4PLNC

Crystal structure of chicken netrin-1 (ln-le3) complexed with mouse neogenin (fn4-5)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
205
structure length
205
Chain Sequence
GSDETRVPEVPSSLHVRPLVTSIVVSWTPPENQNIVVRGYAIGYGIGSPHAQTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPHTVPDPTPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNIPANTKYKNAQATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGATASG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Neural migration. Structures of netrin-1 bound to two receptors provide insight into its axon guidance mechanism.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords Netrin-1
total genus 24
structure length 205
sequence length 205
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4plnC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4plnC01
1JNHB 5SX4H 2AQ2A 3U36A 2FB4L 3MOBL 5E2TH 1J9CT 5FM5O 2APBA 2BSSA 3N1FC 4U1SB 1CL7H 1A7NL 5E2WL 4ZOCA 4D8PA 4HKZB 4LARH 4AK1A 2NCMA 2BDNL 2V17L 5FAAA 2L7UA 3AAZB 5HD8C 2UV3A 3HE6C 4R4FL 4F3FB 4CMHC 4NKDA 3K0WA 3MUGB 2Q8BH 3S5LG 1J87A 2A74A 4G7VL 4M93B 4FS0A 5I1EH 2I07B 3QXWA 1Z3GL 4URTB 3SDYL 4CVZA 1FCGA 2VLKD 4MAYA 1A7RH 5IVXB 4QRQA 4CVWA 3RGVC 3ARDB 1I9RL 2B5IB 1K4DA 4J7RA 3MMEA 4HUVA 4JFZH 4JDZA 4BQ9A 4M6NL 3X14A 4NO0D 3RL2A 4A2LA 1D5MB 3TYGL 4MD0B 4PGDA 4KHXL 4MLIA 3RBSA 5D7IE 5J7CC 2G9HA 4J12A 1I7ZB 4L4VA 4K8RH 5I8CA 3W11D 5I1CH 4TVPH 4LKXA 1JNNL 1T03H 1OSZA 3Q0HA 1WT5A 3O6FA 4XBPB 1AQDA 1CBVL 4U0QB 2FJFB 3BAEL 1E4WL 4YHNB 5HYQA 3MLWH 3EZ8A 4MJ5A 1KC5L 4I9WD 4MA7L 4DVRH 3D0VA 3MRDB 3GMOA 2EDNA 4PJAB 3SQBA 1V3KA 4Z7NE 3U2SB 4UNVA 3MROA 4Q6IA 4I2XB 3U7WL 4EN3B 3CZFA 5A2LH 1MREH 1ZTXL 5F7UA 4RAVB 5DJZA 1NMAL 1RAMA 1L9MA 4N8VB 2D7TH 2ZNXA 3HE7C 2FO4A 3MUZ1 1LEKB 2ZUTA 1RV6X 1UCTA 5DJYA 2JJTC 1KCLA 4X6DE 3T77B 1PD6A 5J3HD 5CBAA 3GMQA 3ZDZE 1AHWB 1HNGA 4N0UB 1NCAH 5DRXB 4Q7DA 5EBMA 3T65A 1TCRB 1Y6NR 3UXFA 3MV9A 5M94B 3PGCA 3O2VH 2WBJC 2W65B 4YPJA 3I9GL 4OD2B 5L2KA 4PJEA 5I1LB 1FORL 5DC9B 4Z76A 3TN0D 5I76A 3ARFD 3QAZB 3FB5B 1BZ9A 2AXGA 2Z91B 4HUUA 5EU4B 4D0CB 4JHZA 4QRRD 2PO6B 4P23B 5F9DC 5B8CB 5ISZB 1LP9B 2VZ1A 1OGAB 4XNUL 1SMAA 3DMMA 4DVBA 5CMAB 4M43H 2GEEA 4CGTA 1X5GA 3OG6B 3S88L 5DRZA 4ODUB 2VR5A 2XQBL 5IW1B 4C83B 4HPOH 1FQ9C 3QRGL 4APQB 3CSYA 1IGIH 3DUSB 2KDGA 5FA3A 2XZAH 3ECBB 3V0AC 1KPVB 1S7UA 2DJSA 3ZKQD 2ZUQC 4HJGB 2ZOLB 1OPGL 3HC4L 1GOHA 2R8SH 1W0WA 4MYWB 5I8EA 3RZCA 3QCUH 4OZHE 3ZSTA 4R90L 4JFDB 4QOKA 4U6XA 3FRUA 2BRQA 3ARTA 2HLFD 2NXZB 2R23A 1P4BL 2P45B 3DO3A 2OZ4A 1LK3H 2DTML 1T5XA 4OLUL 1JMXA 4KMTL 1A6TA 1NC4D 1PJ9A 5GRUH 2FBJH 1I7TA 3EKCA 1A1MA 4NJ9L 2AXJA 2MNUA 4C55A 2XN9D 4JO2H 2DS4A 3LEYL 1V3LA 3CUPB 3T2PA 2YKLH 3RVVC 4G6JH 3EOAA 3ZHLA 2DQDH 5I19L 4GG8B 1J8HB 3G6AB 1RUPH 4TNVK 3GSRB 3VFSB 4YBHA 1KIPB 1N7ML 2R23B 3LS5L 2R29L 3GI9H 1T0NB 3WV0A 3GO1H 4I77H 4NCC2 4AIOA 4GG6E 3GMMB 3AGVA 5E70A 1WTLA 4YXKH 4M48H 2CDGA 3CFBB 3FT4B 2I9TB 4M7ZC 2JCCB 5IKCA 2R56L 2DJUA 2JLLA 3LD8B 1QSZA 3QAZC 4LRIC 1WLHA 5JO5A 3CPLB 3LN5B 3F5WB 1CFNA 2A2QT 1RZ7H 3OAUH 4TYUA 2KL6A 1U8OB 1NCDH 5FEBA 3UMTA 1QSVA 4DN3L 4XVTH 4WRLA 4HKXA 1A4JA 2CIIB 4EUPH 4N5UA 4OFKA 1LP9E 1J7VR 4FHBD 4GUPB 2BXYA 5BZDB 3INUH 4HXAL 1AJ7L 1B0GB 3G6DL 4XHJD 1YN6A 3O45B 1IAIH 1EBPA 3P0VL 1JPST 2DQIH 4PJGE 3SKOA 1MQ8A 2BMKA 1Q72L 3BH9B 2Q87A 4G6FB 4DW2L 4B41A 4LLWA 5FKPB 4LCUA 4OTXH 3CFJB 3EYVB 5I16A 3QRFM 4L3CB 4HWBL 4ODHL 3PP4H 2NY4D 3IDNB 2C3VA 3AS3A 2WBKA 1U95A 1CDUA 1E4XL 4NQCD 3J8F7 3L3GB 5DZNA 3S35X 2EH7L 1RK1A 5LBSL 2VLJB 5FXCH 1L0XA 5B39B 5FUZL 3QJHB 1T7YA 4QKXB 3O3BA 3TJEH 4NWUH 1M7DB 3LQMA 3MYJB 1N5YL 5MEQB 3HMXH 1SJEA 1UEMA 1BEYH 1U58B 3VGDA 2YUXA 5DK2B 4KDTA 1NKOA 4ISVB 3SKOB 2HTLD 3BT2L 1VKXA 2NTFA 3C08H 1DVFB 4WNQA 1R0AL 4M8QA 4N8CH 1JV5B 2VDPL 3O6KH 1D9KB 1YNLL 2QLVB 3ULUE 4XBEL 4U7MA 4OKVB 2AK4D 2BVEA 3V5KB 2PCPB 3N85L 4ZNEA 1NC2B 4KUCD 4XNZB 3HFMH 1C7SA 5TJWK 1JF6A 1UC6A 4POUB 5TF1H 3O3EA 5JORB 3NMEA 4O2EA 4MAYB 4KJYB 3WKML 4Y5VB 1UXSA 1HOCA 5DYOB 5F3HB 4YNYB 1Q1JH 4UQ2B 1E28A 2JTDA 1QLFA 2J3SA 5CLTA 1OL0A 1I4FA 3BZ4A 4MB3A 4HDIA 1T22A 4G9FD 1ND0B 4Q2ZA 2R9HD 4OZHF 1NGXB 5D7IF 3ULVC 2J88L 2Y6SC 1I7ZA 2ZSVA 4LFHG 4V1DA 2NNAB 2DWEB 1A7PH 4Q0XH 4BZ2H 5CJOH 4JO1H 3UO1H 4LHUA 4P3CH 3GB7A 1ZEAH 3ZMRA 2OR9L 4WI3A 1XCQB 4WI9A 3LKSB 3PG2A 2ZOLA 1KCUL 4MHHI 4LVOC 3TBTB 5IQ7L 3CAFA 4GKOA 4JFPB 1HYSC 3LS4H 1I1YB 5F7DB 4JO3H 3QO1A 3ZKNC 3MA9H 3OB8A 4NQSB 1HHIA 1KTRL 2CKNA 4K07A 4EI5B 4G80A 1BFVH 1I75A 1RJCA 1Z0MA 1QBBA 4JFYA 3MLVL 3V6BR 3QNYB 3PWNA 3MRHA 5A3IC 3QIUC 1DTUA 1QKZL 1H9VA 3L5XH 2CMRH 2WV3A 3FT2A 3AMKA 4WI4A 5HGDB 2BNUA 1EV2E 1JNHA 4XP6L 4XNYH 4KK8D 1PZUB 2IBZX 1H8OA 3C5JA 2X1XR 2ENSA 4P46B 3KVQA 4GW1A 3BQUD 3MLZH 2KZWA 2WBJA 3MACL 4ZQKA 3OR6A 2QR0A 1QA9B 3CSBA 4AEIL 4PB9H 4NQDD 5E99L 2X9XA 1A14L 4JFQA 2GY7B 2CLRB 5DJXB 1CFQB 2VWEC 4F58H 4PJBA 2NY6D 4J3XA 5SWZA 2ESVB 2GYSA 3QXDA 4L29B 5E99H 5A16B 4HWNA 4AEIH 4UUJA 2O5XL 1QHPA 1AP2B 5F8QC 3S3SA 4POZD 5F88B 3WE6A 4XTRC 5TGBA 2HH0L 3OX8B 4PGEA 5IMOA 5CAYB 5HGBB 2EH8L 1SBSH 4FQLL 4RNRA 5FKAA 4JY6A 2R2CA 4MJ6B 4X9FA 2V7NA 