4PLLA

Structure of the chromodaomain of mrg2 in complex with h3k36me3
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
HFEEGERVLAKHSDCFYEAKVLKVEFKDNEWKYFVHYIGWNKSWDEWIRLDCLLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords At1g02740
publication title Regulation of arabidopsis flowering by the histone mark readers MRG1/2 via interaction with CONSTANS to modulate FT expression.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription
total genus 12
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pllA00
4BD3A 3FDRA 3NTHA 3MP6A 1OZ2A 2HQXA 2B8AA 3CEYA 4IUUA 3L2QA 4E7HA 2L8DA 2G3RA 5C6SA 3OYNA 1XNIA 1SSFA 3OMCA 4X34A 5J26A 2VYTA 3FC3A 2DIQA 2LCCA 4QW2A 2FHDA 4A4FA 3S3MA 2L89A 2PQWA 3L42A 4IUQA 2EFIA 4ZTJA 3P8DA 3QBYA 2JZ2A 3ASKA 4BDYA 2M16A 2LTOA 3PMIA 4QQGA 5IN1A 3OY9A 3DB3A 4HCZA 3OMGA 3OYCA 4NS5A 2HQEA 2X4XA 1RI0A 5KE3A 3S6WA 3OQ5A 3LGFA 4B9WA 5FRMA 2R5AA 3M9QA 2E5QA 3GOXA 2GF7A 3H6ZA 2L3RA 2LDMA 2X4WA 3OYHA 3OYEA 1WJRA 2P0KA 3BDLA 5KH6A 2EQKA 3QIIA 2K3XA 2CKKA 3S3OA 4A4EA 3F70A 5KE2A 4C5IA 3L2UA 3FEOA 4LD6A 4EDUA 2XDPA 4FU6A 3E9GA 2BUDA 2F5KA 3Q1JA 3MP1A 3QKJA 4IKFA 5D6WA 5FRNA 4PLLA 1OZ3A 2RHXA 3NTIA 4ZTFA 3EAEA 4FL6A 2QQSA 4BE2A 2RHYA 2RI5A 2RI3A 3LLRA 3UWNA 4Z02A 3DLMA 3OS2A 4II1A 3OYKA 2E6NA 2X4YA 3SD4A 2QQRA 4BE1A 3OYFA 2BIVA 3OA6A 3META 4E7KA 4C5HA 3S3NA 4PL6A 3MO8A 1OI1A 3E9FA 3LX7A 2WACA 3ME9A 2EQUA 4N4GA 3OYJA 1KHCA 2GFUA 3QJ6A 1OYXA 2RJEA 3UT1A 5KCOA 3KUFA 4C5GA 1N27A 3C4SA 4QQDA 2M1HA 1MHNA 2RJDA 3LYIA 3ZEHA 4GY5A 3L2WA 2EKOA 4OVAA 1WGSA 5C0MA 3H8ZA 3MP8A 2NLUA 2R58A 4IURA 3LH0A 3OYMA 3PMTA 4BDZA 4IUVA 3OYLA 2LVMA 3MEAA 3L2RA 3LGLA 3MEWA 3L2VA 2XK0A 2R5MA 2RJFA 4E7JA 3OYGA 4CRIA 2MWPA 1H3ZA 2EQMA 5D6YA 4N4HA 5IAYA 5CIUA 2K3YA 1G5VA 4BE0A 3OS1A 4RG2A 4L59A 3MEVA 3OS0A 3OYAA 2M0OA 2RHIA 4A4GA 2D9TA 2DAQA 3MEUA 4B9XA 4QQ6A 1WJSA 4PLIA 4IUTA 5KCHA 2RJCA 4BACA 3DB4A 2LRQA 5J39A 2RO0A 2R57A 2IG0A 3OB9A 4Q5WA 2O4XB 2RHUA 3PFSA 3FLGA 3OYIA 2BKDN 3NTKA 4N4IA 3PNWC 2MWOA 4A4HA 4C5EA 4UC4A 2O4XA 5FROA 2RI2A 2GFAA 4IUPA 3O8VA 2JTFA 4E7LA 2YRVA 2EQJA 4E7IA 1WJQA 2DIGA 3P8HA 3OYBA 2RHZA 5D6XA 3OYDA 4QVZA 2X35A 5M9OA
chains in the Genus database with same CATH superfamily
2COWA 5GAOr 2O31A 2CZ6B 5C6SA 2L0AA 4QW2A 5I11A 2PQWA 2NWMA 2EWNA 4HCCA 1IGQA 1RAHB 4BDYA 4HVUA 2M16A 1K73U 1RADB 5J3BA 3QG1A 2D0NA 3V8KA 3EFOA 1G8XA 3OY9A 1VQOT 3H0HA 4NS5A 4A54A 1KFZA 3S6WA 2ROLA 1UDLA 3HRUA 3ULRB 4F7UB 2QGGA 3I55Q 2FPFA 1VQLT 3SEMA 2ZGWA 5KE2A 4OMQA 4EMKB 2F5KA 3TCJA 5GMKj 1M1GA 3M0PA 3NFCA 4C92D 1BI3A 1BBZA 1YI2Q 4M7AD 1K0XA 4BE2A 1PSFA 1QQJA 4XAXB 3RMQA 1AWJA 4M7DB 4A4KA 2E6NA 2M51A 2QQRA 4E7SA 3META 4M75F 1UGPB 3CCEQ 2OTJA 1FMKA 5LJ3g 1UG1A 3A8HB 1ABOA 1PCXA 4AFSC 1T0HA 3SWNA 2RJEA 4C5GA 4Y28E 2CZ0B 1NLOC 3C4SA 4QQDA 1S72Q 5IT9E 3CMAA 3JCMg 4FYWB 3CCRQ 1WQWA 1YITA 3OYMA 2DK3A 2AZSA 2SEMA 2QQ9A 4LDWA 3LGLA 3G71A 2YT6A 2HL5C 1IGUA 2XICA 3SDZA 2F2XA 4ORZA 5I21A 3GPLA 2R57A 3A1PA 2FPEA 1ZBXA 3PE0A 5DLQE 1WHJA 1G3SA 2PVGB 4V2SA 3OYBA 3E1SA 3EG9A 8ATCB 2X35A 1RLQC 3FJ5A 3MP6A 2FVUA 3HFNA 4OGEA 1SF9A 4PK4A 2D6FA 1WZOA 1D0XA 3CMET 1VOMA 3E19A 2KSSA 4ZTJA 4AMCA 3BW1A 3CPFA 3GNFB 2OTLQ 2EW3A 5GAN5 1YHQT 1Q7YU 1EIFA 3X28B 1NEBA 4LN2A 1HYOA 1MGQA 2QASA 2E64A 4JDSA 4M7DC 1WIEA 2VASA 4PFOA 3F70A 3J7AF 3MCAB 4EDUA 2FRWA 4LDUA 1V1CA 1D3BB 4C92F 5GANe 2IIMA 1PD0A 4HA8A 3KXTA 3KFVA 5KYYA 2KT1A 4FYXB 2DE0X 3OYKA 3VV0A 2DJQA 3EH1A 4D6WA 5CR2A 4KT0E 5GAOp 3EG0A 2RNAA 1KIKA 5IXBA 2GTOA 2V8KA 2JVVA 4XK8E 1VQ5T 2JN0A 2YWWA 1KD1R 2HKQB 3FB9A 4M75A 4C0DC 2NLUA 5GANd 3I55A 4IURA 1BI2A 3PMTA 4F7UG 1I5OB 3MEAA 1M27C 1W70A 2DO3A 2EPDA 3EG3A 4FT2A 1VYVA 2ZPHB 3I56T 2EYWA 3C0CA 4N4HA 4BY6C 2XG8D 4IIOA 3OS0A 2XU8A 3UF4A 1JRIA 5DY9A 2JNGA 2DD5A 1M9SA 1PHTA 4KUDK 1WPYA 2DTHA 2DM1A 2KT8A 4EMGA 4BI3A 1TOVA 1MMDA 1BI1A 4E7HA 2CYZB 2QYZA 3CCSQ 1VQ4Q 1NPPA 4OF1A 1FXXA 4C0FA 1SG5A 1D1AA 1VIEA 3CC2Q 3RNJA 3OYCA 3CPWA 2HQEA 4XU2A 3H0FA 1VQ6A 5CAIA 2HKNA 1Q86R 2EYZA 3BDLA 3G4ST 2YDLA 5GAN8 2KVQG 2DL4A 3M4YA 3EGXA 1KD1C 3HFOA 1YIJQ 1PNJA 1OZ3A 3LWHA 4Y92A 3EAEA 1PG5B 1YJWT 4MZPA 2PZ1A 3OA6A 3PIPA 3VYHB 1OOTA 2CZ1B 4PL6A 2OTLA 3HRSA 3C94A 3OYJA 2NUPA 3UT1A 3OW2A 4PJOG 3CPWS 5GANg 1VQNQ 3CXCP 2EGEA 4YTLA 1SRLA 1MV3A 2QEXQ 4ME7A 2YLBA 3BE3A 1LPLA 2A08A 4JS5A 3MPUB 2K5IA 2LVMA 4JJNK 2LQ8A 4XTUA 3CBOA 4JRIA 3PGGA 1AT1B 3CC7Q 1Y96B 4XTZA 4KRTA 2DEUA 3RKYA 4A4GA 2VB6A 2E5KA 4Z88A 2P84A 1XQHA 4FYYB 3I35A 4C8QB 3OYIA 3EG1A 4EPCA 2DTIA 1VQOA 2C06A 2YXYA 2K9GA 1BI0A 1WJQA 1Q86C 2OX7A 1QP2A 5HK3A 1JU5C 3QDRB 2VWFA 4M77B 4RMOA 3CEYA 1VQLA 3L2QA 1KD1U 2OTJT 1K1ZA 2DIQA 1WI7A 2LCCA 3CCMT 2EFIA 3QBYA 4O5VA 4M7DD 2ECZA 4L5GA 1ZA2B 2ENMA 5IXFA 1YITT 3OQ5A 1TUGB 3JB9I 3LH5A 5GAMh 3QHSA 3FJPA 2PVDB 4DBRA 1M3CA 2FRYA 2JTMA 2CKKA 1G3YA 2LCSA 3FEOA 2KR3A 3Q1JA 3M0UA 3D7SB 3JV3A 2JJ9A 3OSVA 4J83A 2DBMA 2GTJA 3REBB 3UWNA 1CKBA 1GL5A 2K2MA 1V76A 2F69A 1Y7XA 1UJYA 4F17A 3CCSA 4RKUE 3CCQQ 1VQ4A 3I5RA 3AHUA 2CP2A 1B34B 3SHWA 1C0MA 3CC2A 1ZUKA 3CQTA 1HXDA 4J7FA 2A36A 3VS2A 1WA7A 1GBRA 3X25B 2KBTA 3L2WA 2XHCA 4JJDA 3A5ZB 4F16A 3OYLA 1Q86U 3CD6Q 2IPOB 3MEWA 1PKSA 4KH0B 4TVRA 3VU3C 4CRIA 1W6XA 4IIMA 1B3QA 1YNZA 4C92C 2KI7A 4BE0A 4R56A 4M7AC 4ANJA 4ELYC 4M77C 2CP3A 2RB6A 2DXBA 3FLGA 1YHQA 1AWOA 4C5EA 2AZVA 4LUDA 4M78C 2Y4YA 2D1XA 1ZSZB 2WSCE 1C1AA 1DJ7B 2K5FA 3A8LB 4GLKA 3M58A 1AZGB 3CCUQ 4MZMA 3HHTB 4M7DF 2DZ9A 4J9DA 2YRCA 3CC7A 3OMGA 4PJJA 3I55T 4KBMB 1Y71A 2GF7A 4GBQA 4JJBA 3JSCA 2YSQA 2KDSA 1WLPB 3VS0A 4DOVA 3G6EQ 2DEQA 4ZN3A 4N0AC 1YI2T 1OV3A 2Z0WA 2A28A 4C8QG 5KYXA 1VIFA 4CC2A 3MP1A 3JCMW 1ZUUA 3RKWA 3EG2A 1AHJB 2RI5A 1UJ0A 2DF6A 3CCET 2COYA 3I56A 3JCMP 1FWZA 4RTUA 4J5YA 2KK4A 1LVKA 1AEYA 3BY7A 1S72T 4XTYA 1WHGA 4J8OA 2E70A 2GFUA 3CCRT 2P4RA 4AFUC 1W4SA 5IH2A 4Z8AA 3RMSA 4D8KA 3JCMb 1WGSA 5C0MA 2LMJA 3ZFJA 1K73C 4IUVA 2BZXA 1M4ZA 5KYUA 3CXCA 1G2BA 2DJZA 1IB8A 2YUQA 1SPKA 3X24B 4JUVA 2E41A 5IHKA 3QYHB 3M5AA 3OS1A 2ABLA 2GQIA 5GJWB 2VVKA 4QQ6A 1X6OA 5GANf 1I4K1 1OX8A 5J39A 5KYWB 4A63B 2RHUA 2BKDN 1NG2A 2HL3A 2RI2A 4DQ2A 1QVGS 1R8OB 4C0ZA 2K7AA 2FB7A 2CS7A 2ED1A 2H3EB 3FDRA 3G4SA 1NZ9A 1OZ2A 3HP9A 1FYNA 2VUBA 2JS0A 2HNIA 2ZAEA 2OTLT 4K11A 4A4FA 3L42A 2DETA 4FM4B 4MDWA 1RACB 1YJWA 2AKLA 1JXMA 4M75E 1GCQC 4J7IA 4LE9A 4RTXA 3LGFA 4M7DA 2MYSA 2P0PA 2L3RA 4L6V5 5HCKA 4ELZC 3PT9A 4R0KA 1VQPQ 4QKUA 5CCAA 3VS4A 5GAMe 1NM7A 4C5IA 2LNVA 1LOJA 2O9VA 3NGPA 1AOJA 2G6FX 1NJIR 2OAUA 3CPWP 1E7OA 2VKNA 4B6MA 3DKMA 4Z02A 4OMFB 4O6JA 2X3XD 2CREA 2XI9A 3R6NA 2JW4A 5CKFA 3JCMX 2LX9A 2YUOA 2OI3A 2EGAA 4PJNA 1MHNA 2RJDA 2P0QA 3RESA 4BDZA 3VYGA 3G6EA 1Q7YC 1M2VB 1PKTA 4M77D 