4PLNC

Crystal structure of chicken netrin-1 (ln-le3) complexed with mouse neogenin (fn4-5)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
205
structure length
205
Chain Sequence
GSDETRVPEVPSSLHVRPLVTSIVVSWTPPENQNIVVRGYAIGYGIGSPHAQTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPHTVPDPTPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNIPANTKYKNAQATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGATASG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Neural migration. Structures of netrin-1 bound to two receptors provide insight into its axon guidance mechanism.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords Netrin-1
total genus 24
structure length 205
sequence length 205
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4plnC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4plnC01
3GM8A 1ORQA 3LHPL 3RIFK 1KV3A 1V3KA 2HH0H 1MF2H 1FL6A 4YAQA 2FLRT 4JKWA 4WI7A 4H0GA 3VFNB 2R0WH 4JREC 3UJJL 4XZUA 5KSVA 4LPYA 3VRIA 1R3IL 3QNZB 2CRZA 1KPVB 3N50A 1KEGL 1YEIH 2KPNA 3KNBA 1QVOA 4LPTA 5HHMD 4L4VB 4JVWA 1MCNA 2FWOA 4LASH 1S7VB 3ZDZF 2HFEB 1BGXH 3T2NL 1RUML 3BJ91 3U1SL 3V5KB 2R69H 4N90E 5CEXA 4K94L 3UX9B 5CEXB 4GUPB 3MFGB 1CE1H 2DL2A 3KYMB 4KUCF 4QCIB 2EDOA 3HB3C 1R0AL 4U1NB 4JFQB 3MREB 1QFWH 1YMHB 2MPAL 4JCMA 4MXWL 3F8UB 3RWIB 2R4SH 4ZSOA 3MRNB 3U7YL 2GEEA 1RIHH 4DVBA 1JWSA 3SDYL 4PJDA 4OAWB 5DJCB 2NY0C 4MA8L 2QQKL 3L3OB 3TA3C 1JGVH 4OFKA 4JRYD 2XA8H 2VH5H 2VQTA 3H9HA 3DIFA 4FTVB 3IFOB 3KPOA 3NIDE 4PGJA 5EZLB 1JHTB 3D87B 5CGTA 1DN0A 4RFEB 4MAYA 3ULVD 1F42A 2ADIB 5D7KE 5D7JC 2F19L 4O51B 5I75B 4NQXA 5CP3H 3A6CL 1YUHA 1S7UB 1P5UA 2XKNB 4EOWH 1U8KB 4KKBC 1PKQE 4NWTH 4XWOC 2AEPH 1MIEH 2PTTA 4UUJB 5F21B 2JB5H 3V6ZB 4BUHA 3GSXB 3BYYA 3G6JF 3MPCA 1CQKA 3IGAA 1E4XH 1FL5B 1R3KA 3DMMD 5C08B 3VH8A 4I3SH 4LLDB 1YZZA 3ZT6A 4ZD3L 3HUJB 1I1YB 3BVNA 5J13C 4CNIA 4RGMC 3A6BH 1CGTA 3JBG7 4I1NB 2FIRT 3E2HC 2XFXA 1CE6A 4P23C 1HI6A 3JWOH 5KSAB 2NLJA 1MHCA 4WWID 4KVCH 1WZMA 4OLYL 4DZ8A 1Z0NA 3RUGF 5TQ0L 1ZLWH 3ISWA 2R56L 4LCIH 4YBQC 4JN2B 2BSRB 1XR8A 4C4KT 5DJ0A 2FZ3A 1HHGA 3TJEL 3QUZA 2RJMA 3MGTA 2MKWA 1GL4B 1BQHG 15C8L 2MSPA 3EKCA 4OZHF 4PB9H 3WO3B 4QT5B 4TSCH 3OPZL 1WEJH 3C2AH 3GHBL 2OLDA 4LLUA 5E4EB 3WFBH 4BFEA 1BWWA 5EU6B 3L5XH 1UQSB 2GITB 1W72H 1EJ6A 3V6BR 4HUXB 2BSSB 3F7VB 3NCFB 1XF4A 3FAWA 1BQHA 4DJMA 1A4KB 5K9QG 1NKOA 5BRZB 3QXAA 1AH1A 1JUFB 5TGBA 2I9LA 1NC4D 3MJ7A 3NVQA 5DS8A 2OMNA 5DMKB 2LU3A 3DTXA 2CUIA 3S36H 3CX5K 1F13A 4OZIA 1CTOA 5C0BD 3ZKQD 1P5VA 2QHLA 4PRBA 3L5HA 4B5EA 4U2YA 4R7NA 4MD0B 5IM7B 5IQ9B 5K59F 4FABH 4YNYA 5BVJA 3DX9B 4BSJA 1HHHB 1F45A 2BOBA 4JREB 5BS0B 3LQZB 1PJ9A 4M3KB 4YNYB 4DQOL 3N9GH 3KPLA 4PLKD 1QNZH 3RZCC 4TVPL 1KC5H 1MWAL 2CD0A 5DRWA 1FFOB 3GRWH 4MMZC 2DQIL 2XY2A 4OGZA 2O93L 3HI6H 5C8JB 3WUZA 2XZZA 1PG7X 3SOBH 4YHIB 3Q1SH 4M8QA 5GZOC 2A74A 3KPRD 1KB5A 1CG9A 5GS2D 4NZDA 1MFEH 5CBAB 3TC9A 1NAKL 1U42A 3DSFL 3QDJA 4RDQF 2K1MA 5FDWB 2M8XA 2GI7A 3QIUB 3SY0B 5DSCA 4BH7A 2X1WL 4Z76B 5FV2A 3RHWK 3EDDA 3GSWB 4NFBA 5KN5B 1F3DH 3PL6B 4LCYB 2HJFA 1J1PH 3G6JE 3H9SD 2XG4A 4WI9A 5I2IA 2AQ1A 4YFLI 1RUPH 2DQDH 1D9KB 2WANA 1S9XB 3NFPB 1PG7L 4Z7NE 3B4NA 2FSEA 5C3TA 2VDRH 3KXFD 4PG9B 4JPVH 2R1WB 4Y4FD 2IMNA 1KJ2H 3DTXB 4QHNA 5J9PB 4PB0L 4KZDL 1EEUA 3OAUH 3ZHLA 1P1ZA 2B2XH 2MKLC 4K3HA 2IBGA 5JOEA 2P8LB 4QHLA 4NJAH 4UIMA 3T65A 3BN3B 4JJHA 1BOYA 5ABDE 4HKJB 1NC2A 3GMRB 2A74B 1SJEB 5DUPH 3HI5L 4WTXA 2W07A 5FO9A 3PJSB 4IHOA 1JL8A 2CGRL 2VLLA 2VR9A 2OZ4H 4P59L 4MGXA 2WZPD 1RSFA 1JYNA 4WFGD 2Z8WC 3NAAL 3NFPA 5D7IB 2F5BH 4P3CH 1C16B 1RI8A 1BMGA 3D69A 3B2UC 2ZUQB 3THML 2R1XB 1XCQA 2PO6C 4GAJH 4XH2A 2H45A 2GSIA 1NCAH 4Z76A 3GMLA 5I1CL 4PRBB 2J12B 2VXUL 4HK3N 5T3ZE 1P2CB 4P2CG 2J5LB 2B4CH 2NXYB 1TPXB 4UAOC 2CLZB 3H9SA 3TZVB 5B8CC 1KC5L 2X89D 3SKMA 1TCMA 1JNHB 1I4FB 1P4IL 4NKDB 4NSKA 3QDGD 1MPAH 4LARH 3U9UA 4HWBL 3SKNA 3EAKA 4NCC2 2IG2L 2F54A 3NZHL 2VWEE 4HF5H 4WENB 1PZUB 1W0VB 1NFDE 4I0PB 4UQ3B 3V9FA 1KTLA 3LCYA 1E4WH 4EBQL 1OVZA 4JRYE 3PF2A 4LQFH 1YUHB 1NLBL 3OAUL 3AS1A 4CMHC 1TZHB 3RL2A 5ETUB 4Y2DB 4P5TD 4JPVL 3T0WA 3IDIA 4ZUUA 3HZYB 4JN2A 5T1KA 3FQUB 4JRXD 4L1DA 4Q0XL 4P5MA 4A6YB 3LRSB 1BOGA 5F1SA 4R2GB 5SX5K 1DN0B 4RFEA 3GO1L 1UGNA 4XWOD 1NCCL 1WEJL 4RGNC 1FYTA 5E99L 4JY4A 3UMTA 3WLWD 1MHHA 4U1KA 4PJGF 2NY3C 2P45B 1J8HB 5E08H 1WT5A 5FM5M 3TYFB 2CXGA 3I6KA 5IEKB 1BQSA 1MAKA 5FYKE 1UYWH 4HCRA 3RWCB 4WI2A 3EJJX 4PJGA 2BY1A 2EYTA 3S98A 3L3KB 4OD1H 2P47B 1JPFA 4PRHD 4LIQH 1A6TA 4GLRH 3S5LA 3O9WA 1CLZL 1BJMA 3GBML 3CLFH 4U0RC 1XZ0A 1MFDL 1GC1C 3FOLA 2H2PD 2J8OA 5CHNB 3AS2A 1JPSL 1YEEL 4YHLH 5DYOA 3L7EA 1EMTH 5AG9A 1IE5A 1CD0A 1AO7E 3WLBA 1LDSA 1B0GB 2HMIC 3PNWA 2EDEA 4S0SD 1A6VH 1PFCA 4X4XA 3VWJD 1Z9SA 5C0AE 2IAMD 4PLNC 3KLAA 5FO8B 2CIIB 1G9MC 3FO9B 3V4UH 5GS3A 3JTSB 1HSAB 1B6UA 1HWGB 3WV0A 1FO0A 1A1MB 4PYHA 4QRPB 4R4FL 5EC1B 1RZKH 4HWEL 3R1GL 3FRUB 5FB8A 3TIDB 1RHFA 4KXZH 5ADPL 3E6FA 3N1QC 2FIKA 1K9TA 1KYOK 2DYPD 4XVTH 3MLZL 5I75C 4OLZL 3VMOA 3UBXB 2LE9A 2Y25A 2ZCLH 1JGUH 4H5SA 5INCB 1CT8B 3TJEH 1TFHA 4PRID 4KI5D 1U8LA 4MMXC 4PJEA 1U3ZA 2HKFL 2VR4A 2DM7A 