4G6ML 3U6RA 4ZFGH 3MR9A 3L5IA 3P40A 1HEZA 1RZFL 5DJXA 5E8DL 2ED8A 5I1AA 1MVUA 5I75B 4G8EB 2BCKA 3V4VH 3TA3B 2HKFL 1BFVL 3FT3A 3EYFB 2R15A 4KUZH 2YMXL 3VGEA 4WWKD 3AREC 4GW5B 1JIBA 1UM4H 3C6LB 1CFBA 3W39B 1SYVA 1IGMH 3IS1X 4NQED 5C0IB 1EJOH 2A77L 3LS4L 1OAKL 1YUHA 2B4CL 5IQ7H 5L88H 4JZNB 5FF6A 3UJTL 1LO2H 2GITA 5D9SB 4HX1A 5KOVC 2DAVA 4FQQA 3AAZA 5BQ7B 4P3CL 1WIUA 2XICA 5JW3H 4GRLC 1F45A 1G9NH 3GMQB 1KLFA 5F7FA 3LVEA 1CGTA 1DQTA 2XZCH 3MCLH 3VG0L 3A6CL 1GGCH 1T21A 1A6UL 5JOPE 1BP3B 1AXSA 3VFOB 1LE5A 3QT2A 4JFHE 4YHIB 3U9UB 1WWBX 1NGPH 1UM6H 1U8HB 4OSUL 1ZT4A 1MFDH 1S9VB 1Q1JL 1KLGA 2FHBA 1J05B 4JDTH 3QHFL 3V5KA 3VXUD 1FE8L 3O4LA 1SY6A 1S5HB 2XTJD 4P9HH 5JMOC 4JZJC 4BFEA 5AZ2L 3H0TB 1CDGA 3KWWA 4XCCH 4PRIE 4LRNL 4KDTC 3TO4B 3VRIB 4HBCL 5HDQH 2XN9B 1IGJB 4E42B 1H5BC 4PFEA 2D03H 2VO5A 1FFQA 4R7DA 1AXSB 4HDIB 4BUHA 2YC1B 3WFDL 2FJFA 1A9BB 3FB8B 1RJLB 4Q9CA 5HGAB 1Q9LA 1VFUA 3FQUB 4P5MA 5DD0L 1HWHB 5JIPA 2DQHL 3AS0A 4AM0A 4OM0L 4PRNA 4L4TA 2WINA 3X3FL 3EAKA 3FQNB 4U2YA 1Q9OA 1H3TA 1CGUA 3GMRA 1P5VA 5KSVA 5LBSH 3R8BB 1MI5A 3ZYJA 1KJ3H 1T0MB 3BSZL 4K3GA 1LO3L 3DJ9A 3LV3B 2A6IA 3K2UL 4DZ8B 1C5BH 5ID0A 4PJ8B 3RDTC 5I73C 5BZWB 2DI9A 2I25N 4BK5A 3QUKB 3A0OA 1EVUA 3UCRA 4YDLC 3F7RA 2DQIL 3QFDA 1YZZA 4YGVB 4I13B 4YPGA 4IS6B 5F6IC 4X4MA 3PL6A 4H8WC 2EECA 2J5LC 4BZYA 2CUHA 3INUL 1CGXA 3QH3A 3VXRE 4PRIA 1I8IA 4ONHA 1JK8B 4OCRL 5AG9A 3M45A 4XPAH 1YEEH 3CSYB 1DFBH 4RFEA 1G7JA 5I74B 4ZFFA 3HZYA 3QI9B 4UBDC 4OGAC 2VJXA 2XKSA 1EGJL 5JO5B 4Y88A 3ZDYF 1A6VL 4XMLH 4YBLB 3MRKB 3REVB 1MRCL 2BZDA 4J1UB 5KZCB 4I48A 1ZE3C 2OS7A 4PREA 3KYKH 3G6JA 3E2HC 5D2NB 3GO1L 5DUMH 3C09C 4LBEA 4P3DA 3KLHC 4ZUVB 4R96B 4U31A 4WW2A 1A6PA 4Y1AB 3BWAB 3ZTNL 2DQDL 4XVUD 3HG1D 4L8SB 4HUWB 3LRHA 5TQ2L 1QFWI 1P84J 3B2UD 4QTIL 3EJYD 1F3DJ 3LDBB 5IHUH 3X3GL 3FQXA 4V1DD 4R6UA 3PDOB 1VGKB 3ULVL 4NJ9H 1R5VB 1U3HA 3BW9A 3QDJE 3TT3H 4ZYKA 5L9DH 2ICEB 1Z9OA 2BJMH 1FL6A 2YPLA 3S9DB 1U8JA 3MV8B 2DTMH 3MRHB 2D31B 5HJ3B 3LKOA 5H35A 1FVEA 5CEYA 3RWJB 5DUBA 4OD1L 3VFSA 3MRMB 2H6PA 4YC2C 4KQ3L 2NZ9D 4FABL 2EE2A 1S7UB 4OUUB 3C5SA 3BJLA 1E27B 1MHPH 3NH7H 2OX5A 8FABB 1ORSA 5B4MC 1GXEA 1HQ4B 4JRXD 3RAJL 4DAGL 4W6WB 2R8SL 4MJIE 3HPLA 4Z7VF 2IMMA 4HS3A 4WY7H 1D6EB 3HTLX 2Y23A 2KZ1B 4LLUA 3GKWL 2BVTA 2APVA 2WM0A 2WANA 2XACC 3RUGF 2GJZA 4TQEL 2BC4A 1KTDA 3T2OA 2BOBB 2X2YA 3CSPA 3UROR 1HHGA 3KYNA 3RHWF 4BSVA 5IBUB 2JKXA 3GEWB 4XXCA 4KI5E 5C0BB 3QXDB 2FR4A 3S98A 1AO7E 4QRTB 2HTKD 2YSSA 4XNUH 3F7YB 3HG1E 4Y5VA 5D8JH 3SDXB 1U91A 3QEHB 2CQVA 5JW4R 4CN4A 4LLYB 5I9QC 3B4NA 4PRDA 2ZUXA 4NKOB 3SPVB 4FQCH 1T22B 1YMMD 2XWJA 5KG9A 2NY5H 2VDNH 1NCBH 3BKJH 5DT1H 1UACH 5D2NC 1KEMH 2VDQH 2Z8WC 4NT6A 3T77A 3ULUH 2B1AH 3T65B 2AJ3A 5D1QC 3DXAA 4IIQC 1J0IA 2VLJA 4TUKL 5KANG 4LCYA 5DJDA 4RGNB 4GSDL 4KRPC 3O11B 1JZ8A 4LVNC 4XT1C 1TJGL 1C5DB 3PWJB 1EAPB 5I76B 1IGFL 3VRJA 3FQUA 5E2UH 4PY8I 1YC8A 1V8HA 3QQNA 2B1HH 3WD5L 2B39A 4PRNB 1ZS8B 3SEPA 1T83A 3HZMB 4K23L 4Z95L 4U6VH 4IRSA 2QQLL 4W70A 4KK5C 1RZGB 3BAEH 3VXTA 2R39A 3DVFA 4YIQA 2Y06H 2ATKB 3O9WB 4QCIB 3WNLA 5BS0A 3L9RA 1TNMA 4WFEE 4JE4B 4LGRB 1TTUA 4JKPH 4Q9RL 4XC1H 4PRAB 1CLYL 4LSVL 5C08B 5FGCB 3CH8A 4Z7WE 2PCPA 3STBA 2ITDB 3O3AB 4KROC 3BIAX 4LCYB 5DJDB 3RVVD 3MV9E 4HAFA 2AGJL 5E24E 3FO2A 3EOBA 4DN4L 3BKMH 2GT9A 3BN3B 4KVNH 1S9VA 4W81A 4RAUA 2V9QA 5I17A 3UTSB 4IOIB 3RUGE 1CICA 4O9HH 1JGLL 4JCLA 4Y4KB 3Q5OA 3VFWA 3O3BB 3QG6A 2V2XA 2PYED 4K94L 2E5EA 1ZA3A 3RPIB 4NKMB 5DS8B 4G7VH 4NQDB 5F72S 4DGIH 5EBWB 2EYTB 3B5GA 5FK9A 2OBGA 4MMXC 4AQ1B 4E42A 4S1SL 2N7BA 3ISWA 1UZ8B 5A2IH 2XIDA 3WNPA 5GJTL 4Y8DC 2HKHL 3BUYA 1IJ9A 1G7PA 3V4PL 4KKAD 4UILH 1OP5H 2YZ8A 2FB4H 3MOBH 4JY5L 4AYFA 5F9OH 4AM0B 5JIKA 3HZVA 4OAWA 1EEYA 1DQML 1P1ZB 1QFWM 1FRGL 5CKGA 1P4LA 4HWZB 2ICWB 2W9LA 4G8FB 5E2UL 3GFUA 2J6EA 4DK6A 3VXOB 3RIFK 3M1BB 5TFSH 1G6RA 4KHTH 1UYWH 3BPOB 1KB5B 1YDPA 3WHXA 3MRQB 1NUGA 3LV3A 2XTLA 4FTVD 4BKLB 4XMPH 2XV6B 1KPUB 4TTGA 2EXYD 3ULUL 3RUGA 2GFBB 1X4ZA 1JZ5A 3LQAL 5I73B 1MCEA 1H15B 4NNXA 1WIPA 4U05A 3MV7B 3RTQD 2I9LA 3QFJD 1BMGA 4JPWH 2E8YA 1YQVH 2Y9RT 5GGVY 4L8CA 5IEHB 3SY0A 2DM2A 1LDPH 4F7MB 1QYGL 2A73A 5D8JL 2Y07L 4DWHA 5I1JL 3CZJA 3C5ZC 4UTAL 2XA8H 1KCKA 3EO1B 3I6GB 3QWRD 1PX4A 3PV7A 2Z31A 1YEIL 2R0LH 1OCWH 2OMBA 4P49A 3BDBA 4H1LA 3HZYB 2FGWL 4LLVA 4PJFB 3PL6D 4M9OA 4TQEH 4K55A 2VLJE 5MERB 4X6DB 4DGYL 4WGWB 2HFTA 4GW4A 5EH1A 3OG4B 4UV4L 2EXYC 1DN2A 4DUVA 4RISL 5CD3B 4NIKB 3UJJH 3RAJH 4DAGH 1N3NA 3TT1L 4TRPL 1XGUB 5CP3A 3JXAA 2E9WA 2NXZC 4EN3D 3ARDA 1NL0H 4HUMB 1Q94A 2EDEA 5C2BH 2RCSH 4LAQH 1MVUB 1I1AD 5ALCH 3HNSL 2YHGA 1TJIL 1V7ML 4M9PA 5E6ID 2A38A 5DTFB 2G75A 5L9DL 1FNEA 4KY1L 1B4JH 3F62A 4LSSH 1JPSH 3QXVA 3ULVH 4JB9L 5KVGL 1A21A 1IAOB 3DV4B 5FO9A 1MHCA 2A6DA 5T3ZE 4U1LA 2ARJA 3CH1A 4RMVA 5HI4D 3PUCA 5GIRA 5E9DB 1NANI 2GUOA 4Z7WB 3KAAA 4WV1C 5DURB 4FQ1L 3OKYA 4YBQC 3GIZL 3ES6B 1T5WB 2V2TA 4KQ4L 2XY2A 4JEGB 3M8OH 4EI5D 1F6LL 3WHE0 5K9JH 1Q94B 4LLQA 4RMTA 4HW6A 5DUML 4ZUSB 3ESVF 1Q9KB 3HNVH 4JM2C 1DCLA 4KJPD 1FYTE 2DIJA 4HZLB 3N1MC 5IB4A 3HHRB 4LHUD 2OI9C 1N0LA 4RX4D 2FWOA 4AIZA 1OLLA 1T83C 3UTTA 1MCQA 4N0CD 2DLHA 3QBTB 