4PM9A

Crystal structure of ctx-m-14 s70g:s237a:r276a beta-lactamase in complex with cefotaxime at 1.45 angstroms resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
262
structure length
262
Chain Sequence
b'TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGAGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRADVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-14
publication title Molecular Basis for the Catalytic Specificity of the CTX-M Extended-Spectrum beta-Lactamases.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Hydrolase/antibiotic
total genus 96
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4pm9A00
1FR1A 1KGGA 4Q8IA 1XA1A 1O07A 3HUOA 3WS2A 4EV4A 1GA9A 3CG5A 3HUMA 4BQMA 2XQZA 4B4XA 2Y91A 3GSGA 4NK3A 3N8LA 3UDIA 1YLWA 3IXGA 3ZG5A 1IEMA 3P09A 4S2IA 3UNWA 1PI5A 4WBGA 5DTTA 4OP8A 1BULA 3C4PA 2WADA 5GHYA 1GA0A 1KGEA 1Q2QA 4IVIA 1GCEA 5GLCA 1MWRA 4DRTA 2J7VA 5G18A 4DE1A 2G2WA 3DWZA 3MKFA 1MWSA 1SDEA 1ERMA 4GDBA 2HP9A 1MXOA 2C5WB 5AQAA 5M18A 2V2FF 3G30A 4M3KA 5EOOA 4EWFA 1W8YA 4OQIA 3IXDA 5GL9A 1YLJA 3MXRA 2WYXA 3IH8A 1ZG6A 1H8YA 4JXWA 2WGVA 5EVIA 5EVIB 1NYMA 3ZNTA 5EE8A 3WWXA 3D4FA 1M40A 3BFGA 4CPKA 2RL3A 4PM5A 3NCKA 5GHZA 1GHMA 5I94A 4OKPA 1XGIA 4JF4A 1I5QA 3MZDA 5FASA 3WS1A 3FWLA 5JYOA 2EX2A 2V20A 1YLTA 2EFXA 1IYSA 2WUQA 5CXWA 1TVFA 3LCEA 1JVJA 1VQQA 4FH4A 4KQOA 1S0WA 5DTSA 4C75A 5FQMA 4NETA 2Q9MA 5GHXA 2WKIA 4R3BA 4CJNA 1KVLA 2OLVA 2VGJA 4BJPA 4S2MA 3W4PA 1G6AA 2Y2MA 4OOMA 4BENA 3HL9A 2ZC6B 2WZXA 1K55C 2EX6A 5FI2A 4K0WA 1KE4A 4LCLA 5GLBA 4N9LA 4ZJ3A 3S22A 4IBRA 5CGSA 5TFQA 3G2YA 3HLCA 1YLZA 3OCNA 1BTLA 3AGEA 4JXGA 4S2LA 5FATA 3LEZA 1K55A 1MPLA 4N1HA 2HDRA 2UWXA 4EUZA 4OONA 4B88A 3G32A 4JF5A 1L0FA 1EROA 2J9PA 1NZUA 5KZHA 1CK3A 4E6WA 5HAPA 3A3FA 1YM1A 3S1YA 2OSUA 1MBLA 1RP5A 4PM6A 4GN2A 4GKUA 1ES2A 5EVLA 4QB8A 2XLNA 3M6BA 4DE2A 4QJGA 1HZOA 1RGYA 1XPBA 1IYPA 1SKFA 3ITBA 3OCLA 4L0LA 3ZVTA 1VM1A 4BD0A 4WELA 1QMFA 3BLMA 5DTKA 3HREA 4WMCD 3VMAA 4KZ3A 1JTDA 1FCMA 1H5XA 3PTEA 5KSHA 1QMEA 5A90A 2Y2GA 3AGDA 4QY5A 3G34A 3NDGA 4R0QA 4U0XA 3VSLA 4DDSA 4OLDA 4WZ4A 2J8YA 3E2KA 3UPPA 1HVBA 5E2HA 1LHYA 1CI9A 4R3JA 2XR0A 1ALQA 3V5MA 1OMEA 5U47A 4E3KA 1KGFA 4ZTKA 5A93A 5FI6A 1L2SA 4XUXA 5DF9A 3TOIA 2EX8A 2HDUA 3S4XA 2Y59A 1FR6A 4F94A 4UA7A 3A3IA 3HVFA 5HAQA 3IF6C 1JWVA 1PI4A 1MY8A 4DF6A 4U0TA 4IBXA 3VOZA 1BLCA 5HW3A 2JC7A 3QNBA 4KENB 4E6XA 3N6IA 4A5RA 1E3UD 2ZC4B 2HP6A 3O3VA 4KG5A 1W8QA 5FQQA 3IF6A 3PAEA 4DE0A 3QHYA 3NI9A 3RXWA 3UDFA 2H0YA 3V50A 5CHJA 4GOGA 1JWZA 4LCMA 3VP3A 1Y54A 4FCFA 4S2PA 3UPOA 3A3EA 3M2JA 2ZMAA 3HLGA 2WGWA 2WGWB 4ZBEA 2OV5A 2H10A 3O86A 3M2KA 5FAOA 1FCNA 1L0DA 3HLWA 2C6WB 4RX3A 5CTMA 4EBLA 3W8KA 2Y2JA 4K91A 4U3TA 3Q7VB 1I2SA 3RJUA 3FKVA 5CGWA 4E3OA 2Y2LA 4Y0TA 3Q1FA 3EQVA 1BT5A 1ES3A 5EUAA 1J9MA 1ZKJA 1N4OA 1WYBA 4KZ6A 3BRMA 2J9OA 3WS0A 1G68A 3HLDA 2H0TA 2I72A 4KZ7A 4R1GA 3V3SA 1N9BA 5HFOA 2P9VB 3LY3A 5EVIC 1IKGA 1XXMA 4KZ5A 2EFUA 1XKZA 1ZG4A 2Y2PA 2XEPA 3BECA 4N1XA 4OP5A 5TR7A 3ZG7B 3UE1A 5DVAA 4P85A 1ONHA 1DJBA 1K6RA 3EQUA 2DNSA 4IVKA 1TEMA 5FQKA 4YFMA 4EQIA 4E3LA 5KMWA 3O87A 2PU4A 4FH2A 3V39A 4GD8A 4JXSA 5CHMA 1K56A 3ZG8B 5J8XA 3LY4A 4HESA 4QY6A 5F83A 4S2OA 1IYOA 1IKIA 5A92A 3GVBA 3SH7A 2R9WA 4HBTA 1FCOA 4Y0UA 3OPLA 2Q9NA 2RCXA 4BD1A 5M19A 3G31A 1MWTA 2CC1A 4MBKA 4BLMA 3GTCA 3ZFZA 5F1FA 2BG1A 3BYDA 5HAIA 5E2GA 4EBNA 1EI5A 4OQ0A 1NY0A 3FYZA 4BL3A 1WYCA 3C5AA 5M1AA 1XGJA 4OPZA 3IH9A 1M6KA 3IXHA 3C7UA 2GDNA 4OQGA 4OPYA 3WS4A 3LO7A 2P74A 2HDQA 4JPMA 4ZDXA 1K38A 3IT9A 1NRFA 3O88A 2XD5A 1E4DA 2WZZA 1K54C 4RYEA 1BSGA 3ZDJA 4OLGA 3IWIA 4KG6A 3IHAA 1IELA 1PYYA 1K54A 4X55A 1Z6FA 3BFCA 3UDXA 2Y2IA 4LV2A 3TG9A 4KZAA 4RA7A 3M6HA 4HEFA 2EXBA 3HLFA 2Y55A 4DXCA 4P87A 4GDNA 3SH9A 2XGNA 2X02A 2ZC5B 4OOLA 4R23A 5EPHA 1YLYA 2BLSA 3WRZA 2ZC3B 5JYPA 3MZFA 3BEBA 1BUEA 2XD1A 3MZEA 2ZM2A 3JYIA 4X69A 3UPNA 1LL9A 2Y2KA 2JBFA 1K57C 4H8RA 4KZ9A 4WEKA 3UN7A 4DE3A 3CZDA 1FSWA 4GZBA 