  5GAO p;  5LJ3 h;  3MET A;  4JRK A;  2FB7 A;  5LJ3 e;  2MWO A;  3QPH A;  5IT9 E;  1VQ5 A;  2EKO A;  2HQX A;  3GNF B;  4ZGE B;  2QA4 T;  4E7I A;  2K5L A;  3G4S T;  2VUB A;  2RI5 A;  3PFS A;  1Y7X A;  5GMK j;  3L2R A;  2DPP B;  4QVZ A;  1M1G A;  2FYK A;  2ZGW A;  2WSF E;  4OGC A;  4RCB A;  3JB9 J;  2G3R A;  4ZN1 A;  1VQ4 A;  3CC2 A;  4M78 A;  3CD6 A;  5L8R E;  4XQ3 A;  3CCQ T;  4J7F A;  1YIT A;  4J8O A;  2DXB A;  4XTU A;  2R5M A;  3SDZ A;  4M7D A;  1YHQ T;  1JJ2 A;  5LJ5 g;  4M77 C;  5IN1 A;  1YJN T;  2BKD N;  3CCV A;  3QSU A;  1O9S A;  4LD9 K;  3ME9 A;  2VC8 A;  1VQ6 A;  4Y28 E;  2E65 A;  2QTX A;  4OMF B;  1N9S A;  3S3O A;  5LJ3 d;  3LLR A;  2KAF A;  2KQW A;  1QVP A;  2DXT A;  4ME7 A;  5KH6 A;  4NL3 A;  2RJE A;  1HXD A;  3OYK A;  1NPP A;  1XOV A;  2AHJ B;  4R55 A;  1Q86 C;  3BDU A;  3PIO A;  5KE3 A;  3QDR B;  1N9R A;  4LDV A;  3FDR A;  3M4Y A;  3L2Z A;  3SWN B;  3OSS C;  1R8O B;  1VQK T;  3CCS A;  3RIR A;  5LJ3 f;  5GAO m;  3CPF A;  1W2B S;  3CCM T;  2EQJ A;  3E1S A;  2DK3 A;  5CAI A;  2XD0 A;  2JTF A;  3MEV A;  4E7K A;  3A8O B;  4XU2 A;  4FT2 A;  2DTO A;  3SWN A;  1WPY A;  4PL6 A;  5CKF A;  3ZFJ A;  2ZCF B;  4PJO E;  3JB9 G;  4Q5W A;  3OS5 A;  1KQ1 A;  3GIB A;  3AHU A;  4M7A E;  4IUP A;  2LX9 A;  2HD0 A;  4XTY A;  4E7H A;  1YIJ T;  1OZ3 A;  3GNG A;  3SFM A;  3GOX A;  4BI4 A;  2YLC A;  1JB0 E;  1N6A A;  4XAX B;  5KE2 A;  3L2W A;  1S72 T;  3V7S A;  3C94 A;  2DJZ A;  4N4G A;  1YJW T;  4M7A D;  3M58 A;  4F7U G;  3HRU A;  3M57 A;  4FL6 A;  1VQP A;  2L8D A;  3UDC A;  4RG8 A;  4KUL A;  1UB4 A;  2JOY A;  2RI3 A;  4A53 A;  5A0L A;  5J3B A;  2XHC A;  2E10 A;  2LNV A;  3ZBD A;  4QQG A;  1I8F A;  4F7U B;  3X28 B;  4ZGD B;  3QZ9 B;  2JNG A;  2X4Y A;  3G4S A;  1DJ7 B;  5LJ5 d;  2B8A A;  4RCC A;  3OYM A;  1D3B A;  4C92 E;  4IUQ A;  1BI1 A;  4MZT A;  3CCL T;  3L42 A;  4PJO G;  3QII A;  5IAY A;  3M4G A;  2EQU A;  1M5Q 1;  4PNO A;  3CCQ A;  4M75 F;  2FHD A;  2JUF A;  4MZP A;  1YI2 A;  4ZGJ B;  4M7A G;  1W2B A;  2E12 A;  4EMK B;  4R56 A;  1YHQ A;  3I55 T;  2VXF A;  5LJ5 f;  1YJN A;  1VQL T;  4PJO B;  1BI0 A;  1HK9 A;  1UGP B;  4JDS A;  4FSX A;  3CCU T;  4M7A B;  3E19 A;  4DOW A;  1I81 A;  3VJP A;  1BI2 A;  4M78 C;  5GMK m;  2RHY A;  5GAM e;  2K3Y A;  3CCE T;  2JVV A;  4EMK A;  4QVC A;  1Y07 A;  1U1S A;  2VYT A;  3ER0 A;  4M7D C;  3HL8 A;  3M9Q A;  4FT4 A;  1B34 B;  1BIA A;  1UGR B;  2PQW A;  3OYJ A;  2RHX A;  5DY9 A;  4C8Q F;  2E1H A;  3OYA A;  2HQE A;  2XI9 A;  3P8B B;  2ZPG B;  3OYY A;  1VQK A;  4C92 G;  1M4Z A;  3CCM A;  1UGS B;  2O4X B;  1NPR A;  2XU8 A;  4ELY C;  1U1T A;  5GAN j;  3M5A A;  5D6Y A;  2RK1 A;  3JCM W;  2OTL T;  4KUD K;  2E5Q A;  4C92 B;  3M53 A;  4QQ6 A;  3GPL A;  1O75 A;  3H8Z A;  2DVE A;  2L5Q A;  2X4J A;  3DB4 A;  3CCJ T;  4C0D B;  1NE8 A;  3EAE A;  2RB6 A;  3FRN A;  1YIJ A;  4BY6 C;  2CKK A;  2GCX A;  1WGS A;  2MMP A;  2XK0 A;  3G7Z A;  3M56 A;  4M75 A;  1V29 B;  1S72 A;  4HT9 A;  1X01 A;  2L3R A;  1YJW A;  1K73 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...