1RUAH 4I4WB 4GLRH 5B39A 1YEEL 2O5ZH 3H3PH 3MLRL 1JK8A 5H8DA 5FGRA 3RZCC 4ZD3L 5ITFA 1TPXB 1GC1H 4MD5B 1N64L 1U8QA 1SYVB 4ODSH 4WU7B 3SGJC 5DD3L 2J1KA 4HIEB 4B53A 2J8OA 1VACA 3VGAC 3V2AR 1NQBA 2V2XB 4S1QH 5ID1B 2E9JA 4LDLB 2G2RA 1EZVX 4NJAL 1ZAGA 1CGSH 5GGTL 5AWNH 4P9ML 5I8CB 2NZIA 4G9FE 3UTZA 4HC1L 1MFEL 2CSPA 3BIKA 3P9MA 4CU7A 4DUWA 3OAYH 3DVNB 4KDVA 2AJXH 1EFXA 3BSZH 3SO3C 4OD3L 5JPMB 1K8DA 2FECI 3PNWA 5ITFB 3ZO0A 9CGTA 4R2GB 4R0LB 5BOZG 2RHEA 2CDFA 4M5ZL 3X3FH 2MPAH 3TPUA 5MENA 3CZFB 4YXLL 4YIQB 1U3HC 2R69H 5EZIH 4R4NC 1V7NL 3AM8C 3VXRA 4OCXL 1UXWB 4NWTL 4WIQA 1MCHA 1R3LB 2BSRB 3LKOB 4WV1B 4QOKE 5C9JB 3NN8A 5DJAA 4ORGA 1AXTH 3FQWB 1UWEH 5EIVA 5HDQL 3AVEA 2NY3D 3EOTL 1M4KA 4KKNA 2O61B 3BN9D 3QUZC 5JW4Q 4YH6A 1H15A 5L8LB 4CN1A 4ZUWB 4D8PB 2MQCA 5ESQB 5I18H 2FX9L 1IEHA 1FE8H 3BH8A 3GRWA 4MGXA 3RWHB 4FTVE 2VSCA 3GSWB 1P6AB 3ZKMC 1MFDL 3QG6B 4OGZA 4XP4H 1T1XB 4LP4A 1T0NA 5IV2B 4XBGA 5D7JA 1QLEH 2DQJH 1G6RH 4BSVB 4X5WB 1IKFH 4XP1H 1A6UH 2PYEA 4Z78A 3O0RL 1J88A 1YPZE 1M05A 4WVRA 3HE6B 3F5WA 1G9NL 3PWUB 3D39E 4NN5C 3NCJL 1NGZB 4JFFE 3CCHA 1A3LH 4ZFZB 5KVFH 2Y5TB 3VGGA 4L9LA 3ARBC 3UJTH 1HNFA 4NO2A 2EE3A 1HILB 2F53D 1WSST 4Z7OF 1QRND 1Q0YH 1OAKH 3T8XB 5HY9A 4ETYA 4LSUL 4TSCL 3QO0B 4BQCA 5DLML 4FQJH 2WP3O 1PBYA 3EFDL 5KSAB 2YMXH 4M5YH 2P24A 1CIDA 1V3JA 3ULVF 2XZQL 3PJSB 4KK9C 3HI5H 4XNQB 4V2CB 1CLCA 2WP3T 1JCKA 4XC3L 1L9NA 1LK2A 4RZCB 3O4LD 2YPKA 2XWBA 4Y19B 1V3MA 1D6VL 3KPOA 2VITB 1MLBA 4PV8A 4FTVA 3U4BL 2QQQA 4RAHA 1SBSL 4FQLH 5TGBB 1ADQH 1F97A 2WWMC 2EEBA 4YHKL 5IMOB 1MWAH 2C5DC 4HK0B 2FO4B 3BWUC 3C6LC 3QDMA 1EHAA 3AB0B 4Y1AA 2V9TA 1FVCA 1I1AC 3B3IA 1ZT1B 4MQ7A 4FQXD 2ARWA 5KS9E 3FO9A 3HI6L 3ZDYE 4M4RA 1D9KA 4JZJB 5EIQA 5HHPA 1RJLA 3H9ZA 2BOCB 2Z31D 4POZC 3FB5A 4P2QD 4RWYL 4BJLA 5DO2D 2VUYA 3KYMB 1IGYA 4P9HC 1BJ1H 3DRTA 3P4OB 4ALAL 3QZWB 3KR3L 2HJLB 4FP8L 4WW1A 3FONB 3D9AL 2DD8H 5DSCB 3GMNB 1EO7A 4NDMB 2X42A 1NCUA 3EO9L 3ILPA 3TP4A 3GKZA 4KJYA 2IH3B 2EYTA 2YS4A 4YHZH 4YUEL 1G9MC 5SV3A 5HI5D 5AAWA 3L5XL 4E41B 4N0FA 4EN3A 1QKZH 1QO3A 1ND0A 1YEJL 4CUCA 4YK4C 4K8RC 4XCYA 2IGFL 3JZ7A 1W0WB 5HYSA 1LVEA 1VFBA 3KJ6H 1F2QA 1YEHH 3FFDB 4F7CA 3U7YL 5AYQA 4KZEL 1C5CH 2IAND 4JHWL 2EYRA 2X4PA 3AFLA 3S37H 4F9LA 3KXFA 3EDEA 5CJXA 4Q6IC 4JO3L 1F4WH 4Z8FH 5D1XA 3MBED 4ODXB 5ANMB 5ITBH 1NCCH 4KTYA 5A2KH 3MYJA 5I1HH 4OBRA 1XGRA 2PW2B 2Q86A 5B3NA 4X6FB 1ACYL 2W9DL 1GVIA 4GKSA 2HLAB 2JK5B 4LPUA 4M00A 5I30L 5JMRA 2HFFB 5KAQG 4ENED 3TFKC 4G43B 2ITDA 3FN0H 4JY4B 1A7PL 1JI1A 3RZWA 4PR5A 1OD7A 1DQDH 3ARZA 1A1NB 5F97E 1WT5C 1UENA 4LPVA 4MA1B 3IJSB 4JPKL 3EDDA 3VXNB 3WLBB 2ADJA 2P8MA 4W6XB 4JG1L 4LPXA 1GGTA 4PRPA 4QRPB 3F12B 5DEFB 5E6YA 3MODL 3ARPA 25C8L 1UB6A 2X5PA 2PW1A 4RX4A 3CFCH 4F37F 5IMLB 4LVHC 1OGTB 3WKMH 1EO5A 3DIFB 3DYMA 5ADOL 4L1DA 5DK0A 4IMKA 5FECA 2W60A 5C0CB 5E4IA 5TF1L 4FZEH 1U8QB 1B90A 1VFMA 1Q38A 2H26A 1ZWIB 2OTPA 3K2MC 5IB2A 3GSVB 3MRGA 2YD4A 4TSBH 3HG1B 2JCCA 4L4VD 2VQUA 5I30H 3UTQB 2VAAB 1ACYH 3C09B 5D5ME 3KPSD 1CFNB 4FG6C 4Z7UB 1VFAA 2WW8A 5ID1A 2NLJB 4Z8FL 5LGKA 1BAFH 3NFNA 1H3VA 3KDMB 2J8UA 4S1DD 3IRPX 5HYEA 3BFOA 4M7ZB 1U2HA 2VSDA 2VKWA 3BT2H 2VABB 4XZUA 5BZDA 1CT8B 4JRXA 4QLRA 2FGZA 2QL1A 2ORBL 4HFWA 3WNOA 4NBXB 4YHYB 4L4JA 5DHXB 4CNIB 4P2RB 5K59E 1NLDH 1EFXD 5EBGA 1DJSA 4DZBA 4OLVL 2WIIB 2AJUL 2LABA 4JLRB 3PGDB 1KGCE 2RJMA 4X99B 5IFAL 5EOTB 2BVQA 1DL7H 5IIEA 5IG7A 2P46B 5CFHA 1ZHLA 3MJ9A 1KJVB 4HWBH 4ODHH 2W9EH 4Y2DB 5FO9B 1LMKA 3D2UB 3C9NA 1IFHH 5E4EB 4DW2H 3VXRD 3U30C 5GS1C 4EBQH 3SGEH 4YQXH 3QHZL 2IG2L 5C08E 3PE9A 5KAQF 3OJ2C 5FYKE 4ZAKB 5D1ZD 2VUOA 4LLQB 4GRMA 5IFHH 4MXQD 1C12A 4XWOC 4YDVB 2CUIA 2ZKHH 1JL8A 1BQLL 5J1TC 2BY2A 3MX0A 4MA3B 4HX1B 4XVTL 2H2PD 5E2VH 2ZWLT 1YJDC 2H9GB 5SX5H 2EDJA 3P11L 5IG7B 3RJDA 4X6DA 4ETQA 3OGCA 1T5XB 4HS6B 4WUKH 2VXUH 4NKIL 1QOKA 4XPFL 2LE9A 2CIKB 2KPNA 2J8UE 1AGDA 4IRSD 5GZOC 2X4UA 3VRLF 2DIBA 5F7EH 1U8NB 3CCHB 2DLGA 4YDJB 2YEZA 4OV5A 4J3TA 1AR1C 4PGJA 1RUPL 4OFVA 5EB9A 5HVHB 1ZHBB 4IMLB 4IIQB 5I15H 4KDWA 4M5YL 4O4YH 3NFPA 5KOMC 1G1YA 3EFDH 4JY6B 2YKLL 1IAMA 2W38A 4F7MA 1QBLL 4RIRB 3WJLC 2QQNH 1XCTB 1QRNA 2XN9A 4PD4K 1KTDB 1PQZB 3MRIB 5GSRA 5CEZD 1HYSD 3MV9B 4OD2A 1A3LL 5DR5H 5KVFL 4QHMA 1XCQA 5JPMA 2XTJE 4X8XA 2CLZB 2VWEE 4JZOA 1QTYT 3PWLA 2YPKB 1CICD 2FCBA 3QA3A 4N1HB 4OM1H 3PWPD 4HUUB 2Z91A 3QEGH 4MJID 3SE3C 3WUZA 5I2IB 2CR3A 3EYSH 5DC0A 2WINB 3B83A 1I8KA 3N9GL 4LGPB 3GUTB 4IOIA 4KRPB 4ZSOB 1XGPB 4G42B 2JJWA 4J3UA 2PYFA 3UTSD 1D3CA 3BP7A 4JQXA 3PP3K 2XG5A 1XGUA 3DRQA 4KZDH 1OTSC 1T0MA 3HPJB 1FN4A 1BZ7B 2FX9H 4I3GA 4L9DA 1L7TH 3GM0A 3MRFB 2DM3A 4OLYL 4YWGH 2A6IB 5F44A 1GRWA 5ESAB 1UZ8A 2BNUB 3GGWB 5ACMA 5IVNA 2EXWD 3UBXG 4L3CA 5D4QA 5HSFA 1MJJA 3V6OA 1H3GA 1J86A 3I6LD 4DKEL 2V2WA 2YWZA 3P73A 4K3HA 1HCVA 1NLDL 3H7BA 1IBGL 1RHFA 1UB6B 1FAIL 4LGSB 2ORBH 4JFQB 3S7GA 2NXYB 1WJ3A 3UC0H 4KK8C 1WQVT 3CLEH 5SWQA 1TZIB 1UJ3A 2P44B 1AGBB 4P0DA 1GIGL 5ICZA 1CD0A 1CVSC 1TZHB 2W65A 5GRXG 4M7LH 1VFAB 2H32H 4LVNB 4R4BA 4OD3H 3HN3A 3HC3L 3K8LA 4LCWE 3P4NB 4NO2B 1NC2D 4XPBL 4GKZA 4NOFA 1JZ4A 3SDCB 3T3PE 1S9WA 3E0GA 1XZ0B 4JJ5A 4PLNC 4JRXB 4RFNC 1KC5H 