3HN3A 4KPHL 2OL3A 2P5EA 4X7SL 3U2SA 5JDSB 1AY1H 3KPNA 4WWKD 4XWGL 5F7UA 3MUGA 1QFWL 3CX2A 4D8PB 1UCBL 1WWAX 4KKCC 2A6IB 4R8WL 1CFTB 4OIIH 2NNAB 3KLDA 5J11B 4MA3A 5EZIH 4DGVH 3PGDB 5D1QC 3L6FB 1DQJA 1AO7B 3IDNB 4W6WB 1WVZA 1OGAE 1T22A 4HZLB 1C7SA 3VFTB 1T66C 5D7LD 5D2LE 1UWEH 3DNKA 1R3IH 5GGSA 3ALXA 5CZXC 4MHHG 3QUYC 1YEDB 4R8WH 2Q6WA 4F9LA 5BMFH 4NZRL 3OX8A 3QFJB 3ZSTA 4EOWL 5JNYB 5FAAA 4JAMA 2WM0A 2R23B 3RTQB 4NQCE 3U46B 3UTTB 4X8JB 2F19H 2H2PC 1B3JA 2QKIB 1L9NA 4UV7L 5JW3H 1JNJA 1EAPB 3I2CL 1A2YA 1JWUB 3HRZA 1H5BA 2NY7L 1WUNT 3HE7A 3DV6A 5CKGA 5GGUA 2DLTA 3K0WA 3VD3A 3RZCD 2GFBA 3P0YH 3HC4L 4HWZB 4HPOL 2EKSB 1I3UA 5J3HC 3DOSA 2LU7A 3SDYH 2YC1B 1GZQA 4NQEA 3RY6C 4WDIA 5HGGS 4AMKL 3TEUA 3IKCB 4N8VG 2IANB 1RPQA 1LP9A 4L8DB 5H37H 4KY1L 1WZKA 1R3HA 2MPAH 1G7MA 4EUPH 2D2OA 4ODXB 5DD0H 1CCZA 4PP1C 2YD2A 3HPLA 4WGWB 3STZA 1E28B 3AM8A 3P0VL 4KKLC 4NUJB 3ESUF 1K8IB 1T22B 3SJVA 3MRHB 4YXHL 3PWPA 1F2XK 3BHBB 1T1ZA 4ZUWB 4XPHH 3LS5H 2NXZB 4GG6B 4IMLA 4P9ML 4K9EH 4F7CB 3SGKA 1F8TH 3ULVF 4F37K 3RVTC 1UZ8A 4XCFL 1QR1B 5E6ZA 3AREC 1JPGB 1T5XB 3ARXA 3KPSE 3NACL 1AXTH 2H8PB 2DM3A 4BZ2H 3MSPA 4LEOB 2EXYC 4FFYH 4OLXL 4FQ2L 2QTEA 3HMXH 3MROA 1AGEA 2KQMA 2Y06H 3AMKA 4WTZG 4QHLB 4XP9H 3SE3C 3EHBC 4L4VD 4NKMB 4CW1A 4X5WB 4PLOB 4ZTOH 5F89B 1TMCB 3RTQD 5C08E 1EX0A 3I2CH 4N9GA 5ALCH 4IMKA 5EPMA 4NBXB 3PWJB 4UT7L 2C26A 4Y2DA 2DWEA 4OCNC 1FNGA 2HT2C 2GJ6D 3S97C 2DI7A 3TBVA 1FORH 3UPAA 5HDBF 1YMMA 2NY1C 1OLZA 4I0PA 3U9PH 5I74B 1JN6A 2A9ML 3JTTA 4LKCA 4UNTA 4KMLB 2E6PA 4Z7OE 2CDEA 4QOKA 5KS9B 4GKNB 3CXHK 1G7LA 5K9OA 3O9WB 2VLMD 1CDYA 4WFFD 4GKSA 4Q0XH 4PJ9A 3QUYD 5LBSL 1DBAH 1D5ZA 3ARBD 4L29A 3SDCB 4PJFF 2R4RL 2PTUA 3BN9D 1FG9C 4NRZB 2EE9A 3STLA 4QTIL 1JGDA 5SWSA 3QG7H 4FXGB 4P3WA 1CDBA 5FHBH 3BE1L 1PKQA 4EUPG 1AP2A 1E6OL 1YEKL 3F12B 1WC7A 5T1LA 1WGOA 3FJTA 1T2JA 1RY7B 1JWMA 4LARL 5LXGH 1DFBL 4KTYA 4O2FA 3VRLE 1NGWB 5GS1C 5ESAA 4BQCA 2ZCHH 3VD7A 1TZHA 3AM8C 4BUGA 3OWEA 3OG6B 3HG1B 1FH5H 1DVFD 5TDNA 3RY4A 4QXGL 5D96C 5F3BA 1HDMA 1AHWB 1YNLL 5KVMC 4E42A 1XGTB 1UWGH 5EOTB 1JF1A 4HT1L 5ADPH 4KJYB 3QDAA 1LILA 1RZJC 2LFGA 3VWJC 1KGCD 3L1OH 5J06A 4LPWA 1O0VA 3IJHB 1VEOA 1IGCH 1F3JA 3N85L 3I6LE 1G7HB 2P24B 4LLUB 3FAXA 4TULL 1LO5B 2WQRA 3D39E 3KPPA 4ZO6A 3TH3T 5C0RH 2FH8A 5I15L 2B1HH 3MRIA 3JV5A 2ITDB 1X5GA 3OHXA 5F9WC 4OB5H 4IMKC 1NEZB 5HGHB 3MGTB 4IRSA 3QFDB 1HZHH 2W1NA 3RWHA 3SDXE 1WBZA 4P2YA 1ZANL 1MI5D 2XZAH 3QPXH 4S11A 4H8WC 3BZDA 1ZLUH 1F4XH 4J6RL 3NCBB 4FFZL 4KTDH 4GW4B 2W92A 3QIUA 4HIJB 1FZJB 2MCPH 1A4KA 4YHLL 4GT7A 5GJTH 2DDQL 3IFNL 3L7FA 4KRPB 5MI0C 3SGDI 5F7WC 5JUEH 4OCRL 5IR1A 1LQSR 1IM9D 4G42A 2XZQH 3ME0A 5FYJE 3LB6C 3MODL 4FXKA 4ZTPL 4I0CC 5BV7C 5CS7A 4PRHE 5FYLH 4AG4L 3RP1A 5IB1B 2R2CA 4HXAH 1N64H 5DMIL 3Q6FA 1I9JH 1YDPA 1HH9A 4W4OC 4KK5C 2EIBA 1S78C 4G6AC 2A77L 1ROWA 5IVOA 3HKFA 3VFRA 5IKCA 4JPWL 4YPGB 5I18L 4HIEB 4GRLC 1SBSL 1SEBA 1LEGB 1OAKL 1JUFA 4C4KO 3GK8L 4D0DB 2GTWA 1OAYH 3IDXL 3MNWB 5I1HH 2VLKE 1W0WB 1FVCB 3TNNB 4LQFL 4DKFL 4HIXH 3HMWH 1JTTA 2O5ZH 3O6KH 3PHQA 4QRUA 4QLRA 3LKNA 5JW4R 4GG6E 3QDJB 5IR1B 3LIZL 3NABH 4JKLA 5ALCL 2RCSH 2VLRB 3FN3A 1MHPH 3MJ9A 3L5WA 1G9NC 4JHWL 5C0CA 1P6FA 2V17H 4MLSA 3L7FB 4WW2C 2AABL 4OZFB 4M6MH 4IOFC 4KRLB 2Z4QA 35C8H 1I9IL 1C12A 3MREA 4NQDA 2B0SH 1KIQB 3QULB 3V6OE 2Z8VC 5CBEA 5AD0A 4NUJA 3MRIB 2YRZA 4U1MA 2FBJL 3OSKA 5T1LB 4Z0BL 3QCTH 4Z78A 4HEPG 4JPIB 1E6JL 3C6LD 3WDHA 4HKXB 3BIAX 4JDVA 1NCBH 5HDOA 4PB9L 5DUBA 5HYQB 2A0LC 4OM1H 3UTQA 3L3OA 1TZGL 1T4KA 4JO1L 3QXAB 4YDKL 3ULVC 5F9AC 2CO7B 5H2BB 5D7IF 4NRXB 4JVPA 3DLQR 3IJSA 1S7RB 3B43A 3ARDA 4P9HH 3GSNA 5FYKH 5T1MB 1JCKA 4DN4L 1D5ZB 4YXLL 3IRPX 5E8OB 3IETA 4LGPB 5KVEH 3D85D 4S1QH 5F1IB 1VEMA 4I3GA 2WUBH 4MJ2A 1QFUH 4FN0A 4RGND 1DBML 5FKPA 2DQEL 1OTUD 1XGQB 4JZJC 4XX1E 3SDAB 2Y7QB 2ZCKH 3TCLB 4L4VE 4P2QE 3T1WA 2BCKA 5LKNA 1U8MA 1V05A 2VXSL 1KXQE 2AJXH 4K3EL 3X12B 5HPMA 2ESVA 5EBGA 4ZO7A 3IDJB 1G6RL 1PG7H 1WTGT 3ULUC 2GTZA 1IAKB 4X6EA 3HI1A 3RI5F 3WDIA 4M61A 2HRLA 4JFYA 2BJML 1A6ZA 2UZIL 1AO7A 2F5AL 4PBVC 2JELH 3MJ8A 2CLRB 4OFYD 5I71B 2J3SA 3DXAB 4G9DA 1GJIA 1J88A 2EKJA 3ZDZE 3IFLH 4NHUB 5J3HD 1IAOA 1NGZB 2XQBH 3LV3A 3QXWA 1MNUH 4MQTB 2A6KB 2C1PA 3O3BB 1ACZA 3JVGC 1H3XA 1BFSA 2EDQA 5K9KB 2IPKB 2R29H 1KCUH 3MMEA 1IFHL 3BWAB 3EYSL 5I8OL 3FB7A 1AGDB 4LL9A 4HC1A 3ZO0A 4F7MA 5KVGL 4PJAB 3D9AH 2VJXA 4MB3A 1EFQA 1KCRH 4HK3J 1NQBA 2VIRA 4DEPC 4KMQA 3D2UB 2JCCB 1FYTE 2VIRB 5J57B 4OUOA 1BVKB 1SM3H 5D6DC 5I8CA 3CH8A 4DZ8B 1NBQA 2OS7A 1CYGA 3QSKB 2FIKB 4MS8C 2OR9L 3NN8A 4KDWA 1IM9B 5ANME 3MV8E 3I3DA 4IRJB 1AFVH 5KVGH 1UM6H 3SGKC 1Q38A 4Y19E 3V6OA 5GGVY 2C3GA 1MUJA 3BRFA 2NY5L 1KCUL 1NBZB 3S4SG 2NX5E 1JV5A 5DJ6B 1PBYA 3ILQC 4RZCA 3T2NH 4U1GC 3U1SH 4C57C 4JR9H 3QH3A 4X6DA 1PQZB 4P4RA 4WO4B 4XBPB 1J8KA 3KYOB 3T0DA 1B88A 1F11B 3OKMA 3GSUB 2Y4SA 2Y36H 4JZJB 4YE4H 2JELL 3HZVB 1X5LA 3MV9D 1FC1A 4ENEC 1ZV5A 3BGMB 3RNQA 5AWNH 3GJEA 1LMKA 3S4SA 2DWEB 4JKMA 4PJIA 4X5XA 5CJ8A 2BRQA 2AJSL 4OZHB 1DSFH 4PP2B 1UVQB 3CFJA 4ZFZB 3QR2A 2NTFA 3ZKND 4JKKA 3FB5B 2LQRA 1N5AA 3WFHB 1HSAA 2D0HA 3QQ9D 2D7TL 3FQXA 1MFAH 4ODTH 3SDAC 3TBTA 1YPZF 