2XH9A 4EBPA 1H8ZA 2ZLYA 3CJMA 1YMSA 5HX9A 5CGXA 3SS4A 1K57A 1FSYA 1YQSA 2ZQDA 1W79A 4E3MA 5HL1A 2ZD8A 1SCWA 2H5SA 3IHBA 4UHUA 4KQQA 3WRTA 3IWOA 1PW8A 4OOYA 3WS5A 2HPBA 5FQJA 5E43A 3ZVWA 3Q07A 3NY4A 4X56A 3MKEA 2PU2A 4E3NA 2QZ6A 1EWZA 3NC8A 2FFFB 3ZNYA 3NBLA 2XDMA 2DCFA 4P6BA 5GLDA 5BOHA 3DTMA 1E3UA 4JLFA 1NYYA 1KDWA 2EX9A 5F82A 3OC2A 1L0EA 3BFEA 4WEJA 4N9KA 1LI0A 2JE5A 3Q7VA 3G4PA 4XXRA 5CTNA 1K4EA 5CERA 3IWQA 4PM7A 3SH8A 2FFYA 4JF6A 4PPRA 1MWUA 1K25A 1XP4A 3NDEA 2A3UA 1LLBA 1JTGA 4GD6A 3SS3A 3VFHA 4MLLA 3QNCA 4X68A 3MBZA 4KZ4A 4ZJ1A 4WM9A 4RX2A 4YINA 4K0XA 5IHVA 4Z9QA 3PBSA 1XX2A 1U60A 5FDHA 2P9VA 5AQ9A 4LENA 3ZCZA 3Q7ZA 2EXAA 3SS5A 4DDYA 3GMWA 4JKTA 1ESUA 4S2NC 3HBRA 4ZAMA 1PWCA 4IEDA 1O7EA 2WAFA 2ZQ7A 2V1ZA 4PM9A 3VSKA 3VFFA 5A91A 1FQGA 2ZQ9A 4S2JA 5FSRA 2Z2MB 3P98A 5EOEA 4KG2A 5FA7A 4S2NA 5E2EA 1PZOA 3W4OA 3C4OA 1IYQA 4O7DA 4DXBA 1W5DA 3ZG0A 4GNUA 2HDSA 4KQRA 2Y2HA 5EVID 4WZ5C 4JXVA 3FZCA 4DKIA 4X6TA 2R9XA 3ZHHA 1XA7A 3OPPA 1WE4A 2PBYA 1PIOA 4MBFA 3MXSA 4N92A 2ZJ9A 1GHPA 2ZQCA 3PAGA 2X71A 4LV1A 4ID4A 4WZ5A 1FOFA 1LI9A 1PW1A 3GQZA 2Y2OA 4PM8A 1K56D 1C3BA 3AGFA 3PBRA 1PZPA 1L0GA 4C3QA 3PBNA 5AQBA 3BFDA 1K4FA 1KVMA 1LL5A 2QPNA 3IQAA 3NIAA 2XFTA 5CEDA 1ERQA 1NXYA 5D3OA 3ZGAB 1KDSA 5FQ9A 4ZJ2A 1TDLA 3ITAA 3SOIA 2WKHA 1BLSA 2DRWA 4UA9A 3OZHA 3PBOA 2B5RA 4XUZA 4Y7PA 4WYYA 2OLUA 1W7FA 5FQIA 3A3JA 4E3JA 3UY6A 3PBTA 2ZM0A 2WK0A 2A49A 2E8IA 3V3RA 3FKWA 2XK1A 3DW0A 1TDGA 3HLEA 1CEGA 2Z2LB 3UO9A 4UAAA 3VOYA 1RGZA 5FAPA 2HP5A 2Y4AA 3IXBA 5FAQA 3I7JA 2XFSA 4LV0A 1SDNA 4P0MA 4BL2A 5FI7A 4UA6A 3IF5A 3BM6A 5GLAA 2Y2NA 5DF7A 4R4SA 1HD8A 3W4QA 4B4ZA 1DJCA 4C6YA 1ESIA 3Q82A 2ZM8A 1BZAA 2ZQAA 1DY6A 3HLBA 4X53A 2QMIA 4MEZA 3VP1A 1NZOA 2Y2QA 3VP0A 1ES5A 1E25A 4S2KA 4R4RA 1YT4A 4HBUA 1HTZA 5E2FA 4WMCA 3Q81A 3UE0A 5CHUA 3HUNA 1KE3A 1PWDA 3CMZA 2WKEA 4QU3A 1PWGA 5EECA 3N4IA 5HARA 2WGIA 3C7VA 3DWKA 2IWCA 5KSCA 1YMXA 1CEFA 2IWBA 4Y0OA 4QHCA 3OPRA 4OPRA 5CEBA 3VP2A 3GV9A 1S6RA 4KZ8A 4OH0A 4OQHA 2ZQ8A 1I2WA 3G35A 3VP4A 1AXBA 3B3XA 1ZC2A 5DF8A 3N8RA 3TSGA 1ONGA 1SHVA 2VGKA 2X01A 5CRFA 2XF3A 3FV7A 3MFDA 4FSFA 2ZC7A 3PBQA 4GB7A 4OPQA 5L2FA 4PMAA 1ES4A 3GRJA 4FD8A 1BLHA 1DJAA 1MKIA 1Q2PA 3ZG9B 3ISGA 5CECA 4JBFA 4LV3A 4E3IA 3N7WA 3RXXA 4D2OA 4RVAA 2WAEA 1CI8A 3G2ZA 3BLSA 5AQ7A 4MNRA 1JWPA 3BFFA 3GR2A 1BLPA 2G2UA 3N8SA 3A3DA 4KZBA 3OPHA 4MBHA 4OVDA 4QD4A 5TGFA 2JCHA 3UE3A 2IWDA 1KE0A 3E2LA 3IF6B 1GHIA 1YLPA 5F1GA 1RCJA 1NJ4A 1K6SA
chains in the Genus database with same CATH superfamily
1KGGA 4EV4A 3CG5A 1PRQA 2O0YA 4B4XA 4GW9A 3LI9A 3ZG5A 3H7WB 3QP6A 1V9YA 3R7WB 2NUTC 2GZAA 2J7VA 3TW8A 3MQOA 1MWSA 1UGUA 1ERMA 4O01A 1UWNX 2OOLA 2PYRA 4F3LB 5M18A 4EWFA 1W8YA 4OQIA 2WYXA 3JVUA 2WGVA 5EVIB 5EE8A 1M40A 3BFGA 3LR0A 3NCKA 5CX7A 2VEAA 3FPVA 4JF4A 3MZDA 3IS2A 2ZOIA 3FWLA 2EX2A 2V20A 2EFXA 4ARZB 1S0WA 4NETA 3E98A 5GHXA 4R3BA 4B9OA 4BJPA 1G6AA 1G28A 5F68A 4D60A 4K0WA 4N9LA 3HLCA 1LT0A 5LBRA 1BTLA 3AGEA 4JXGA 4S2LA 5FATA 3BY9A 2HDRA 4EUZA 2W1TB 4B88A 2J9PA 1NZUA 3A3FA 2OSUA 1MBLA 1RP5A 4GN2A 1CF0A 2XLNA 4DE2A 1HZOA 1XPBA 4L0LA 3OCLA 1VM1A 5DTKA 1D7EA 1NLZA 4WMCD 1JTDA 2INWA 1XJ3A 1GSVA 5KSHA 2W0NA 3AGDA 4U0XA 3VSLA 4WZ4A 2J8YA 3E2KA 5HPIA 4MN5A 4R3JA 2XR0A 3V5MA 1TS6A 2XA7S 3S4XA 4F94A 4UA7A 3A3IA 3HVFA 4DF6A 1MY8A 4IBXA 4E6XA 3IX3A 3N6IA 3LUQA 4P6ZM 5EFWA 3QHYA 3NI9A 3RXWA 3PHYA 2W3GA 2ZMAA 2WGWB 3H82B 3M2KA 5FAOA 4U3TA 5CGWA 2Y2LA 4BBUA 1BYWA 1ES3A 5EUAA 2OWHA 1G68A 2Z6CA 4KZ7A 2JKRM 3LR4A 3V3SA 1N9BA 2IA2A 1XKZA 3BECA 4OP5A 5TR7A 3ZG7B 3GECA 1K6RA 3T1RA 5FQKA 3CWFA 5A8BA 4YFMA 3O87A 4FH2A 4JXSA 3HCYA 3LY4A 4HESA 5F83A 4DN0A 3GVBA 5DJUA 3MMHA 1YKDA 5M19A 1MWTA 4EETB 4R3AA 3UB9A 4R6LA 3ZFZA 2BG1A 5E2GA 3OBFA 1G6OA 4OPZA 3IH9A 1VEUA 4OPYA 3WS4A 3HJIA 3LO7A 4JPMA 2HDQA 4ZDXA 3TRCA 4WN5A 3O88A 4EQ1A 2WZZA 1K54C 4QWOA 4Q0JA 3C30A 2JHEA 3F1NB 1K54A 4X55A 1Z6FA 2Y2IA 4M4XA 5HSQA 2Y55A 1DRMA 2ZC5B 2A24A 2P7JA 3ZYTA 2ZC3B 3ZQ5A 1SKOA 