3M56A 4E7JA 1KK7A 2RK2A 3OW2P 1IZ6A 2GNCA 5LJ5j 1U1SA 1RAIB 1SHGA 4M78D 4L59A 4CC3A 2D9TA 4B9XA 3CCMA 4PLIA 5KCHA 2A0FB 1O9SA 2DERA 3NTKA 5EG2A 5LJ5h 3EHQA 1I5LA 4IUPA 3OYDA 1T0JA 3P8HA 2D8HA 4BI4A 2MF2A 4C92E 3FRNA 1YN8A 3CCST 1VQ4T 1RAGB 4M7AE 2CDTA 4IUUA 1W1FA 1MNEA 1NJIC 1I0CA 3CC2T 2RQVA 4X9DA 1NYFA 4IUQA 1PD1A 2JZ2A 3EFOB 3ASKA 2XDBA 2D0QB 3PMIA 2F2VA 4M78E 2ESWA 3X20B 4PNOA 2FG0A 2W10A 4B9WA 4JRQA 3A8OB 2J6OA 5LJ5f 3H6ZA 1LCKA 3OYEA 3VKIA 3HKSA 4WTOB 3QIIA 1YIJT 3GBQA 4KGZB 4A4EA 1AZEA 1QVFS 4OB3B 1EFNA 4XTWA 3V8LA 1KC8R 1IRXA 1YJ9Q 1ZSGA 1T3SA 2AHJB 2GBQA 1X6GA 4PJOB 2NUTA 2RI3A 4EMKC 2RMOA 3TSWA 4RG8A 3MHXA 2CSIA 4FYVB 3SWNB 3LX7A 1NLPC 1VQNT 2EQUA 4N4GA 4XU3A 2QEXT 5KCOA 1Z9QA 4NL2A 2DNUA 2MMPA 4M7AF 5FU6B 3VS5A 1VQPA 4KGXB 3CC7T 2R58A 2YHTA 3L1AA 4M77F 2F2WA 2VGMA 2HBPA 1BIAA 4FW2A 2COZA 2OAWA 5LL6S 4M78F 1QCNA 5A0DA 1TXQA 1NJIU 3V7SA 4CI0C 3QUIA 4AG2C 2RJCA 2F5TX 4DBFA 2QA4Q 1RI9A 2E3IA 2IG0A 2JMAA 3RKXA 5HK0A 2MWOA 2JUFA 5FROA 1MMNA 2GFAA 4E6RA 2J06A 2L3SA 3EG9B 4E7LA 2K57A 2RHZA 2MCNA 3OS5A 2J6FA 1ZA1B 2LC4A 2HD0A 1VQKQ 1YI2A 1B7TA 2RK1A 4PKCC 3M0RA 3QZ9B 3VS7A 1M30A 4HXJA 1RUWA 4JPBW 2LCLA 3HRTA 3TSZA 4DEXA 1U3OA 2K79A 3CCEA 2ATCB 1M1FA 2EAYA 5KE3A 2DPPB 2DRMA 3A98A 4JS4A 3NHNA 2ZPIB 4PJOC 2DD4A 1WJRA 1S72A 1TUDA 2V1RA 3CCRA 4ZGDB 2DA9A 4LD6A 1YCYA 2GGRA 4EIKA 5GAN3 4KGVB 1CKAA 1I81A 4J9IA 2BZ8A 2FPDA 5KYYB 5CQXA 3CCQT 1YWPA 2KRNA 2DFUA 4CC7A 1I07A 3CC4Q 4BE1A 2DBKA 5FU6C 5CKHA 2L5QA 5GAN6 2VGNA 2XMFA 1ZX6A 1ZHIA 3GIBA 3HL8A 1TG0A 1BK2A 2J7IA 3I9QA 1NYGA 3G1JA 4OMPA 5GAOm 3CD6T 3QZ5B 4J9CA 3M0QA 3LH0A 1I1JA 2BTTA 4C92A 5A0LA 2EGCA 1BU1A 4M7AA 3GP8A 2MPXC 5DLOA 4DEYA 3U23A 1VQ8Q 1KC8U 2RHIA 1WJSA 2O01E 4R55A 2PVOB 2LRQA 2CP6A 3THKA 4M78A 5GMKl 4A53A 1XTDA 5I2SA 4LD9K 2V1QA 2DX1A 5FWCA 3RBBB 1YFNA 4M4ZA 3OBWA 3CCVQ 3TEEA 2PUOB 1H8KA 3CCUT 4QVZA 5LJ5e 1JJ2S 2HQXA 3OYNA 5DM7R 2QTXA 1X43A 1N8RR 1KQ1A 3BDUA 4FSSA 1SRMA 4DBQA 3V7RA 1Y07A 5GAN2 1UFFA 4ZN1A 2VC8A 1F1BB 1WXBA 1UB4A 4MZTA 2QXFA 3CCLQ 4LDXA 2KGTA 3M9QA 3G6ET 2E5QA 1FMVA 1LJOA 2RM4A 2LDMA 2X4WA 3EGDA 4N0AA 4RCBA 4XTVA 2P0KA 5KH6A 2A3LA 2EQKA 1XOVA 3QXEB 3EGXB 5LJ5d 1PC0A 1GFDA 4OGCA 2BUDA 1EX4A 5GAMj 2M02A 1H3HA 1UHFA 2MAMA 4HT8A 3NPFA 4BUGA 1OQKA 4E7ZA 4VUBA 2X3WD 2ROTA 2MIOA 1KG1A 1HSQA 1Y57A 2QQBA 2J6KA 3L2ZA 2NUPB 4F7UE 1KJWA 3ME9A 1VQ7Q 1X2QA 1QCOA 3GF5A 3M0SA 2EKOA 5GMKi 3UDCA 3WVDB 2EQIA 1VQ9Q 1N9RA 1Z9ZA 3CCJQ 2SRCA 1QLYA 1RAEB 1VYTA 2ZPFB 4M7DE 4XTXA 4HVWA 2K3YA 1YP5A 5GAMf 3V7CA 3PVLA 1ACMB 4LDVA 3HPWA 4MMKA 3QYGB 3UPUA 4BACA 1YBYA 3OB9A 1YJNQ 4A4HA 1VA7A 2CSQA 2O4XA 2EJ9A 2YRVA 1UGSB 4C8QC 1AD5A 2Y90A 5GAN7 1YIJA 1WX6A 1D09B 4M75G 2KROA 5A2QE 3VJPA 4PJOD 2QG9B 3FC3A 2L2PA 1GCQA 2KMTA 4J6XA 1WFWA 2MI6A 4KH1B 4F7UF 4XQ3A 1VQPT 1D1CA 3X26B 2ED0A 1P92A 2R5AA 1VQMQ 3GOXA 3OYHA 5LJ5g 3EHRA 1VQNA 3R6OA 3WVEB 2K3XA 2QEXA 5KYNA 3HTRA 2YUNA 3RDVA 5ECAA 1X69A 2QQSA 1OEBA 3OS2A 1UHCA 3NMZC 1SEMA 2RH2A 4C5HA 2PUKB 3S3NA 6AT1B 1Q95G 3JRZA 2DZCA 1N8RU 1B07A 1IREB 4J9EA 3LW5E 3JAME 1BCMA 1N27A 3CBPA 2ZPGB 2QGFB 4OVAA 2NUZA 1K8AR 1AWWA 1IHWA 3L2RA 2B86A 3TREA 1H3ZA 1QVGA 5CIUA 2JM9A 1OX9A 4F14A 3J81E 4RG2A 2HZYA 1M1KR 2AKKA 4Y91A 4F04B 2RO0A 5GAOq 2PNIA 5AT1B 4J9BA 1EZZB 1N6AA 3ER0A 2LQWA 1JQQA 1MNDA 2CT4A 2JTFA 1KQSS 1ZLMA 3CMAQ 1M90R 3OYAA 3OBYA 2MOXA 3M0TA 1M3BA 2Y4XA 1XNIA 4PJOF 3G71Q 4X34A 1ZSZC 1GCPA 2FO0A 1PM3A 1UECA 3P8DA 1W2BS 3MJXA 2DXCA 3CCQA 2E4HA 4ZGJB 4QQGA 2EYYA 4JLIA 2L3QA 1SSHA 3RR6A 2X51A 2AT1B 3TU4K 5FWBA 4F7UA 4RTZA 5CKEA 2BE7D 1QKWA 1YJ9T 4E2FB 1KHIA 1GXIE 1ABQA 3CD6A 2LNHB 4EMKA 3UA7A 3NTIA 1E6GA 2JT4A 4LDYA 1K8AC 1FX7A 2M0YA 4PFZA 9ATCB 1WHHA 2DXUA 1M2VA 2LX7A 7AT1B 2K5LA 1OI1A 4WCIA 2A37A 2DVJA 1M1KC 1D0ZA 1R0BG 3KUFA 4NL3A 1M2OA 1OULA 1WHLA 2A7YA 5GAOl 4ATOA 5KYUB 2K4YA 3JCMQ 2QDLA 3CCUA 2WSFE 1R0CB 1MMAA 1JJ2P 4AFZC 1WXTA 1GFCA 2QA4T 3EGUA 2FZKB 2LT4A 4C8QD 1S1NA 5GAMd 2LT1A 1WQ7A 2O9SA 1PWTA 2DRKA 2EIFA 2PU9B 1VQKT 1JEGA 5M9OA 4RTWA 1E6HA 1BKBA 4OMMA 2KXCA 5J26A 2FHDA 1RLPC 1QMCA 2V8IA 1K8AU 1QVFA 8AT1B 5IN1A 4PJOA 4LUEA 4C8QE 2LJ1A 1AVZC 3EH2A 5GMKh 4Z89A 3JB9G 2DMOA 3H0IA 5GAN4 2L3PA 4J6YA 1M1KU 1MMGA 3L2UA 4KUIA 4M77E 5IHIA 1UTIA 3QO3A 3QKJA 1RAAB 4FSXA 5FRNA 4KULA 1D3BA 2C0OA 2W0ZA 3CC4T 2EVRA 2CH4A 3KBGA 1QKXA 1IO6A 4LNPA 1M90U 1K0SA 1NBEB 4ZNXA 1R77A 2BIVA 5IHNA 2EBPA 1AWXA 4J6WA 4C0DB 2CUDA 4EMHA 1VQ6Q 1KHCA 1QCFA 3GLXA 1X27A 3UA6A 3UATA 4HT9A 4QVDA 2LJ0A 3MKDA 1FMWA 2ZPEB 1VUBA 5CO7A 4BY6B 1VQ8T 5GJVB 2RJFA 3OYGA 1X2KA 4P5NA 2H8HA 1G5VA 4J9GA 4C8QF 5GAMg 3QJYA 1TU0B 3DB4A 3CCVT 4N4IA 3JCMV 1WYXA 1QWFA 2KYMA 1Y0MA 3EFRA 4PJLA 4BD3A 2EJFA 3FIFA 3A8MB 4E47A 2QI2A 4OP0A 1K76A 2VYTA 2IVWA 2L89A 3OSSC 3CCLT 2D8JA 5I22A 1QW1A 2XDDA 4OB0B 4LXCA 1M3AA 4QVCA 1VQOQ 4AFQC 2DYBA 1HJDA 1I8FA 2ZPBB 2J05A 2YLCA 2PTKA 1QVPA 2VV5A 3JB9J 2QDYB 1MV0B 2GCXA 1KC8C 1X01A 2NUTB 2RHXA 1VQLQ 3AT1B 3LLRA 2C0TA 5HKCA 5EC7A 1HK9A 3VS3A 2V26A 3JB9D 2HBWA 1VQ7T 1NPRA 4FCYA 1SKUB 1VYUA 5L8RE 2E65A 4ESRA 2WACA 3QJ6A 1OYXA 3OYYA 1VQ9T 2RD1A 2M1HA 1UGRB 3CCJT 3LYIA 3SWNC 3ZEHA 4M7DG 1SHFA 4AG1C 1ZBJA 3MP8A 2QK0A 2LP5A 2RF0A 3CBMA 2HSEB 1KQSP 3SB2A 4ZGEB 3RUXA 2DL5A 1WXUA 1G3TA 4RTVA 1A0NB 1Y96A 1WNLA 2JOYA 1YJNT 3HSBA 4AT1B 3MEUA 2KRMA 2HEQA 1JJ2A 4M75B 1W2BP 2O88A 2BE9B 2FZGB 2EYXA 3O5ZA 2JMCA 4C8QA 2C0IA 3O8VA 1QVGP 2O2OA 1H92A 1V29B 2HMAA 2KRSA 1NEGA 5CK9A 3J80E 1M8MA 2KY9A 1YJ9A 4JJCA 4M77A 4GLMA 1SSFA 5LJ3j 2DILA 3S3MA 5FW9A 3VRZA 3ZL7C 2KAFA 1VQMT 3CMEQ 2NYSA 1KSWA 5LJ3h 2RQWA 1K9MR 1YHQQ 2E1HA 2JS2A 1N9SA 3S3OA 3JB9H 5GMKe 1RL2A 2FEIA 3JCMh 2QQAA 3E9GA 3IQLA 4HCKA 1UGVA 2DTOA 3VUZA 2CP5A 1LNXA 1U06A 3JCMc 5A0GA 2ZZDA 3DLMA 5I2MA 4II1A 3JB9F 3SD4A 3OYFA 1U1TA 2M9UA 4C0GA 4E7KA 4XU1A 5CQYA 5LJ3f 3TVTA 2QA4A 1K4US 4HVVA 1B34A 3RERA 2FZCB 3REAB 3JCMf 4GY5A 1VQ5Q 1IXDA 4JRPA 3A8GB 1PRLC 4DOWA 3QDFA 4M75C 5CVIA 4C92B 1VQKA 2X9HA 4M7AB 3L2VA 3M53A 3OW2S 1ARKA 2CZ7B 2EQMA 5D6YA 4RCCA 2HDAA 1OU8A 3LWIA 3VS6A 2LQNA 1Q82R 3H9NA 3I56Q 4IUTA 4M78B 1UGQB 2DXTA 2DYIA 3CMAT 2AIRB 1T3LA 1WHMA 4BI8B 1K9MC 2EJGA 4PJMA 2K2VA 2LQKA 1JBMA 1J3TA 2RQRA 2EYQA 3G71T 3NTHA 1ZSZA 3QWYA 2B8AA 2YUPA 2G3RA 2E3HA 3SFMA 5GAOn 3OMCA 1G3WA 1N8RC 3DLLA 3VS1A 1Q81R 4MMLA 3CC4A 3EFSA 4OB1B 1K9AA 2ZCFB 3DB3A 4HCZA 1O75A 1ZQ1A 2MK5A 2X4XA 2KXDA 3EGDB 1UE9A 3I5SA 2KYBA 1CSKA 1X6BA 2RQTA 4JZ3A 3M59A 3GNGA 1H641 1QVFP 2KE9A 2XDPA 4FU6A 2E10A 1JXOA 2DL7A 3P8BB 1D1BA 4CC4B 4IKFA 5D6WA 3G4SQ 4PLLA 1PSEA 1UEBA 2FYKA 4X1VA 4ZTFA 3M55A 1TWBA 2VXFA 2CH4W 1VQ8A 2QAZA 2X4YA 2EKHA 4J9FA 1YJWQ 2I2LA 2K6DA 2DKGA 3MO8A 2DLPA 2V8JA 4FIBA 1RAFB 3CMEA 1Q82C 1PRMC 3V8JA 4J9HA 