2R0KL 4ZFFA 4M6NL 1VFMA 3WNKA 1XF2A 5HHNB 1PX4A 2FEEI 4MNQA 1YECL 4FP8H 3TCXA 4LIQL 4N0CD 1T6VN 4GW5B 3SCMB 2IC2A 4DOHE 4XBGA 2YK1H 2OR9H 2CDFB 4JY4B 3HNSL 4P23D 3N1GC 3MUY1 2H32H 1B2WL 3CFEA 5FEBA 2NTFB 1IGJB 4ZFOL 1OAQH 4Y4KC 4PV9A 3TT3H 4ZO8A 3WFCL 4OM0L 5TH2A 3P9MA 3O45A 3T3PE 4P5KB 3PL6C 4QEGA 2X4RB 3DUSB 5JW5A 3MXVH 3FFCD 5HHPB 1KBGL 3LD8C 1A1MA 4ALAL 4LVHC 5TFSL 5J6GB 2O5XH 3KYKL 1ZTXL 4RGOL 4LNRB 1OARH 1LD9A 2AABH 2AGJH 4IJ3B 1H8OA 3G9AB 4MJIA 3G5VA 5CD5C 4X8JA 1TQCC 4TVPE 5DD6B 3WIFA 3LKNB 5EIQA 3WFHA 1QLRB 1MUJB 2V17L 2IGFH 1AO7D 3C5ZA 3OX8B 3QFJA 2E9BA 2BSTB 4PLJC 1MCSA 5C9JB 4NQSB 1YEDA 2R4SL 5IJVB 3FCTA 1IT9L 5IB2A 2HT3C 3GMPB 1GRWA 4U6TA 2VXSH 4K3EH 4QOKD 4E41A 4JG0H 4F2MB 3BFOA 3NA9H 4K71B 4M02A 2C9AA 4J4PC 2DTSA 2BHZA 1BREA 2GYSA 1T2QH 1UWEL 4MS8D 5LAXB 4TUKH 1LO3H 1MAMH 4H25A 4CRPA 1QOKA 3WIHA 4TPRL 1G0YR 4M1CC 1KTKE 1T83C 2DWDB 3BD4A 3C5ZD 3ULSB 3H3PL 2FJGB 4HXAL 1EJOL 2V9QA 2DMCA 5BXFB 1I9RL 1UM4H 4TUJB 2VL5A 1IC7H 2IALB 3MRQA 3ARGB 1U8OA 3ZE1F 1LO0H 3LRSA 5A16B 4XPFH 5JDJA 2YWZA 4JO3H 4U05A 5ADOH 4QHNB 2EDKA 5J9PA 3S8WA 5GJTL 1BAFH 2DD8L 2A6DA 1NEUA 3BDYL 3D6GA 1YC8A 4MNHA 2DQEH 4PJHA 4QF1A 4RAVB 2EZ0C 3CFCL 4QHMA 3W5NA 3FQNB 2WUBL 3B2UD 2EYTB 4Y2DC 5BZDB 4PJGB 2VLKD 4C56B 1FDLH 2W9EH 3L9RA 3MRLA 1XF3A 3TO2B 4QTHA 1TJIL 4DK3A 3MRKA 5IJKA 2YD3A 4RGNB 4TQEL 2GAZB 1IAKA 3DRTB 4Y16D 3W0WB 1FPTH 2G5BB 3IU3A 4PJDF 5BS0E 3MRDA 5LJYH 2WBJC 3BH8B 1HHJA 2PXYA 2VZTA 4RRPA 3VXSA 3WLBB 1GIGL 3QWRD 5ERWB 4PGBB 3VXMB 4FNLL 1D9KC 3QWRA 4U4BA 4IEFB 4MX7A 4QXTB 3WIIL 4K55A 4NPYA 2HFTA 2R1XA 4EEEA 3ZZ1A 1G9NL 2PKDA 4ZPTA 1CFNB 3F6IA 3B5TA 3RWEB 5DVLA 5ICZB 3WHXB 1F3RB 1N7MH 1BX2A 3A6OA 3VXRE 4LDLB 3ZE0F 3X11B 4DW2H 2Z0BA 3CU7A 3U9UB 3TWCH 2EC8A 1QRNE 1KENH 3RI5K 5DFVC 1TENA 1FG2A 3QO0B 4PY7B 3DETC 1BBDL 3H7BB 4UOW1 2DYPB 3HMWL 4G8GD 4WUUB 4XB8A 1D5XB 4HUXA 5D7IE 1AR1D 5HBBA 3PDOA 4KQ4L 3G6JB 4ETQA 1EZVX 5DI8A 1CU4L 5I66A 3OXRA 5JHDA 1K4DA 2HJKA 1G7LB 1CVSC 1FVCA 3K46A 4PRHA 1ZMYA 5LBSH 3CJJA 4ZUUB 4Y5YA 4IOIB 2D7NA 1T66D 3QDGB 1S9WA 5L2KB 1ZGLB 4Q6IA 3O9WC 4FQXB 5DJDA 5MEPA 1KIRB 1HIML 3CUPA 5DJ0B 4F33A 2PXYD 3VXSD 1JVKA 4LHUD 4MNGB 1AGFB 1LK2A 4PRNA 4Y4HA 3NIGF 5D4QA 5ICXB 2C3HA 4PRIB 2ATPA 3MXWL 5D70H 3O3AA 2HLFC 3WJLC 3C09B 1CIUA 1UQSA 2GITA 4YHOL 4J3VA 5F9OH 4RFOH 5TQ0H 4MJ4A 1JZ3A 4KI5F 3LEXA 2W9DH 5IIEA 4M8QB 3WEXB 4MXQC 3NCCB 1EGJH 1OF2A 4UDTB 1IEHA 3ILPA 3GHEH 4UIKL 1NGYB 3QUZB 3FT4A 3GMLB 4XNZC 3PQYE 2V2WA 2XPGA 2FHCA 4NT6B 5IW3A 1DANT 3MO1B 3BQUC 3PV6B 2YA0A 3WIIH 3G08A 1HZHL 5A16A 4LNVA 2YD4A 5MEOA 5D7IA 4IDJL 3UTPE 4LGSB 2DIBA 4PRHB 2BVPA 1U8KA 4S0TD 5AAMA 1ZWIB 2DS4A 2X05A 4G6KL 2DLEA 2CPCA 3KPPB 5FHBL 1VERA 1DQLL 5L88L 1T1YB 5TQ2H 3TM6A 2P43B 2WP3O 3ZKMD 3H8NA 5B3NA 4YHIA 4JDTH 3RU8H 2BSSA 3PL6D 3UC0H 3WXVL 1JTPA 1KELH 3CX5J 4XRCA 4JO4H 5FCUL 1FAIH 4GBXB 3I6GA 5F71A 1FJ1B 4KHTL 2WWMC 3U82B 4KKLD 5E5UB 4O2EA 3U6RA 4QHUA 3KGRA 1S7TA 1T2QL 3MRGB 5ESQA 3VXTA 4KKNA 4BFGA 4NQXB 1ERNA 4ZUVB 2AV7B 1XCTB 4QWWC 1ZLSL 1EEZB 4OD3L 5EU6E 2IBZX 1NGWA 5ERWA 5C9JA 1N5YL 5J11C 1LE9A 4WI4A 3RJQB 1IGJA 4YGAB 3QDMA 4LOUD 1BQLL 3IJHA 1I9RH 4NO0B 4L4VA 1NFIA 25C8L 1P69B 1MVFA 2R69L 2BY2A 3OZ9L 3FO2B 1JE6A 3DHMA 4CVXA 4M9PA 5HHPA 4LFHG 4Y1AE 1FIGL 2R39A 2AJZA 1URLA 2YK1L 2YPLD 1RUAH 1GGBL 5C9KA 1KBGH 1I1YA 3BVNB 3PABB 4PIRF 5HVFB 2O26U 4OIIL 5FCSH 2DQUH 4RAVA 2V2TA 2H6PA 3AB0C 4XNMB 4PGEB 4XPHL 2X9XA 3OGCB 1MCDA 4X9FA 5T3XH 1IQWL 1JN6B 3JTTB 1IT9H 4M7ZC 1RD6A 1I1AA 1U8QB 5CAYB 4J3WA 1QZ1A 5IB2B 3H9YA 3D0VA 5F88A 5IESL 2Y06L 3I85A 3W0WA 1WFNA 4JZJA 3O2WL 4OBRA 3MRCA 1CDCA 2V6HA 3PUCA 1LVEA 4QRPA 5KVFH 2OM5A 1AGEB 2X4NB 4PTUB 1XF3B 1AGBA 5EWIH 1BZ9A 4K7PY 1DTUA 3U0TB 3ZTNL 5EU6A 4XPBL 1JWUA 3QDGE 1MJJA 1VEPA 3OKOA 1XIWC 3HRZB 3UDWA 4LDOB 3V52H 2WV3A 5F72S 1JHLL 3G04B 4Y2DD 5IROA 4L8SC 2HVJB 4X9HA 3BO8A 3S36X 1I1FA 5BQ7B 2YZ1A 5EFIB 2XN9E 2IAMC 1UH4A 3SCMD 1INEL 2VAAA 1A3LH 4N8CL 5D93B 3EW3B 1LEIB 4G6ML 3X3GL 5T3ZD 1YEGH 5H35A 3P0VH 5CCKH 3DGGB 2FYYA 4XNXL 5KVFL 1YY9D 1NGQH 2AK4B 5FXCH 1LDPH 3I3EA 4FXLA 1H3UA 5CWSA 2Z31A 1OW0C 1EUTA 5HI3D 2BHYA 3G5YA 3X13A 3I84A 4MAYB 3CSYB 2DQGH 2HA1A 4HH9A 5DEGA 4NQVB 5D6CA 3MROB 2ZSVB 4ORZC 4AIZB 4NN6B 5FHAL 1UADC 2NMSA 2R1YB 2X89A 2XKUA 5EZIL 2G5RA 4F7CA 3RVWD 2A6KA 4NJ9H 3OBAA 3VFSB 5FM5O 3V8OA 3KPNB 3OKOB 2EECA 4NKOB 1BVLB 1MRCL 3B3IB 5GSRA 2FHBA 1XIWB 3NA9L 4JM4H 4CVXB 4DTGL 5F1NB 4LHJB 3TA3D 2QSCL 3BP6A 5I0ZA 3D48R 3PWNB 1QQDA 2ITCA 4ODUA 3C60B 1G7PB 1CXFA 3G5YB 1E28A 3RHWF 3VD4A 3G6AA 2AJYL 1N0LA 3PHOB 4Y19A 1FGNL 4G7VL 2OMBA 1P84J 2D7QA 4BZ1L 4X98A 1UFUA 1LEIA 1JRHH 4XBGB 4YDLC 3ARFA 3ORJA 4HPYL 4UQ2B 5B4MD 4Y4KD 1MWAB 1KXVC 1YEGL 4RMRA 3X3GH 5ACZB 3CDFA 4GAGL 3SPVB 3I9GH 1OGTA 1KFAH 1ADQL 1FLTX 1ETZA 4O9HL 2F58L 2QQNL 4OFYA 1YPZE 5E4EC 1NBYA 1FN4B 2VH5L 5FM8A 3TJHD 5E8OA 1N5AB 1K2DA 3ZTNH 2D03H 3EOBB 5ECJE 4P2RE 1OAQL 2NY4B 5F8QC 2HMID 4PR5B 2BX5A 1KSRA 2WWKT 5M7QA 1JGUL 4FA8A 4NO2B 5JA9A 4HIIA 3GRWA 1S7XA 5BV7B 2GUOA 3DPBA 1XZ0B 3OKDA 4XNXH 1W8OA 4H5SB 4M1CD 1RUKH 3HCVA 3T0VA 4PRDA 1RZFH 2H3NA 1CICC 1KG0B 4H0HB 4GW5A 3SCMA 3QXDB 