3MZFA 1BUEA 2ZM2A 1HLUP 4X69A 1LL9A 4EBPA 1N9OA 1FSYA 4HY8A 4WF0A 5HL1A 4UHUA 4KQQA 3IWOA 5IT5A 2L4RA 1OTDA 3D9YA 3MKEA 2EA9A 2PU2A 2QZ6A 1EWZA 3NC8A 2XDMA 3T4JA 3NECA 5GLDA 3KX0X 2MJ6A 1L0EA 3BFEA 4WEJA 2JE5A 5CTNA 1OT9A 4PM7A 4QPRA 4PPRA 3VFHA 3VV4A 4JGOA 4YINA 5IHVA 3T4QA 3P7NA 2EXAA 3U4LP 4LPZA 1PWCA 2PR5A 4IEDA 3VSKA 3VFFA 1FQGA 5FEFA 5FSRA 4CQHA 3G6OA 5FA7A 5E2EA 3W4OA 2O9AA 2VK3A 3C4OA 4DXBA 5FDSA 3ZG0A 5EVID 1WA9A 4UEYA 2ZQCA 4LV1A 2X71A 1AWIA 4ID4A 4PM8A 1N9NA 1IFQA 1TS7A 1XFQA 4HJ4A 5CEDA 5FQ9A 4HNBA 3SOIA 3ITAA 2DRWA 4UA9A 4WYYA 3FC7A 2ZM0A 3T1QB 2LB5A 3BW6A 1TDGA 1CEGA 2W3HA 3UO9A 5FAPA 4AFIA 1KOUA 2Y4AA 4B93A 3H9WA 2O99A 4JGQA 5FAQA 2XFSA 4LV0A 1SDNA 5TBMB 3IF5A 2KDKA 3LFVA 2Y2NA 3KYZA 4G3WA 3MSHA 1DJCA 4C6YA 1ESIA 3UMEA 3Q82A 2ZQAA 4ZRRA 3A0RA 4S2KA 4HBUA 3Q81A 3HUNA 1F2KA 4ETZA 2ZMFA 1KE3A 3CMZA 4ETXA 3UB8A 3N4IA 3DWKA 2IWCA 1YMXA 4QHCA 5CEBA 1D06A 4OQHA 4EESA 3G35A 2M7UA 4JGPA 2VGKA 2VJWA 1FIKA 3RH8B 1G5UA 4OPQA 5L2FA 4Q0IA 3GRJA 3ISGA 2WAEA 1CI8A 2HF6A 2FZ0A 3GR2A 3N8SA 2G2UA 4QD4A 3MFXA 4E3JA 2P04A 2IWDA 5HDDA 3E2LA 4IUKA 1RCJA 3LYXA 4UQIM 1XA1A 3HUOA 1GA9A 2UV0E 4BQMA 2XQZA 4PHTA 2Y91A 3N8LA 3UDIA 1S66L 4Q0HA 3UNWA 1PI5A 3R7WA 3C4PA 1GA0A 4GS9B 4LFUA 1KGEA 5GLCA 1LSVA 1SDEA 1MXOA 4YNRA 4UQIS 4F3LA 3G30A 5EOOA 5GL9A 3MXRA 5EVIA 2V8FA 3NOPC 1TS0A 4L9GA 4CPKA 4PM5A 3CPTA 4FOFA 5I94A 2Y8HA 2CMNA 5FASA 5F69A 1NRJA 2V9AA 4DJ2A 5JYOA 1D1JA 3LCEA 5DTSA 4FH4A 5HWWA 5J7EA 4C75A 1KVLA 2OLVA 2Y2MA 3A0VA 4NG2A 3CITA 3HL9A 2ZC6B 2WZXA 5FI2A 1KE4A 4LCLA 3S22A 3OCNA 1MPLA 3DTEA 5AVEA 2HZ5A 2W1TA 1L0FA 1EROA 5KZHA 4NXGA 3SW1A 5EVLA 4QB8A 4QJGA 4LRYC 3VMAA 3HREA 3IX4A 3NDGA 4O8GA 5G4ZA 2VX8A 5HD3A 3UPPA 1DP9A 1L3LA 3F1PB 1ALQA 5A93A 1VB6A 5DF9A 3TOIA 2HDUA 2Y59A 3BY8A 5HAQA 3IF6C 4H6JB 4U0TA 1BLCA 4KENB 3S7OA 3SZTA 1OPXA 4KG5A 3IF6A 3PXPA 2H0YA 5CHJA 1JWZA 4S2PA 1GSWA 3BQAA 3M2JA 4MN6A 3HLGA 2WGWA 4LRZE 2H10A 3O86A 2OV5A 1JNUA 3HLWA 4RX3A 3W8KA 2Y2JA 3Q7VB 4EXOA 2XSSA 3RJUA 2ZMVA 3Q1FA 3EQVA 2YKHA 1XFNA 4LLOB 3WS0A 1F9IA 2I72A 4I39A 2P9VB 3U2AA 2YKFA 2ZL1A 4KZ5A 1OTEA 4N1XA 3UE1A 4P85A 1ONHA 5L10A 4Y2FA 4EEUA 3OOVA 4IVKA 5KMWA 2PU4A 2M7VA 2M1CA 5J8XA 4QY6A 2LB9A 5A92A 2VV7A 2Q9NA 4BD1A 1NWZA 4BLMA 2V1AA 3GTCA 5FL3A 4HH2A 4BMWA 3BYDA 5F1FA 1EI5A 3FYZA 4BL3A 4CLCB 5J3WA 1WYCA 5M1AA 2J3WA 2JKTI 3O5YA 3MR0A 2PD7A 3IT9A 1NRFA 2XD5A 3K3DA 4OLGA 5K5BA 3IWIA 1X0OA 1CQAA 4X1MA 4LV2A 2XA7M 1MC0A 3CLOA 2BLSA 3QP2A 3KSHA 4Z1WA 4Y17A 4BWIA 3UPNA 3CUEA 2K7SA 4H8RA 3CZDA 4GZBA 2WKPA 4DJ3A 4ME4A 3CJMA 1YMSA 1H3QA 1H8MA 5TJJA 4HOIA 2H5SA 3WRTA 1PW8A 3WS5A 5FQJA 5E43A 5DFXA 4XT2A 3Q07A 4X56A 2FFFB 3NBLA 2XRNA 2GX5A 4JLFA 2EX9A 5F82A 3OC2A 4N9KA 4HQAA 2I9VA 2EWWA 2FFYA 1TS8A 4JF6A 1K25A 3NDEA 1LLBA 4X68A 4ZJ1A 1OTAA 4WM9A 3CAXA 3PBSA 2QJ7A 5AQ9A 3JVVA 3Q7ZA 2J80A 4JKTA 1LL8A 4PM9A 5A91A 2Z2MB 4ESPA 4HIAA 1PZOA 4YWZA 1IYQA 1W5DA 4GNUA 4NXEA 4WZ5C 3FZCA 4LRXC 2VLGA 1XA7A 3OPPA 1PIOA 3C38A 3MXSA 3NJAA 4WZ5A 1H0MA 1K56D 3PBRA 1PZPA 3CHWP 5AQBA 1K4FA 4I3JA 2XFTA 1NXYA 3ZGAB 1YAXA 3PBOA 2B5RA 4Y7PA 1W7FA 3UY6A 3PBTA 4R70A 4I38A 3T1SA 2A49A 2E8IA 3V3RA 2L1MA 2XK1A 3DW0A 3HLEA 2R78A 3MJQA 3QP1A 1TF1A 4UA6A 1LSXA 4BBVA 5GLAA 1STZA 2OAQ1 2PRFA 3W4QA 2NUPC 2ZM8A 1BZAA 1GSXA 2Y2QA 1HTZA 4FTXA 4WMCA 5EECA 5MC7A 3KO6A 3T50A 3C7VA 5KSCA 4OPRA 3VP2A 3GV9A 2ZQ8A 1I2WA 3B3XA 1SHVA 2X01A 5FEGA 3KYQA 2ZC7A 3PBQA 1PFLA 4JBFA 4E3IA 3P01A 4D2OA 4RVAA 3G2ZA 3RFBA 3BLSA 3T4TA 5AQ7A 4DDYA 3A3DA 3OPHA 4OVDA 1KE0A 4NEED 2D02A 1NJ4A 1FR1A 4GHIB 1P97A 2OWJA 1S1YA 3GSGA 3P09A 4S2IA 4MMNA 3LIAA 4WBGA 5DTTA 4OP8A 2WADA 4GS9A 5J4EA 1P0ZA 4IVIA 3MQ0A 1GCEA 4DRTA 4DE1A 1TD5A 2G2WA 3MKFA 3FG8A 2C5WB 4G3VA 1T1AA 3IXDA 4JXWA 5KIZA 1NYMA 3ZNTA 3WWXA 1VETB 2RL3A 3CI6A 1SZVA 1OJGA 4OKPA 3MQQA 3EEHA 3E4OA 5C5KA 3WS1A 4CLCD 1IYSA 1TVFA 2W3FA 1JVJA 4JGRA 2Q9MA 4CJNA 2Q0OA 4OOMA 1K55C 2EX6A 2G7UA 4GJ4A 5GLBA 4I3AA 4IBRA 5CGSA 3G2YA 1YLZA 3F1OA 1K55A 