2RPNA 4NOYA 2FL7A 3CCVA 4DA4A 1BCOA 2H3JA 2E6ZA 2K3BA 1OPKA 4OMNA 1K9MU 1U8RA 1K73R 2OJ2A 4PJOE 2DL3A 2VXEA 2WSEE 1TSFA 3ZBDA 5HY6A 1JB0E 1KQSA 1TS9A 3M54A 3C12A 4D8DA 1OU9A 2M0OA 1Q81C 1WDXA 2DAQA 2F1LA 5D7UA 3CCLA 4WF2A 4Q5WA 1WHKA 2O4XB 4RUGA 4DBHA 5KYWA 2HCKA 1X75C 5CKDA 1W2BA 2EQJA 4E7IA 2DIGA 2RN8A 4HCBA 1VQ5A 3H41A 5FU7B 2AK5A 2YRDA 2L8DA 2BZYA 3G7ZA 2X4JA 4X9CA 4MDXA 3QPHA 1C6VX 3JCMJ 3BFMA 1QP3A 1TTHB 3TQ7P 4C92G 5GANj 1TH7A 2OTJQ 2LTOA 2CT3A 4M7AG 1OPLA 2LJ3A 3CCMQ 1NE8A 1RI0A 2KEAA 2QTVA 4M77G 1VQ7A 5FRMA 1BYMA 3C95A 2KNBB 5FLXE 1GRIA 2HSPA 1ZUYA 2CGHA 1YITQ 1Q82U 2I0NA 5GANh 4RTYA 5LJ3e 3E2UA 1N5ZA 4M78G 1JO8A 4JZ4A 2GQVA 1VQ9A 2JTEA 2XIDA 3URGA 1D0YA 3CCJA 4JLGA 2KQWA 3INZA 3PVQA 5L23A 2P4TA 2RA2A 3JCMe 1TUCA 3WXMB 4FL6A 2XKOC 1HD3A 2RHYA 3M4GA 5CKBA 1M8VA 3QSUA 4OMOA 3M57A 1VQ6T 1KQ2A 2CP0A 2E12A 1G83A 4M75D 3E9FA 1YJNA 1Q81U 5KYXB 4QT7A 1GBQA 4FT4A 5AYFA 1IHVA 5LJ3d 5GMKm 3N5BB 3PIOA 1YWOA 1U5SA 3H8ZA 2HQHA 1YCSB 4BB7A 4FW1A 1MUZA 3RIRA 4HKEA 4XU0A 3JCMd 3VUBA 1Q7YR 2XD0A 2DL8A 4PFPA 1BIBA 2XK0A 2CUBA 2R5MA 2HAXA 2MWPA 2DVEA 1QWEA 5IAYA 1XJWB 3PTAA 3QWXX 3MEVA 4OB2B 4RTTA 2CP7A 2RQUA 1RABB 3T9NA 5FU7C 3CXCS 1VQMA 2JXBA 3PFSA 3VRYA 3PNWC 4JRKA 4UC4A 1UUEA 2LZ6B 1BB9A 2JM8A 5D6XA 1M90C 4OMLA 1M5Q1
chains in the Genus database with same CATH topology
4BD3A 1DJ7B 2EJFA 3A8MB 3FIFA 4E47A 2HQXA 5GAOr 2K5FA 2QI2A 2CZ6B 3A8LB 4OP0A 4GLKA 3M58A 5C6SA 5DM7R 3OYNA 2QTXA 4MZMA 2VYTA 3HHTB 1KQ1A 2IVWA 3BDUA 4QW2A 4M7DF 2L89A 2PQWA 3OSSC 2EWNA 3V7RA 2DZ9A 4HCCA 3CCLT 1Y07A 4BDYA 3CC7A 2M16A 1K73U 5GAN2 5J3BA 3QG1A 3V8KA 4ZN1A 3OY9A 1QW1A 2VC8A 3OMGA 1VQOT 4NS5A 4A54A 1UB4A 4MZTA 2QXFA 3S6WA 2XDDA 3I55T 4KBMB 4LDXA 1Y71A 3HRUA 3M9QA 3G6ET 2E5QA 4OB0B 4F7UB 2GF7A 1LJOA 2RM4A 2LDMA 2X4WA 4RCBA 4N0AA 4XTVA 4QVCA 3JSCA 2P0KA 2KDSA 5KH6A 1I8FA 4DOVA 2A3LA 2EQKA 1XOVA 2ZPBB 2YLCA 3QXEB 2DEQA 4ZN3A 5LJ5d 5KE2A 2ZGWA 4N0AC 1YI2T 1VQLT 1QVPA 2VV5A 3JB9J 4OGCA 2BUDA 2F5KA 3TCJA 4C8QG 4EMKB 5GMKj 2QDYB 5GAMj 1M1GA 2GCXA 1VIFA 3JCMW 3MP1A 1KC8C 1X01A 3NFCA 4C92D 1BI3A 2RHXA 3RKWA 4M7AD 2MAMA 4BE2A 1PSFA 4XAXB 1AHJB 2RI5A 3LLRA 3RMQA 4BUGA 5HKCA 4HT8A 4M7DB 1HK9A 4A4KA 2E6NA 3CCET 2QQRA 4VUBA 3JB9D 1VQ7T 3META 3I56A 1KG1A 1NPRA 3JCMP 1FWZA 4M75F 4J5YA 2QQBA 2KK4A 3BY7A 3L2ZA 1S72T 5L8RE 1UGPB 4XTYA 2E65A 4F7UE 2OTJA 2WACA 3ME9A 5LJ3g 3A8HB 4J8OA 2E70A 2GFUA 3QJ6A 3CCRT 3SWNA 1OYXA 2RJEA 3GF5A 4C5GA 4Y28E 3OYYA 1W4SA 2CZ0B 1VQ9T 3C4SA 2RD1A 2M1HA 4QQDA 1UGRB 5IT9E 3RMSA 3LYIA 3CCJT 3SWNC 3ZEHA 3CMAA 4M7DG 3JCMb 3JCMg 2EKOA 1WGSA 5GMKi 5C0MA 3MP8A 3UDCA 1WQWA 3WVDB 3ZFJA 1YITA 3CBMA 2DK3A 1N9RA 3OYMA 1K73C 4IUVA 1M4ZA 3CXCA 3SB2A 2QQ9A 4LDWA 3LGLA 4ZGEB 3G71A 2DJZA 2ZPFB 3RUXA 3X24B 4M7DE 4XTXA 2XICA 4JUVA 2E41A 3SDZA 1G3TA 2K3YA 3QYHB 1Y96A 5GAMf 3V7CA 3M5AA 4LDVA 3OS1A 1WNLA 3HPWA 2JOYA 1YJNT 4MMKA 3HSBA 3MEUA 3QYGB 4QQ6A 5I21A 1JJ2A 3GPLA 1X6OA 4M75B 5GANf 3UPUA 4BACA 1I4K1 1YBYA 5J39A 2R57A 3OB9A 2RHUA 2BKDN 4A4HA 1ZBXA 4C8QA 2O4XA 2RI2A 4DQ2A 5DLQE 3O8VA 1R8OB 4C0ZA 1QVGS 1G3SA 2EJ9A 2YRVA 2PVGB 4V2SA 2FB7A 1V29B 3OYBA 3E1SA 1UGSB 4C8QC 2CS7A 2Y90A 5GAN7 2X35A 3FDRA 3G4SA 1NZ9A 3MP6A 5CK9A 1OZ2A 2KY9A 3HP9A 2FVUA 3HFNA 3J80E 1YJ9A 4M75G 2VUBA 4OGEA 5A2QE 2HNIA 4M77A 3VJPA 2D6FA 1SSFA 2OTLT 5LJ3j 3CMET 4PJOD 3E19A 3FC3A 3S3MA 4A4FA 2KMTA 2KSSA 3L42A 4FM4B 3BW1A 4MDWA 4ZTJA 4J6XA 2KAFA 3CPFA 3GNFB 1VQMT 2MI6A 1YJWA 4M75E 4F7UF 5GAN5 1YHQT 1Q7YU 1EIFA 4XQ3A 4QVZA 4J7IA 1VQPT 3X28B 3X26B 1P92A 3LGFA 4M7DA 2R5AA 5LJ3h 2P0PA 3GOXA 1MGQA 2L3RA 4L6V5 3OYHA 5LJ5g 2E1HA 1N9SA 2E64A 3PT9A 4ELZC 4JDSA 1VQNA 3R6OA 3WVEB 4M7DC 5CCAA 2K3XA 3S3OA 5GAMe 5GMKe 3JB9H 2QEXA 3F70A 1RL2A 2LNVA 3JCMh 1LOJA 3MCAB 4C5IA 3J7AF 4EDUA 2QQAA 4LDUA 3E9GA 2OAUA 1D3BB 2DTOA 4C92F 3VUZA 5GANe 1LNXA 4HA8A 3JCMc 3DKMA 2QQSA 3KXTA 5A0GA 2ZZDA 4Z02A 3DLMA 5I2MA 4OMFB 4O6JA 4II1A 3VV0A 3OS2A 3OYKA 3JB9F 4D6WA 3SD4A 4KT0E 5CR2A 5GAOp 3OYFA 1U1TA 2M9UA 2RH2A 2XI9A 4C0GA 4E7KA 4C5HA 2PUKB 3S3NA 4XU1A 5CQYA 5LJ3f 2QA4A 3CC7T 3JRZA 2V8KA 2DZCA 2JVVA 5CKFA 1N8RU 1B34A 4XK8E 1IREB 3JCMX 1VQ5T 3RERA 3LW5E 2JN0A 3JAME 2LX9A 1N27A 3CBPA 3FB9A 2ZPGB 1MHNA 2RJDA 4M75A 3JCMf 4C0DC 4GY5A 2P0QA 4OVAA 3RESA 3A8GB 4JRPA 2NLUA 4DOWA 5GANd 4IURA 3I55A 1BI2A 3PMTA 4M75C 5CVIA 3VYGA 4C92B 4F7UG 3G6EA 4BDZA 1Q7YC 1VQKA 3MEAA 4M77D 4M7AB 2DO3A 3L2RA 3TREA 3L2VA 3M56A 3M53A 4FT2A 3OW2S 4E7JA 2RK2A 2ZPHB 1IZ6A 3I56T 2CZ7B 1H3ZA 1QVGA 2EQMA 5D6YA 4N4HA 4BY6C 4RCCA 2XG8D 5CIUA 5LJ5j 1U1SA 3LWIA 3J81E 4M78D 4L59A 4RG2A 3OS0A 2XU8A 2D9TA 4B9XA 3CCMA 4Y91A 4PLIA 4IUTA 1JRIA 4M78B 5DY9A 5KCHA 1O9SA 2JNGA 2DD5A 1M9SA 2RO0A 5GAOq 1UGQB 2DXTA 4KUDK 3NTKA 3CMAT 1N6AA 5EG2A 5LJ5h 3ER0A 1I5LA 4IUPA 1WPYA 2JTFA 1KQSS 4BI8B 1K9MC 2EJGA 3OYDA 3P8HA 2K2VA 2DTHA 2LQKA 1JBMA 4BI4A 2MF2A 4C92E 2EYQA 3FRNA 3G71T 3OYAA 3NTHA 3OBYA 3CCST 1VQ4T 4M7AE 4EMGA 4BI3A 2B8AA 4IUUA 1BI1A 2Y4XA 4E7HA 2G3RA 3SFMA 2CYZB 1XNIA 4PJOF 1NJIC 5GAOn 3OMCA 1G3WA 4X34A 1N8RC 3CC2T 3DLLA 1NPPA 4MMLA 4X9DA 4OF1A 4IUQA 3P8DA 1W2BS 2JZ2A 3EFSA 4OB1B 3ASKA 1FXXA 2DXCA 3CCQA 3CC4A 4C0FA 2XDBA 2D0QB 4ZGJB 3PMIA 2ZCFB 4QQGA 4M78E 1VIEA 3DB3A 4HCZA 3OYCA 4JLIA 3CPWA 2HQEA 1O75A 3X20B 1ZQ1A 2X4XA 4PNOA 4XU2A 4B9WA 4JRQA 1VQ6A 3A8OB 5LJ5f 5CAIA 3H6ZA 3OYEA 3TU4K 3VKIA 3HKSA 4F7UA 3BDLA 3M59A 3QIIA 3GNGA 5CKEA 5GAN8 3G4ST 1YIJT 4A4EA 1YJ9T 1QVFS 2KVQG 1H641 3M4YA 2XDPA 4OB3B 4FU6A 1KD1C 1KHIA 2E10A 3HFOA 1GXIE 3P8BB 4XTWA 3V8LA 4IKFA 3CD6A 5D6WA 4EMKA 2FYKA 1PSEA 1OZ3A 1UEBA 3NTIA 4PLLA 3LWHA 4ZTFA 4LDYA 2AHJB 1K8AC 3EAEA 1FX7A 4PJOB 3M55A 1YJWT 2RI3A 2VXFA 4EMKC 4MZPA 1VQ8A 2X4YA 2DXUA 4RG8A 3OA6A 3PIPA 2I2LA 2K5LA 3VYHB 2CZ1B 2DKGA 4PL6A 3MO8A 3MHXA 2V8JA 3SWNB 1OI1A 3LX7A 4FIBA 2OTLA 3HRSA 3CMEA 1VQNT 1Q82C 3C94A 2EQUA 4N4GA 4XU3A 3V8JA 3OYJA 1M1KC 2QEXT 3UT1A 3OW2A 5KCOA 4NL2A 3KUFA 4NOYA 4PJOG 4NL3A 2FL7A 3CPWS 2MMPA 3CCVA 5GANg 4DA4A 2A7YA 4YTLA 5GAOl 4M7AF 5FU6B 4ATOA 2H3JA 1VQPA 2E6ZA 4ME7A 2YLBA 2R58A 2K4YA 2YHTA 3JCMQ 3L1AA 1K9MU 4JS5A 4M77F 1U8RA 2K5IA 2VGMA 2LVMA 4JJNK 4PJOE 2LQ8A 4XTUA 2VXEA 3CBOA 2HBPA 2WSEE 3CCUA 1BIAA 2WSFE 4JRIA 3ZBDA 3PGGA 1Y96B 5LL6S 4XTZA 1YIJA 5HY6A 1JB0E 1KQSA 4M78F 5A0DA 2QA4T 3RKYA 1NJIU 3M54A 3V7SA 3C12A 4CI0C 2M0OA 1Q81C 3QUIA 4A4GA 2DAQA 2LT4A 4C8QD 3CCLA 2RJCA 2F5TX 5GAMd 1XQHA 4WF2A 2IG0A 4Q5WA 3RKXA 2LT1A 2O4XB 4C8QB 4EPCA 3OYIA 1WQ7A 2DTIA 5HK0A 1VQOA 2C06A 2MWOA 2JUFA 5FROA 1X75C 2GFAA 2EIFA 2PU9B 5CKDA 1BI0A 1VQKT 4E7LA 2K57A 1W2BA 2EQJA 4E7IA 1WJQA 2DIGA 1Q86C 2RHZA 1QP2A 5HK3A 3OS5A 3QDRB 4HCBA 2LC4A 5M9OA 2HD0A 4M77B 4RMOA 1VQ5A 3CEYA 5FU7B 1VQLA 3L2QA 2RK1A 