1MAJA 4O5LH 1T1WA 5EUOE 2IMMA 1TNMA 3O3EB 1BBJB 1XF2B 2PW1A 4UV4L 1MCBA 4J8RA 3BRGC 1O7SA 1RZGB 5SX4H 2IQAB 4LSPL 3UJJH 4NHUA 4TNVF 1X6NA 4RMVA 2VDOH 2FL5B 1VACB 5I30L 4X4ZA 1T7ZA 3CD4A 1KCSL 1ZA3A 4JO1H 5IEHA 3JTSA 1I1AC 1HOCB 2QSTA 2PNDA 1NCUA 4R3SB 1J1XH 5T1LD 4OF5A 4DK6A 2IQ9L 4R90L 5C0NC 1U8LB 5AD0B 4KK9C 3UJTL 2P8MB 4N8CH 2BK8A 3O6KL 4NZTL 3SDDD 5DJ2A 1KN2H 4PB0H 3FB7B 1AIFA 1OTSC 2VABB 4YDLB 5E2UH 3MRBA 1A6AB 3S7GA 4PGDB 3V6FA 2V2WB 1B0WA 4GRLA 2F74A 3O0RL 3DI3B 1INQB 1YDPB 4OD1L 5EUOA 2HT2D 1PYWB 1FV1B 2IAND 4YIQA 1Z3GL 1CLYH 3WXVH 5BZWA 3LEXB 5EBWB 2JCCF 2BSED 2IBZY 4D9LL 1UENA 4RGMB 3UTSB 4EUPA 2X5PA 3O3DB 3GO1H 3SDDA 4M48L 2IPUK 4ONGL 4Y8AA 2ESVB 5ICXA 1JPTH 1U8MB 1H3TA 4ORGB 4DVRL 4YHKL 1QSED 5EC2A 3GMNA 4I3RL 5BCAA 3CU1A 8CGTA 3B9EA 4U1SB 1HHIB 4GKZB 4CADA 1G6RB 2J88L 5HYJE 4MJIE 1P7KA 4KAQL 3BP7A 1CFQB 1MH5A 3KYNA 3MV7D 2QADC 4KI5E 3RPIB 3MRGA 5JO5B 5FYLL 1DANU 1INDL 4HHAB 4MQ7B 1KELL 1ZVHA 5F9JA 3VFVA 4L8CA 3PQYD 3GHEL 4JKPH 5IW6A 4AEHH 3REWB 1I7ZA 2HG5B 3CAFA 3EYVB 1TCRB 1NFIB 4PG2C 5E4IA 3BX7C 1CDGA 1SYSA 5JIHA 3AY4A 1DVFA 5DVMA 1BOGB 1GHFH 5DMYA 5I1AB 3L5IA 3B9AA 4WFED 5F7NC 5D70L 1FRGH 2VXUH 3CZFA 1OT1A 3RVXD 3RL1B 1ULVA 1I9EA 1A9BB 4BKLB 1BEYH 3MBXH 1F6FB 1NFKA 5DK2B 2AQ3A 4UU9A 4FFWD 5IMLA 1R24A 1L7TH 1QO3B 1G7JA 5SWQB 1KEML 2GHWB 15C8H 2GSIB 4ZAKD 3MGOA 3VFWA 1KPRB 3GGWA 2FH6A 5DMIH 2V7HB 5IOPA 3QUMB 2HJKB 1EFXB 2IFFH 4F58L 1CWVA 4PJIE 1QRND 1FNEB 2OL3H 4H26B 1BIIA 2JCCE 3L5WB 1WWWX 4PY8J 2MMXA 2DMKA 2M26A 5T1DH 5EU3A 3PP3K 3VFVB 4PJ9C 3UPRA 1N59A 1I4FA 3JV6B 2VOTA 4AEHL 3SDCA 4L9DA 3LEVH 5IVZA 2XYCA 3M8OH 3V0WL 3IXTB 1I8MB 3SN6N 4KTDL 2GJZA 2ZUVA 1CS6A 3IS1X 4HUMB 4POZC 1AXSA 3MOAH 1R3JA 2J88H 3HNTL 4U0RB 4RMSA 1GOGA 1MQ8A 4ELKB 1PY4A 1T89C 3QFDA 4PD4K 4YHKH 3QHTC 2BY3A 4MZ2A 4M62L 2JB5L 4N8VB 2X10A 4EVNB 3KLHD 4XNZB 2I9TB 1HXYA 1A3QA 1JPTL 4GRLD 6FABH 1ES0A 1GIGH 3GEWB 5IFHL 2QLVB 2WWKO 1MCPH 5FO9B 3C5JB 1JHTA 3U7AA 4MZ3A 3AREA 1N26A 3BMWA 4ZG1A 4N8PA 5EUOB 2FO4A 5DI8B 3MOBH 1DBAL 2IQAA 3LD8B 2Y23A 4WFHD 4YJZL 5DD3L 4QRTB 3BPLC 4Z7QE 2MHAA 1EFXD 3X11A 4LAQL 4OV5B 3RGHA 1BX2B 3OB0K 3ILQD 3O45B 1FORL 5DK0A 3DXAD 4OZIF 1NEZA 4KQ4H 3AU1A 5IFAL 1R5IB 4BH7B 5IMKB 3LEVL 5EN2A 1D6VH 1WC7B 1K4DB 2GY7B 1CGVA 4R26L 4XNUH 2GJJA 4OD2A 3VXMD 5IUSA 1CK0H 3WNOA 1HCFX 3W11D 3BZ4A 1X5ZA 3RRQA 1FPTL 4E41E 4OCRH 1JYWA 5DZLA 1FZOA 2CKBA 5B39B 3OMZA 3C6LC 2FJGA 3VRIB 4XCCL 4G9FB 3UTSA 2FGWH 4JQVA 3WL9B 5A3IC 4Q2ZB 1JGEB 3FB8A 1W72L 2D0GA 1ACYH 2DF3A 1GGCL 3P11L 4WFEE 2BMKB 3H42L 2DQFB 3MGAA 4B41A 4DAGH 2J8UE 2D7OA 5KG9A 4UV4H 1KG0A 3ZYJA 4ZQKB 5DJYB 3FRPG 1QBLH 4HUUA 5EIIB 4ZD3H 2BXZA 3DECA 1J1OL 4HPOH 4LCWB 4LVHB 4PJ7E 1T3FB 4DCQB 1AD9B 4OTXL 5C0RL 2ZOLB 5I15H 4ZODA 3P3YA 5HDLA 5J89A 1A14L 5T5FH 4Y1AB 4QYOB 2VXVH 3TBSB 4QF1B 3GI9H 1AP2B 2CQVA 5I1JH 3IFPA 2ZPKH 2I07B 2R56H 4TVPD 2NCMA 3QIUD 1NMBL 2NXZD 4U6XA 3U7WL 5E6IC 4HZAA 5IBLD 4M7LH 2NZ9C 1T89A 1VPOL 5LGHL 1IC7L 4JFXB 4NN7C 2VZOA 3M45A 1CR9H 1SYSB 3ESVF 1KB9K 3ARGD 3OQ3B 1KLFA 3MRQB 2IFGA 4XCFH 5HYSA 1U2HA 3CFCH 5KSAA 5IW6B 2YZ8A 1OARL 1VFBB 4HV8B 4LFHD 3BGFB 1CFSA 3EYQD 5HYFA 2E6QA 3O6FC 3QPQC 1S78D 4G6AD 4XPAL 1DQQA 5C0DA 2MWCA 3ZTJH 4GG6A 4PJBF 3FOMB 4OZHE 2XTJE 5IVXF 1U8NA 2Y72A 2AEPL 1DBKL 4F7TB 3F12A 4PGCA 2R2HA 2Q76A 3W9DA 3SE4A 4G7VH 2UWEF 1UJTA 4AMKH 1UB5B 5D1ZA 1FHGA 1ZHBB 5IK3B 4JM2D 4PJCB 4OZ4B 3O81A 2JF1A 3QFJD 1T0PB 2RAMA 1YEIL 2J6EL 1KEGH 1HI6B 4NKIH 1KYOJ 4YC2B 4ZPVB 4JM4L 1UZ6E 2QQKH 4NHCH 3C9NA 1DQQB 1QLRA 1FZMB 5DRXA 5C0BB 4PJHF 1KTDB 5E8PB 1TQBB 4PTTB 4JGMA 4LGRB 3U7YH 2R15A 1FFNB 4M7LL 4PJEB 4HPYH 4WU5A 5L0QC 1XMWA 5FHAH 4X7FC 2O5YH 3KPQB 4KGLA 2EYRB 1CT8A 2Z93A 1CGUA 3RWIA 4HS6B 3TVMB 4PJFA 5T5NG 3WNPA 4LKXA 5IK3A 1OGAD 3MR9B 4G6JH 1G7MB 3CLEL 3QA3B 2JJVA 5FA4B 2V5TA 4JHBA 3HZVA 2BNQD 1IZJA 2G60L 3GMQA 2Q8AL 3CMGA 5F89A 1ZTXH 2I27N 5E1AB 3RVUC 5CHNA 5BS0D 2EDBA 3GUTB 4LNRA 3FO0H 4UTBL 2FX8L 4RSVA 5I1GL 3WDJA 1H8NA 3DSNA 4O5LL 3SEPA 5C0GB 3V52L 5I6XB 3LPWA 4G8IA 1MVUB 4PJXB 1MFAL 1F6LL 3DXAA 4G9DB 5IBLC 2H26A 2NY6D 4YDVB 1VADB 5LCVH 3WL9A 4X9IA 3TPUB 3F65A 2SEBA 5HHQB 1VGKB 5IG7B 2Z35A 1D6VL 5J6HA 1IZKA 4QCIA 3ARQA 1U8QA 5TDPB 2OZ4A 1UG9A 4KY1H 5D6CB 4HGMA 2P44B 1YN7A 1P7QA 2DIJA 1L4IA 3HI1B 5DLMH 1QLFA 4V2CB 3KXFE 2KDGA 3X12A 3VI3E 2IPTL 2DM2A 3QRGL 1QRNB 2HRPH 2MNUA 4M6NH 2R0KH 5KS9E 1INEH 4XP5H 5ESQB 4I5BA 4RMQA 5KSBB 5HI5D 1ZA6B 3KDMA 1G0DA 1RURH 4JFPB 3LV3B 4Y4FB 4HWZA 1OPGL 4G8IB 3VWKA 4NNYB 1EO7A 2JIXA 4OZGE 4UQ3A 4XRCB 2CLRA 4OT1H 1FL6B 4YAQB 4GBXA 2UYLA 1G7QA 1I7RB 4E9LA 4NO0A 3U30B 2OL3B 3SPVA 2OX5A 4NRXA 2N4IA 5DZOA 1QACA 3GSQA 2BP3A 1N8ZA 1D3CA 25C8H 3LDBC 1IEBB 2EDXA 4M61B 4Y5XB 5E1HB 4P5MB 4A6YA 2WWMD 2FECL 3BP4A 2JB6B 2M2DA 3TZVA 3BD3A 1I1AD 3M17A 4RGNE 3BDXA 2EXWD 1KCRL 2HAZA 1X4ZA 5JQ6L 4EN3D 2PO6A 4LCUA 5IB3B 1Z9LA 5CJQL 2E27L 2NW3B 5D8JL 1PGRB 4ZQKA 1KT2B 1HH9B 1KJ3L 3VFOA 3RAJH 4BQ6A 1FO0B 3B3IA 3VXUD 3VFPA 4NM4H 4ODWB 1CFTA 2IJ0C 2YMXH 5DMGD 3DARA 2HJLA 3CPLB 3T0EA 3O4LE 5C0DB 1XGYL 4I0PC 3RZCB 5H2BA 2F5BL 2CKNA 5BOPA 1Y6MR 1NEZG 1RULL 1RZ8B 4AG4H 2UV3A 2N7AA 4XMKL 