1NDMB 4S1QL 3PHSA 2R1YB 3MLWL 3CFCL 3OPZH 1XGYL 5E9DE 1JI2A 4Z7QE 2YRPA 4KKAC 4G8EA 1TZIA 4P3WA 1CYGA 5DD3H 4BZ1L 3ABZA 1AI1H 4KI5F 4KROD 4ZXBC 1MAMH 2G5RA 2VLME 1N64H 3B9EA 5I1CL 3PGDA 1GC1L 4QF1B 4X99A 1J0ZA 3U0PB 2NPLX 4UT9L 2OJZL 1RUAL 2ZSWA 4IMKC 2GCYA 1HHKB 4NN7B 3T1WA 1FYTB 4NNYA 3RWDB 1BQHB 4M6NH 2NY1D 4G8GB 2YXFA 4XXDA 4QRPA 5DEFA 2JIXB 2AV7A 3DVNA 3L3IB 3SKJH 4X8JB 2QEJA 1A7RL 3ZE1E 5GGSY 3V95A 4JFXA 2OSLB 2DF3A 4AL8H 3FAXA 5IF0A 4NOBA 5CGYD 3DO7B 1T1WA 2N4IA 4MJ4A 1T6VN 1C5CL 3V52H 4TUOA 1MAJA 1WAAF 4LSTL 1TENA 2PXYA 4XMKH 2V9RA 3M8OL 2IGFH 5HHMB 4KQ4H 3MGOB 4XAKD 3TIDA 3IF1B 4AENB 5GS3A 1BREA 2V5YA 3VGHA 2BC4B 2V17H 4ZS6C 3V6FA 1N59A 1RY7B 5I6XC 2A6DB 2FEDC 5DJ6A 4QHUB 5CEXB 3BGMA 1FGVH 5E2WH 5GIRB 4YUEH 5HHNA 4LCCB 3GMNA 3LKRA 3ZYIA 5K33A 4KY1H 1T2QL 2N1KA 5CZXC 1XH3B 3RGVB 1PX3A 1NAML 3MLSH 3RQ3A 2DD8L 5KANI 3ARFC 3GSUB 2DRUA 4PLJD 1J0KA 4YDJA 4HBQA 4P2RA 3MCG1 5MEOA 1MRDH 1CU4L 2CRYA 1J1XH 4IIQA 3UZEA 4EIGB 4HF5L 1A9EB 5L8KB 4YXHH 1J5OH 1DBBL 2Y4SA 4NQDE 3HI6H 4PJ7A 4RISH 3HAEA 4RWHA 3MV8A 3VWKC 1KENL 3BUTA 3C60A 3ZTJH 1UVQA 1AFVL 2BVPA 1MY7A 1J0YA 4QO1A 4DGYH 2ICWJ 3JBG7 1XGRB 2PW2A 3D5OF 1L4IA 4JM2B 1MWAL 4QYOA 1E27A 3Q48A 3TO2B 2HG5B 4Q9QH 4KK9D 1JWUB 4PJAA 1YEIH 2IH1A 2Y5TA 4HV8A 2DMKA 5DVOA 1NAMA 3ZYOA 2IPUG 1NJ9B 4HJJH 1UADC 5SWZD 3HE7A 4ONGL 2QADC 2YBRA 4U1NA 3D39A 1N4XL 2X6MA 2VL5A 2DQFA 4GMTL 1JN6B 4UDTB 3HI5L 1CR9H 5DGQA 5BV7H 2EDDA 2FL5A 2DQTL 3S35L 3VXUE 5ICYB 4Y4HB 2Y7QA 4XVJL 4YEFA 1HWGB 3K1DA 3S4SA 2ERJB 1Q0YL 5AEAA 1DANU 1U8PB 1M6OA 1JUFA 1X5IA 3VW3L 3GM8A 5I66B 1QFPA 4Y2DD 2F5AH 4KHTL 2MFNA 3IDJA 1N6QL 1ZHBA 4Q6YA 2APXA 4X6BB 3L6FA 3QDGB 4L3ED 4FFYH 2AS5M 2B20A 1ZA3B 3RPIA 3O2WL 1AY1H 3RA7L 3WCYA 4UU9A 2D2OA 5GGSA 2AJVH 5C07B 4TVPE 1X5YA 4D0BA 3WNNA 5JHLL 2NZ9C 4P3DB 4RBPK 1DDHA 3X13A 4L3EE 4AMKH 1OSZB 4ZUUB 4XP4L 5E00B 3O6FB 4XBPA 1DLFL 5BZWA 3BHBA 2Y6SD 3VU2A 1KBGL 2D7NA 5EWIL 4QRSA 4M62L 5SV4A 5F6HJ 5DURD 4P59H 4RRPA 1FPTH 1EFQA 4BFGA 5DQDL 1IM3B 1WUNT 4YE4L 3AY4A 1S3KH 2P1YA 3DUHA 2HT3C 1HIMH 4G7YH 5EFIB 4HMDA 2L4OA 1CFSA 5BJTB 2LAGB 5EUOF 4D9RD 3MRBB 1UWEL 1KXTB 4X4YA 4XVUC 4MVBC 2ADJB 2P8MB 4DKAA 5JTWA 4J4PA 3AU1A 3BE1L 1JFQH 4NCC1 3MGTB 2X4RB 3CFDB 1ACZA 3P9WB 2X4SA 3LRSB 2VLLB 4JFFB 4DN4H 4OCXH 3T0ED 7FABH 5IBLD 3MJ8A 1F4YH 5EZIL 5H94A 5C3TA 3WFBH 4HIHA 4FFVD 2HWZH 1E0OB 2ZSWB 1I3RA 4X4XB 4GXUN 3KPSB 5DJCB 1F13A 1T89A 1EEQA 2W91A 3R1GL 1HH9B 1VENA 2QADB 4LSVH 1CLYH 4AY0A 4XC1L 3HZKB 4F15B 4ZXBD 3V0VB 2F53B 1SY6L 4IDLA 5BMFH 4PS4L 1LEGA 3E6HB 4TVPD 4GG6B 4K8RD 5MI0C 5E5RB 1C8PA 5IF0B 2ADGB 3CK0L 4HC1H 5C0AE 2BSRA 2EC8A 2HLAA 2JK5A 3E6FB 2P7TA 2UZIH 2QHRH 4AEHH 5IM7A 3QWOB 3SGDH 2I9TA 4K3EH 2NY7H 5DMKA 2Z8RA 3TN0A 4L4TD 2FECL 4K7FB 3JWOH 4MNHB 3MJ8B 4A6YA 4PJ9D 4Y16D 3QJFB 4QRRA 4MSWA 5FB8A 1CG9B 4LSRH 4R0LC 4KKBC 2VDQL 1JRHL 5BQ7A 5DEGB 2VH5L 4HHAB 5DT1L 1NCBL 2VQ1A 2O5ZL 3H3PL 3MLRH 4TTDC 1HHJA 4Q97A 4DEPB 4RCAA 5E08H 3SDXE 2AJ3B 2JB6A 5ANME 4Y8AA 3NPSB 1WCBB 5FUOL 3VFMB 1CLOL 3QPXH 1GL4B 4ZMAT 1FIEA 1HHHB 5E0QA 3G6JB 4PLJC 2ARJB 2XKNA 1KFAH 4MXWH 4KPHH 1KPRB 5ABDE 2VXTL 1F4AA 2VNCA 1FFPB 4TULH 1TXKA 1NPUA 1T5WA 2V2TB 4FQ1H 2ZOKA 3GKWH 5F1KC 4KJPC 3TCLB 1BF8A 4R8WL 4X5LA 35C8H 1BZ7A 5JW5B 1P69B 4NM8L 3CFIC 4PRDB 3PIQB 4NZUL 4RDQG 1KCRH 4H1LB 1HCFX 3AC0A 4U0RC 2VDKH 3TIEB 1LK2B 3V6OC 2B2XH 4C54A 1DQLH 4MD4B 1MHPL 1F4HA 3NH7L 4PJFA 4U1NB 4YFEA 3TIDB 1DEEB 3QDGE 4QRPD 5FO8A 1VFBB 4F7CB 1MCBA 2VITA 3KPOB 3MBEA 3HR6A 4D2NA 2OLDA 4LP5A 3HNSH 2LTQB 1WZMA 1KOAA 2F54E 2FL5B 1HKLH 1JHLL 3NACL 5K9QI 5H35B 3DBXB 1WK0A 3A67H 4DK3A 4OZIA 2XFXA 4FQQB 4PG2A 4AJ0A 4FQXB 3LEXA 4NZUH 1VADA 4X7EC 3V5HB 4K2UL 3GSUA 1BVLB 4ZPVA 5IHUL 2XPGA 4TN9A 3JTTB 4H8WL 4QTIH 3AXLB 5TQ2H 2ZJSH 4S1RL 1QSFA 1TQBB 5KSAD 3AM8A 4Y4KC 3B9AA 2F5BH 3N1GC 2P5WE 4OF8A 4MAUL 4HJ0C 5AAMA 1EDQA 5IMKA 2H9GA 1G9NC 3AMLA 4IDJL 1VEPA 3DVGA 5FIEA 1YYLL 2XWTA 3W0WE 3WN5A 4DCQB 1QFWL 3O8XA 1Z9MA 1F2XK 1P1ZA 4N0YL 5I1JH 2GJJA 4NBYB 5J1AA 3VWJD 5HPMA 1AGDB 4NRXA 1XFPA 4QRTA 1A7QL 1QYGH 1OAYL 3FO2B 4LLMB 3S34H 3I3DA 1EGJH 1WZLA 1CTOA 3DROB 3WSQL 3MRRB 4JAMA 4MA1C 5FV1L 2VLRA 4UT6L 3C60C 3ARSA 1BVLA 4E9LA 3QI9A 4XPAL 2JCCF 3H3KA 3TYFA 2EDHA 4FQ2H 6FABH 1DVFC 1MFCL 3OL2A 4M7LT 4O02L 1VCAA 4PTTA 5HYJB 3IKCA 1FC2D 4XMPL 1MVFA 12E8L 1KJMA 1F90H 1II4E 1T4KB 2FO1A 3G6JE 1JYWA 1UYWL 1B9ZA 2GTZB 3JWOL 2C3HA 5BXFB 3BD5A 4X5XB 5JOPD 1KJ2A 1KNOA 1CZ8H 3PWJA 5JNYA 2UZIL 4AEHL 1S7RA 3K2UH 4D94A 3QB7C 1KELL 5ESQA 1FV1B 2Z8SA 3HZVB 4FZ8H 4Y5VC 1A6ZA 4UILL 1WITA 2WMPA 3NFSL 4U2ZA 2EXWC 3GDBA 4FNLL 1LEIA 2YPVH 1U42A 4Y2DA 2PNDA 1QACA 3M1BA 2D7PA 3P4NA 4G6KH 3WHXB 2LU7A 4L3EA 2HWZL 3W0WA 1MJ8L 2L0DA 3ZE2E 5C0CD 5EU7C 5C86A 3QJFA 4Y5XB 5AUMA 5H37H 3ZKXB 1E4JA 1JFQL 1WF5A 1ZOXA 3BE1H 4PJDF 4QNPF 3WNKA 2D03L 4NNXB 1NGYA 3LKQA 5EZOL 1RZKH 2VIRB 5EBLA 1MRFL 3QUYB 3C8HA 1RJZA 4F7PB 3H7BB 1CTNA 1WIOA 4K3DH 3TPUB 5MENB 3TPKA 5T1LA 3SBWC 1UKQA 4MJ6A 5DDHB 3G5YB 2EDFA 5DEGA 3TNMB 1S3KL 1BOYA 5F9JA 4WJ5B 3VXUB 3MR9B 4YE4H 1UH4A 4P2YA 4IOFD 3QUMB 5JUEH 1A5FH 2OR8A 1NBVH 5EWIH 3MJ7A 5ICZB 4WTXA 4N1EA 3A6BH 4ODWB 