1YI2A 4PKCC 1BKBA 2L8DA 3G7ZA 1KD1U 3QZ9B 2X4JA 4X9CA 4MDXA 2OTJT 5J26A 2DIQA 2LCCA 3QPHA 3CCMT 3JCMJ 2FHDA 3BFMA 1QP3A 2LCLA 2EFIA 2V8IA 3QBYA 4O5VA 4M7DD 1K8AU 4L5GA 3HRTA 4C92G 5GANj 1QVFA 1TH7A 2LTOA 5IN1A 4M7AG 4PJOA 1NE8A 4C8QE 3CCEA 1RI0A 1M1FA 2EAYA 5KE3A 1YITT 2DPPB 3OQ5A 3JB9I 4M77G 1VQ7A 5FRMA 1BYMA 5GAMh 5GMKh 3C95A 3QHSA 3FJPA 2ZPIB 2PVDB 4JS4A 4PJOC 2DD4A 5FLXE 3JB9G 1WJRA 1S72A 2CGHA 2JTMA 5GAN4 1Q82U 5GANh 4J6YA 2CKKA 1M1KU 1G3YA 5LJ3e 3CCRA 3L2UA 4ZGDB 4M78G 3FEOA 4LD6A 4KUIA 2GQVA 4M77E 1VQ9A 2XIDA 3Q1JA 1YCYA 3URGA 5GAN3 3QO3A 1I81A 3CCJA 3QKJA 4JLGA 4FSXA 2KQWA 3INZA 5FRNA 4KULA 1D3BA 2P4TA 2RA2A 3JCMe 3CC4T 5CQXA 3WXMB 3CCQT 3OSVA 4FL6A 4J83A 2XKOC 5CKBA 2RHYA 3M4GA 3UWNA 3KBGA 1M8VA 3QSUA 1M90U 2F69A 1Y7XA 3M57A 4BE1A 5FU6C 3CCSA 4RKUE 1VQ4A 2BIVA 1KQ2A 5CKHA 1VQ6T 3AHUA 2L5QA 5GAN6 2VGNA 2E12A 1ZHIA 3GIBA 3HL8A 1B34B 4J6WA 4C0DB 4M75D 3E9FA 1YJNA 4EMHA 1Q81U 3CC2A 1KHCA 3GLXA 4HT9A 5AYFA 4FT4A 4QVDA 5GAOm 1HXDA 4J7FA 5LJ3d 3N5BB 5GMKm 3PIOA 3X25B 3CD6T 3QZ5B 3L2WA 2XHCA 3H8ZA 2ZPEB 3A5ZB 4BB7A 1VUBA 3LH0A 5CO7A 4BY6B 3RIRA 4HKEA 4XU0A 3JCMd 3OYLA 1Q86U 3VUBA 1VQ8T 2XD0A 3MEWA 4C92A 5A0LA 4TVRA 1BIBA 2XK0A 2R5MA 2RJFA 2HAXA 4M7AA 3VU3C 3OYGA 3GP8A 4CRIA 2MWPA 2DVEA 4P5NA 5DLOA 5IAYA 3PTAA 4C92C 1G5VA 4BE0A 4R56A 4M7AC 3MEVA 4OB2B 4C8QF 5GAMg 1KC8U 2RHIA 3QJYA 4ELYC 3T9NA 1WJSA 2O01E 4R55A 4M77C 3DB4A 2PVOB 5FU7C 2LRQA 3CXCS 1VQMA 2RB6A 3CCVT 3PFSA 4M78A 2DXBA 3FLGA 1YHQA 4N4IA 3PNWC 3JCMV 4A53A 1XTDA 4JRKA 4C5EA 4UC4A 5I2SA 5GMKl 4LD9K 4M78C 3OBWA 2Y4YA 3TEEA 2PUOB 5D6XA 1M90C 3CCUT 3EFRA 2WSCE 5LJ5e 1M5Q1 1JJ2S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BD3 A;  3FDR A;  3NTH A;  3MP6 A;  1OZ2 A;  2HQX A;  2B8A A;  3CEY A;  4IUU A;  3L2Q A;  4E7H A;  2L8D A;  2G3R A;  5C6S A;  3OYN A;  1XNI A;  1SSF A;  3OMC A;  4X34 A;  5J26 A;  2VYT A;  3FC3 A;  2DIQ A;  2LCC A;  4QW2 A;  2FHD A;  4A4F A;  3S3M A;  2L89 A;  2PQW A;  3L42 A;  4IUQ A;  2EFI A;  4ZTJ A;  3P8D A;  3QBY A;  2JZ2 A;  3ASK A;  4BDY A;  2M16 A;  2LTO A;  3PMI A;  4QQG A;  5IN1 A;  3OY9 A;  3DB3 A;  4HCZ A;  3OMG A;  3OYC A;  4NS5 A;  2HQE A;  2X4X A;  1RI0 A;  5KE3 A;  3S6W A;  3OQ5 A;  3LGF A;  4B9W A;  5FRM A;  2R5A A;  3M9Q A;  2E5Q A;  3GOX A;  2GF7 A;  3H6Z A;  2L3R A;  2LDM A;  2X4W A;  3OYH A;  3OYE A;  1WJR A;  2P0K A;  3BDL A;  5KH6 A;  2EQK A;  3QII A;  2K3X A;  2CKK A;  3S3O A;  4A4E A;  3F70 A;  5KE2 A;  4C5I A;  3L2U A;  3FEO A;  4LD6 A;  4EDU A;  2XDP A;  4FU6 A;  3E9G A;  2BUD A;  2F5K A;  3Q1J A;  3MP1 A;  3QKJ A;  4IKF A;  5D6W A;  5FRN A;  4PLL A;  1OZ3 A;  2RHX A;  3NTI A;  4ZTF A;  3EAE A;  4FL6 A;  2QQS A;  4BE2 A;  2RHY A;  2RI5 A;  2RI3 A;  3LLR A;  3UWN A;  4Z02 A;  3DLM A;  3OS2 A;  4II1 A;  3OYK A;  2E6N A;  2X4Y A;  3SD4 A;  2QQR A;  4BE1 A;  3OYF A;  2BIV A;  3OA6 A;  3MET A;  4E7K A;  4C5H A;  3S3N A;  4PL6 A;  3MO8 A;  1OI1 A;  3E9F A;  3LX7 A;  2WAC A;  3ME9 A;  2EQU A;  4N4G A;  3OYJ A;  1KHC A;  2GFU A;  3QJ6 A;  1OYX A;  2RJE A;  3UT1 A;  5KCO A;  3KUF A;  4C5G A;  1N27 A;  3C4S A;  4QQD A;  2M1H A;  1MHN A;  2RJD A;  3LYI A;  3ZEH A;  4GY5 A;  3L2W A;  2EKO A;  4OVA A;  1WGS A;  5C0M A;  3H8Z A;  3MP8 A;  2NLU A;  2R58 A;  4IUR A;  3LH0 A;  3OYM A;  3PMT A;  4BDZ A;  4IUV A;  3OYL A;  2LVM A;  3MEA A;  3L2R A;  3LGL A;  3MEW A;  3L2V A;  2XK0 A;  2R5M A;  2RJF A;  4E7J A;  3OYG A;  4CRI A;  2MWP A;  1H3Z A;  2EQM A;  5D6Y A;  4N4H A;  5IAY A;  5CIU A;  2K3Y A;  1G5V A;  4BE0 A;  3OS1 A;  4RG2 A;  4L59 A;  3MEV A;  3OS0 A;  3OYA A;  2M0O A;  2RHI A;  4A4G A;  2D9T A;  2DAQ A;  3MEU A;  4B9X A;  4QQ6 A;  1WJS A;  4PLI A;  4IUT A;  5KCH A;  2RJC A;  4BAC A;  3DB4 A;  2LRQ A;  5J39 A;  2RO0 A;  2R57 A;  2IG0 A;  3OB9 A;  4Q5W A;  2O4X B;  2RHU A;  3PFS A;  3FLG A;  3OYI A;  2BKD N;  3NTK A;  4N4I A;  3PNW C;  2MWO A;  4A4H A;  4C5E A;  4UC4 A;  2O4X A;  5FRO A;  2RI2 A;  2GFA A;  4IUP A;  3O8V A;  2JTF A;  4E7L A;  2YRV A;  2EQJ A;  4E7I A;  1WJQ A;  2DIG A;  3P8H A;  3OYB A;  2RHZ A;  5D6X A;  3OYD A;  4QVZ A;  2X35 A;  5M9O A; 
#chains in the Genus database with same CATH topology
 2COW A;  5GAO r;  2O31 A;  2CZ6 B;  5C6S A;  2L0A A;  4QW2 A;  5I11 A;  2PQW A;  2NWM A;  2EWN A;  4HCC A;  1IGQ A;  1RAH B;  4BDY A;  4HVU A;  2M16 A;  1K73 U;  1RAD B;  5J3B A;  3QG1 A;  2D0N A;  3V8K A;  3EFO A;  1G8X A;  3OY9 A;  1VQO T;  3H0H A;  4NS5 A;  4A54 A;  1KFZ A;  3S6W A;  2ROL A;  1UDL A;  3HRU A;  3ULR B;  4F7U B;  2QGG A;  3I55 Q;  2FPF A;  1VQL T;  3SEM A;  2ZGW A;  5KE2 A;  4OMQ A;  4EMK B;  2F5K A;  3TCJ A;  5GMK j;  1M1G A;  3M0P A;  3NFC A;  4C92 D;  1BI3 A;  1BBZ A;  1YI2 Q;  4M7A D;  1K0X A;  4BE2 A;  1PSF A;  1QQJ A;  4XAX B;  3RMQ A;  1AWJ A;  4M7D B;  4A4K A;  2E6N A;  2M51 A;  2QQR A;  4E7S A;  3MET A;  4M75 F;  1UGP B;  3CCE Q;  2OTJ A;  1FMK A;  5LJ3 g;  1UG1 A;  3A8H B;  1ABO A;  1PCX A;  4AFS C;  1T0H A;  3SWN A;  2RJE A;  4C5G A;  4Y28 E;  2CZ0 B;  1NLO C;  3C4S A;  4QQD A;  1S72 Q;  5IT9 E;  3CMA A;  3JCM g;  4FYW B;  3CCR Q;  1WQW A;  1YIT A;  3OYM A;  2DK3 A;  2AZS A;  2SEM A;  2QQ9 A;  4LDW A;  3LGL A;  3G71 A;  2YT6 A;  2HL5 C;  1IGU A;  2XIC A;  3SDZ A;  2F2X A;  4ORZ A;  5I21 A;  3GPL A;  2R57 A;  3A1P A;  2FPE A;  1ZBX A;  3PE0 A;  5DLQ E;  1WHJ A;  1G3S A;  2PVG B;  4V2S A;  3OYB A;  3E1S A;  3EG9 A;  8ATC B;  2X35 A;  1RLQ C;  3FJ5 A;  3MP6 A;  2FVU A;  3HFN A;  4OGE A;  1SF9 A;  4PK4 A;  2D6F A;  1WZO A;  1D0X A;  3CME T;  1VOM A;  3E19 A;  2KSS A;  4ZTJ A;  4AMC A;  3BW1 A;  3CPF A;  3GNF B;  2OTL Q;  2EW3 A;  5GAN 5;  1YHQ T;  1Q7Y U;  1EIF A;  3X28 B;  1NEB A;  4LN2 A;  1HYO A;  1MGQ A;  2QAS A;  2E64 A;  4JDS A;  4M7D C;  1WIE A;  2VAS A;  4PFO A;  3F70 A;  3J7A F;  3MCA B;  4EDU A;  2FRW A;  4LDU A;  1V1C A;  1D3B B;  4C92 F;  5GAN e;  2IIM A;  1PD0 A;  4HA8 A;  3KXT A;  3KFV A;  5KYY A;  2KT1 A;  4FYX B;  2DE0 X;  3OYK A;  3VV0 A;  2DJQ A;  3EH1 A;  4D6W A;  5CR2 A;  4KT0 E;  5GAO p;  3EG0 A;  2RNA A;  1KIK A;  5IXB A;  2GTO A;  2V8K A;  2JVV A;  4XK8 E;  1VQ5 T;  2JN0 A;  2YWW A;  1KD1 R;  2HKQ B;  3FB9 A;  4M75 A;  4C0D C;  2NLU A;  5GAN d;  3I55 A;  4IUR A;  1BI2 A;  3PMT A;  4F7U G;  1I5O B;  3MEA A;  1M27 C;  1W70 A;  2DO3 A;  2EPD A;  3EG3 A;  4FT2 A;  1VYV A;  2ZPH B;  3I56 T;  2EYW A;  3C0C A;  4N4H A;  4BY6 C;  2XG8 D;  4IIO A;  3OS0 A;  2XU8 A;  3UF4 A;  1JRI A;  5DY9 A;  2JNG A;  2DD5 A;  1M9S A;  1PHT A;  4KUD K;  1WPY A;  2DTH A;  2DM1 A;  2KT8 A;  4EMG A;  4BI3 A;  1TOV A;  1MMD A;  1BI1 A;  4E7H A;  2CYZ B;  2QYZ A;  3CCS