1ZEAL 1MHHB 1U8HA 5C6TH 3QZWA 2VXTH 1IM3B 1J0KA 4UILH 3CSYA 3HE6C 4NC2B 1NUGA 3L3JB 4Z7UB 3Q2CA 3BPNB 5J1AA 1MRFH 1GVIA 4KK8C 5EORL 1A1NB 2AKRB 1LNUA 5LGJA 5L2KA 2YS4A 2VC2H 1FL3A 3KPRE 3ZHDA 3GMOA 1U3HC 5ESVB 3KPSA 2OR7A 3V5DB 4GMTH 3RKPA 4KVNL 5KVEL 3CDCA 5EBLA 2H32B 2RBLA 2GSGA 5DUPL 3D1MC 1F3DJ 1ADQA 4WI6A 3OXRB 1F00I 5IESH 3ZDXE 3IETB 2X4QA 4X0KB 4JFYB 5F7YC 2VDKH 2ZPKL 1HEZB 1NCBL 1NGPH 4DKFH 1N6UA 5FKAB 4MA7H 2C4XA 2X7LA 4GQPH 1M7DA 1DBMH 5DJDB 5MEPB 4IDJH 4MDIB 3QCTL 4IRSC 2JIXD 3GK8H 4HKBA 4JY6B 4OZGA 3VMNA 3RL2B 5F96L 4BFIB 4K2UH 12E8L 5CMAA 4WFGE 3MLSL 4TYUA 4WGVB 5GGTA 2KBGA 5CMAB 2B0SL 4K71C 4DAGL 4JPWH 3BZFA 3EOYG 3F7PC 2FX9H 4RQQA 4HUUB 3P4LA 1X7QB 4MA1B 4ZXBB 1FFPB 5H94A 2V2TB 3TYGL 4KMTL 3RDTD 5EBMB 4F9LC 2Z31C 1JRHI 4P99A 2KL6A 3L95B 3OZ9H 3WMSA 3QDHA 2F8XC 1UB6B 4P2QD 3WE6A 3ZSSA 5A3ID 4I0KA 4UDTA 4XNUL 3RUGA 3ZMRA 4W68A 2A83B 4J3TA 1DBBH 3RWGA 3Q5YA 4EN3C 5DTFA 3ZKXC 4WIQA 2VRAA 3IXAA 1DVFC 2H9GB 4BZYA 3VGHA 4QRQB 4DW2L 5C7XH 4MQ7A 1JF1B 3PHQB 4QRUB 3QDMB 3RGVA 3ZE2E 4OF3A 4E42B 3FQUA 3LKRB 4Q9CA 2EIZA 1RK0A 5IHLB 4B0MM 1RUQH 3EYOA 2DQDL 4I77H 1AGFA 1LK2B 4PREB 4KK6D 4PGDA 3L5XL 4XCYA 3V6FB 5HHOB 1FZKB 2VTFA 4FFZH 3SGEH 4AEIL 4G80B 5K9QI 1MCRA 1U91A 4X6BB 3LN9A 2EO9A 2Z4QB 5FGBC 3C08H 1SHMA 5D93C 5TE6H 5FOJA 2P8MA 1MIMH 2ZUUA 4J23A 4HX1A 3STBA 3VG9C 1NJ9B 4TUJA 2F53B 5L0QB 1D5IL 4FQLH 1KIPB 2XWTA 4PV8B 4LVOB 3O3DA 4UT7H 2HTLC 3ARGA 5SWZE 1OAKH 4X4MA 5MI0B 1I8KA 1W0WA 4XPGL 1IC1A 5BXFA 4J12A 1BPVA 4YR6B 2HJLB 1WCBA 1N7ML 2QBWA 5D1QD 1MWAH 4MYWB 5IFJB 4BQ8A 1T6WA 5IWLC 2MCPL 3SBWC 4PG9A 1V7MH 1F8TL 2YHGA 4EXPX 4GW1B 1HHKB 3LPFA 3EBAA 4BYHA 5IOPB 4JFDB 1HHKA 3NPSB 3FHQA 4MVBC 3L3JA 5BW7A 1NL0L 1BFOA 4NT6A 4AQOA 1PX3A 5ADOL 3Q6FB 3TN0A 3IF1A 3RKDC 1YMME 4P4KC 3T2OA 5JUEL 1OW0A 5DHYA 4N5UA 1Y6KR 2VITB 1DLHA 2CXKA 4NWTL 3EGSA 3MRDB 4XX1G 2FX8H 5DJAA 2OTWA 3QWOA 4D2NA 5E8DH 1R5WA 4YIQB 5I71C 1I7RA 5GRUL 1QRKA 3DX6B 3K3QA 3OAYH 3QNYA 2GJ6A 1ZS8A 2X4TB 1QPXA 1NCTA 2ESVE 5M94B 4OI8A 2EDFA 3D85A 2V7HA 3KWWB 1OGTB 1WITA 4G6JL 1S9XA 3EYFA 2KKQA 3ARFB 5ITFA 2NR6C 3GDBA 3UTZA 4ELMA 1H15A 4MD0A 4R4ND 5T33H 4EI5D 5IM7A 3MJ9H 4W81A 4TOYH 4QHKI 5KAQF 1JFQL 3HA0A 3VXPA 3EYOB 4M5YH 1A7BA 1QLFB 5C2BL 1X5JA 1T20A 3T4YB 4ZNCD 3T0EE 2JKXA 4XBEL 5KANI 3CFKA 3UZVB 3PDOB 1FSKB 4JDZA 1SY6L 1QKZL 2Y1VA 1BFVL 2NY0D 3D5OF 5HHVH 4QXGH 1E4KA 3TV3L 2Q86B 3RVUD 1FNHA 3VWKB 1MAML 3V95A 1LO4L 2ZNXA 3G5XB 3QG6A 3UZQA 3OKEB 3CPLA 2EIEA 4APQC 3U4BL 3OJDB 3HUJA 4WNQA 5A2IH 3L3HB 2HVKB 3SQBA 1VGEL 2YBRB 3HCVB 1NCDH 4Z7WF 4YFLF 1TJHH 3VGEA 5IWLA 1U58B 3NPSC 4BFIA 4QTIH 3MLYL 1F2QA 4L5FH 4PJIB 1IQDB 4NRYA 3T2PA 1WWBX 4HWBA 1CLYL 5D2LF 3QEUA 4O58H 5J1AB 3QNZA 3LKSB 4TNWK 3CIQA 5SWSB 1W72B 4G8FA 3UBXI 4TNWF 2NY4D 1RZ7L 3L6FA 5GIRA 3RBSA 2YPKB 3DVNA 4JFEA 4G5ZH 3K2MC 2KH2B 4RGOH 2GKIA 4UOW0 5IB4B 1TITA 4PJ5E 4V1DE 4NQDE 4JM2F 1N6VA 1JWSB 3BI9X 3ULUL 3CFIC 3U0TA 3HAEH 4HKZA 5E7FA 1A7QL 1RV6X 4HUWB 5D7LA 1DQTA 5GZND 4JAMB 3VG0H 3MRNA 4WJ5B 1HN1A 4D3CH 3UJTH 3O4OC 1CE1L 3T3MF 4HH9B 3RDTC 1FNGB 1CQYA 3PWPB 4OGAD 2Q20A 5E5RB 2XKSA 1OP3K 2XWJB 3PNWB 4W4OA 3ZE0E 5HY9A 3T77B 2XZCL 5INCA 3QWQB 2OJEB 2DOCA 5I0DA 3KYOA 3K8MA 1IM3A 3N1FC 4YE4L 1T0NA 4CN1A 3P4OA 3QAZC 5GS2H 4KKBD 2M1KA 2E8YA 5GHWH 3KG5A 3IKCA 3OGOE 3J8F7 3MV7B 3TV3H 1ZT7B 1JBJA 1KPUA 2RB8A 1CFSB 4HS8H 4NP4L 3O6FA 3MNZA 1A5FL 1S9YA 3WBDA 2HFGH 1MJJB 2VDQL 5DFWH 1RHHB 5GGUB 1DE4A 5D96B 1AFVL 3WO4C 5JZ7D 5CSBA 4JFXA 4BK4A 4RISL 3CH1A 1TVHA 3DJ9A 1F90L 4ZXBC 1RIUH 4G6FD 2BDNL 1EH9A 4ZYKA 5HPMB 2BNQA 1OD7A 1ZE3C 1LP9B 4ZOBA 3QYCA 3MFFA 4HDIB 3SJVD 1YNKL 4KRNA 4YEFA 3BWAA 4FG6C 2XA8L 4I18B 3CFDA 2NY6C 5HYEA 2YPVH 5C2UB 1U58A 3PHOA 4Y19B 1ZOXA 2PYFA 4DN3L 5FUZL 3BIBX 4FTVA 3ULUD 2PN5A 2J6EA 4P57B 4TNVK 1ZK9A 3AAZB 4Z7VA 3ULUE 1F5WA 5JIPA 3IAGC 2QQQA 3HNVH 4OF8A 1WV7T 3MLYH 3OKLA 1DE4B 3QEQB 4NOBA 5IFHH 5L2JA 1A6ZB 2E9IA 4UI2A 2EIDA 3DUUB 4JFEB 2VLME 4LPCA 4ZSOB 3MNZB 1WIOA 5C07B 4J2XA 1FBIH 2ICEA 5B4MC 5JHDE 2MCG1 1L7IL 3CGTA 5TH2B 3SBWA 5C0JA 4BSVB 5DUBB 4NO5B 5HYQA 1A6VL 3B5GA 4Y1AA 4JDVB 2CDGA 3G5ZA 3MOAL 4LIQE 1T20B 4ZYKB 4UNUA 1EMTL 3CVHH 1T1XB 4TSBH 1XCTA 3QIWB 1WWCA 1QSFD 4I4WB 1MF2L 1C16A 1UCBH 4TRPL 1XIWD 4KI1A 4P23A 2SEBB 4WV1B 4XWGH 3SDXF 4KHXH 2ED9A 2EYRA 3ARSA 3MLTB 4MAUH 3O41B 5C0ND 4S1QL 5B38A 5I1IH 3RWFB 1MCWW 3MUGB 5GGSY 1I3RA 1X6LA 3TFKC 3WN5A 2QADB 1OB1B 3V4UL 1IBGL 3ARPA 4HJGB 4OCLC 4L4TD 1D5MB 1WAAE 3GBNH 4KROB 3BUYB 4OLZH 5EUOF 5L6YH 4JPIA 4HXBH 1GYAA 5JORA 4FZEL 5AWNL 1DLHB 5EN2B 1PG7W 5BVPH 2D31B 2AJXL 1R5IA 2X44D 4P46D 1HXYB 3H42H 4OZHA 4PP2A 4X6EB 2ZUSA 3BUTA 3BP5A 1WTLA 2QR0A 2E9WA 4ZUVA 4JB9H 5J8OA 1LEGA 3SQOL 2J8UA 5KSBF 1JHLH 3D69B 3KPQA 1KIUA 1UACH 2H1PL 3UJIH 4X6CA 5ENWB 5EWIL 1N4XH 1JNLL 1RUPL 4QRRE 1TTGA 1FFNA 4QXWA 3FQRB 3BKYH 5DVNA 3OJ2C 4YHNB 3BMVA 1MHPL 3QJFA 4JHWH 5CKAA 1K8DA 5JHLH 5DJAB 3H7BA 3FL7A 2CRIA 5C0FB 3TYGH 4ZUSA 1FNFA 3FZUD 3E8UL 3WIHL 1BLNA 1QA9B 3T04D 1T5WA 1OCWH 3CSPA 5MENB 4JJ5A 12E8H 4JRXA 5JA8B 1WLHA 1BM3L 5F96H 2DQUL 3Q5TA 3VFWB 1S5IL 2FB4H 3MOBL 1SBSH 2YR3A 4U6XB 1REIA 5I1CH 1CXIA 1CD1B 1CD8A 