4HP4A 3EGDC 3UB6A 3VE4A 1YM1A 3S1YA 2W3EA 4PM6A 4GKUA 1ES2A 4NXBA 4HJ3A 1IYPA 1SKFA 3ITBA 1LSWA 4WELA 2A24B 1H5XA 1SKOB 3LR5A 1QMEA 2J3TD 4GCZA 4BBTA 1J3WA 4QY5A 1MZUA 4DDSA 4MDZA 4OLDA 1HVBA 5E2HA 1OMEA 1KGFA 4ZTKA 5FI6A 4XUXA 2EX8A 1FR6A 1JWVA 1PI4A 4H6JA 2JC7A 3QNBA 5DJTA 2ZC4B 5EM0A 1W8QA 5G4YA 1T1BA 3B42A 2XROA 4FCFA 2WKRA 3A3EA 2ZBBA 3E4PA 3K2NA 4EBLA 4K91A 3H7WA 3UE6A 3FKVA 4E3OA 4Y0TA 1S67L 1PNEA 3TJZC 1BT5A 1ZKJA 3DBAA 1N4OA 1WYBA 3BRMA 5HD5A 2K31A 3HLDA 1XJ4A 3ICYA 4R1GA 3LY3A 5EVIC 1MKMA 3KSGA 1IKGA 1XXMA 1ZG4A 2XEPA 3PR6A 5DVAA 3EQUA 1TEMA 3LGOA 1EW0A 4GD8A 5IU1A 3S7PA 3ZG8B 1FCOA 4Y0UA 2RCXA 4ARZA 4MBKA 2CC1A 4FUWA 4EBNA 3C5AA 2JKRI 1XGJA 2GDNA 3FPWA 4OQGA 2ZOHA 2P74A 1K38A 4PKYG 5L8MA 1S4RA 4RYEA 1BSGA 3ZDJA 3S7NA 3IHAA 3EEAA 1IELA 1VHMA 1PYYA 3BFCA 2VA0A 3TG9A 3M6HA 4HEFA 2EXBA 4DXCA 4GDNA 3SH9A 2XGNA 4OOLA 4Y3IA 5JYPA 3BEBA 2XD1A 3JYIA 2JBFA 1P9RA 4WEKA 3MS6A 3UN7A 4DE3A 1FSWA 1ODVA 1H8ZA 2GJ3A 2PR6A 2HJ9C 5CGXA 3SS4A 1T19A 1YQSA 3LIFA 3IHBA 3LIDA 1V9ZA 4IJGA 4OOYA 2HPBA 1IOUA 2E8JA 4EEPA 2K2NA 4E3NA 2DCFA 4P6BA 3DTMA 1NYYA 3H82A 2VGLS 4IUHA 4XXRA 3G4PA 1K4EA 5CERA 4EERA 1MWUA 1XP4A 2A3UA 1JTGA 4GD6A 4HJ6A 2VKSA 2FH5A 4G3KA 3MBZA 4K0XA 5I5LA 3ZCZA 3T4LA 3SS5A 1ESUA 4S2NC 4ZAMA 2WAFA 2ZQ7A 2ZQ9A 4S2JA 3P98A 4S2NA 3L7HA 1W63M 4O7DA 4KQRA 2Y2HA 4JXVA 4DKIA 2R9XA 3ZHHA 1WE4A 3MF0A 2ZJ9A 1GHPA 3PAGA 1LI9A 1PW1A 3GQZA 3W2ZA 2Y2OA 2PBDP 4C3QA 1C3BA 2W1RA 3PBNA 1F5MA 1LL5A 1KVMA 2DMWA 1ERQA 2D01A 3CPTB 5HWTA 3BJNA 1TDLA 2WKHA 1K0KA 2OLUA 3QP8A 5FQIA 1S4SA 2WK0A 3FKWA 3F1NA 4UAAA 3VOYA 1RGZA 2HP5A 4X1LA 3IXBA 4X25A 4BL2A 3BM6A 4LGWA 3CUEC 4R4SA 1HD8A 4B4ZA 5F5YA 5F6AA 1DY6A 3HLBA 4X53A 2QMIA 3VP1A 1NZOA 3VP0A 3BQ8A 5DKKA 4WLAA 3UE0A 5CHUA 1OTBA 3KSIA 4QU3A 4HP9A 5HL6A 1PWGA 2B02A 1Y4OA 2WGIA 1CJFA 3D72A 4Y0OA 1XJ2A 3VP4A 2BTFP 3N8RA 3R4KA 3TSGA 5CRFA 1Y28A 2XF3A 4FSFA 4KQDA 4GB7A 4PMAA 4FD8A 1BLHA 1DJAA 1MKIA 4NKPA 4LV3A 3LIBA 2WKQA 3RXXA 4MNRA 2ACGA 3BFFA 3UE3A 4WUJA 5TGFA 2JCHA 3IF6B 5F1GA 4LENA 3DAVA 4Q8IA 4GHIA 2JKFA 1O07A 3WS2A 3GDIA 2H28A 3HUMA 3LI8A 4NK3A 1YLWA 3IXGA 1IEMA 1ZHHB 2HGVA 2Z6DA 2V0WA 1BULA 3A0SA 5GHYA 1Q2QA 1MWRA 5G18A 4P6ZS 3DWZA 4K08A 4GDBA 2HP9A 1YPRA 1YSPA 5AQAA 2ZL1B 2HV1A 2V2FF 4M3KA 3IX8A 1YLJA 1T18A 1ZG6A 3IH8A 1H8YA 4Y13A 1VETA 4HI4A 1NLYA 3D4FA 3NHQA 3L9KA 3EOIA 5GHZA 2KX6A 1GHMA 1XGIA 2PHYA 1I5QA 3IS2B 4EW7A 3TE8A 1YLTA 2W3DA 2WUQA 5CXWA 1VQQA 4KQOA 5FQMA 2WKIA 1W63Q 2PDRA 2VGJA 4S2MA 3W4PA 2JKGA 4BENA 3UMDA 4ZJ3A 3NULA 3E4QA 5TFQA 2V8CA 5TBMA 3LEZA 4N1HA 1Z09A 2UWXA 2O9CA 5AJGA 4OONA 3G32A 4JF5A 1CK3A 4E6WA 5HAPA 1UWPX 3DTIA 2VZWA 4I5SA 3M6BA 1RGYA 4BD0A 3ZVTA 3DTKA 3LICA 2KLIA 1QMFA 3BLMA 4KZ3A 4KUOA 1FCMA 3PTEA 4WL9A 5IS1A 1N9LA 3ULFA 5A90A 2Y2GA 2B18A 3G34A 4R0QA 4II7A 4YOFA 2V0UA 5HZHA 1LHYA 1CI9A 3OLOA 5U47A 4E3KA 1L2SA 2KOIA 2QWSA 5HW3A 3VOZA 3K3CA 1E3UD 4A5RA 2HP6A 3O3VA 5FQQA 4XT2B 3PAEA 4GLQA 4DE0A 3EGXC 3UB7A 3UDFA 3V50A 4GOGA 3VP3A 4LCMA 1Y54A 3UPOA 2B95A 4ZBEA 3VOLA 1FCNA 1L0DA 2C6WB 5CTMA 2VV6A 3T1XA 1I2SA 5HDSA 1ACFA 2PD8A 1J9MA 4KZ6A 3B47A 2J9OA 5HWVA 1YSQA 2H0TA 2JKTM 5HFOA 3QP5A 2EFUA 2Y2PA 3KSFA 1DP8A 3MXQA 1DJBA 4CLCE 3HJKA 3JPUA 4RQ9A 2DNSA 3LEQA 4EQIA 4E3LA 3V39A 5CHMA 1K56A 4S2OA 1IYOA 2PYPA 1IKIA 3SH7A 2R9WA 4HBTA 3OPLA 2VV8A 3G31A 3KYEA 5HAIA 4OQ0A 1NY0A 1M6KA 3IXHA 4O0PA 3UB5P 3C7UA 1VEUB 4MCWA 4PKYA 1E4DA 2W27A 5L07A 4KG6A 3UDXA 2PT7A 4KZAA 4RA7A 3HLFA 1A0KA 4R38A 4P87A 4Y5FA 2Y79A 2HJEA 2X02A 4R23A 5EPHA 1YLYA 3WRZA 4HH3A 3C2WA 3LIEA 3MZEA 2V1BA 2JN7A 4DMZA 2Y2KA 4KZ9A 1K57C 3NOUC 3F1PA 2XH9A 2ZLYA 5HX9A 1K57A 3S7QA 2ZQDA 4E04A 1W79A 1T1CA 4E3MA 2ZD8A 3EWKA 1SCWA 3RTYA 3ZVWA 3NY4A 3ZNYA 2QYBA 5BOHA 1E3UA 5DKLA 1KDWA 2L0WA 4I3IA 1LI0A 3Q7VA 3IWQA 4EUVA 3SH8A 4EU0A 3SS3A 2OAP1 3LR3A 4MLLA 3QNCA 4KZ4A 4RX2A 4Z9QA 1XX2A 1U60A 3IBRA 5FDHA 2P9VA 1P9WA 3GMWA 3HBRA 1O7EA 2V1ZA 2PAVP 2A2LA 5EOEA 4KG2A 2QKPA 4HHDA 2HDSA 4PAUA 4IHQA 