3BI9X 4QRQB 5C0ND 3P0GB 4BH8B 5JHLH 1H0DA 3ARQA 4MZ2A 2AJVL 1G7QA 4OT1H 1QSEB 5F1NA 3L7FA 3SDCA 5D70L 1FO0B 4FFYL 3HZKA 4NZTL 1IGFH 3IJHA 1FP5A 1LO5A 3BEWA 5A1AA 1VEMA 2F54A 5DFVD 4MDJA 4QT5B 5IMMB 1U92A 4N9GB 3FFCE 2B1AL 1BWWA 1M71B 3TCXA 2YD1A 4LCUB 3OTTA 5BRZB 1JPFB 1U8HA 2VDNL 2C3VB 4OI9A 3P4MB 5C92A 5K9OB 3BQUA 5ETUA 1HQ4A 1X7QA 3MRCA 5JHDA 3QZWA 2R0WL 7CGTA 1RZFH 1UQSB 5GZND 4WI8A 4F9PC 5GGVH 1A1OA 1TPXC 3GRWL 1T2JA 2MKWA 3GSOA 3EDKA 4TNWF 1FGNH 3TBYA 2EH8H 2DBLL 2EEAA 4XP5L 3C5ZA 5EA0H 3RWCA 3KYOA 5DMIL 4FOMA 5ESAA 3G5XB 3V79C 2YPLE 5GRYA 5KJRL 5IP4A 5IKCB 5CD5D 3ZHDA 1S7XA 1G7LB 2PETA 4ELME 3SDXA 1X5KA 1KV3A 2VXVL 2F53E 2NY4C 3MLUH 5IVXE 2NMSA 3GSXB 3C8DA 1NAMB 1MCIA 2YZ1A 4XTRD 3RY4A 4Y4KA 2YBRB 1F8TH 4HF5H 1PG7H 4MQTB 4F57L 4BQ8A 5EO0B 4LSDA 1FVCB 1CDBA 1GZPB 1BQUA 3FZUC 1ZT1A 4MQ7B 4LSQH 1MCCA 2ZG2A 1NAMH 1BJ8A 1S9KC 1R3JB 1QBAA 3QXAB 1DE4A 3T0AA 1P7QD 1G7LA 3ULUC 3H9HA 3T2NH 3RVXC 5D72L 2AEWA 4X6CA 3QG7H 3BP6A 1IAOA 3DV4A 3HRPA 1C16A 1KTLB 3BJ91 3P4OA 3U4AA 4NHCH 4RDQF 3U2SA 5HVWA 5GRJL 2HA1A 2P43B 4KRMB 1MIMH 1P4LB 1I1AA 3I6LE 1I8IB 3O2DH 3QDGA 2VXQL 2ZPKH 4WEBL 3BN9C 3QUZD 43CAB 1HE7A 3T4AA 5KTEH 3K4DA 5F7DA 3TO4C 3G9VA 2OCFD 1I8LA 5L2JB 4XCNB 1VKXB 4E41A 4K7FA 3SKJL 4PJXA 2GFBA 5KSBE 2NLJA 2P5WD 1QSFD 4WUUE 3KDMA 4KH2A 1CG9A 3UO1L 4Y16B 4BZ2L 3VFPB 3A6OA 2V7HA 3FT2B 3FQWA 2WBWB 1ES0A 1P84K 5EDXA 1GYAA 5EC2A 1I8MB 2OSLA 4MMZC 5M95B 1OP3H 4CNIA 1MLCB 3HAEG 1WAAA 4NKMA 5DS8A 2Q86B 4JQVA 3QCVL 4BZ1H 4K71B 4IRJC 1WCBA 1IAKA 4HIEA 3MUY1 2IQ9H 3QDHA 5CJQL 3GSWA 4KK6D 2BHZA 4NQTA 1R5VA 2P5EB 1QEWB 2AV1A 3VWJA 4GBXA 2DQUL 1J18A 3EIFA 4HKXB 2FLBT 3BGMB 4XRCB 3RVXD 2WUCH 3GSNB 3CU7A 4MXQC 1QFHA 2PO6C 1A47A 4PB0H 1LNUA 1Y0LB 1OARH 3MUJA 4N90D 2ZZUT 4LPTA 1YNLH 1K8DB 5GSVA 5D1QA 3MYZA 3AUVA 1CD8A 3FZUD 1EPFA 2YOCA 1R0AH 1J0JA 4HKJA 3U0TA 3RNKA 3QWOA 1DBML 4PV9A 1M7IB 5DD0H 1BEYL 3CFJA 3IVKA 3BGFC 5JXEA 4JN1H 2J8UF 4JM4L 4K7PY 1CFSB 5BJTA 1S7QA 3T4YB 3MRKA 3REVA 3WFDH 5KW9L 4NWUL 3MUGA 1MFBH 5F93C 3L3GA 3HS0A 1PEZA 5ENWA 1OARL 4DKEH 3NA9L 4PRID 3QIBD 2ID5A 4J4PC 3UJIL 1LNUB 1Y0LA 3MO1A 2X4OA 3SDCC 2JIXA 3OF6A 3FQRA 2YA2A 2ADIB 4NM4H 4OIAA 2IH3A 4YAQA 3DUUA 3LSOA 2CH8A 1TVBB 1ZANH 4OCYH 5FGSA 5IJKA 3QHFH 3L3OA 3RKDC 3MV11 5F6HI 3ZZ1A 2FJHB 3D69A 1YEDB 2P8PA 4OB5L 5C7XL 3BKCL 4L4VB 1IAIM 4M1CD 3N9GH 3SCMB 3A6CH 5C6PB 4RGNC 2DKUA 4AH2B 2ADGA 4OM1L 3VWJC 2GJ6E 1P5UA 5C0AD 5DUBB 5HVFB 4XCFH 4JZJA 5JW3L 4WHDA 3OZ9H 4O2FB 3VG9C 1BHGA 3DNKA 4M1GH 4HGWA 5DR5L 4X6FA 4GAYA 1U0QA 5F1IA 2DWDB 4G8GD 3UDWC 3BKYH 1G9EA 4WFGE 1FLTX 2B4CH 1ORSB 2NXYD 2A77H 1BFOA 1EJOL 3MROB 4G42A 4HMEA 4Q6IB 1IGML 1MCWW 2X4QB 3VXTB 3LZFH 4YEEA 4O4YL 2P4AB 5I15L 5LGJB 1FNEB 2MCG1 2OTWB 3ARUA 5KSUA 1ZK9A 3V4VL 3T0EB 3L95B 3CIQA 2QQKL 4TNVF 2N7AA 3IDXH 5EULV 1MIML 4L8BB 1FFOB 4KKCD 2YUZA 1WFNA 3OXRB 4POYA 3GNMH 3GJFB 2XQYK 1KIQB 4JFPA 5D72H 3SDCD 4RSVA 4EIZC 2NY0D 4GRWB 3VH8A 3MOQA 5BW7A 2HH0H 5C0IA 3RX5A 4KWUA 1A6ZB 1UKTA 4JVWA 4OI8A 1SYSB 5IFJA 3CGTA 4DOHB 3OKEA 1RUQH 4HZLA 4HK0A 4XI5C 1F58H 5CCKL 3MXWL 4M03A 3MV9D 2FBOJ 4H26A 5F96L 4F57H 2XWTB 2MTPA 3SE4A 2GJ6D 3T0EA 4PJHF 1FVDA 3IB4A 1B0RB 4X7DC 3MRJA 2E7MA 4HJGA 5IB1B 3QHZH 1G1CA 2FX7L 3H9SE 2NY1B 2B8OT 4KFZC 3S4SB 3QUXA 3MZTA 4GKZB 4PRHD 1ZLUK 4TUJA 1IGIL 2V6HA 4Z5RB 5IFJB 3HRZA 3GMLA 1KIRB 2DBLH 1T20B 2IMNA 4OZIB 4NDMA 5C0AB 2ENYA 5FDWB 3ARYA 3O9WC 1RULL 2DYPA 4IRZH 4Q58C 1LQSR 2CMRL 5T1KD 1IT9L 2Z92B 5EUOB 4XCEB 1FVDB 2R0WH 3TN0B 3BZFB 4JFEB 5FA4A 1FL3B 4KAQH 3WO4C 1A9BA 2YD3A 4EXPX 3SDXF 4JREC 3KPRE 5HGAA 5F7YC 3F7QA 1R5WA 4LHQB 1LD9B 2ERJC 2NY0C 4MZ3A 3OX8A 4UNTA 5DMYA 3T8XA 4PBXA 1P7QA 2DN7A 4Y7MA 2MCPL 1AGCA 3IXTB 3VDBA 3STLA 4O51A 2O5YL 2X40A 4X8JA 3GBLA 4NUGL 4UINL 5IBLC 2VQ1B 3BD4A 4NP4H 2OR9H 4C83A 3EO1A 5GS2D 1NDGB 3U7WH 5CJOL 3WFEH 4Q0XL 5ESVB 1FG9C 3B2UC 4WV1A 5D70H 1U3JA 2ICCA 4HJ0D 3PXHA 3U48A 4QXGH 2OK0H 1S7QB 1G7HA 2RGSA 5FYLD 2KUTA 4Y5YC 1YNKH 1MIEL 2XNAA 1X7QB 1NBYB 3KPNA 3LN4A 4TVPL 3F8UB 5DMGC 1PY4A 3ARGD 2GJ6B 4LHUB 5HYIA 1DSFL 5JUEL 4W4NA 1RZIB 5KVEL 3RGVA 3TYGH 2FATL 5FOBB 3ARDC 2ZOKB 3FN0L 2CRIA 3E6HA 2LQRA 3V4UL 4RMQA 4XVSL 4X0KA 3G5XA 2W9DH 5CIPB 3VDAA 3WIFB 5HD8D 1K8IB 5EZOH 3KLDA 4XBEH 4GOSA 1F4WL 1KYOK 5C09B 5MEPB 3HE6A 3D69B 1YN7B 1TZGL 1QSED 1FYTD 5C07E 4RA0C 3W5MA 3C08L 4WHYH 2HMIC 4D9QE 1NFIA 4R4FH 2HN7B 3V7AG 4U0RB 1F4XL 5KS9F 3PWVA 2BDNH 3LPWA 4PGBB 5FUZH 3D85A 3VH8G 3TA3D 5F7WC 3MRFA 2G60L 4CKVX 5MI0B 3NFSH 4YHZL 1RZ8A 2FDBP 2P5WB 1E4XH 2VDLL 3UPRB 1JV5A 5T3ZD 1DP0A 1QFUL 5EU5B 3NCFB 5HYSB 4RIRA 4P5MB 4ZO7A 3RTQA 1CZ8L 2DQFB 3QFJA 4FQXC 4L4TB 1Q9WA 2WSKA 2X4PB 5EU6E 3UTTB 2B5IC 4RWYH 4TTDD 5T33H 4X7FC 2UWEF 3RNQA 3KXFE 4H0GA 1W72L 4P2QE 5JORA 2QSVA 5EU6D 1IEBA 3FOMB 1U8MA 2VZSA 1ONQB 2SEBB 2C9AA 4BUGA 3U4EA 5KVDL 4ODTH 4DN3H 1SYSA 4P57A 1A7BA 3PWPB 4EZMA 5IUSA 1K85A 1TLKA 3NPSC 3E3QC 3QEUB 3TA3C 3IT8D 5DZOA 4XXCC 2VOTA 3DSFL 1AD0B 3BD3A 4APQC 5LXGH 3T0DA 4G9FB 5C0EA 5GS2H 5GGSB 2XTJB 5I1IL 1A7QH 4IOSD 5DRWB 4BSWA 3UTZB 2C1OB 3UZQA 4Y4FD 3F12A 2HJLA 3DBXA 4P4KD 4JN2B 4PRPE 5DGRA 5GGQH 2FR4B 3WXWL 3G6JF 3C87A 1YYLH 