1M05B 5MEQB 1AQKH 1MSPA 2H6PB 3S5LB 4QRSA 1H15B 1AGDA 3FT3B 4AT6B 2VXQH 3N0PB 5E00B 3UROR 4OZFH 5TE6L 1HHJB 2FEDC 2PXYB 3E3QE 3VXSB 1E4XI 5I1AA 4HV8A 5F7LB 4CN4A 2Z9TA 4LLYB 3SGDH 1A7PH 1J0JA 2VZSA 1DLFL 1OTTC 2O5ZL 1UZ6F 4I18C 4EQ2A 2QSQA 1F3JB 5JIIA 2J5LC 3U36A 2GJ6B 1FCCA 2P8LA 3JV4B 4JFFE 3EJYC 3OKNB 1K85A 5FA3B 3MGOB 4FQQA 1I75A 3C6LB 3DROA 4RWHA 3QUXD 3P4MA 2BVOA 4IS6B 1TVDA 1MRFL 4ERSH 4N8VA 4EVNA 3UTZB 4DKAA 4ELMB 3BW9A 1G6VK 2JK5A 2CK2A 4ONFL 1FAIL 4LLVB 5K59E 5LWYH 3OJMB 1J1XL 3FTGB 2IPUG 4JFDD 2VXTL 4NBYB 4OB5L 1ND0A 5GS1A 2OSLA 2V7NA 1FIEA 3ZKSD 4OZGB 5HVHC 3UP1A 1IBGH 5DJYA 4WY7L 2ATKA 3V0AC 4F3FB 1XR9B 3MODH 2R8SL 4RAHA 4NRZA 3RIFF 1WBXB 4BQ9A 5KSBE 1YQ2A 3RVWC 3LQAH 1Z9MA 3GJFB 4G9FA 7FABL 4IRJD 3VXQB 3MBXL 3SDXB 1YNTA 5E2WH 1RUKL 3MCG1 5K9OB 4HX1B 2BNRD 1A0QL 5GISH 4LLDA 4JG0L 1KIPA 2XWTB 5HI4C 4A2LA 2PF6A 4WUUE 2NX5A 1A6AA 3SE4C 2VDRL 1M7IA 4HIHB 4K7PX 4KXZI 4TVPH 2ZCHL 3VXRD 4NYLA 1QPPA 1KIQA 5J7CC 3KJ4C 5JW4N 5CSZA 4MQSB 4JFOA 1S7UA 3PGFL 4H88H 5HHMB 2IGFL 4L3EA 4MJ5B 3D3VB 4WW1B 1S9WB 4YHOH 3S36L 3P0GB 2CKBH 4Y5YB 4W4NA 2CJUH 1B4JL 2YD9A 3ZYIA 1JNNL 1SQ2N 3LKRA 2KUTA 4I13B 2IALA 3RWJA 4Q97A 1AQKL 4N1HB 5FK9B 1SJXA 4R96A 3MA7A 3CC5B 5E2JA 5EZJB 3CFBA 4RIRB 2GK2A 1LK3L 1UWGL 4LU5L 2X4PA 4Y4HB 4CGTA 1TVBB 4XTRC 4YO0B 3O3EA 5JOFA 1SMOA 3WFBL 2XIDA 3MOQA 3WFCH 4D0CA 5I8EA 2EXYD 5F7EL 1BZ7B 5JW5B 4G80A 3U9PL 1RULH 2ARWA 4HIEA 4OI9A 5L2KD 1HH6B 2PR4L 1QSVA 1EDQA 3PL6A 4LCYA 3T08A 3EOTL 3RVXC 1CFNA 4RNRA 1S7XB 4OCSH 3HC3L 1AKJD 3BPCB 3MNVB 4DGIH 2FATL 2CDGB 1KJ3H 5ACMA 1XH3A 1N4XL 1M7DB 1NC4A 1D5BB 4P5TC 4M7KH 1C08B 1CBVH 4HKBB 1OL0A 4JY6A 1G9ML 5SWSD 1CE6B 5F8RC 2NXYD 1E0OB 2JJSC 4FQ2H 3HPJB 5SV4A 4YHML 3SQOH 1CFVH 1N59B 3GSQB 3WIFB 4J8RB 2G2RA 3C2SA 1S9VB 1OGAB 4MNQB 3HS0A 4AZ8A 3OF6D 5GSVA 3BHBA 3T1FA 1JPST 2EO1A 4FABL 3Q3GA 3REWA 5EBMA 5D2NA 3KPLB 5D2NE 4O02H 4YWGL 2GSGB 3AAZA 4Z7VB 5L6YL 4YXHH 3IU4L 3HE6D 2Q3ZA 4G8EB 1II4E 4M6AA 5CUSH 4F2MA 4CUCA 2BVQA 4X83A 5HGHA 3QQ9C 3KPSB 3BGAA 5BV7L 3MFFB 1MIEL 1NLDH 2GK0A 3P73B 3FMGH 3GMNB 4NC0B 4L9LA 5GRJL 5BRZA 1IGYA 2OXGA 1M7XA 1G7PA 3BP4B 3PWJA 2GAZA 4Y4HD 3IDNA 2ICES 5EZLA 4FFYL 4OLXH 3F7VA 2DLGA 3E2HB 5D71H 5ISZB 5L2KE 1L6ZA 3BGFC 3IB4A 1VCAA 4RA3A 1NDMA 4FMKA 4ZS6C 4E5XA 4H8WH 1OY3B 3HC4H 4OFIA 1HCVA 4N0YL 4JHZA 1Y0LB 4UB0L 1I8IB 1G0XA 1I3RB 5L7XL 4J3XA 2JJTA 1DR9A 3RVVD 1JHKL 3GJFK 2IBBA 2H2SC 1NSNH 4QRRB 1CGXA 3QCVL 3TT1L 1E6OH 3D3VE 2N1KA 3CNKA 4L8BB 5LGJB 2LVEA 2F8VA 4O2FB 3U0WH 4I48B 2DICA 4KVCL 2BOCA 4MJ6B 3G6AB 3VFMB 2N7BA 2YD8A 3STZB 4HMEA 2D9QB 3AS3A 1WIPA 4JJ5B 4X5XB 1DQJB 4XAKD 4FQ1L 2W91A 3QZWB 5DGRA 4KRMB 2R4RH 1RUAL 2F54D 3MZTA 1JIBA 3BH9A 3IDYC 4DOHB 2AV1A 2B7DT 3D18A 1X44A 4RRPG 4X8XA 2YPVL 2RFXB 4EI6B 4BSWB 5BQ7A 1XEDA 5KS9F 1CDIA 5I6XC 1IGFL 4C55A 5DQ9B 1YEHL 3CVIL 1CXKA 4NBZB 5JW3L 5J1SC 2JJUA 5J13B 2HH0L 4YK4C 1RIUL 2O5YL 5SWZB 2E7CA 3T0XA 4RISH 4X7SH 4KTEH 3HHRB 2PYEE 3X13B 4UT9L 4YPJA 5IF0A 4M93C 4XVUD 5IW1B 2ZCKL 1QRNA 3ARRA 2VDPH 4X6FB 2Q8BH 4FQCL 1IGFH 5KSBA 4K94H 3VDCA 4KJPD 5D7JD 2APFA 2APXA 2GUOB 2VLKA 4PJ5A 2VAAB 3BPOB 5F7HA 1AE6H 3GKWH 3CK0H 4N0FA 4N68A 4PJ8C 3H9HB 3FOLB 3MBEA 5TFSH 4CBPA 4IIQC 4OAWA 3WO4B 2IEPA 5HHQA 3QI9D 3CVHA 1C1EL 5J4MA 4P9MH 4LSVH 4CKVX 5E2VL 2D4DA 2WIMA 2E7LA 4XZUB 2V9TA 1LDPL 5DQ9A 4PBXA 5GJSL 5HHOD 4OM0H 5T1MA 3VGDA 1WICA 1L9MA 3CDGA 2CIKB 4L3ED 4G8FB 1HSBB 4U1NA 4P23B 1ZT7A 1J05B 4PJFE 3VXUB 2R1YA 1WCQA 4GUPA 4KK8D 4LHUB 3PE9A 1EUUA 4N0UA 5B8CA 3MLZH 5ITBL 1AI1L 3BKML 1YJDH 4Z7OF 3CFJB 1FNAA 4ZFZA 3MR9A 1FE8L 3HC0A 5HDQH 3V8CA 4MB4A 3NCYS 3ARVA 4M6ML 3LKPA 3BRDA 4PJXF 4D94A 1QSEE 1JYXA 4Y16C 4WO4D 5EA0H 5BW7C 2AJZB 3FRUA 5FB8B 3LIZH 3NABL 3HTLX 5CGMA 3ZDYE 5FGCE 2YOCA 3OR7A 2Q86A 1D5IH 2UWEE 4FQLL 4XB7A 2H41A 5L9DL 5GS0L 4OIAA 1NUFA 4Q58C 1YEFL 1NCWL 5KZCD 5EOCL 3HS0B 4OZIE 5C0EA 5CP3A 5DJ6A 1A02N 1XAUA 5I17A 3FO9A 5E99H 1DJSA 1IKFL 5GIRB 2LVCA 4AEIH 1LE5A 1WFOA 4XMPH 1IC5L 4U6HA 4PJCA 1C08A 1W72A 1LO4H 1T0NB 1Q94B 4RMWA 2Y07L 2XN9A 3INUL 3NTCL 2YKLL 1NANI 4P48A 1EHLL 2BVTA 3K4AA 1QSEB 5CEZE 2P5WA 3U6RB 5EO9A 3D2UA 2ZNWA 1CLZH 3E0GA 1CBVL 1KLGB 2NY5H 2ORBL 3GSOA 5C08D 1CLCA 4Z18A 2YRLA 5D2NB 5EU7C 2WSKA 3NIFF 3SO3B 5IP4A 3VFUB 4X9BA 3QNYB 3ILPB 1DP0A 5EFIA 4YXKL 4NZUL 4HF5L 4KPHH 3OKEA 2MFNA 5DJZB 4EI6A 4MD5A 4LLWA 5DHVH 5HVGB 4ODVL 5KSUB 2P5EB 3U2SB 1VFBA 3C8DA 5JXEC 1EXUA 5MP6L 1QSZA 3MLUH 5DD3H 3IF1B 1DEEB 4C54A 3VRJB 2A9NL 3UTPD 4R2GD 1EBPA 1K5NA 1AKJB 1ZVSB 2DBJA 2F54E 3QEUB 5GRUH 1MNUL 1J8HE 1PDKA 1V7NL 5L88H 1MCPL 1HH6A 5DEFB 1YY8B 4EI5B 4BELD 2WK2A 4JANB 5HDBE 1U3YA 1DDHB 5CILH 5E9DB 1R3JB 5HHXH 3L3DB 5CJBA 4ELMF 3IJYB 2W9EL 4OCYH 2E7HA 4HWBH 3S88H 3VJ6B 4JZNB 5KTEH 1B0RA 2BNUA 5DQJB 2UUDH 4U7SA 3QDME 1GSMA 3MV9A 4UBDC 3QBTB 3ARBB 4UTAL 1EPFA 5AEAA 4OQTH 4KJYA 1A7OH 1F4WL 4JDZB 1JPSH 2YPLB 4UIKH 5DRWB 5I1KL 1AJ7H 1Z6JT 3W81A 3B9DA 4RWYL 4Y5VB 1WSST 2PYEB 2R9HC 1VFUA 3LQAL 4RDQG 5I1LB 1ZHNB 4EDXA 5F1KC 5F9OL 2QQLL 4P3CL 4ONGH 5FO7A 1UM4L 2EDJA 1A4JB 3L3HA 3SJVE 3OHXB 1E27A 1W8NA 4YDKH 3ROOB 3UXFA 3D3VD 3KJ6H 1GPOH 1K6QL 5FYJU 1CI5A 4TPRH 