1OJ5A 4X6TA 2PBYA 3T4SA 4MBFA 4N92A 3T4OA 1FOFA 5EVEA 4CLCC 3AGFA 1L0GA 3BFDA 2QPNA 3IQAA 3NIAA 3B33A 4CLCA 5D3OA 4L9EA 4Y15A 1KDSA 4ZJ2A 5AVFA 1F98A 1BLSA 3OZHA 4XUZA 1ZTUA 5HDCA 3A3JA 4MN7A 5HPFA 3VE3A 3T12B 3C8CA 2Z2LB 1S1ZA 4NXFA 3T4KA 3I7JA 4P0MA 3F1OB 5FI7A 3IBJA 3QP4A 5DF7A 3D3OA 1FILA 3V67A 3NOTC 4MEZA 2J3TC 1ES5A 1E25A 4R4RA 1YT4A 5E2FA 4KUKA 2VGLM 1DP6A 1PWDA 2WKEA 3BWLA 4L9FA 5DFYA 5HARA 1OTIA 2QJ5A 2IWBA 1CEFA 3OPRA 2BASA 1S6RA 4KZ8A 4OH0A 5EV0A 1AXBA 2O9BA 1ZC2A 5DF8A 1ONGA 2AVXA 3FV7A 3MFDA 3PYPA 2QHKA 3E0YA 1ES4A 1Q2PA 3ZG9B 5CECA 3N7WA 5EM1A 2P08A 4MBHA 1JWPA 1BLPA 4KZBA 1OT6A 5L09A 1XJ6A 1GHIA 2GNXA 1YLPA 2EWVA 1K6SA
chains in the Genus database with same CATH topology
1FR1A 1KGGA 4Q8IA 1XA1A 1O07A 3HUOA 3WS2A 4EV4A 1GA9A 3CG5A 3HUMA 4BQMA 2XQZA 4B4XA 2Y91A 3GSGA 4NK3A 3N8LA 3UDIA 1YLWA 3IXGA 3ZG5A 1IEMA 3P09A 4S2IA 3UNWA 1PI5A 4WBGA 5DTTA 4OP8A 1BULA 3C4PA 2WADA 5GHYA 1GA0A 1KGEA 1Q2QA 4IVIA 1GCEA 5GLCA 1MWRA 4DRTA 2J7VA 5G18A 4DE1A 2G2WA 3DWZA 3MKFA 1MWSA 1SDEA 1ERMA 4GDBA 2HP9A 1MXOA 2C5WB 5AQAA 5M18A 2V2FF 3G30A 4M3KA 5EOOA 4EWFA 1W8YA 4OQIA 3IXDA 5GL9A 1YLJA 3MXRA 2WYXA 3IH8A 1ZG6A 1H8YA 4JXWA 2WGVA 5EVIA 5EVIB 1NYMA 3ZNTA 5EE8A 3WWXA 3D4FA 1M40A 3BFGA 4CPKA 2RL3A 4PM5A 3NCKA 5GHZA 1GHMA 5I94A 4OKPA 1XGIA 4JF4A 1I5QA 3MZDA 5FASA 3WS1A 3FWLA 5JYOA 2EX2A 2V20A 1YLTA 2EFXA 1IYSA 2WUQA 5CXWA 1TVFA 3LCEA 1JVJA 1VQQA 4FH4A 4KQOA 1S0WA 5DTSA 4C75A 5FQMA 4NETA 2Q9MA 5GHXA 2WKIA 4R3BA 4CJNA 1KVLA 2OLVA 2VGJA 4BJPA 4S2MA 3W4PA 1G6AA 2Y2MA 4OOMA 4BENA 3HL9A 2ZC6B 2WZXA 1K55C 2EX6A 5FI2A 4K0WA 1KE4A 4LCLA 5GLBA 4N9LA 4ZJ3A 3S22A 4IBRA 5CGSA 5TFQA 3G2YA 3HLCA 1YLZA 3OCNA 1BTLA 3AGEA 4JXGA 4S2LA 5FATA 3LEZA 1K55A 1MPLA 4N1HA 2HDRA 2UWXA 4EUZA 4OONA 4B88A 3G32A 4JF5A 1L0FA 1EROA 2J9PA 1NZUA 5KZHA 1CK3A 4E6WA 5HAPA 3A3FA 1YM1A 3S1YA 2OSUA 1MBLA 1RP5A 4PM6A 4GN2A 4GKUA 1ES2A 5EVLA 4QB8A 2XLNA 3M6BA 4DE2A 4QJGA 1HZOA 1RGYA 1XPBA 1IYPA 1SKFA 3ITBA 3OCLA 4L0LA 3ZVTA 1VM1A 4BD0A 4WELA 1QMFA 3BLMA 5DTKA 3HREA 4WMCD 3VMAA 4KZ3A 1JTDA 1FCMA 1H5XA 3PTEA 5KSHA 1QMEA 5A90A 2Y2GA 3AGDA 4QY5A 3G34A 3NDGA 4R0QA 4U0XA 3VSLA 4DDSA 4OLDA 4WZ4A 2J8YA 3E2KA 3UPPA 1HVBA 5E2HA 1LHYA 1CI9A 4R3JA 2XR0A 1ALQA 3V5MA 1OMEA 5U47A 4E3KA 1KGFA 4ZTKA 5A93A 5FI6A 1L2SA 4XUXA 5DF9A 3TOIA 2EX8A 2HDUA 3S4XA 2Y59A 1FR6A 4F94A 4UA7A 3A3IA 3HVFA 5HAQA 3IF6C 1JWVA 1PI4A 1MY8A 4DF6A 4U0TA 4IBXA 3VOZA 1BLCA 5HW3A 2JC7A 3QNBA 4KENB 4E6XA 3N6IA 4A5RA 1E3UD 2ZC4B 2HP6A 3O3VA 4KG5A 1W8QA 5FQQA 3IF6A 3PAEA 4DE0A 3QHYA 3NI9A 3RXWA 3UDFA 2H0YA 3V50A 5CHJA 4GOGA 1JWZA 4LCMA 3VP3A 1Y54A 4FCFA 4S2PA 3UPOA 3A3EA 3M2JA 2ZMAA 3HLGA 2WGWA 2WGWB 4ZBEA 2OV5A 2H10A 3O86A 3M2KA 5FAOA 1FCNA 1L0DA 3HLWA 2C6WB 4RX3A 5CTMA 4EBLA 3W8KA 2Y2JA 4K91A 4U3TA 3Q7VB 1I2SA 3RJUA 3FKVA 5CGWA 4E3OA 2Y2LA 4Y0TA 3Q1FA 3EQVA 1BT5A 1ES3A 5EUAA 1J9MA 1ZKJA 1N4OA 1WYBA 4KZ6A 3BRMA 2J9OA 3WS0A 1G68A 3HLDA 2H0TA 2I72A 4KZ7A 4R1GA 3V3SA 1N9BA 5HFOA 2P9VB 3LY3A 5EVIC 1IKGA 1XXMA 4KZ5A 2EFUA 1XKZA 1ZG4A 2Y2PA 2XEPA 3BECA 4N1XA 4OP5A 5TR7A 3ZG7B 3UE1A 5DVAA 4P85A 1ONHA 1DJBA 1K6RA 3EQUA 2DNSA 4IVKA 1TEMA 5FQKA 4YFMA 4EQIA 4E3LA 5KMWA 3O87A 2PU4A 4FH2A 3V39A 4GD8A 4JXSA 5CHMA 1K56A 3ZG8B 5J8XA 3LY4A 4HESA 4QY6A 5F83A 4S2OA 1IYOA 1IKIA 5A92A 3GVBA 3SH7A 2R9WA 4HBTA 1FCOA 4Y0UA 3OPLA 2Q9NA 2RCXA 4BD1A 5M19A 3G31A 1MWTA 2CC1A 4MBKA 4BLMA 3GTCA 3ZFZA 5F1FA 2BG1A 3BYDA 5HAIA 5E2GA 4EBNA 1EI5A 4OQ0A 1NY0A 3FYZA 4BL3A 1WYCA 3C5AA 5M1AA 1XGJA 4OPZA 3IH9A 1M6KA 3IXHA 3C7UA 2GDNA 4OQGA 4OPYA 3WS4A 3LO7A 2P74A 2HDQA 4JPMA 4ZDXA 1K38A 3IT9A 1NRFA 3O88A 2XD5A 1E4DA 2WZZA 1K54C 4RYEA 1BSGA 3ZDJA 4OLGA 3IWIA 4KG6A 3IHAA 1IELA 1PYYA 1K54A 4X55A 1Z6FA 3BFCA 3UDXA 2Y2IA 4LV2A 3TG9A 4KZAA 4RA7A 3M6HA 4HEFA 2EXBA 3HLFA 2Y55A 4DXCA 4P87A 4GDNA 3SH9A 2XGNA 2X02A 2ZC5B 4OOLA 4R23A 5EPHA 1YLYA 2BLSA 3WRZA 2ZC3B 5JYPA 3MZFA 3BEBA 1BUEA 2XD1A 3MZEA 2ZM2A 3JYIA 4X69A 3UPNA 1LL9A 2Y2KA 2JBFA 