Q;  1VQ4 Q;  1NPP A;  4OF1 A;  1FXX A;  4C0F A;  1SG5 A;  1D1A A;  1VIE A;  3CC2 Q;  3RNJ A;  3OYC A;  3CPW A;  2HQE A;  4XU2 A;  3H0F A;  1VQ6 A;  5CAI A;  2HKN A;  1Q86 R;  2EYZ A;  3BDL A;  3G4S T;  2YDL A;  5GAN 8;  2KVQ G;  2DL4 A;  3M4Y A;  3EGX A;  1KD1 C;  3HFO A;  1YIJ Q;  1PNJ A;  1OZ3 A;  3LWH A;  4Y92 A;  3EAE A;  1PG5 B;  1YJW T;  4MZP A;  2PZ1 A;  3OA6 A;  3PIP A;  3VYH B;  1OOT A;  2CZ1 B;  4PL6 A;  2OTL A;  3HRS A;  3C94 A;  3OYJ A;  2NUP A;  3UT1 A;  3OW2 A;  4PJO G;  3CPW S;  5GAN g;  1VQN Q;  3CXC P;  2EGE A;  4YTL A;  1SRL A;  1MV3 A;  2QEX Q;  4ME7 A;  2YLB A;  3BE3 A;  1LPL A;  2A08 A;  4JS5 A;  3MPU B;  2K5I A;  2LVM A;  4JJN K;  2LQ8 A;  4XTU A;  3CBO A;  4JRI A;  3PGG A;  1AT1 B;  3CC7 Q;  1Y96 B;  4XTZ A;  4KRT A;  2DEU A;  3RKY A;  4A4G A;  2VB6 A;  2E5K A;  4Z88 A;  2P84 A;  1XQH A;  4FYY B;  3I35 A;  4C8Q B;  3OYI A;  3EG1 A;  4EPC A;  2DTI A;  1VQO A;  2C06 A;  2YXY A;  2K9G A;  1BI0 A;  1WJQ A;  1Q86 C;  2OX7 A;  1QP2 A;  5HK3 A;  1JU5 C;  3QDR B;  2VWF A;  4M77 B;  4RMO A;  3CEY A;  1VQL A;  3L2Q A;  1KD1 U;  2OTJ T;  1K1Z A;  2DIQ A;  1WI7 A;  2LCC A;  3CCM T;  2EFI A;  3QBY A;  4O5V A;  4M7D D;  2ECZ A;  4L5G A;  1ZA2 B;  2ENM A;  5IXF A;  1YIT T;  3OQ5 A;  1TUG B;  3JB9 I;  3LH5 A;  5GAM h;  3QHS A;  3FJP A;  2PVD B;  4DBR A;  1M3C A;  2FRY A;  2JTM A;  2CKK A;  1G3Y A;  2LCS A;  3FEO A;  2KR3 A;  3Q1J A;  3M0U A;  3D7S B;  3JV3 A;  2JJ9 A;  3OSV A;  4J83 A;  2DBM A;  2GTJ A;  3REB B;  3UWN A;  1CKB A;  1GL5 A;  2K2M A;  1V76 A;  2F69 A;  1Y7X A;  1UJY A;  4F17 A;  3CCS A;  4RKU E;  3CCQ Q;  1VQ4 A;  3I5R A;  3AHU A;  2CP2 A;  1B34 B;  3SHW A;  1C0M A;  3CC2 A;  1ZUK A;  3CQT A;  1HXD A;  4J7F A;  2A36 A;  3VS2 A;  1WA7 A;  1GBR A;  3X25 B;  2KBT A;  3L2W A;  2XHC A;  4JJD A;  3A5Z B;  4F16 A;  3OYL A;  1Q86 U;  3CD6 Q;  2IPO B;  3MEW A;  1PKS A;  4KH0 B;  4TVR A;  3VU3 C;  4CRI A;  1W6X A;  4IIM A;  1B3Q A;  1YNZ A;  4C92 C;  2KI7 A;  4BE0 A;  4R56 A;  4M7A C;  4ANJ A;  4ELY C;  4M77 C;  2CP3 A;  2RB6 A;  2DXB A;  3FLG A;  1YHQ A;  1AWO A;  4C5E A;  2AZV A;  4LUD A;  4M78 C;  2Y4Y A;  2D1X A;  1ZSZ B;  2WSC E;  1C1A A;  1DJ7 B;  2K5F A;  3A8L B;  4GLK A;  3M58 A;  1AZG B;  3CCU Q;  4MZM A;  3HHT B;  4M7D F;  2DZ9 A;  4J9D A;  2YRC A;  3CC7 A;  3OMG A;  4PJJ A;  3I55 T;  4KBM B;  1Y71 A;  2GF7 A;  4GBQ A;  4JJB A;  3JSC A;  2YSQ A;  2KDS A;  1WLP B;  3VS0 A;  4DOV A;  3G6E Q;  2DEQ A;  4ZN3 A;  4N0A C;  1YI2 T;  1OV3 A;  2Z0W A;  2A28 A;  4C8Q G;  5KYX A;  1VIF A;  4CC2 A;  3MP1 A;  3JCM W;  1ZUU A;  3RKW A;  3EG2 A;  1AHJ B;  2RI5 A;  1UJ0 A;  2DF6 A;  3CCE T;  2COY A;  3I56 A;  3JCM P;  1FWZ A;  4RTU A;  4J5Y A;  2KK4 A;  1LVK A;  1AEY A;  3BY7 A;  1S72 T;  4XTY A;  1WHG A;  4J8O A;  2E70 A;  2GFU A;  3CCR T;  2P4R A;  4AFU C;  1W4S A;  5IH2 A;  4Z8A A;  3RMS A;  4D8K A;  3JCM b;  1WGS A;  5C0M A;  2LMJ A;  3ZFJ A;  1K73 C;  4IUV A;  2BZX A;  1M4Z A;  5KYU A;  3CXC A;  1G2B A;  2DJZ A;  1IB8 A;  2YUQ A;  1SPK A;  3X24 B;  4JUV A;  2E41 A;  5IHK A;  3QYH B;  3M5A A;  3OS1 A;  2ABL A;  2GQI A;  5GJW B;  2VVK A;  4QQ6 A;  1X6O A;  5GAN f;  1I4K 1;  1OX8 A;  5J39 A;  5KYW B;  4A63 B;  2RHU A;  2BKD N;  1NG2 A;  2HL3 A;  2RI2 A;  4DQ2 A;  1QVG S;  1R8O B;  4C0Z A;  2K7A A;  2FB7 A;  2CS7 A;  2ED1 A;  2H3E B;  3FDR A;  3G4S A;  1NZ9 A;  1OZ2 A;  3HP9 A;  1FYN A;  2VUB A;  2JS0 A;  2HNI A;  2ZAE A;  2OTL T;  4K11 A;  4A4F A;  3L42 A;  2DET A;  4FM4 B;  4MDW A;  1RAC B;  1YJW A;  2AKL A;  1JXM A;  4M75 E;  1GCQ C;  4J7I A;  4LE9 A;  4RTX A;  3LGF A;  4M7D A;  2MYS A;  2P0P A;  2L3R A;  4L6V 5;  5HCK A;  4ELZ C;  3PT9 A;  4R0K A;  1VQP Q;  4QKU A;  5CCA A;  3VS4 A;  5GAM e;  1NM7 A;  4C5I A;  2LNV A;  1LOJ A;  2O9V A;  3NGP A;  1AOJ A;  2G6F X;  1NJI R;  2OAU A;  3CPW P;  1E7O A;  2VKN A;  4B6M A;  3DKM A;  4Z02 A;  4OMF B;  4O6J A;  2X3X D;  2CRE A;  2XI9 A;  3R6N A;  2JW4 A;  5CKF A;  3JCM X;  2LX9 A;  2YUO A;  2OI3 A;  2EGA A;  4PJN A;  1MHN A;  2RJD A;  2P0Q A;  3RES A;  4BDZ A;  3VYG A;  3G6E A;  1Q7Y C;  1M2V B;  1PKT A;  4M77 D;  3M56 A;  4E7J A;  1KK7 A;  2RK2 A;  3OW2 P;  1IZ6 A;  2GNC A;  5LJ5 j;  1U1S A;  1RAI B;  1SHG A;  4M78 D;  4L59 A;  4CC3 A;  2D9T A;  4B9X A;  3CCM A;  4PLI A;  5KCH A;  2A0F B;  1O9S A;  2DER A;  3NTK A;  5EG2 A;  5LJ5 h;  3EHQ A;  1I5L A;  4IUP A;  3OYD A;  1T0J A;  3P8H A;  2D8H A;  4BI4 A;  2MF2 A;  4C92 E;  3FRN A;  1YN8 A;  3CCS T;  1VQ4 T;  1RAG B;  4M7A E;  2CDT A;  4IUU A;  1W1F A;  1MNE A;  1NJI C;  1I0C A;  3CC2 T;  2RQV A;  4X9D A;  1NYF A;  4IUQ A;  1PD1 A;  2JZ2 A;  3EFO B;  3ASK A;  2XDB A;  2D0Q B;  3PMI A;  2F2V A;  4M78 E;  2ESW A;  3X20 B;  4PNO A;  2FG0 A;  2W10 A;  4B9W A;  4JRQ A;  3A8O B;  2J6O A;  5LJ5 f;  3H6Z A;  1LCK A;  3OYE A;  3VKI A;  3HKS A;  4WTO B;  3QII A;  1YIJ T;  3GBQ A;  4KGZ B;  4A4E A;  1AZE A;  1QVF S;  4OB3 B;  1EFN A;  4XTW A;  3V8L A;  1KC8 R;  1IRX A;  1YJ9 Q;  1ZSG A;  1T3S A;  2AHJ B;  2GBQ A;  1X6G A;  4PJO B;  2NUT A;  2RI3 A;  4EMK C;  2RMO A;  3TSW A;  4RG8 A;  3MHX A;  2CSI A;  4FYV B;  3SWN B;  3LX7 A;  1NLP C;  1VQN T;  2EQU A;  4N4G A;  4XU3 A;  2QEX T;  5KCO A;  1Z9Q A;  4NL2 A;  2DNU A;  2MMP A;  4M7A F;  5FU6 B;  3VS5 A;  1VQP A;  4KGX B;  3CC7 T;  2R58 A;  2YHT A;  3L1A A;  4M77 F;  2F2W A;  2VGM A;  2HBP A;  1BIA A;  4FW2 A;  2COZ A;  2OAW A;  5LL6 S;  4M78 F;  1QCN A;  5A0D A;  1TXQ A;  1NJI U;  3V7S A;  4CI0 C;  3QUI A;  4AG2 C;  2RJC A;  2F5T X;  4DBF A;  2QA4 Q;  1RI9 A;  2E3I A;  2IG0 A;  2JMA A;  3RKX A;  5HK0 A;  2MWO A;  2JUF A;  5FRO A;  1MMN A;  2GFA A;  4E6R A;  2J06 A;  2L3S A;  3EG9 B;  4E7L A;  2K57 A;  2RHZ A;  2MCN A;  3OS5 A;  2J6F A;  1ZA1 B;  2LC4 A;  2HD0 A;  1VQK Q;  1YI2 A;  1B7T A;  2RK1 A;  4PKC C;  3M0R A;  3QZ9 B;  3VS7 A;  1M30 A;  4HXJ A;  1RUW A;  4JPB W;  2LCL A;  3HRT A;  3TSZ A;  4DEX A;  1U3O A;  2K79 A;  3CCE A;  2ATC B;  1M1F A;  2EAY A;  5KE3 A;  2DPP B;  2DRM A;  3A98 A;  4JS4 A;  3NHN A;  2ZPI B;  4PJO C;  2DD4 A;  1WJR A;  1S72 A;  1TUD A;  2V1R A;  3CCR A;  4ZGD B;  2DA9 A;  4LD6 A;  1YCY A;  2GGR A;  4EIK A;  5GAN 3;  4KGV B;  1CKA A;  1I81 A;  4J9I A;  2BZ8 A;  2FPD A;  5KYY B;  5CQX A;  3CCQ T;  1YWP A;  2KRN A;  2DFU A;  4CC7 A;  1I07 A;  3CC4 Q;  4BE1 A;  2DBK A;  5FU6 C;  5CKH A;  2L5Q A;  5GAN 6;  2VGN A;  2XMF A;  1ZX6 A;  1ZHI A;  3GIB A;  3HL8 A;  1TG0 A;  1BK2 A;  2J7I A;  3I9Q A;  1NYG A;  3G1J A;  4OMP A;  5GAO m;  3CD6 T;  3QZ5 B;  4J9C A;  3M0Q A;  3LH0 A;  1I1J A;  2BTT A;  4C92 A;  5A0L A;  2EGC A;  1BU1 A;  