2XXCB 3MRJB 3FT2A 4ZFGL 2B39A 5D5MB 1FG2B 3QO0A 4XP6H 4XP4L 5D2LA 2O61B 5FYJH 3FO1B 3AS0A 4XCEB 1MCEA 4XAWL 1FRGL 1OP5H 2A9MH 2FGZA 4YLQT 4CVUA 1T7XA 3C5JA 1JF6A 2OYPA 3HI6L 1CICB 4RFNC 3WD5H 1CZ8L 1GHFL 3D25A 5E9DD 1KJ2B 5AUMB 4V1DB 5IB5B 1KPRA 3NGBC 1RJLA 5CEYA 3CZJA 3BZEB 2D7PA 5A2FA 4R7NB 4MNHB 3QNXA 4P2RB 2WUCL 5ETUA 4KROD 4JKPL 3EFFB 4NOFA 2BZDA 1LK3H 2ITDA 5CJ5A 3DV4A 4P49A 1DZBA 4ZFOA 3IT8D 5DURD 1MRDL 2VUYA 3EO9H 4ORGA 2P1YA 4HS3A 1AXTL 4AM0B 1FJ1A 2D9CA 4WUKL 4XVSH 1U41A 3V5HA 1T5WB 1U8PB 2VDOL 4LSQH 3OKKA 2AP2A 3ETBF 1WJ3A 1PKQB 1G1YA 3EYUH 4M00A 4QTHB 3EO9L 4ZS6D 1AHWC 1TPXC 4MXVE 2IANE 5HGAA 3SKOA 3QQ4B 4ONHB 3KPRA 1PZ5B 4ETQB 5FDYA 4PS4H 2J4WH 4FRWA 4WHTB 3R06B 4HMCA 4U7KA 1HILB 2IH3B 4MWFA 5DTFB 1DQDH 1Z0MA 3GRWL 3E8UH 4D9QE 1XR9A 3EDKA 4H26A 3GHBH 2NX5D 2A77H 3QCUH 4YHPB 3O9WD 2ARJB 5F93C 1S3KH 3FRPA 5SWSE 1XR8B 3FT3A 2AJVH 1A0QH 3BJLA 1MJ8H 4X6CB 3MRHA 1A1NA 3TESA 4LSRL 3JSSA 4Y5YC 3CSGA 3U0PA 2PTTB 5BS0A 1ONQB 4ZAKB 4U6VL 4P59H 4NFDA 2UY7A 4NPYB 5FGSA 2GJZB 1WBZB 5C09A 2WW8A 2Y5TA 3W9EA 1FYTD 2XZQL 1YECH 4FP8L 4HCRH 1GPOL 3OXSB 3S6CA 3CCHB 3C6LA 3LS4L 1IVLA 2XFXB 1WT5C 3QEQE 2ZUQC 3SKUD 1XF5A 5KAQG 1V8HA 3X3FL 4WDIB 2AEIT 3VW3H 5IIEB 4XT1C 4NZTH 3FO0L 3HRPA 3OTTA 4JG1H 3VI3F 3VJ6A 2FR4A 2EDWA 4J6RH 2UYLB 4UIMB 2OTUA 3JV0A 3S37L 4NNYA 4PP1D 4XAKE 3EOAA 4MNGA 4OZFG 2FJFB 1QYGL 4WTZA 4ZNEE 1XGTA 4F57L 1AIFB 2VABA 1QO3A 5CD5D 1D9KA 2AJYH 2XKNA 4JRXE 4P5TB 3WUWA 3H3PH 4BH8A 1OSPL 4YQXL 4PRDB 1B9ZA 5MEQA 1HHGB 3NIDF 3LKQB 3B8YA 4U6YB 2VUOA 1Q9OB 1LNUB 2YMXL 5GGVH 4NM4L 2AW2A 1ZHNA 3WXWL 5MENA 1D7FA 1MFEL 4OLYH 1CXHA 4LBEA 5TE4L 4M1DH 1MRCH 4KJPC 4WWKC 1Y6NR 2X1PA 3Q1SL 5HSFA 2E27H 3BUYA 4IIQA 3QO1B 2AQ2A 4PY7A 4BM7A 4P46C 4DVBB 2X70B 1A6PA 5D1XC 5DJXB 2V5MA 4G9FD 5DD5L 3IYLW 5CD3B 1P84K 1EHAA 5D5MA 3GSVB 5TDNB 3HLAA 3JWNC 1M71B 1RFDL 3EIFA 4WV1A 2QKIA 4CADB 3O2DH 3ELAT 5DHVA 4PJGE 4P57A 5AAWA 1L0XA 4MVBD 4QOKB 3JWDL 3D9AL 3MX0A 4X99B 2XNAB 3S3PA 1NGQL 5IQ9A 3GSXA 4XXDB 3MRBB 5I1LA 4Q9QH 1FNLA 1YY8A 1ADQH 2HTKD 1UM5H 4LSTL 1A3LL 3QUYB 5IGXH 4R4FH 4OI7A 3LSOB 4PJFB 3VXUE 4F9PA 4WW2F 1XT5A 2X4OA 1JRHL 5FOBA 5FUOH 3VRJA 2UWEA 1JMXA 3WJLA 3OR6B 4LQ1A 4Z5RB 1MJ7H 5IEHB 3DUUA 3PGCB 3HZKB 5C09E 4L4JA 4R97B 1KJVA 4JB9L 1RIHL 3I75B 1A1OA 3ARUA 4Y0GA 5D1XB 4MXWH 1ZT4B 3HFML 4IRJA 2CLVB 3L3DA 4NQCB 5HD8C 2YUXA 4LAJH 4OFDA 4LEXL 2VXVL 4LVOC 4H20H 3QDJD 3QXDA 2AKRA 1T21B 4C58B 3HMXL 3DVFA 5DT1H 1N3NA 2X09A 4MDJB 2AXGA 1B0GA 4HS6A 3TVMA 4PLJD 3NACH 2VKXA 5GPRA 1M1SA 2AXGB 1YPZA 4UZGA 3MBEC 3S37X 2XWJA 5JW4Q 1J05A 1U8NB 2X4SB 4DGYL 2MJWA 3MV11 3E6FB 1JF5A 4PJAF 4JE4B 4U1HA 3OB8A 1WQVT 1AJ7L 3WHE1 2EEDA 1T03L 1UZ8B 4WHYH 1I8IA 2CLVA 2HVJA 4Q6YA 5B38B 4YHYB 4D8PA 2DKMA 5D7SH 5E56A 1G7QB 4MHHI 1NCCH 4UTAH 4PPTA 4M43L 2C1OB 5HGDA 3QRFM 5F1OB 3GIVA 3TBYA 3NOIA 1K8IA 1A7QH 1N5YH 3N06B 2HWZL 3MA9L 3QP3A 4R2GC 4YDIL 3MRMB 5ID1A 3S96B 5JPMA 3BT2H 2Z31B 4LAQH 1Q8MA 2QHRH 4F7EA 3O2WH 5LQBH 3DGCR 2Q6WB 2DL9A 1X9QA 2EH8H 3GJEB 3V7MA 3IDUA 2ICWJ 5SWZA 2YWYA 1MPAL 3EZ8A 3T4AB 4D9RD 1ED3B 3PWNA 3PV7A 1EEYA 3O6MH 4GXUM 3VFSA 1ED3A 5IB4A 5HHME 2OP4H 3QG6B 4XVJL 5DQDL 3VXRB 5HVHB 6FABL 2VDPL 5ISZD 2C4FU 1RJZA 3RTQA 3BT2L 1C5CH 1IFHH 3EYSH 5I8OH 3P4NA 1YC7A 3U4BH 1GGBH 1PD6A 3WFDL 3O8XD 1SY6A 1TJGH 5DEGB 1RUMH 2B5IC 3OB0H 1QSFA 1CFBA 1NMAH 1MEXH 2IADA 3W82A 5D1ZB 3S96A 2NY4C 3NAAH 1CDJA 2FWOB 1X5FA 2FD6H 3EJZC 4HWUA 4U6YA 2Z91B 2XI9A 3X14A 3UO1H 4F7TA 2HLAB 2DLIA 4XC3L 3TNMA 5F1NA 1Q9KB 5ITFB 5DRZB 2ADFH 5BJTB 2ZKHL 4LPUA 2CMRL 5CD3A 3MMEB 1F11A 2V2XA 5T1DL 2W0FB 5HGBB 1ZLSH 4KQ3H 3QO1A 4S2SB 3K1DA 1KPUB 4X9GA 4XHJC 4Z9KB 2F54B 2DDQH 2X70A 1YJDC 1LO2L 1GGIL 4HKJA 4FFWC 2ZUWA 5DT1L 4JRYA 4KZDH 3GJFH 3MBEB 3GI8L 4K94C 1Y18B 2UY6A 1HXMB 3DURB 5FCUH 4XP1L 4E0RB 4FZ8L 4O2CA 2NZIA 4GKOA 2P46B 4WFFE 4P2OC 4OZ4A 5HY9B 1F97A 1L0YA 5EA0L 5GRYA 1I1AB 3QUKB 1Z5LA 1DQLH 2EH8L 4M03A 3QUXC 4ZS7H 1A8JH 3GSUA 4JFEE 4OM1L 2VB5A 2W9LA 3IVKA 3L7EB 2XOTA 2ZOLA 4G5ZL 2A6JA 4UBDD 4R26H 2X4PB 1T2XA 5GSVB 3RDTB 1DL7H 4Z0BH 1QFPA 3WLWC 3IKKA 4R7DB 4HT1H 1QR4A 3VG9B 2DAVA 1YNLH 3PABA 1IGML 2APTA 2HT4C 3OXSA 4D0DA 1D5BA 2G9HB 4Y2OA 1TJHL 5AG8A 1EZVY 4NKQB 3JWDH 1IMHC 3OL2A 3FO2A 1K4CB 2CK0L 3O3AB 4AIXA 4YWGH 4JQIH 1YEKH 3V5HB 1A9EB 2R2EA 4AIOA 3V0VB 3GFUA 2RCSL 2YN5A 1RU9H 1RVFL 4HFUL 3MLRL 3VI4E 3BIKB 3MO1A 5D2NC 5IVNA 2L7UA 4NWUL 5BO1L 2VLRD 5DC9B 3QUZC 5L8LB 4HUNB 1OLLA 3MUZ1 2IH1B 3T0BA 3X17A 4XCYB 5IVZB 2VWEC 2KQNA 2C1PB 3O3BA 4M7KL 2E7LC 3IAQA 1RJLB 4OFVA 5CEYB 4CAGA 3EDJA 4AEEA 4PJ7B 2I9LB 3CFBB 4RIRA 5K33A 4OKVA 1Q9LA 5A2KH 4KWUA 4OCSL 3S35X 3RWJB 3NCJH 4HEME 4CDHA 1XF4B 1M6OA 5GRVL 4TSCL 1A7RH 4L3CA 1U3HA 4NN6C 1NJ9A 2F53E 3FFCB 4NSKB 2L0DA 5L8JB 2C3WA 3UTQB 3DI2B 1FAKT 1NLBH 3MRJA 4TN9A 4DEPB 1FVDA 3CCHA 4S1RL 1AGCB 5BRZD 3MLWL 2ZUYA 4HMDA 3UYPA 3GSRA 1PLGL 4LCIL 4UU9B 3KJ4B 1G6RA 1DUZB 1HHIA 2IQ9H 2WLZA 3LQZA 2DQJH 3SCMC 1IKNC 4NO3B 3BIKA 1KB5L 2AJ3B 4Y16A 2Q7YB 4KI5C 4MQXD 1CICA 4MX7B 2AI0H 1XCQB 5SX5H 1NBVH 3WFEL 4JFFB 5INDB 2CKBL 3V79C 3NIGE 4X80H 1XGPA 1NGYA 3AROA 2MHAB 1NGXB 3QEGL 2WAHA 3QIBB 1A47A 