3HKFA 2X44D 1R3HA 5J11B 2MQ3A 4MAUH 4LQFL 3MA7A 1A0QH 2F5BL 3IGAB 1Q8MA 1HDMB 3OKKB 3ZE2F 3W81A 4OGXL 2WWKT 5DLMH 3OKNA 3TV3L 4U7KA 3V5DB 4ZNEE 2XA3A 3IDIA 4K2UH 3RVTC 4ZO6A 3QXAA 4JO2L 1B2WL 2BHYA 4FQIH 4WCYH 5IHZA 4GBXB 5B22A 4C4KO 5IW1A 4LEXH 4ONFH 4PG9A 2DKMA 3W2DH 1ZLSL 5GRUL 3BOVA 4HUXA 5EUKB 3A67L 3DGGB 1J8KA 5IB3B 3NACH 1HKLL 1AIFB 2AEIT 2FSEA 4CAGA 4R96A 1FH5L 1I1AB 2X09A 4WWKC 5IT2L 2AKRA 3MRNA 3LCYA 3VXMA 2VISB 3MOAH 1B4RA 3WNMA 2F19H 4XP1L 2EDRA 2NR6D 3RZCB 5J13B 1U3ZA 1UZ6E 4GW1B 1KCRL 5JA9A 5I66A 3HB3D 1BJMA 5J12C 4BQBA 2YN3A 4R8WH 1LEGB 2YXMA 1GGYA 4YO0A 3V9FA 1WZ1H 1YEGL 2ICEA 4WGVB 5M7QA 3C9NB 5CP7A 5HYSG 2NW2B 5CEXA 4JHAH 5F9WB 1AHWA 4N0UA 5DRXA 5EU6B 1I7UA 4P5KA 4Z78B 2VXTH 5C0DB 3REWB 4L29A 4LLAA 2J6EH 3H3BC 3O3AA 1G7MA 1A02N 4OLXL 4EXKA 4PY7B 1KTKE 4ZAKA 4N0RA 2CGRH 4MSWB 2H41A 5C0JB 1JHKH 1IGTA 1NFDB 3V7MA 5B8CA 3N06B 3NIDF 3VXQB 5HY9B 4PJDB 1LHZA 4NRZB 3L3IA 5D6CA 2VLMD 4JDVA 1MQKH 5D1ZC 2VZOA 2H1PH 3HI1A 4YDLB 1NCAL 3NN8B 2JE8A 4LSRL 3LEVL 4O2FA 5KSBA 1E4KC 4RZCA 2D7TL 5T1KA 1AE6H 1NMAH 5CBEA 4N1CA 3RDTA 5J1SC 4PY8J 3V6FB 3FL7A 5ETUB 4EDWL 3KPMB 4BELD 1CGSL 4HKJB 5GGTH 3U0TB 2OI9B 3S36H 2NY7L 3VWKD 3JUYA 1EH9A 1NFDA 2XWJB 3ZL4L 3CDGA 5HHXL 3UBXI 1MJ7H 1NMBH 2ADFL 1IC4H 1A3QA 4XI5D 3SOBL 4WUUA 2R1YA 3V8OA 2D7OA 1DBJH 2QHLA 3QIBB 2H32A 1HI6A 3QDJD 1BGXH 1J8HE 1IM9D 3KYOB 4MCYA 4C58B 4K8RL 5DA0B 3UPRA 4YZFF 3BESR 1QRKA 3FQRB 3TEUA 5ICXB 3ROOB 5GGTA 4OLEA 5TH2B 2VYRE 4AEEA 1IZKA 5BVPL 3BGAA 1X5AA 3DUUB 1FNSL 2KQNA 2YR3A 1U8KA 3FCTB 5EZLA 3SKMB 1SHMA 3BQUC 4JHBA 4JFZL 5LJYH 1G7QB 2A83B 3I75B 3ARBB 3GIVA 4GAGL 3GJFK 1MWAA 4PGZA 5LQBH 5AZEL 4JPVH 3MV01 3P77B 2IWGA 3ALPA 5GSVB 3BZDA 3STZA 2JB5L 5EBMB 3I02B 2VLKB 3SE9H 3PJSA 1HIML 4HQQL 4X0KB 4ZOAA 1JF1B 1J1PH 2Q8BL 4PJIF 1NGQH 3CX5J 3QXUA 3T3MF 1K8IA 5J9PA 3R06A 3PDOA 4GAFB 1A2YA 2FYYB 1U3HB 1JPGB 4XAWH 4F7EB 4AIZB 4UQ3A 5KVGH 3TVMC 5C0RL 3HCVB 4AMKL 5SWSD 2HLFC 2HRPL 1NFIB 4NN6B 2W1NA 4LQ1A 5TPWL 5C71A 1R3HB 1U6AH 5ALCL 2R2EB 1P7KB 8FABA 5EUOA 4LMQI 5E8NA 2E6PA 3BEVA 1NL0L 2BXZA 4N5EC 1PLGL 4KJQC 1QQDA 3CVHH 4PR5B 3O11A 3HA0A 15C8H 3MZGB 3UJJL 5JR1L 4M4PA 4P4RB 1BBDH 4PG9B 2E8ZA 3LIZH 1ZGLB 2NY2D 2OL3A 4MAYC 4WTWA 3O9WD 4XVJH 4HUXB 1J10A 4X4ZA 3O4OC 4OIIH 3WMSA 3CH1B 3MRLB 5J56B 4GKNA 3WIIL 1I3GH 2FGWH 4GO6B 5INCA 5I1KL 1N0XL 4ORZC 3QCTL 4WTZG 3GJFH 3G08A 3QIWA 4ZODA 3TF7C 2IH1B 4M6AA 4NZJA 4PUBH 1HHIB 5GRWA 2Y07H 1DQQB 5GGRB 4EUPG 3L3JB 5TE7L 5I1KH 4P2QA 1YQVL 3CFKA 4JPWL 5LCVH 3LKPA 3DVGB 3QIUA 4G6AC 1JE6A 2BK8A 2OL3B 4OIIL 3JV4B 5EU6A 3K4AA 4CL7A 2RAMA 1DBAH 3FFCB 1EVTC 3LH2H 2NY4B 3NGBC 2BX5A 1KENH 3CX2A 3X12B 1BBDL 2K3TA 3MQIA 2WAHA 4PJXE 3HE7D 1ZHNA 3KHOA 4GH7B 4Z6AT 5JXED 3D39D 3D3VB 2QSQA 3FAWA 2VN7A 3MFFB 4JQVC 5CEZH 3GMOB 1GGIL 2VDOH 1PDKA 4OZFB 2W92A 4I2XA 1DQQA 5GGRA 3IF1A 4RGMC 1U6AL 3FB6A 4PJBF 1DQMH 5CINL 5HYJA 4Z18A 4UV7H 1KXQE 2IANA 1HN1A 5DJ8B 1RZJC 4IRJB 1E6OL 4X5WA 4GBXC 3UPCA 3V6OE 2E6QA 3SKUD 4QWWD 3MNVA 3V4PH 1TVHB 3OHXB 4JR9H 3AREB 4U1IA 4HXBH 4AT6A 4HUNB 4KVCL 3SN6N 1C12B 3MRQA 4PJGA 4NNPH 4RFEB 4JG0L 3DI3B 1LILA 2HMID 4K94H 4JGMA 4U1JA 5GS0H 4BH7A 1I9JH 5FO8B 4PLKD 4JGUA 3MV7D 3RTQB 5HVGB 3VFVA 5LQBL 1MPAH 3QNYA 4AZ8A 2YRZA 2J8UB 2WQ8A 4KVNL 3B9KD 3BKML 4FRWA 2NTSP 2PXYC 4G8GA 4F9LC 3VDCA 3FTGA 4FFZH 3U1SH 4OCNC 1DN0B 2EIBA 4WW2C 3V5HA 1R5IB 2X41A 1SBBA 3BDXA 5HVHC 1F6AA 4I3RL 1C1EL 5C8JB 2JJSA 3LKQB 4HKBB 1MAML 1BGXL 3KPSA 1AQKH 3RL2B 2IPKA 4G8IA 3MLYL 4PD4J 4YR6A 2NW3A 2R1XA 4J4PD 4ZDHA 1OF2B 5GGUB 1Q0XL 3I85A 4HWZA 1IC4L 2ADFH 1NMBL 3K4ZA 2QQLH 4GG6A 4U6VL 3CC5B 5IOPB 3VD5A 3LB6D 1X5ZA 2W0LA 1A6AA 1Z9SA 1T21B 2F58H 2P5ED 2EIZA 5TQ0H 3OKLA 4PJEF 1DQJA 4GSDH 2C26A 1WFUA 1YMMA 1RJYB 3SQOH 3TJHC 5FB8B 4WU7A 4YHPB 4MNGE 2ZCHH 1GIGH 4NYLB 3EZJB 1UACL 1OGAE 3MV7E 2GJ6A 3BKJL 5FUCE 2HFGL 2EDXA 4K7PX 4GMSH 3CLEL 1YNTA 1BX2A 5B39G 5DK2A 3WIHH 3KNBB 3I6GA 1DDHB 5BO1H 5CHNB 2X7LA 1NBZA 2ED7A 1BM3L 2EIZB 2YC1A 1OVZA 4I18C 1MSPA 2AEPH 2HFGH 2X4UB 1OAUL 4OLXH 2A9NL 2XRAH 2ZCLL 3HMWL 1X6NA 4UAOB 2ZCHL 5GXBB 5EZLB 4U6YA 1A4JB 2CIIA 3BMWA 3SQOL 3QNZA 1AKJD 4JHAL 3LQAC 3K81A 5IBUG 1MJUH 2UYLB 4QY8B 1T7ZA 4GRWF 2VAJA 3IDGB 1ITBB 4U6HB 2X9WA 4KZDL 4HLZH 1BVKA 4YDIL 1XCTA 1OM3H 5E7FA 5LGHH 3MRRA 3QP3A 1WFOA 4JAMB 5INDB 1QNZL 5T3XD 1XEDA 4E5XB 2X4RA 3WL9B 5IESH 1NBQA 5E94B 1FNGB 2EC9U 3E1F1 3BPNB 4KI1A 1I4FB 3BZ4B 3QUMH 5T1DH 3MJ9L 4LKCB 1JGVH 4NC1C 3EYSL 1FL3A 1KCVH 5A2FA 1W8NA 1FL5B 3IKCB 1MEXH 1FH5H 3T0WA 3VFRA 5DA4A 4IEFB 4OFYA 4HPYL 1NEZB 1ZLSH 4WW1B 2GUOB 4Z7WA 4JGJA 4WCYL 4WO4B 2Q7NA 5DHYA 3PABB 3V5DA 2NY1C 3WEXB 4ERSL 3TV3H 5CILL 2R0ZH 1DBKL 1FN4B 3HPJA 1A0QL 3IJYB 5A16A 3HNTL 3IAGC 1KCSL 1INDL 3SE8H 2X70B 4H0HB 3DV6A 2RB8A 4L5FH 3WJJA 1A4KA 1Y6KR 3WN5B 3UTSA 2GKIA 3GSRA 5IEHA 4PJIE 4NKIH 5TDPB 5FYKL 3HRZB 4K9EH 4WUKL 5EO9B 2A73B 1WISA 2VZ3A 2ITCA 1T20A 3TH2T 5KSAA 2BRRL 4MNQA 5L6YL 1U93B 4JR9L 2OR7A 4RA3A 3ZE0F 1DFBL 4APQA 3FOLB 2FJGB 3ZKMD 2YK1L 4P46A 5HHME 3DUSA 3IGAA 2NY5C 3IAQA 1JYNA 1PY9A 4LLVB 3O8XD 3MGOA 4UV7L 3K74B 5CINH 3VFMA 3FO0L 3QUYD 1W72H 5I6XB 4U3XA 1O0VA 4OFPA 1NGXA 