4M7A A;  3GP8 A;  2MPX C;  5DLO A;  4DEY A;  3U23 A;  1VQ8 Q;  1KC8 U;  2RHI A;  1WJS A;  2O01 E;  4R55 A;  2PVO B;  2LRQ A;  2CP6 A;  3THK A;  4M78 A;  5GMK l;  4A53 A;  1XTD A;  5I2S A;  4LD9 K;  2V1Q A;  2DX1 A;  5FWC A;  3RBB B;  1YFN A;  4M4Z A;  3OBW A;  3CCV Q;  3TEE A;  2PUO B;  1H8K A;  3CCU T;  4QVZ A;  5LJ5 e;  1JJ2 S;  2HQX A;  3OYN A;  5DM7 R;  2QTX A;  1X43 A;  1N8R R;  1KQ1 A;  3BDU A;  4FSS A;  1SRM A;  4DBQ A;  3V7R A;  1Y07 A;  5GAN 2;  1UFF A;  4ZN1 A;  2VC8 A;  1F1B B;  1WXB A;  1UB4 A;  4MZT A;  2QXF A;  3CCL Q;  4LDX A;  2KGT A;  3M9Q A;  3G6E T;  2E5Q A;  1FMV A;  1LJO A;  2RM4 A;  2LDM A;  2X4W A;  3EGD A;  4N0A A;  4RCB A;  4XTV A;  2P0K A;  5KH6 A;  2A3L A;  2EQK A;  1XOV A;  3QXE B;  3EGX B;  5LJ5 d;  1PC0 A;  1GFD A;  4OGC A;  2BUD A;  1EX4 A;  5GAM j;  2M02 A;  1H3H A;  1UHF A;  2MAM A;  4HT8 A;  3NPF A;  4BUG A;  1OQK A;  4E7Z A;  4VUB A;  2X3W D;  2ROT A;  2MIO A;  1KG1 A;  1HSQ A;  1Y57 A;  2QQB A;  2J6K A;  3L2Z A;  2NUP B;  4F7U E;  1KJW A;  3ME9 A;  1VQ7 Q;  1X2Q A;  1QCO A;  3GF5 A;  3M0S A;  2EKO A;  5GMK i;  3UDC A;  3WVD B;  2EQI A;  1VQ9 Q;  1N9R A;  1Z9Z A;  3CCJ Q;  2SRC A;  1QLY A;  1RAE B;  1VYT A;  2ZPF B;  4M7D E;  4XTX A;  4HVW A;  2K3Y A;  1YP5 A;  5GAM f;  3V7C A;  3PVL A;  1ACM B;  4LDV A;  3HPW A;  4MMK A;  3QYG B;  3UPU A;  4BAC A;  1YBY A;  3OB9 A;  1YJN Q;  4A4H A;  1VA7 A;  2CSQ A;  2O4X A;  2EJ9 A;  2YRV A;  1UGS B;  4C8Q C;  1AD5 A;  2Y90 A;  5GAN 7;  1YIJ A;  1WX6 A;  1D09 B;  4M75 G;  2KRO A;  5A2Q E;  3VJP A;  4PJO D;  2QG9 B;  3FC3 A;  2L2P A;  1GCQ A;  2KMT A;  4J6X A;  1WFW A;  2MI6 A;  4KH1 B;  4F7U F;  4XQ3 A;  1VQP T;  1D1C A;  3X26 B;  2ED0 A;  1P92 A;  2R5A A;  1VQM Q;  3GOX A;  3OYH A;  5LJ5 g;  3EHR A;  1VQN A;  3R6O A;  3WVE B;  2K3X A;  2QEX A;  5KYN A;  3HTR A;  2YUN A;  3RDV A;  5ECA A;  1X69 A;  2QQS A;  1OEB A;  3OS2 A;  1UHC A;  3NMZ C;  1SEM A;  2RH2 A;  4C5H A;  2PUK B;  3S3N A;  6AT1 B;  1Q95 G;  3JRZ A;  2DZC A;  1N8R U;  1B07 A;  1IRE B;  4J9E A;  3LW5 E;  3JAM E;  1BCM A;  1N27 A;  3CBP A;  2ZPG B;  2QGF B;  4OVA A;  2NUZ A;  1K8A R;  1AWW A;  1IHW A;  3L2R A;  2B86 A;  3TRE A;  1H3Z A;  1QVG A;  5CIU A;  2JM9 A;  1OX9 A;  4F14 A;  3J81 E;  4RG2 A;  2HZY A;  1M1K R;  2AKK A;  4Y91 A;  4F04 B;  2RO0 A;  5GAO q;  2PNI A;  5AT1 B;  4J9B A;  1EZZ B;  1N6A A;  3ER0 A;  2LQW A;  1JQQ A;  1MND A;  2CT4 A;  2JTF A;  1KQS S;  1ZLM A;  3CMA Q;  1M90 R;  3OYA A;  3OBY A;  2MOX A;  3M0T A;  1M3B A;  2Y4X A;  1XNI A;  4PJO F;  3G71 Q;  4X34 A;  1ZSZ C;  1GCP A;  2FO0 A;  1PM3 A;  1UEC A;  3P8D A;  1W2B S;  3MJX A;  2DXC A;  3CCQ A;  2E4H A;  4ZGJ B;  4QQG A;  2EYY A;  4JLI A;  2L3Q A;  1SSH A;  3RR6 A;  2X51 A;  2AT1 B;  3TU4 K;  5FWB A;  4F7U A;  4RTZ A;  5CKE A;  2BE7 D;  1QKW A;  1YJ9 T;  4E2F B;  1KHI A;  1GXI E;  1ABQ A;  3CD6 A;  2LNH B;  4EMK A;  3UA7 A;  3NTI A;  1E6G A;  2JT4 A;  4LDY A;  1K8A C;  1FX7 A;  2M0Y A;  4PFZ A;  9ATC B;  1WHH A;  2DXU A;  1M2V A;  2LX7 A;  7AT1 B;  2K5L A;  1OI1 A;  4WCI A;  2A37 A;  2DVJ A;  1M1K C;  1D0Z A;  1R0B G;  3KUF A;  4NL3 A;  1M2O A;  1OUL A;  1WHL A;  2A7Y A;  5GAO l;  4ATO A;  5KYU B;  2K4Y A;  3JCM Q;  2QDL A;  3CCU A;  2WSF E;  1R0C B;  1MMA A;  1JJ2 P;  4AFZ C;  1WXT A;  1GFC A;  2QA4 T;  3EGU A;  2FZK B;  2LT4 A;  4C8Q D;  1S1N A;  5GAM d;  2LT1 A;  1WQ7 A;  2O9S A;  1PWT A;  2DRK A;  2EIF A;  2PU9 B;  1VQK T;  1JEG A;  5M9O A;  4RTW A;  1E6H A;  1BKB A;  4OMM A;  2KXC A;  5J26 A;  2FHD A;  1RLP C;  1QMC A;  2V8I A;  1K8A U;  1QVF A;  8AT1 B;  5IN1 A;  4PJO A;  4LUE A;  4C8Q E;  2LJ1 A;  1AVZ C;  3EH2 A;  5GMK h;  4Z89 A;  3JB9 G;  2DMO A;  3H0I A;  5GAN 4;  2L3P A;  4J6Y A;  1M1K U;  1MMG A;  3L2U A;  4KUI A;  4M77 E;  5IHI A;  1UTI A;  3QO3 A;  3QKJ A;  1RAA B;  4FSX A;  5FRN A;  4KUL A;  1D3B A;  2C0O A;  2W0Z A;  3CC4 T;  2EVR A;  2CH4 A;  3KBG A;  1QKX A;  1IO6 A;  4LNP A;  1M90 U;  1K0S A;  1NBE B;  4ZNX A;  1R77 A;  2BIV A;  5IHN A;  2EBP A;  1AWX A;  4J6W A;  4C0D B;  2CUD A;  4EMH A;  1VQ6 Q;  1KHC A;  1QCF A;  3GLX A;  1X27 A;  3UA6 A;  3UAT A;  4HT9 A;  4QVD A;  2LJ0 A;  3MKD A;  1FMW A;  2ZPE B;  1VUB A;  5CO7 A;  4BY6 B;  1VQ8 T;  5GJV B;  2RJF A;  3OYG A;  1X2K A;  4P5N A;  2H8H A;  1G5V A;  4J9G A;  4C8Q F;  5GAM g;  3QJY A;  1TU0 B;  3DB4 A;  3CCV T;  4N4I A;  3JCM V;  1WYX A;  1QWF A;  2KYM A;  1Y0M A;  3EFR A;  4PJL A;  4BD3 A;  2EJF A;  3FIF A;  3A8M B;  4E47 A;  2QI2 A;  4OP0 A;  1K76 A;  2VYT A;  2IVW A;  2L89 A;  3OSS C;  3CCL T;  2D8J A;  5I22 A;  1QW1 A;  2XDD A;  4OB0 B;  4LXC A;  1M3A A;  4QVC A;  1VQO Q;  4AFQ C;  2DYB A;  1HJD A;  1I8F A;  2ZPB B;  2J05 A;  2YLC A;  2PTK A;  1QVP A;  2VV5 A;  3JB9 J;  2QDY B;  1MV0 B;  2GCX A;  1KC8 C;  1X01 A;  2NUT B;  2RHX A;  1VQL Q;  3AT1 B;  3LLR A;  2C0T A;  5HKC A;  5EC7 A;  1HK9 A;  3VS3 A;  2V26 A;  3JB9 D;  2HBW A;  1VQ7 T;  1NPR A;  4FCY A;  1SKU B;  1VYU A;  5L8R E;  2E65 A;  4ESR A;  2WAC A;  3QJ6 A;  1OYX A;  3OYY A;  1VQ9 T;  2RD1 A;  2M1H A;  1UGR B;  3CCJ T;  3LYI A;  3SWN C;  3ZEH A;  4M7D G;  1SHF A;  4AG1 C;  1ZBJ A;  3MP8 A;  2QK0 A;  2LP5 A;  2RF0 A;  3CBM A;  2HSE B;  1KQS P;  3SB2 A;  4ZGE B;  3RUX A;  2DL5 A;  1WXU A;  1G3T A;  4RTV A;  1A0N B;  1Y96 A;  1WNL A;  2JOY A;  1YJN T;  3HSB A;  4AT1 B;  3MEU A;  2KRM A;  2HEQ A;  1JJ2 A;  4M75 B;  1W2B P;  2O88 A;  2BE9 B;  2FZG B;  2EYX A;  3O5Z A;  2JMC A;  4C8Q A;  2C0I A;  3O8V A;  1QVG P;  2O2O A;  1H92 A;  1V29 B;  2HMA A;  2KRS A;  1NEG A;  5CK9 A;  3J80 E;  1M8M A;  2KY9 A;  1YJ9 A;  4JJC A;  4M77 A;  4GLM A;  1SSF A;  5LJ3 j;  2DIL A;  3S3M A;  5FW9 A;  3VRZ A;  3ZL7 C;  2KAF A;  1VQM T;  3CME Q;  2NYS A;  1KSW A;  5LJ3 h;  2RQW A;  1K9M R;  1YHQ Q;  2E1H A;  2JS2 A;  1N9S A;  3S3O A;  3JB9 H;  5GMK e;  1RL2 A;  2FEI A;  3JCM h;  2QQA A;  3E9G A;  3IQL A;  4HCK A;  1UGV A;  2DTO A;  3VUZ A;  2CP5 A;  1LNX A;  1U06 A;  3JCM c;  5A0G A;  2ZZD A;  3DLM A;  5I2M A;  4II1 A;  3JB9 F;  3SD4 A;  3OYF A;  1U1T A;  2M9U A;  4C0G A;  4E7K A;  4XU1 A;  5CQY A;  5LJ3 f;  3TVT A;  2QA4 A;  1K4U S;  4HVV A;  1B34 A;  3RER A;  2FZC B;  3REA B;  3JCM f;  4GY5 A;  1VQ5 Q;  1IXD A;  4JRP A;  3A8G B;  1PRL C;  4DOW A;  3QDF A;  4M75 C;  5CVI A;  4C92 B;  1VQK A;  2X9H A;  4M7A B;  3L2V A;  3M53 A;  3OW2 S;  1ARK A;  2CZ7 B;  2EQM A;  5D6Y A;  4RCC A;  2HDA A;  1OU8 A;  3LWI A;  3VS6 A;  2LQN A;  1Q82 R;  3H9N A;  3I56 Q;  4IUT A;  4M78 B;  1UGQ B;  2DXT A;  2DYI A;  3CMA T;  2AIR B;  1T3L A;  1WHM A;  4BI8 B;  1K9M C;  2EJG A;  4PJM A;  2K2V