1K57C 4H8RA 4KZ9A 4WEKA 3UN7A 4DE3A 3CZDA 1FSWA 4GZBA 2XH9A 4EBPA 1H8ZA 2ZLYA 3CJMA 1YMSA 5HX9A 5CGXA 3SS4A 1K57A 1FSYA 1YQSA 2ZQDA 1W79A 4E3MA 5HL1A 2ZD8A 1SCWA 2H5SA 3IHBA 4UHUA 4KQQA 3WRTA 3IWOA 1PW8A 4OOYA 3WS5A 2HPBA 5FQJA 5E43A 3ZVWA 3Q07A 3NY4A 4X56A 3MKEA 2PU2A 4E3NA 2QZ6A 1EWZA 3NC8A 2FFFB 3ZNYA 3NBLA 2XDMA 2DCFA 4P6BA 5GLDA 5BOHA 3DTMA 1E3UA 4JLFA 1NYYA 1KDWA 2EX9A 5F82A 3OC2A 1L0EA 3BFEA 4WEJA 4N9KA 1LI0A 2JE5A 3Q7VA 3G4PA 4XXRA 5CTNA 1K4EA 5CERA 3IWQA 4PM7A 3SH8A 2FFYA 4JF6A 4PPRA 1MWUA 1K25A 1XP4A 3NDEA 2A3UA 1LLBA 1JTGA 4GD6A 3SS3A 3VFHA 4MLLA 3QNCA 4X68A 3MBZA 4KZ4A 4ZJ1A 4WM9A 4RX2A 4YINA 4K0XA 5IHVA 4Z9QA 3PBSA 1XX2A 1U60A 5FDHA 2P9VA 5AQ9A 4LENA 3ZCZA 3Q7ZA 2EXAA 3SS5A 4DDYA 3GMWA 4JKTA 1ESUA 4S2NC 3HBRA 4ZAMA 1PWCA 4IEDA 1O7EA 2WAFA 2ZQ7A 2V1ZA 4PM9A 3VSKA 3VFFA 5A91A 1FQGA 2ZQ9A 4S2JA 5FSRA 2Z2MB 3P98A 5EOEA 4KG2A 5FA7A 4S2NA 5E2EA 1PZOA 3W4OA 3C4OA 1IYQA 4O7DA 4DXBA 1W5DA 3ZG0A 4GNUA 2HDSA 4KQRA 2Y2HA 5EVID 4WZ5C 4JXVA 3FZCA 4DKIA 4X6TA 2R9XA 3ZHHA 1XA7A 3OPPA 1WE4A 2PBYA 1PIOA 4MBFA 3MXSA 4N92A 2ZJ9A 1GHPA 2ZQCA 3PAGA 2X71A 4LV1A 4ID4A 4WZ5A 1FOFA 1LI9A 1PW1A 3GQZA 2Y2OA 4PM8A 1K56D 1C3BA 3AGFA 3PBRA 1PZPA 1L0GA 4C3QA 3PBNA 5AQBA 3BFDA 1K4FA 1KVMA 1LL5A 2QPNA 3IQAA 3NIAA 2XFTA 5CEDA 1ERQA 1NXYA 5D3OA 3ZGAB 1KDSA 5FQ9A 4ZJ2A 1TDLA 3ITAA 3SOIA 2WKHA 1BLSA 2DRWA 4UA9A 3OZHA 3PBOA 2B5RA 4XUZA 4Y7PA 4WYYA 2OLUA 1W7FA 5FQIA 3A3JA 4E3JA 3UY6A 3PBTA 2ZM0A 2WK0A 2A49A 2E8IA 3V3RA 3FKWA 2XK1A 3DW0A 1TDGA 3HLEA 1CEGA 2Z2LB 3UO9A 4UAAA 3VOYA 1RGZA 5FAPA 2HP5A 2Y4AA 3IXBA 5FAQA 3I7JA 2XFSA 4LV0A 1SDNA 4P0MA 4BL2A 5FI7A 4UA6A 3IF5A 3BM6A 5GLAA 2Y2NA 5DF7A 4R4SA 1HD8A 3W4QA 4B4ZA 1DJCA 4C6YA 1ESIA 3Q82A 2ZM8A 1BZAA 2ZQAA 1DY6A 3HLBA 4X53A 2QMIA 4MEZA 3VP1A 1NZOA 2Y2QA 3VP0A 1ES5A 1E25A 4S2KA 4R4RA 1YT4A 4HBUA 1HTZA 5E2FA 4WMCA 3Q81A 3UE0A 5CHUA 3HUNA 1KE3A 1PWDA 3CMZA 2WKEA 4QU3A 1PWGA 5EECA 3N4IA 5HARA 2WGIA 3C7VA 3DWKA 2IWCA 5KSCA 1YMXA 1CEFA 2IWBA 4Y0OA 4QHCA 3OPRA 4OPRA 5CEBA 3VP2A 3GV9A 1S6RA 4KZ8A 4OH0A 4OQHA 2ZQ8A 1I2WA 3G35A 3VP4A 1AXBA 3B3XA 1ZC2A 5DF8A 3N8RA 3TSGA 1ONGA 1SHVA 2VGKA 2X01A 5CRFA 2XF3A 3FV7A 3MFDA 4FSFA 2ZC7A 3PBQA 4GB7A 4OPQA 5L2FA 4PMAA 1ES4A 3GRJA 4FD8A 1BLHA 1DJAA 1MKIA 1Q2PA 3ZG9B 3ISGA 5CECA 4JBFA 4LV3A 4E3IA 3N7WA 3RXXA 4D2OA 4RVAA 2WAEA 1CI8A 3G2ZA 3BLSA 5AQ7A 4MNRA 1JWPA 3BFFA 3GR2A 1BLPA 2G2UA 3N8SA 3A3DA 4KZBA 3OPHA 4MBHA 4OVDA 4QD4A 5TGFA 2JCHA 3UE3A 2IWDA 1KE0A 3E2LA 3IF6B 1GHIA 1YLPA 5F1GA 1RCJA 1NJ4A 1K6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FR1 A;  1KGG A;  4Q8I A;  1XA1 A;  1O07 A;  3HUO A;  3WS2 A;  4EV4 A;  1GA9 A;  3CG5 A;  3HUM A;  4BQM A;  2XQZ A;  4B4X A;  2Y91 A;  3GSG A;  4NK3 A;  3N8L A;  3UDI A;  1YLW A;  3IXG A;  3ZG5 A;  1IEM A;  3P09 A;  4S2I A;  3UNW A;  1PI5 A;  4WBG A;  5DTT A;  4OP8 A;  1BUL A;  3C4P A;  2WAD A;  5GHY A;  1GA0 A;  1KGE A;  1Q2Q A;  4IVI A;  1GCE A;  5GLC A;  1MWR A;  4DRT A;  2J7V A;  5G18 A;  4DE1 A;  2G2W A;  3DWZ A;  3MKF A;  1MWS A;  1SDE A;  1ERM A;  4GDB A;  2HP9 A;  1MXO A;  2C5W B;  5AQA A;  5M18 A;  2V2F F;  3G30 A;  4M3K A;  5EOO A;  4EWF A;  1W8Y A;  4OQI A;  3IXD A;  5GL9 A;  1YLJ A;  3MXR A;  2WYX A;  3IH8 A;  1ZG6 A;  1H8Y A;  4JXW A;  2WGV A;  5EVI A;  5EVI B;  1NYM A;  3ZNT A;  5EE8 A;  3WWX A;  3D4F A;  1M40 A;  3BFG A;  4CPK A;  2RL3 A;  4PM5 A;  3NCK A;  5GHZ A;  1GHM A;  5I94 A;  4OKP A;  1XGI A;  4JF4 A;  1I5Q A;  3MZD A;  5FAS A;  3WS1 A;  3FWL A;  5JYO A;  2EX2 A;  2V20 A;  1YLT A;  2EFX A;  1IYS A;  2WUQ A;  5CXW A;  1TVF A;  3LCE A;  1JVJ A;  1VQQ A;  4FH4 A;  4KQO A;  1S0W A;  5DTS A;  4C75 A;  5FQM A;  4NET A;  2Q9M A;  5GHX A;  2WKI A;  4R3B A;  4CJN A;  1KVL A;  2OLV A;  2VGJ A;  4BJP A;  4S2M A;  3W4P A;  1G6A A;  2Y2M A;  4OOM A;  4BEN A;  3HL9 A;  2ZC6 B;  2WZX A;  1K55 C;  2EX6 A;  5FI2 A;  4K0W A;  1KE4 A;  4LCL A;  5GLB A;  4N9L A;  4ZJ3 A;  3S22 A;  4IBR A;  