2XXMB 5B3JE 1HHHA 1I1RA 1CFQA 1A4KB 5CEZL 2D31A 4YQXL 4IS6A 1UQSA 2KH2B 4LU5H 1N3NB 2H6PB 4PJ9C 2PTUA 1C5BL 1QFUH 3E2HB 4XAKE 3DWTA 5JW4N 5JW5A 2EDKA 1QVOB 1KJ3L 5DD1L 2VXSH 2AJUH 2WNGA 4HS3B 2G60H 1G7JB 3FHQA 1LO0H 5J9PB 4DUXA 2QTEA 3IJHB 1D5XB 3PWUA 5JOFB 5TE7H 4MDJB 2FD6L 3KYMA 4FQHA 3T09A 1VFOA 3GSXA 4AH2A 2DQHH 3OKMA 3GI8L 3I3EA 1CL7I 3ILQD 1YPZF 3DECA 5DJ2B 1JYVA 4CMMA 4H20L 2CO7B 3FRPA 5DQ9B 4BQ6A 5I1DB 1BAFL 3QDJB 2NR6C 1TIUA 2R2EA 3GHEL 3P3YA 4OI7A 1BLNA 4PP1C 3DETD 2YD6A 4HBCH 1B3JA 3F7VB 3TBWA 3LIZL 2A1WL 4MWFA 5HGHA 3OJDB 3V4UH 4XCCL 3VFTA 5I8KH 3RU8L 3W0WD 4FZEL 4R9HA 4YDKL 5BRZE 2EDQA 3T4YA 1NCTA 1UCBL 3OJMB 5T3ZH 4FTVB 2NXYC 4JDTL 2PTTB 4WFGD 25C8H 4M6MH 1TVDA 1ORQA 3EO0A 4MCZB 5BCAA 4JG1H 5ANMA 4CMMB 5LKNA 3WJLA 3BRDA 3UP1A 1W2KT 2FEDD 2DIAA 2PF6A 2RFXA 5J4MA 4JPKH 2OK0L 1GGCL 1FDLL 5CGTA 4MJ5B 3O41B 2HRPH 3CXHJ 4P5TB 1P9MA 4U6YB 4XPHL 4JCMA 1SEQL 2I5YL 4XAWL 3UAJC 3WFEL 1AO7B 3SKNB 2AJYH 4PJ8A 1SJVA 2EE9A 4RAVA 5F7NC 1MOEA 4NP4L 3B9KA 3QQ3A 2YPLD 3UTTD 2GJZB 2O5YH 2AQ1A 5GGRY 4AG4L 1GAFH 3LOWA 3W5NA 3CC5A 5IOPA 4D0BB 3FRPG 3L5WB 3VXSD 1EUTA 3SJVD 4IJ3C 5LAXB 3FONA 3SHSA 5KN5B 4KUZL 4FMFA 1OGTA 4JPVL 4U3HA 5DSCA 1KJ2B 1KT2B 3U7YH 1YEHL 1AGFA 3EUUA 5MEQA 1U91B 3MFFA 5FCSH 1YEJH 4Y19E 4LLYA 1ZMYA 4OCSH 4YHPA 4ZO8A 5TE4L 5LWYH 5DFTA 3NIGE 2OQJA 2G5BA 4G6MH 4NN7C 1ZXQA 2DB8A 1NUFA 2CKBL 1RULH 3TWCL 4HULB 4PJGF 1D5MA 4OJFL 5KSVB 3EO9H 4KJWC 5T3XL 2CPCA 3ALXA 3GSNA 5E2JA 2FWOB 5H37G 1SMOA 1TVHA 1NAKL 2GAZA 4ODBD 4ZAKD 1CE1H 2VTFA 4MX7B 4BFIA 3DX8A 1GH7A 2ESVE 4ALAH 1DUZA 1K6QL 1MH5A 1KJ2L 3IDMB 3SOBH 2A0LC 3SCMD 2FX7H 4NRXB 3CDFA 1BBJB 1OSPL 4RGOL 5H94B 1MJ7L 4L3AA 2CRMA 1PVHA 2JJUA 1HYRC 4HWUA 1E4XI 1KLGB 3CX5K 4X6EA 4YPGB 1I8KB 2X10A 3GUTA 2D0HA 3VXPA 1XZ0A 2BFVL 1JZ2A 4TOYL 1F58L 3NABL 4PTTB 5F7MC 1NUNB 1RMFL 2BNRE 1RUQL 3LEVH 1XR8B 1SEBB 1UG9A 2HJFA 3FFCA 3D2UD 3KJ4B 4LF3A 3DGGA 1MQKL 4HEPG 1H3UA 1AP2A 3RZCD 3GNML 1E6JH 1DE4B 2ZCKL 3D18A 1KXVC 3QZWG 4QOKD 1FBIL 2LAAA 3NOIA 2ZG3A 4IOFC 1H3PL 1VB9A 3L7FB 3JWDC 1LP9F 4ZNCD 2QQKH 1LP9A 4PYHA 4N5ED 3MLVH 1FLRH 1WBZB 2V7NB 5D7JD 3WFZA 5IWLC 1MCLA 4NO3A 1MCFA 2FEEI 2H3NB 2IBGA 5IHLB 3LZFL 3GBNL 4KJQD 4XWGH 1FYHB 3MLXL 4P5KB 3JWOC 4KU1A 2F8XC 5BRZA 4J2XA 1YEGH 5FUCC 4HGWB 4OFYD 2P8LB 1CXKA 1RVFH 3MBEC 4RRPG 5F1IB 5EORL 3LKPB 1YECH 2YEZB 3QDGD 3L3HA 2P48B 4YGVA 1QPPA 2X05A 1ZGLM 3KPLA 3DXAE 4JQIH 3RJQB 2YA0A 4HUKB 1IKFL 5D96B 2F19L 1JGEB 3OSKA 3MOAL 32C2B 4PRIB 4S2SB 1OP3K 4E41D 4LCWA 4LNRA 3B2VH 1C08A 2X1QA 1A6WH 5IV2A 4XB7A 2X7LB 1IGCL 3RWFB 2P5WA 3X17A 4HT1L 3L3OB 5DD5L 4OLWL 4B7IA 4FQIL 5EU5A 1D5ZB 3HFML 1N8ZA 1MHHB 3NA4A 5B38B 2ZUVA 4RFOL 1NGZA 2JJVA 4PJ7B 4GRMB 1DLHA 4L9LB 4OZGF 1AXTL 2B7DT 4LQFH 4HWEH 4N9OB 1K4CA 4MNGA 5IQ9A 4B5EA 5CZKA 5KW9H 3EBAA 5F3BB 5GGQL 5E5MA 8CGTA 2BNRB 1JWSA 1KLUA 4UOJA 1FSKB 4XX1E 4GRWE 1A6AB 2E27L 3TLRA 4AEFA 4GBXD 3O6LL 3I6KB 2E9BA 5TDNB 2DQGL 3TJEL 2QADD 1W0VA 3ULSB 5TH2A 2ZUSA 1JTPA 5EOTA 5FYKU 4PJIB 4EVNB 3P73B 3T04D 1CXIA 3VFNA 3G04B 4KKLC 2AJXL 4NYLA 3WFHA 5IJVB 1X6LA 3PP4L 5FHBH 2GITB 4ODXA 2IPUK 2ZUYA 1FZJA 4GXVH 4OF7A 5I1DA 2GTWA 2BVOB 4GG6F 5HYQB 5EBWA 1Q72H 1UJ3B 3LKNB 5CWSB 3U36B 1ZS8A 3I02A 3BPCA 3QIBC 4BSJA 1QBMH 5CGMA 3BZFA 4XPGH 3G6DH 1OTSD 1LE5B 2QSTA 3LPGA 4MWFB 4RQQB 2AK4A 1HSBB 1KUMA 4OZHB 2CJUL 3IDNA 1S7SB 1I3UA 4EVNA 1R24A 2VDLH 2FIKA 1BZQK 2CDEB 3IDUA 2NY3B 4V1DB 3PF2A 1TCRA 1NCDL 3G04A 4NPYB 1S5HA 4LHUG 4Y19D 1B88A 5EUOE 1JWMA 1VA9A 5FYLH 1CDHA 4XHJC 1LGVA 3RBGA 4CADB 2R56H 2DLFL 3IFPA 4JREB 4X80L 4DOHE 3QWQB 2YD9A 3LEXB 1IC7L 4M48L 4YXKL 2EO9A 1HSAB 4Q74A 5I17B 4MA8L 3BPCB 3DSNA 4P5TA 2R29H 3GI9L 4XNXL 3LS5H 3VXME 4G5ZH 1BD2D 4I0PB 1TZGH 4GFTB 1I1FA 2OYPA 2X89D 5DZLA 5C0AA 5ERWB 5IB4B 2Y5EA 4Y4FB 4QTHB 1RZJH 4QHLA 5GRJH 4XRCA 5BOPA 4P4KB 1SM3L 4PJBE 1JMZA 4R2GC 3C2SA 2BSED 4XVSH 4J3OC 5F1OB 4IRJD 1IAII 3NPZB 5FCUL 2EDLA 4QHMB 4IJ3B 4JB9H 5KVEH 1V05A 1N6UA 5AYUL 1B4JL 1NH6A 3VGFA 3LDBC 3T4AB 3DROA 4NKQB 1G0DA 3L5HA 4F8QA 1R3IH 3RPKA 3VH8B 2EDOA 5D93B 4PV9B 1RJZB 2VC2H 3SO3B 1AGCB 1NCNA 3IXTA 1AC0A 3JV5A 4LPWA 2YA1A 2X70A 1GZQB 5D7IB 4R90H 4FQHB 2APFA 1XF5A 1A22B 5C07A 3L7EA 4WHCA 2ZG1A 2R2BB 4TVSa 3LKRB 3DTXB 4S0SD 4HLZG 2ZNWA 3O6ML 1AXIB 1JZ7A 1BLNB 2AK1H 3VGBA 4K94C 1ZSDA 3QRGH 5DMIH 3GJEA 2H45A 4KTEH 2GSGA 4LLUB 4PJEE 4S10A 3S88H 5EG6C 5GJSH 2VZVA 3NIDE 1OP9A 1NEUA 4Z7QF 4Y4HD 4PJ5D 4UB0L 1GZQA 2YN5A 1BIHA 4NN5B 5JW4M 1HHGB 1LDPL 4PJHA 1X9QA 2K1MA 1RPQA 1RU9H 1WCQA 4NGHL 3HAEH 3IJYA 4IRZL 4NBZB 1F3JA 3NGBB 2OTUA 3B8SA 4GAYB 3I9GH 1PZ5A 1W72A 4FXKA 4KTEL 4M7KH 4ZOBA 3H9YA 3TNNB 4MXVE 1MCJA 2KKQA 3QEQB 4KKBD 3M07A 1ZSDB 4JFOB 3RI5K 1GOFA 1RSFA 3OXSA 2JJSC 3NFPB 2DDQH 3D39B 2BVQB 4WI7A 1XF4B 1XGTB 3BDYH 4C59B 5DWUL 1T1XA 4G3YH 2CLRA 4BSWB 1FL6B 2YPLB 4U1GC 3HS0B 4PJBB 1FVEB 2VB5A 1OTTC 3T3ME 3Q5YA 3MXWH 5F96H 4F37K 3HUJA 5CCKH 3EDJA 2PR4L 1XH3A 2D7MA 2HVJA 3A6BL 2OP4H 5D2LB 4W68A 3QFJB 2HKHH 3RDTB 1R3IL 1U8PA 5GJTH 4ZFZA 3VFNB 4DFIA 5FYLE 4Y5YA 5EZJA 2GCYB 3U0WH 4DKFH 2DL2A 4S1SH 4C56D 5C0NC 3H0TA 4NNYB 3RWDA 4NQEA 3QJHA 5HGHB 4LLDB 4N8VA 5CSZA 3B5TA 