A;  2LQK A;  1JBM A;  1J3T A;  2RQR A;  2EYQ A;  3G71 T;  3NTH A;  1ZSZ A;  3QWY A;  2B8A A;  2YUP A;  2G3R A;  2E3H A;  3SFM A;  5GAO n;  3OMC A;  1G3W A;  1N8R C;  3DLL A;  3VS1 A;  1Q81 R;  4MML A;  3CC4 A;  3EFS A;  4OB1 B;  1K9A A;  2ZCF B;  3DB3 A;  4HCZ A;  1O75 A;  1ZQ1 A;  2MK5 A;  2X4X A;  2KXD A;  3EGD B;  1UE9 A;  3I5S A;  2KYB A;  1CSK A;  1X6B A;  2RQT A;  4JZ3 A;  3M59 A;  3GNG A;  1H64 1;  1QVF P;  2KE9 A;  2XDP A;  4FU6 A;  2E10 A;  1JXO A;  2DL7 A;  3P8B B;  1D1B A;  4CC4 B;  4IKF A;  5D6W A;  3G4S Q;  4PLL A;  1PSE A;  1UEB A;  2FYK A;  4X1V A;  4ZTF A;  3M55 A;  1TWB A;  2VXF A;  2CH4 W;  1VQ8 A;  2QAZ A;  2X4Y A;  2EKH A;  4J9F A;  1YJW Q;  2I2L A;  2K6D A;  2DKG A;  3MO8 A;  2DLP A;  2V8J A;  4FIB A;  1RAF B;  3CME A;  1Q82 C;  1PRM C;  3V8J A;  4J9H A;  2RPN A;  4NOY A;  2FL7 A;  3CCV A;  4DA4 A;  1BCO A;  2H3J A;  2E6Z A;  2K3B A;  1OPK A;  4OMN A;  1K9M U;  1U8R A;  1K73 R;  2OJ2 A;  4PJO E;  2DL3 A;  2VXE A;  2WSE E;  1TSF A;  3ZBD A;  5HY6 A;  1JB0 E;  1KQS A;  1TS9 A;  3M54 A;  3C12 A;  4D8D A;  1OU9 A;  2M0O A;  1Q81 C;  1WDX A;  2DAQ A;  2F1L A;  5D7U A;  3CCL A;  4WF2 A;  4Q5W A;  1WHK A;  2O4X B;  4RUG A;  4DBH A;  5KYW A;  2HCK A;  1X75 C;  5CKD A;  1W2B A;  2EQJ A;  4E7I A;  2DIG A;  2RN8 A;  4HCB A;  1VQ5 A;  3H41 A;  5FU7 B;  2AK5 A;  2YRD A;  2L8D A;  2BZY A;  3G7Z A;  2X4J A;  4X9C A;  4MDX A;  3QPH A;  1C6V X;  3JCM J;  3BFM A;  1QP3 A;  1TTH B;  3TQ7 P;  4C92 G;  5GAN j;  1TH7 A;  2OTJ Q;  2LTO A;  2CT3 A;  4M7A G;  1OPL A;  2LJ3 A;  3CCM Q;  1NE8 A;  1RI0 A;  2KEA A;  2QTV A;  4M77 G;  1VQ7 A;  5FRM A;  1BYM A;  3C95 A;  2KNB B;  5FLX E;  1GRI A;  2HSP A;  1ZUY A;  2CGH A;  1YIT Q;  1Q82 U;  2I0N A;  5GAN h;  4RTY A;  5LJ3 e;  3E2U A;  1N5Z A;  4M78 G;  1JO8 A;  4JZ4 A;  2GQV A;  1VQ9 A;  2JTE A;  2XID A;  3URG A;  1D0Y A;  3CCJ A;  4JLG A;  2KQW A;  3INZ A;  3PVQ A;  5L23 A;  2P4T A;  2RA2 A;  3JCM e;  1TUC A;  3WXM B;  4FL6 A;  2XKO C;  1HD3 A;  2RHY A;  3M4G A;  5CKB A;  1M8V A;  3QSU A;  4OMO A;  3M57 A;  1VQ6 T;  1KQ2 A;  2CP0 A;  2E12 A;  1G83 A;  4M75 D;  3E9F A;  1YJN A;  1Q81 U;  5KYX B;  4QT7 A;  1GBQ A;  4FT4 A;  5AYF A;  1IHV A;  5LJ3 d;  5GMK m;  3N5B B;  3PIO A;  1YWO A;  1U5S A;  3H8Z A;  2HQH A;  1YCS B;  4BB7 A;  4FW1 A;  1MUZ A;  3RIR A;  4HKE A;  4XU0 A;  3JCM d;  3VUB A;  1Q7Y R;  2XD0 A;  2DL8 A;  4PFP A;  1BIB A;  2XK0 A;  2CUB A;  2R5M A;  2HAX A;  2MWP A;  2DVE A;  1QWE A;  5IAY A;  1XJW B;  3PTA A;  3QWX X;  3MEV A;  4OB2 B;  4RTT A;  2CP7 A;  2RQU A;  1RAB B;  3T9N A;  5FU7 C;  3CXC S;  1VQM A;  2JXB A;  3PFS A;  3VRY A;  3PNW C;  4JRK A;  4UC4 A;  1UUE A;  2LZ6 B;  1BB9 A;  2JM8 A;  5D6X A;  1M90 C;  4OML A;  1M5Q 1; 
#chains in the Genus database with same CATH homology
 4BD3 A;  1DJ7 B;  2EJF A;  3A8M B;  3FIF A;  4E47 A;  2HQX A;  5GAO r;  2K5F A;  2QI2 A;  2CZ6 B;  3A8L B;  4OP0 A;  4GLK A;  3M58 A;  5C6S A;  5DM7 R;  3OYN A;  2QTX A;  4MZM A;  2VYT A;  3HHT B;  1KQ1 A;  2IVW A;  3BDU A;  4QW2 A;  4M7D F;  2L89 A;  2PQW A;  3OSS C;  2EWN A;  3V7R A;  2DZ9 A;  4HCC A;  3CCL T;  1Y07 A;  4BDY A;  3CC7 A;  2M16 A;  1K73 U;  5GAN 2;  5J3B A;  3QG1 A;  3V8K A;  4ZN1 A;  3OY9 A;  1QW1 A;  2VC8 A;  3OMG A;  1VQO T;  4NS5 A;  4A54 A;  1UB4 A;  4MZT A;  2QXF A;  3S6W A;  2XDD A;  3I55 T;  4KBM B;  4LDX A;  1Y71 A;  3HRU A;  3M9Q A;  3G6E T;  2E5Q A;  4OB0 B;  4F7U B;  2GF7 A;  1LJO A;  2RM4 A;  2LDM A;  2X4W A;  4RCB A;  4N0A A;  4XTV A;  4QVC A;  3JSC A;  2P0K A;  2KDS A;  5KH6 A;  1I8F A;  4DOV A;  2A3L A;  2EQK A;  1XOV A;  2ZPB B;  2YLC A;  3QXE B;  2DEQ A;  4ZN3 A;  5LJ5 d;  5KE2 A;  2ZGW A;  4N0A C;  1YI2 T;  1VQL T;  1QVP A;  2VV5 A;  3JB9 J;  4OGC A;  2BUD A;  2F5K A;  3TCJ A;  4C8Q G;  4EMK B;  5GMK j;  2QDY B;  5GAM j;  1M1G A;  2GCX A;  1VIF A;  3JCM W;  3MP1 A;  1KC8 C;  1X01 A;  3NFC A;  4C92 D;  1BI3 A;  2RHX A;  3RKW A;  4M7A D;  2MAM A;  4BE2 A;  1PSF A;  4XAX B;  1AHJ B;  2RI5 A;  3LLR A;  3RMQ A;  4BUG A;  5HKC A;  4HT8 A;  4M7D B;  1HK9 A;  4A4K A;  2E6N A;  3CCE T;  2QQR A;  4VUB A;  3JB9 D;  1VQ7 T;  3MET A;  3I56 A;  1KG1 A;  1NPR A;  3JCM P;  1FWZ A;  4M75 F;  4J5Y A;  2QQB A;  2KK4 A;  3BY7 A;  3L2Z A;  1S72 T;  5L8R E;  1UGP B;  4XTY A;  2E65 A;  4F7U E;  2OTJ A;  2WAC A;  3ME9 A;  5LJ3 g;  3A8H B;  4J8O A;  2E70 A;  2GFU A;  3QJ6 A;  3CCR T;  3SWN A;  1OYX A;  2RJE A;  3GF5 A;  4C5G A;  4Y28 E;  3OYY A;  1W4S A;  2CZ0 B;  1VQ9 T;  3C4S A;  2RD1 A;  2M1H A;  4QQD A;  1UGR B;  5IT9 E;  3RMS A;  3LYI A;  3CCJ T;  3SWN C;  3ZEH A;  3CMA A;  4M7D G;  3JCM b;  3JCM g;  2EKO A;  1WGS A;  5GMK i;  5C0M A;  3MP8 A;  3UDC A;  1WQW A;  3WVD B;  3ZFJ A;  1YIT A;  3CBM A;  2DK3 A;  1N9R A;  3OYM A;  1K73 C;  4IUV A;  1M4Z A;  3CXC A;  3SB2 A;  2QQ9 A;  4LDW A;  3LGL A;  4ZGE B;  3G71 A;  2DJZ A;  2ZPF B;  3RUX A;  3X24 B;  4M7D E;  4XTX A;  2XIC A;  4JUV A;  2E41 A;  3SDZ A;  1G3T A;  2K3Y A;  3QYH B;  1Y96 A;  5GAM f;  3V7C A;  3M5A A;  4LDV A;  3OS1 A;  1WNL A;  3HPW A;  2JOY A;  1YJN T;  4MMK A;  3HSB A;  3MEU A;  3QYG B;  4QQ6 A;  5I21 A;  1JJ2 A;  3GPL A;  1X6O A;  4M75 B;  5GAN f;  3UPU A;  4BAC A;  1I4K 1;  1YBY A;  5J39 A;  2R57 A;  3OB9 A;  2RHU A;  2BKD N;  4A4H A;  1ZBX A;  4C8Q A;  2O4X A;  2RI2 A;  4DQ2 A;  5DLQ E;  3O8V A;  1R8O B;  4C0Z A;  1QVG S;  1G3S A;  2EJ9 A;  2YRV A;  2PVG B;  4V2S A;  2FB7 A;  1V29 B;  3OYB A;  3E1S A;  1UGS B;  4C8Q C;  2CS7 A;  2Y90 A;  5GAN 7;  2X35 A;  3FDR A;  3G4S A;  1NZ9 A;  3MP6 A;  5CK9 A;  1OZ2 A;  2KY9 A;  3HP9 A;  2FVU A;  3HFN A;  3J80 E;  1YJ9 A;  4M75 G;  2VUB A;  4OGE A;  5A2Q E;  2HNI A;  4M77 A;  3VJP A;  2D6F A;  1SSF A;  2OTL T;  5LJ3 j;  3CME T;  4PJO D;  3E19 A;  3FC3 A;  3S3M A;  4A4F A;  2KMT A;  2KSS A;  3L42 A;  4FM4 B;  3BW1 A;  4MDW A;  4ZTJ A;  4J6X A;  2KAF A;  3CPF A;  3GNF B;  1VQM T;  2MI6 A;  1YJW A;  4M75 E;  4F7U F;  5GAN 5;  1YHQ T;  1Q7Y U;  1EIF A;  4XQ3 A;  4QVZ A;  4J7I A;  1VQP T;  3X28 B;  3X26 B;  1P92 A;  3LGF A;  4M7D A;  2R5A A;  5LJ3 h;  2P0P A;  3GOX A;  1MGQ A;  2L3R A;  4L6V 5;  3OYH A;  5LJ5 g;  2E1H A;  1N9S A;  2E64 A;  3PT9 A;  4ELZ C;  4JDS A;  1VQN A;  3R6O A;  3WVE B;  4M7D C;  5CCA A;  2K3X A;  3S3O A;  5GAM e;  5GMK e;  3JB9 H;  2QEX A;  3F70 A;  1RL2 A;  2LNV A;  3JCM h;  1LOJ A;  3MCA B;  4C5I A;  3J7A F;  4EDU A;  2QQA A;  4LDU A;  3E9G A;  2OAU A;  1D3B B;  2DTO A;  4C92 F;  3VUZ A;  5GAN e;  1LNX A;  4HA8 A;  3JCM c;  3DKM A;  2QQS A;  3KXT A;  5A0G A;  2ZZD A;  4Z02 A;  3DLM A;  5I2M A;  4OMF B;  4O6J A;  