5CGS A;  5TFQ A;  3G2Y A;  3HLC A;  1YLZ A;  3OCN A;  1BTL A;  3AGE A;  4JXG A;  4S2L A;  5FAT A;  3LEZ A;  1K55 A;  1MPL A;  4N1H A;  2HDR A;  2UWX A;  4EUZ A;  4OON A;  4B88 A;  3G32 A;  4JF5 A;  1L0F A;  1ERO A;  2J9P A;  1NZU A;  5KZH A;  1CK3 A;  4E6W A;  5HAP A;  3A3F A;  1YM1 A;  3S1Y A;  2OSU A;  1MBL A;  1RP5 A;  4PM6 A;  4GN2 A;  4GKU A;  1ES2 A;  5EVL A;  4QB8 A;  2XLN A;  3M6B A;  4DE2 A;  4QJG A;  1HZO A;  1RGY A;  1XPB A;  1IYP A;  1SKF A;  3ITB A;  3OCL A;  4L0L A;  3ZVT A;  1VM1 A;  4BD0 A;  4WEL A;  1QMF A;  3BLM A;  5DTK A;  3HRE A;  4WMC D;  3VMA A;  4KZ3 A;  1JTD A;  1FCM A;  1H5X A;  3PTE A;  5KSH A;  1QME A;  5A90 A;  2Y2G A;  3AGD A;  4QY5 A;  3G34 A;  3NDG A;  4R0Q A;  4U0X A;  3VSL A;  4DDS A;  4OLD A;  4WZ4 A;  2J8Y A;  3E2K A;  3UPP A;  1HVB A;  5E2H A;  1LHY A;  1CI9 A;  4R3J A;  2XR0 A;  1ALQ A;  3V5M A;  1OME A;  5U47 A;  4E3K A;  1KGF A;  4ZTK A;  5A93 A;  5FI6 A;  1L2S A;  4XUX A;  5DF9 A;  3TOI A;  2EX8 A;  2HDU A;  3S4X A;  2Y59 A;  1FR6 A;  4F94 A;  4UA7 A;  3A3I A;  3HVF A;  5HAQ A;  3IF6 C;  1JWV A;  1PI4 A;  1MY8 A;  4DF6 A;  4U0T A;  4IBX A;  3VOZ A;  1BLC A;  5HW3 A;  2JC7 A;  3QNB A;  4KEN B;  4E6X A;  3N6I A;  4A5R A;  1E3U D;  2ZC4 B;  2HP6 A;  3O3V A;  4KG5 A;  1W8Q A;  5FQQ A;  3IF6 A;  3PAE A;  4DE0 A;  3QHY A;  3NI9 A;  3RXW A;  3UDF A;  2H0Y A;  3V50 A;  5CHJ A;  4GOG A;  1JWZ A;  4LCM A;  3VP3 A;  1Y54 A;  4FCF A;  4S2P A;  3UPO A;  3A3E A;  3M2J A;  2ZMA A;  3HLG A;  2WGW A;  2WGW B;  4ZBE A;  2OV5 A;  2H10 A;  3O86 A;  3M2K A;  5FAO A;  1FCN A;  1L0D A;  3HLW A;  2C6W B;  4RX3 A;  5CTM A;  4EBL A;  3W8K A;  2Y2J A;  4K91 A;  4U3T A;  3Q7V B;  1I2S A;  3RJU A;  3FKV A;  5CGW A;  4E3O A;  2Y2L A;  4Y0T A;  3Q1F A;  3EQV A;  1BT5 A;  1ES3 A;  5EUA A;  1J9M A;  1ZKJ A;  1N4O A;  1WYB A;  4KZ6 A;  3BRM A;  2J9O A;  3WS0 A;  1G68 A;  3HLD A;  2H0T A;  2I72 A;  4KZ7 A;  4R1G A;  3V3S A;  1N9B A;  5HFO A;  2P9V B;  3LY3 A;  5EVI C;  1IKG A;  1XXM A;  4KZ5 A;  2EFU A;  1XKZ A;  1ZG4 A;  2Y2P A;  2XEP A;  3BEC A;  4N1X A;  4OP5 A;  5TR7 A;  3ZG7 B;  3UE1 A;  5DVA A;  4P85 A;  1ONH A;  1DJB A;  1K6R A;  3EQU A;  2DNS A;  4IVK A;  1TEM A;  5FQK A;  4YFM A;  4EQI A;  4E3L A;  5KMW A;  3O87 A;  2PU4 A;  4FH2 A;  3V39 A;  4GD8 A;  4JXS A;  5CHM A;  1K56 A;  3ZG8 B;  5J8X A;  3LY4 A;  4HES A;  4QY6 A;  5F83 A;  4S2O A;  1IYO A;  1IKI A;  5A92 A;  3GVB A;  3SH7 A;  2R9W A;  4HBT A;  1FCO A;  4Y0U A;  3OPL A;  2Q9N A;  2RCX A;  4BD1 A;  5M19 A;  3G31 A;  1MWT A;  2CC1 A;  4MBK A;  4BLM A;  3GTC A;  3ZFZ A;  5F1F A;  2BG1 A;  3BYD A;  5HAI A;  5E2G A;  4EBN A;  1EI5 A;  4OQ0 A;  1NY0 A;  3FYZ A;  4BL3 A;  1WYC A;  3C5A A;  5M1A A;  1XGJ A;  4OPZ A;  3IH9 A;  1M6K A;  3IXH A;  3C7U A;  2GDN A;  4OQG A;  4OPY A;  3WS4 A;  3LO7 A;  2P74 A;  2HDQ A;  4JPM A;  4ZDX A;  1K38 A;  3IT9 A;  1NRF A;  3O88 A;  2XD5 A;  1E4D A;  2WZZ A;  1K54 C;  4RYE A;  1BSG A;  3ZDJ A;  4OLG A;  3IWI A;  4KG6 A;  3IHA A;  1IEL A;  1PYY A;  1K54 A;  4X55 A;  1Z6F A;  3BFC A;  3UDX A;  2Y2I A;  4LV2 A;  3TG9 A;  4KZA A;  4RA7 A;  3M6H A;  4HEF A;  2EXB A;  3HLF A;  2Y55 A;  4DXC A;  4P87 A;  4GDN A;  3SH9 A;  2XGN A;  2X02 A;  2ZC5 B;  4OOL A;  4R23 A;  5EPH A;  1YLY A;  2BLS A;  3WRZ A;  2ZC3 B;  5JYP A;  3MZF A;  3BEB A;  1BUE A;  2XD1 A;  3MZE A;  2ZM2 A;  3JYI A;  4X69 A;  3UPN A;  1LL9 A;  2Y2K A;  2JBF A;  1K57 C;  4H8R A;  4KZ9 A;  4WEK A;  3UN7 A;  4DE3 A;  3CZD A;  1FSW A;  4GZB A;  2XH9 A;  4EBP A;  1H8Z A;  2ZLY A;  3CJM A;  1YMS A;  5HX9 A;  5CGX A;  3SS4 A;  1K57 A;  1FSY A;  1YQS A;  2ZQD A;  1W79 A;  4E3M A;  5HL1 A;  2ZD8 A;  1SCW A;  2H5S A;  3IHB A;  4UHU A;  4KQQ A;  3WRT A;  3IWO A;  1PW8 A;  4OOY A;  3WS5 A;  2HPB A;  5FQJ A;  5E43 A;  3ZVW A;  3Q07 A;  3NY4 A;  4X56 A;  3MKE A;  2PU2 A;  4E3N A;  2QZ6 A;  1EWZ A;  3NC8 A;  2FFF B;  3ZNY A;  3NBL A;  2XDM A;  2DCF