4LCIL 1AKJB 5FCUH 4DGIL 4S0TD 2Q7YB 1LEKA 1LO5B 1VADB 3BEWB 1X44A 5J6HB 4O58L 3T1FB 3D3VE 2VDMH 1RZJL 4XGZB 3WL9A 3IDXL 1HH6A 3ARGC 1AGEA 3VD9A 2FZ3B 2HVKA 3GSQA 3VXMB 3QQ9D 2PXYB 1BBJA 1REIA 2FIRT 4MJIA 1JPFA 2JF1A 1OW0C 3EOBB 5C09A 5MEPA 2HT2C 5E03A 4Y2OA 1IC1A 4IRSC 5IHBA 4MA8H 1MCKA 2HG5A 1FC1A 1U8LB 5C0GA 1DLHB 1BFOB 4G6KL 3BKYL 1UWXH 2DLFH 3I75A 4X80H 3QDAA 2CLVA 4XH2B 3LMJH 4LARL 3NTCH 4QXUL 4WENB 4JKPL 4PJCA 5CP7B 4XCFL 2I24N 5HHOB 1WZKA 1CGYA 1KB9K 3DX9A 5FK9B 3STZB 2LV4A 3IETB 3RL1B 3CFEB 5HDBF 2MQ0A 4EKXA 4I1NB 2UVEA 2AVGA 5J12B 1EGJA 3GSQB 1KG0A 1XIWD 4H5SA 4MJIB 2V5TA 1ZGLP 3NZ8A 5JHDD 5F9WC 5C0JA 1TJGH 1IGYB 1LE9B 2PN5A 4PP1D 1L6XA 3D85D 2R4RL 1S9WB 4MS8C 5GHWL 1F90L 1S8DB 3RY5A 3WFHB 5DQJA 1EFXB 3EO0B 5JHDE 1LO4L 3RVWD 1W0YT 3I2CL 5JXAH 1KEML 4FQ2L 6FABL 2UY6A 4M1DH 4W6YB 2F8OA 1EEZA 2OZ4H 2Z93A 5C08A 1QSFE 4BYHA 1IQDB 1QR1A 1N5AB 5T5NG 4I0KA 4HC1A 1D5IL 1NFDE 4M8QB 4GRWH 2EZ0C 4HCRA 4MDIA 3S34L 1R3JA 3WBDA 1G7HB 4ONOA 1FIGL 3KHQA 4ZFOL 1U9KA 1WBXA 2VL5B 1DBMH 43C9B 4UZGA 3GSNH 5EU4A 4D0CA 1YC7A 2AABL 4UOW0 4UDTA 5JOEA 3MCKA 3RWGA 3Q6FB 4IDJH 3VFGL 4HWEL 2P24B 4DFHA 1QZ1A 4RMWA 2NYYC 2VN4A 4PB0L 1YA5A 3BZEB 3PGFL 2AEQH 2CKBB 3OR7B 4YFLI 1MFAH 1P2CB 4RFOH 2Q76A 3GJEB 5CIPH 3I3BA 4WHYG 5FA3B 4YHMH 1TITA 5I9QB 1S5IH 1VGKA 1CXLA 1N8ZB 2XWBB 4Y19A 4R7NA 2HFEA 1GPOL 5GPRA 5BV7B 1PKOA 1MCOH 5F21B 3IU4H 4LOUD 1NCWL 3RVTD 2WZPD 1JHLH 5D6DA 2ICES 1CVRA 2UUDK 2WUBH 1F02I 5EN2A 4GUPA 3CJJA 1PAMA 4P5TD 2AXFB 3X11B 1OWRM 3TT3L 1R5IA 4Z76B 4M6OL 4UT7H 1VERA 4LRIA 3EYUL 2I26N 4HS8H 4MQSB 3BPLC 4H88H 3K8MA 1P2CA 4JFOA 5EU3A 3V6ZB 4PJ9B 4Z0XB 5FKAB 4U33A 1UH3A 3VMNA 1KEGL 1W0VB 5JDSB 2I60L 1BECA 4NO0A 1ZLWK 3ZKND 3RUGB 1K3IA 3GBMH 3ZDXE 2HT4C 1K2DA 4QHKJ 3ZTNH 1R3KA 4D9RE 2Z9TA 1MF2L 4KPHL 3U83A 3PWNB 1WAAE 3AROA 4OGAD 4WEBH 2VABA 4XZUB 2ZPKL 4WHTA 3PQYE 1FLRL 3ES6A 3KYKL 4KKCC 4R26L 4KRPD 4Y2DC 5C0CE 3BWAA 1BD2B 3P9LB 4I0PD 5FUOH 3LKNA 3ZE1F 2XKUA 4XMLL 1A6VH 1FBIH 3D18B 4ZPVB 4NHCL 1RFDH 4B7LA 4YHLH 1QSFB 3QG7L 5L0QB 1NMCB 5E08L 3OR6B 4KK5D 3PL6C 4WFFE 3T2QA 3B9DA 1PYWA 1AD0A 3QDMB 1JRHH 2ARJQ 4K3JL 5IW6B 4OCRH 3TBYB 4GQ9L 4GAJH 1HXYA 1G0YR 3MBXH 3IKKA 4QHUA 5C70A 1KF9B 2XKNB 4Y4HA 3HR5A 2PYEB 3S36X 3NABH 4I5BA 4ZTOL 2AJSL 1PG7L 3MLTA 4C56E 3C5SB 4ODWA 4KGLA 1XF2A 3IS0X 4PJHE 4YNYA 4K3EL 3O4OB 3F65A 5MEOB 1F6FB 1QLFB 1ZV5A 4HD9A 3BO8B 3PIQA 1VACB 5CEZE 2VXVH 4NQVA 4WDIB 1OSPH 4RGOH 2UYLA 4QY8A 3K1KC 4YR6B 5BV7C 1GC1C 4U6HA 5SWSB 4ZDHB 4PJCB 3QO0A 3DMMD 1SY6H 5KJRH 1CE1L 4G9DB 1IM9B 3DX9B 4NKDB 4KI5C 2NNAA 3SCMA 1FJ1B 4XP5H 3QPQD 1UVQB 4XX1G 2X4NB 4OGYL 4PJAE 2YUVA 3THMH 5IB1A 5D5MF 4UTBH 5CZXD 1A7OL 4CVZB 1ZT7A 4ELKB 3EW3B 3NZHH 3OAZK 3CXDH 2V5SA 3K3QA 3QO1B 4WUUD 3EYQD 4XNMB 2XOTA 2NTFB 5FM4A 2A83A 3KPRA 5J0BA 4NSKA 1FAKT 1CQYA 3WIHA 2J4WH 3F58L 1B6UA 4MD0A 5F3BA 4G9DA 1L0YA 5DQDH 1GAFL 4AG4H 2QSCH 4YC2B 5AZ2H 3W0WB 1IQDA 1QR1B 1FPTL 4NPYA 5HGDA 1I3VA 1EHNA 3EYVA 2AJYL 5I16B 5TDNA 4M3JA 4LNVA 1T0PB 1AGFB 1WFTA 3L1OL 4OZ4A 3ULSA 3W11C 2Z4QA 3VRJB 1JHTA 3VXNA 1NGPL 1R5WB 1UM6L 3WLBA 1NMCC 1HOCB 5DYOA 5F3HA 1IGTB 1AD9A 2D4DA 4IRSB 3PL6B 4ODVL 2GY5A 4QRUB 3O4LB 3VXQA 1WBZA 4YZFE 2XZCL 2C4FT 2OXHA 3H9SD 2X4TA 4X6BA 1UWGH 2C3GA 4ZO9A 4M6ML 3I84A 5D1XC 2GIYA 4LEOA 4H26B 3WLWC 1Z0NA 1NBVL 1SJEB 3QUMA 3Q1SL 4ZTPL 3E6FA 5D7SH 5KSBF 5T3ZL 1LO2L 2CXGA 3WS3B 2PYEE 5CSGA 4OZIE 2DI8A 1QR4A 1ZVHA 3OKDB 4NO5B 1DN0A 4CDGC 2A1WH 3FO1A 1CD9B 2J7LA 2IANB 2AV1B 2J4WL 5JNYB 1OY3B 1OAZH 3Q2CA 3TBSA 2NYYD 3KPNB 3GHEH 3LN4B 2HKFH 2FX8H 1WEJL 3CDGB 2RR3A 1CICB 3M17B 1N4XH 4MQXD 4H20H 32C2A 3DMMC 3U6RB 4LCWB 4PJCE 2XI9A 4ONGH 1IKNA 5D1QB 3GI8H 1MJ8H 3VG9B 2F8VA 43CAA 1A7OH 4LK4A 1INEH 1OTTD 5A40E 3THML 4EI6A 4PJGB 4OGYH 5EC1A 1HZHH 5C0DA 4PJ9A 5EPMA 1BQSA 4JRXE 3QIWC 4Q9QL 2EIEA 3OB0H 5ICXA 3ROOA 5A2JH 5IBTL 1D5XA 5DI8B 1LO0L 3TYFB 3ZT7A 4R4BB 5FYJU 2GQHA 3QNXA 1UM5H 4FZ8L 1AFVH 1OAQH 1I7RA 2DWEA 3S3PA 3H42H 3RWJA 4KMLB 4NCDA 5C08D 5EOCH 4PRBA 2D0GA 1DBBH 4WI5A 3Q6FA 1QHOA 4F58L 2F74A 4F7TB 5IGXL 5J6HA 2D7QA 1JYXA 3SGJA 2LU3A 2YD2A 1A14H 1MLCA 2BSTA 4RGNE 4XBGB 4PJHB 1ZVSB 3VMOA 4JFHD 4LIQH 5GZNC 2FRGP 4L9LC 5FHAH 5IROC 3FO0H 2PUQT 1MHEA 3FB7B 4HLJA 4JZOB 2P8LA 3QI9C 5D7KD 1PZ5B 1W72B 3TZVA 4JANB 3EHBD 3UYRH 2BOBA 3QNXB 3W9DB 2DICA 1UB5A 4UT6H 4Z7WF 3FQTB 3S5LB 4PJ7F 4K9EL 4OZIF 1EXUA 3HUJE 3X11A 4R26H 2X9YA 3ZLQC 2BSTB 2Q3AA 3WHE1 3BEVB 2AI0L 5EOQL 4D9LH 5HYJD 4OV5B 3TO4D 2BCKB 5L7XH 4CU8A 1QQDB 3PV6B 1M7IA 2GSGB 1X5XA 5H2BB 4PJFF 1INQB 1J1OL 4R2GD 3D3VD 2R1WA 4NO0B 4G9FA 5C0EB 1ERNA 5E6IA 1ZGLA 4X6DF 2I60H 1KCUH 4K7PH 3ARGA 1ZEAL 5ICYA 3D48R 3RGVD 3O6FC 2Y7QB 1J11A 1GGBH 1EO8H 1T66D 2YD8A 4QGTA 5J11C 2X4OB 2OM5A 2OJZH 1S7TA 2P42B 4M6OH 4UT7L 1IEAA 2ICWI 3TCLA 1FCCA 3G08B 3QIWB 4OF6A 2VLKA 2PXYD 1WC7B 4O5LL 2NY3C 4DZ8A 1MY5A 4I0PA 1KCVL 4MDIB 4JVUA 1JGVL 3IDGA 3WUWB 1MCOL 1A9EA 2DTSA 1VPOH 5T1DL 3PHQA 5IVOA 2VDKL 4HGKC 2AW2A 1FNLA 3DHMA 5IESL 5DJYB 2J8HA 4JKLA 2IALB 1QD0A 3SDDB 2OL3H 4YHML 4UQ3B 2GK0A 4MX7A 4X6CE 4XPBH 4X7SH 1D9KC 5IJVA 3KWWB 3LKSA 1IQWH 5GQBA 1S9XA 5IB5B 1MJUL 4OZGB 5FECB 3ZDZF