4II1 A;  3VV0 A;  3OS2 A;  3OYK A;  3JB9 F;  4D6W A;  3SD4 A;  4KT0 E;  5CR2 A;  5GAO p;  3OYF A;  1U1T A;  2M9U A;  2RH2 A;  2XI9 A;  4C0G A;  4E7K A;  4C5H A;  2PUK B;  3S3N A;  4XU1 A;  5CQY A;  5LJ3 f;  2QA4 A;  3CC7 T;  3JRZ A;  2V8K A;  2DZC A;  2JVV A;  5CKF A;  1N8R U;  1B34 A;  4XK8 E;  1IRE B;  3JCM X;  1VQ5 T;  3RER A;  3LW5 E;  2JN0 A;  3JAM E;  2LX9 A;  1N27 A;  3CBP A;  3FB9 A;  2ZPG B;  1MHN A;  2RJD A;  4M75 A;  3JCM f;  4C0D C;  4GY5 A;  2P0Q A;  4OVA A;  3RES A;  3A8G B;  4JRP A;  2NLU A;  4DOW A;  5GAN d;  4IUR A;  3I55 A;  1BI2 A;  3PMT A;  4M75 C;  5CVI A;  3VYG A;  4C92 B;  4F7U G;  3G6E A;  4BDZ A;  1Q7Y C;  1VQK A;  3MEA A;  4M77 D;  4M7A B;  2DO3 A;  3L2R A;  3TRE A;  3L2V A;  3M56 A;  3M53 A;  4FT2 A;  3OW2 S;  4E7J A;  2RK2 A;  2ZPH B;  1IZ6 A;  3I56 T;  2CZ7 B;  1H3Z A;  1QVG A;  2EQM A;  5D6Y A;  4N4H A;  4BY6 C;  4RCC A;  2XG8 D;  5CIU A;  5LJ5 j;  1U1S A;  3LWI A;  3J81 E;  4M78 D;  4L59 A;  4RG2 A;  3OS0 A;  2XU8 A;  2D9T A;  4B9X A;  3CCM A;  4Y91 A;  4PLI A;  4IUT A;  1JRI A;  4M78 B;  5DY9 A;  5KCH A;  1O9S A;  2JNG A;  2DD5 A;  1M9S A;  2RO0 A;  5GAO q;  1UGQ B;  2DXT A;  4KUD K;  3NTK A;  3CMA T;  1N6A A;  5EG2 A;  5LJ5 h;  3ER0 A;  1I5L A;  4IUP A;  1WPY A;  2JTF A;  1KQS S;  4BI8 B;  1K9M C;  2EJG A;  3OYD A;  3P8H A;  2K2V A;  2DTH A;  2LQK A;  1JBM A;  4BI4 A;  2MF2 A;  4C92 E;  2EYQ A;  3FRN A;  3G71 T;  3OYA A;  3NTH A;  3OBY A;  3CCS T;  1VQ4 T;  4M7A E;  4EMG A;  4BI3 A;  2B8A A;  4IUU A;  1BI1 A;  2Y4X A;  4E7H A;  2G3R A;  3SFM A;  2CYZ B;  1XNI A;  4PJO F;  1NJI C;  5GAO n;  3OMC A;  1G3W A;  4X34 A;  1N8R C;  3CC2 T;  3DLL A;  1NPP A;  4MML A;  4X9D A;  4OF1 A;  4IUQ A;  3P8D A;  1W2B S;  2JZ2 A;  3EFS A;  4OB1 B;  3ASK A;  1FXX A;  2DXC A;  3CCQ A;  3CC4 A;  4C0F A;  2XDB A;  2D0Q B;  4ZGJ B;  3PMI A;  2ZCF B;  4QQG A;  4M78 E;  1VIE A;  3DB3 A;  4HCZ A;  3OYC A;  4JLI A;  3CPW A;  2HQE A;  1O75 A;  3X20 B;  1ZQ1 A;  2X4X A;  4PNO A;  4XU2 A;  4B9W A;  4JRQ A;  1VQ6 A;  3A8O B;  5LJ5 f;  5CAI A;  3H6Z A;  3OYE A;  3TU4 K;  3VKI A;  3HKS A;  4F7U A;  3BDL A;  3M59 A;  3QII A;  3GNG A;  5CKE A;  5GAN 8;  3G4S T;  1YIJ T;  4A4E A;  1YJ9 T;  1QVF S;  2KVQ G;  1H64 1;  3M4Y A;  2XDP A;  4OB3 B;  4FU6 A;  1KD1 C;  1KHI A;  2E10 A;  3HFO A;  1GXI E;  3P8B B;  4XTW A;  3V8L A;  4IKF A;  3CD6 A;  5D6W A;  4EMK A;  2FYK A;  1PSE A;  1OZ3 A;  1UEB A;  3NTI A;  4PLL A;  3LWH A;  4ZTF A;  4LDY A;  2AHJ B;  1K8A C;  3EAE A;  1FX7 A;  4PJO B;  3M55 A;  1YJW T;  2RI3 A;  2VXF A;  4EMK C;  4MZP A;  1VQ8 A;  2X4Y A;  2DXU A;  4RG8 A;  3OA6 A;  3PIP A;  2I2L A;  2K5L A;  3VYH B;  2CZ1 B;  2DKG A;  4PL6 A;  3MO8 A;  3MHX A;  2V8J A;  3SWN B;  1OI1 A;  3LX7 A;  4FIB A;  2OTL A;  3HRS A;  3CME A;  1VQN T;  1Q82 C;  3C94 A;  2EQU A;  4N4G A;  4XU3 A;  3V8J A;  3OYJ A;  1M1K C;  2QEX T;  3UT1 A;  3OW2 A;  5KCO A;  4NL2 A;  3KUF A;  4NOY A;  4PJO G;  4NL3 A;  2FL7 A;  3CPW S;  2MMP A;  3CCV A;  5GAN g;  4DA4 A;  2A7Y A;  4YTL A;  5GAO l;  4M7A F;  5FU6 B;  4ATO A;  2H3J A;  1VQP A;  2E6Z A;  4ME7 A;  2YLB A;  2R58 A;  2K4Y A;  2YHT A;  3JCM Q;  3L1A A;  1K9M U;  4JS5 A;  4M77 F;  1U8R A;  2K5I A;  2VGM A;  2LVM A;  4JJN K;  4PJO E;  2LQ8 A;  4XTU A;  2VXE A;  3CBO A;  2HBP A;  2WSE E;  3CCU A;  1BIA A;  2WSF E;  4JRI A;  3ZBD A;  3PGG A;  1Y96 B;  5LL6 S;  4XTZ A;  1YIJ A;  5HY6 A;  1JB0 E;  1KQS A;  4M78 F;  5A0D A;  2QA4 T;  3RKY A;  1NJI U;  3M54 A;  3V7S A;  3C12 A;  4CI0 C;  2M0O A;  1Q81 C;  3QUI A;  4A4G A;  2DAQ A;  2LT4 A;  4C8Q D;  3CCL A;  2RJC A;  2F5T X;  5GAM d;  1XQH A;  4WF2 A;  2IG0 A;  4Q5W A;  3RKX A;  2LT1 A;  2O4X B;  4C8Q B;  4EPC A;  3OYI A;  1WQ7 A;  2DTI A;  5HK0 A;  1VQO A;  2C06 A;  2MWO A;  2JUF A;  5FRO A;  1X75 C;  2GFA A;  2EIF A;  2PU9 B;  5CKD A;  1BI0 A;  1VQK T;  4E7L A;  2K57 A;  1W2B A;  2EQJ A;  4E7I A;  1WJQ A;  2DIG A;  1Q86 C;  2RHZ A;  1QP2 A;  5HK3 A;  3OS5 A;  3QDR B;  4HCB A;  2LC4 A;  5M9O A;  2HD0 A;  4M77 B;  4RMO A;  1VQ5 A;  3CEY A;  5FU7 B;  1VQL A;  3L2Q A;  2RK1 A;  1YI2 A;  4PKC C;  1BKB A;  2L8D A;  3G7Z A;  1KD1 U;  3QZ9 B;  2X4J A;  4X9C A;  4MDX A;  2OTJ T;  5J26 A;  2DIQ A;  2LCC A;  3QPH A;  3CCM T;  3JCM J;  2FHD A;  3BFM A;  1QP3 A;  2LCL A;  2EFI A;  2V8I A;  3QBY A;  4O5V A;  4M7D D;  1K8A U;  4L5G A;  3HRT A;  4C92 G;  5GAN j;  1QVF A;  1TH7 A;  2LTO A;  5IN1 A;  4M7A G;  4PJO A;  1NE8 A;  4C8Q E;  3CCE A;  1RI0 A;  1M1F A;  2EAY A;  5KE3 A;  1YIT T;  2DPP B;  3OQ5 A;  3JB9 I;  4M77 G;  1VQ7 A;  5FRM A;  1BYM A;  5GAM h;  5GMK h;  3C95 A;  3QHS A;  3FJP A;  2ZPI B;  2PVD B;  4JS4 A;  4PJO C;  2DD4 A;  5FLX E;  3JB9 G;  1WJR A;  1S72 A;  2CGH A;  2JTM A;  5GAN 4;  1Q82 U;  5GAN h;  4J6Y A;  2CKK A;  1M1K U;  1G3Y A;  5LJ3 e;  3CCR A;  3L2U A;  4ZGD B;  4M78 G;  3FEO A;  4LD6 A;  4KUI A;  2GQV A;  4M77 E;  1VQ9 A;  2XID A;  3Q1J A;  1YCY A;  3URG A;  5GAN 3;  3QO3 A;  1I81 A;  3CCJ A;  3QKJ A;  4JLG A;  4FSX A;  2KQW A;  3INZ A;  5FRN A;  4KUL A;  1D3B A;  2P4T A;  2RA2 A;  3JCM e;  3CC4 T;  5CQX A;  3WXM B;  3CCQ T;  3OSV A;  4FL6 A;  4J83 A;  2XKO C;  5CKB A;  2RHY A;  3M4G A;  3UWN A;  3KBG A;  1M8V A;  3QSU A;  1M90 U;  2F69 A;  1Y7X A;  3M57 A;  4BE1 A;  5FU6 C;  3CCS A;  4RKU E;  1VQ4 A;  2BIV A;  1KQ2 A;  5CKH A;  1VQ6 T;  3AHU A;  2L5Q A;  5GAN 6;  2VGN A;  2E12 A;  1ZHI A;  3GIB A;  3HL8 A;  1B34 B;  4J6W A;  4C0D B;  4M75 D;  3E9F A;  1YJN A;  4EMH A;  1Q81 U;  3CC2 A;  1KHC A;  3GLX A;  4HT9 A;  5AYF A;  4FT4 A;  4QVD A;  5GAO m;  1HXD A;  4J7F A;  5LJ3 d;  3N5B B;  5GMK m;  3PIO A;  3X25 B;  3CD6 T;  3QZ5 B;  3L2W A;  2XHC A;  3H8Z A;  2ZPE B;  3A5Z B;  4BB7 A;  1VUB A;  3LH0 A;  5CO7 A;  4BY6 B;  3RIR A;  4HKE A;  4XU0 A;  3JCM d;  3OYL A;  1Q86 U;  3VUB A;  1VQ8 T;  2XD0 A;  3MEW A;  4C92 A;  5A0L A;  4TVR A;  1BIB A;  2XK0 A;  2R5M A;  2RJF A;  2HAX A;  4M7A A;  3VU3 C;  3OYG A;  3GP8 A;  4CRI A;  2MWP A;  2DVE A;  4P5N A;  5DLO A;  5IAY A;  3PTA A;  4C92 C;  1G5V A;  4BE0 A;  4R56 A;  4M7A C;  3MEV A;  4OB2 B;  4C8Q F;  5GAM g;  1KC8 U;  2RHI A;  3QJY A;  4ELY C;  3T9N A;  1WJS A;  2O01 E;  4R55 A;  4M77 C;  3DB4 A;  2PVO B;  5FU7 C;  2LRQ A;  3CXC S;  1VQM A;  2RB6 A;  3CCV T;  3PFS A;  4M78 A;  2DXB A;  3FLG A;  1YHQ A;  4N4I A;  3PNW C;  3JCM V;  4A53 A;  1XTD A;  4JRK A;  4C5E A;  4UC4 A;  5I2S A;  5GMK l;  4LD9 K;  4M78 C;  3OBW A;  2Y4Y A;  3TEE A;  2PUO B;  5D6X A;  1M90 C;  3CCU T;  3EFR A;  2WSC E;  5LJ5 e;  1M5Q 1;  1JJ2 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...