4GSDH 1P53A 1ZANH 2DJ4A 2XZAL 3O4LD 4AY0A 1UJ3A 3BKCH 4LSSL 1TVBA 4YBQD 4KKCD 2VLLB 4J4PD 1Z9OA 4Y4HC 5DC0A 1K8DB 1FNSL 1R5VB 4JPKH 1KACB 1NGPL 1A4JA 3DYMA 4WV1C 2F15A 1OQOA 1V7ML 4Q6IC 5EOCJ 5MERA 4TULH 1E27B 4KKAC 1XGRA 3MNWA 4EDXB 3IJYA 1C5DB 3C5ZC 4B7IA 3BPLB 3MYJB 5ANMA 3LN4B 1U93B 3VFGH 5HI5C 2XPGB 5F9WB 5DR5L 2QEJA 1A3RH 4OQTA 1FVDB 1CN4A 1NPUA 4OSUH 3V7AE 4YHPA 2AK4E 4HULB 1FVEA 2C4FT 3O6FD 3QPQD 2G5BA 4LLMA 1P4BL 4YX2L 5KN5A 1EHNA 1E4KC 2AXHA 1MIML 4CMMB 5E2TL 3KPMB 2DD8H 4BJLA 3FB6A 4JRYB 5IQ7L 1R5VA 1G7HA 2DBLH 2P42B 5CZKA 2FL5A 3FZUC 1JPGA 5E0QA 4FXKB 7CGTA 3FQRA 1A21A 5KBNC 3WN5B 4WEUD 4Y8DC 2DLFL 4GAFB 4NZRH 1J87A 3KYAA 5ENWA 5DO2C 5I76A 4I77L 5DA0B 2DQCL 4XMKH 4YHMH 4OF6A 4JFFD 4MB5A 1KT2A 3VFOB 1VDGA 1GAFL 2EE2A 2GW5A 4G9FE 4ELKA 1XGYH 3QDGA 2C7UB 3V0VA 5MHSE 4CJ1A 4N9GB 5EIVA 2ZG2A 1P7QD 4XC1L 2W0PA 3AGVA 5EU7E 5DMGC 3MV8A 4NO5A 5FECB 5DZNA 3LQAC 4NIKB 3SOBL 4UDUA 3UCRA 2DKSA 1F6AB 1MY5A 4B7LA 1JI2A 2WBJB 2JB6A 2BSTA 2VXQL 3OKNA 1KN2L 2P24A 4OCWL 3VFNA 3ABZA 3MV9B 5EU3B 3U36B 1VENA 3BPOC 3DV6B 4G3YL 5E94A 1M6OB 1T1WB 1CF8L 2DLFH 3VFPB 1ZHLA 2XT1B 2E8ZA 3RWEA 4R90H 3P9LB 2LTQB 2GCYB 1VSCA 2VZVA 1PSKH 4Q9RH 3IVKB 1KCLA 1DSFL 4I0PD 3GSNL 4ODBD 2Q7NA 5EO9B 4K07A 4E41D 1ZA6A 3KDMB 1Z5LB 4AK1A 4LLVA 1R24B 3S9DB 3HG1E 4HJJL 3KYKH 4NC1C 4RCAA 32C2A 3A67L 4ETYA 1DUZA 1WBYB 5KJRL 4PR5A 1C5BH 2B5IB 4WI5A 1YYLH 4IS6A 2AK1H 3H9ZA 5I73B 2X4UA 1RURL 3I50L 4NNXB 1Y18A 5T3ZH 4M7JH 3TBWA 4JRXB 1KULA 3OAZH 4HGKC 2BVUA 4KVNH 3GBLA 3RX5A 4NQDD 4XPBH 1BVZA 3V4VL 3BYTA 4LRNL 5EO0B 4L3CB 4PY8I 1VGKA 5IG7A 5CILL 4LF3B 4LEOA 5D7JB 4PJCF 2NW2A 1ZLUK 2W0FA 5HGBA 3R8QA 3ZTJG 2FX7L 1U3JA 1J9CT 5EOTA 3HNSH 3ZT5A 3MC0A 2GQHA 4K7FA 5C0CD 3JVGA 5DRZA 5DXWA 3CXDL 4OLWH 1OAXL 2IH1A 4HFWA 3RDTA 5JIKA 4K3DL 4EI5A 1YEEH 2VQ1B 5IV2B 3MLUL 1UXWA 5CIPB 5LAXA 5C08A 2IF7A 3VH8B 3KS0H 1JK8A 2AS5M 1U6AH 1J7VR 1GC1L 1JWMB 1MCQA 3QUML 4N0FB 5IHZB 4HUKB 1EEQA 3VXNA 5D1ZC 2R2EB 3TJHC 4AENA 2R29L 5FA4A 1QQDB 1KFAL 5L8KB 1WZLA 4GXUN 4X6CE 4ONFH 4RMTA 9CGTA 2D31A 5LVEA 4JFZH 1GH7A 3VWJB 1S9KC 4HKZB 4XTRD 3UO1L 2ICWI 1TLKA 3T0EB 2QJDA 3QEQA 3BEWB 1FGNH 1MY7A 4YDJB 1Q0YH 5BOZG 3QEQD 4B53A 4YBLB 3B9KB 1NBZA 3EFDL 4GKNA 3HE7B 1RZGA 4NCDA 1TDQA 5FF6B 1QEWB 2YPKA 3DVNB 3ES6B 1IL1A 2PO6B 4JR9L 4LCUB 4PRIE 5BJTA 4PUBL 3EDEA 3D0VB 5F88B 5D72H 1VHPA 3L3IB 2HN7B 1M4KA 1ZHBA 1Q94A 4Y88A 2EDDA 3RNQB 5IMOB 4JFZL 5C71A 4PJ8D 5EPMB 1KXTB 2J6EH 1MI5E 3DYPA 4MA8H 1MI5A 1Q72H 5EC1A 1RIVL 2ZJSL 4QRPE 2PCPA 4MAYD 1N8ZB 4ACPA 3V5KA 3CDYA 1QSFB 1GGYA 3BEVA 1HSBA 4AJ0A 3TPUA 3ZYZA 1T7YA 4D0BA 1M71A 1JYVA 3QUMH 4P2OD 4XP5L 5GZOD 1AGBB 1TZGH 2LU4A 1MVUA 4PJXA 1VA9A 4IRJC 4IDLA 1T7WA 2IPTH 3I6KB 4K3DH 3K2UL 5EU4B 3TBTB 5FO8A 5IEKA 4GG8A 3AMLA 2XXMB 5HHNA 2X9WA 2QADD 1ETZB 2AAVA 3ARYA 4YUEH 1SJHB 3NFNA 2HFFB 2H3NB 3W2DH 5GQBA 4EZMA 3UZEA 3HMXA 1K3IA 3HR5A 1MI5B 1JNLH 1NKRA 1MFBL 3RGVD 5CEZH 2F5AH 3DVGA 2VQ1A 5IV2A 4KKAD 2YD5A 4LHUA 1I9IH 2I60H 3TH2T 2DTML 2OZ4L 1QFHA 2BJMH 4JN1H 3VGAC 3RUGE 1BF2A 32C2B 1A64A 2BVQB 4ZMAT 4NQCA 3NGBB 2APWA 3R0NA 2FYYB 3LHPH 2X42A 2E7MA 3W0WD 2H26B 3D0LB 1OWRM 1DQMH 5D1XA 3I3BA 1CTNA 3U30C 1HYSC 4KH2A 3I6GB 2AERT 3BP6B 5C0GA 4WEMB 3O3UN 4RZCB 5DJXA 5F70A 2C1OA 5HGDB 3EO1B 2BNQE 2VL4A 3MXWH 1I1RA 2DQFA 1NDMB 1OGAA 2DKUA 3CMOL 3VXSE 4PRPA 1UT9A 4MSWA 2VMFA 3HAEA 3S3JA 2X4NA 4PTUA 3PDGA 1F58H 3T4YA 4HK0A 1OM3H 3MRCB 4KQ3L 2R9HD 1WBYA 3RFZC 3BH9B 3TLRA 4F7EB 2X4SA 3QAZB 4KHXL 5ELIA 1H3GA 3QI9B 3HR5B 5FYLD 1IAII 1P4LB 4F9PC 2R2HB 3ARWA 4XGZB 5HDQL 3CVIH 2VERN 4GFTB 2Y6SD 5DWUH 2JTDA 5CEZL 2C7UA 2XTJB 4H1LG 3WUWG 3QIUC 3WN5C 1JZ6A 1BBDH 3QDMD 3OAZK 1JV5B 3MRFB 2AVGA 2XV6B 1HKLH 4M6OL 5K9KA 3ARDB 4W6YB 1GAFH 3MCLL 4PFEA 4PD4J 5HYJA 4P2RD 3LRHA 2RFXA 3MV7A 3H9SB 4FG6D 5F9DC 2ICWB 2VDNL 1G9NH 4N0RA 4ZUTA 2K7PA 3WKML 4NQVA 3U4AA 3DETD 5GGRY 1BVKA 1N2RA 1J8HD 4KHTH 1GGUA 3TN0B 1IC4L 4OLUH 1Q1JL 1BQUA 4JO4L 4PGCB 3RIAF 3TZVC 2Z92B 3RY6A 4RNRB 4MDJA 1OP3H 5JLZB 4I48A 4JDTL 1KIRA 3RU8L 3VI4F 1I7UB 4EDWL 1J5OL 3DGGA 3CXHJ 4B50A 2BCKB 5I76B 5JOFB 5A40E 4FQCH 5F7DB 4G6KH 3LKOA 5EDXA 4QOKE 5D7LB 4O2EB 3DHJA 5LGHH 1X4XA 5AZ2L 2NY3D 5I18H 2VZ3A 2BHUA 2HP4A 1U95A 1D5XA 3U7WH 4OQ1A 5FUCE 3SKOB 2K9UA 2NY0B 5BV7H 3UBXG 5I1JL 3GI9L 3S35L 4Y4KB 4OUUB 5C8JA 2AXFA 3MJGX 3RJDA 4U1KB 4X7EC 4IIQB 5CEZD 5I73C 2CGRH 4M9OA 4Z7WB 3HB3D 1T83A 1SEQH 4NUGL 3QUYA 5IHZA 4JFED 2NY2C 4GW4A 4PRPE 4K3GA 5TPWH 1AQDA 4IOFD 4BQBA 1EGJA 1UXWB 5CIPA 1TETH 4Z8FL 5GRVK 3C5SB 5DK0B 3O8XB 4NQDB 3JWOL 4IOSD 2JK5B 1QLEH 2IFFL 1CLOL 1S7TB 4WU7B 3MLVL 4FTVE 2DIAA 5CZVH 4HCRL 3VXME 4WHTA 1CG9B 5JQHC 5A2LH 1IAIH 1OT2A 1W0VA 4Q2ZA 4M8VA 4Z0XB 3RWGB 4XNYL 2YA2A 3EYQC 1HQRB 4U1GB 4EXKA 1T0MB 1OAZL 4F3FA 4QXUL 1L0QA 5F44A 2AK4D 2FR4B 5E7BA 3FONA 3EOTH 1ZAGA 4WVRA 3UPCA 5ICZA 4WWKB 3EDFA 1NFDA 3BQUA 1RZJH 3WKNA 1S3KL 3FTGA 1V3LA 4ZFOB 1ES0B 2ATPB 4XXCA 3DX9A 2XRAL 1NAKH 2RHEA 4GMSL 4P2OA 2R2BA 5ILTL 3ULVL 3W9EB 4XPGH 3VFRB 4C83B 5IKCB 1INDH 1KENL 2HKHH 1A9BA 3QXTA 4FQXA 1T80A 4PBWD 2B20A 1A6UH 4NYLB 2Z92A 3ARED 5DUML 3NA4A 2BC4A 3TP4A 4FQQB 2CR6A 5EZOL 3KWWA 1T04B