A;  4P6B A;  5GLD A;  5BOH A;  3DTM A;  1E3U A;  4JLF A;  1NYY A;  1KDW A;  2EX9 A;  5F82 A;  3OC2 A;  1L0E A;  3BFE A;  4WEJ A;  4N9K A;  1LI0 A;  2JE5 A;  3Q7V A;  3G4P A;  4XXR A;  5CTN A;  1K4E A;  5CER A;  3IWQ A;  4PM7 A;  3SH8 A;  2FFY A;  4JF6 A;  4PPR A;  1MWU A;  1K25 A;  1XP4 A;  3NDE A;  2A3U A;  1LLB A;  1JTG A;  4GD6 A;  3SS3 A;  3VFH A;  4MLL A;  3QNC A;  4X68 A;  3MBZ A;  4KZ4 A;  4ZJ1 A;  4WM9 A;  4RX2 A;  4YIN A;  4K0X A;  5IHV A;  4Z9Q A;  3PBS A;  1XX2 A;  1U60 A;  5FDH A;  2P9V A;  5AQ9 A;  4LEN A;  3ZCZ A;  3Q7Z A;  2EXA A;  3SS5 A;  4DDY A;  3GMW A;  4JKT A;  1ESU A;  4S2N C;  3HBR A;  4ZAM A;  1PWC A;  4IED A;  1O7E A;  2WAF A;  2ZQ7 A;  2V1Z A;  4PM9 A;  3VSK A;  3VFF A;  5A91 A;  1FQG A;  2ZQ9 A;  4S2J A;  5FSR A;  2Z2M B;  3P98 A;  5EOE A;  4KG2 A;  5FA7 A;  4S2N A;  5E2E A;  1PZO A;  3W4O A;  3C4O A;  1IYQ A;  4O7D A;  4DXB A;  1W5D A;  3ZG0 A;  4GNU A;  2HDS A;  4KQR A;  2Y2H A;  5EVI D;  4WZ5 C;  4JXV A;  3FZC A;  4DKI A;  4X6T A;  2R9X A;  3ZHH A;  1XA7 A;  3OPP A;  1WE4 A;  2PBY A;  1PIO A;  4MBF A;  3MXS A;  4N92 A;  2ZJ9 A;  1GHP A;  2ZQC A;  3PAG A;  2X71 A;  4LV1 A;  4ID4 A;  4WZ5 A;  1FOF A;  1LI9 A;  1PW1 A;  3GQZ A;  2Y2O A;  4PM8 A;  1K56 D;  1C3B A;  3AGF A;  3PBR A;  1PZP A;  1L0G A;  4C3Q A;  3PBN A;  5AQB A;  3BFD A;  1K4F A;  1KVM A;  1LL5 A;  2QPN A;  3IQA A;  3NIA A;  2XFT A;  5CED A;  1ERQ A;  1NXY A;  5D3O A;  3ZGA B;  1KDS A;  5FQ9 A;  4ZJ2 A;  1TDL A;  3ITA A;  3SOI A;  2WKH A;  1BLS A;  2DRW A;  4UA9 A;  3OZH A;  3PBO A;  2B5R A;  4XUZ A;  4Y7P A;  4WYY A;  2OLU A;  1W7F A;  5FQI A;  3A3J A;  4E3J A;  3UY6 A;  3PBT A;  2ZM0 A;  2WK0 A;  2A49 A;  2E8I A;  3V3R A;  3FKW A;  2XK1 A;  3DW0 A;  1TDG A;  3HLE A;  1CEG A;  2Z2L B;  3UO9 A;  4UAA A;  3VOY A;  1RGZ A;  5FAP A;  2HP5 A;  2Y4A A;  3IXB A;  5FAQ A;  3I7J A;  2XFS A;  4LV0 A;  1SDN A;  4P0M A;  4BL2 A;  5FI7 A;  4UA6 A;  3IF5 A;  3BM6 A;  5GLA A;  2Y2N A;  5DF7 A;  4R4S A;  1HD8 A;  3W4Q A;  4B4Z A;  1DJC A;  4C6Y A;  1ESI A;  3Q82 A;  2ZM8 A;  1BZA A;  2ZQA A;  1DY6 A;  3HLB A;  4X53 A;  2QMI A;  4MEZ A;  3VP1 A;  1NZO A;  2Y2Q A;  3VP0 A;  1ES5 A;  1E25 A;  4S2K A;  4R4R A;  1YT4 A;  4HBU A;  1HTZ A;  5E2F A;  4WMC A;  3Q81 A;  3UE0 A;  5CHU A;  3HUN A;  1KE3 A;  1PWD A;  3CMZ A;  2WKE A;  4QU3 A;  1PWG A;  5EEC A;  3N4I A;  5HAR A;  2WGI A;  3C7V A;  3DWK A;  2IWC A;  5KSC A;  1YMX A;  1CEF A;  2IWB A;  4Y0O A;  4QHC A;  3OPR A;  4OPR A;  5CEB A;  3VP2 A;  3GV9 A;  1S6R A;  4KZ8 A;  4OH0 A;  4OQH A;  2ZQ8 A;  1I2W A;  3G35 A;  3VP4 A;  1AXB A;  3B3X A;  1ZC2 A;  5DF8 A;  3N8R A;  3TSG A;  1ONG A;  1SHV A;  2VGK A;  2X01 A;  5CRF A;  2XF3 A;  3FV7 A;  3MFD A;  4FSF A;  2ZC7 A;  3PBQ A;  4GB7 A;  4OPQ A;  5L2F A;  4PMA A;  1ES4 A;  3GRJ A;  4FD8 A;  1BLH A;  1DJA A;  1MKI A;  1Q2P A;  3ZG9 B;  3ISG A;  5CEC A;  4JBF A;  4LV3 A;  4E3I A;  3N7W A;  3RXX A;  4D2O A;  4RVA A;  2WAE A;  1CI8 A;  3G2Z A;  3BLS A;  5AQ7 A;  4MNR A;  1JWP A;  3BFF A;  3GR2 A;  1BLP A;  2G2U A;  3N8S A;  3A3D A;  4KZB A;  3OPH A;  4MBH A;  4OVD A;  4QD4 A;  5TGF A;  2JCH A;  3UE3 A;  2IWD A;  1KE0 A;  3E2L A;  3IF6 B;  1GHI A;  1YLP A;  5F1G A;  1RCJ A;  1NJ4 A;  1K6S A; 
#chains in the Genus database with same CATH topology
 1KGG A;  4EV4 A;  3CG5 A;  1PRQ A;  2O0Y A;  4B4X A;  4GW9 A;  3LI9 A;  3ZG5 A;  3H7W B;  3QP6 A;  1V9Y A;  3R7W B;  2NUT C;  2GZA A;  2J7V A;  3TW8 A;  3MQO A;  1MWS A;  1UGU A;  1ERM A;  4O01 A;  1UWN X;  2OOL A;  2PYR A;  4F3L B;  5M18 A;  4EWF A;  1W8Y A;  4OQI A;  2WYX A;  3JVU A;  2WGV A;  5EVI B;  5EE8 A;  1M40 A;  3BFG A;  3LR0 A;  3NCK A;  5CX7 A;  2VEA A;  3FPV A;  4JF4 A;  3MZD A;  3IS2 A;  2ZOI A;  3FWL A;  2EX2 A;  2V20 A;  2EFX A;  4ARZ B;  1S0W A;  4NET A;  3E98 A;  5GHX A;  4R3B A;  4B9O A;  4BJP A;  1G6A A;  1G28 A;  5F68 A;  4D60 A;  4K0W A;  4N9L A;  3HLC A;  1LT0 A;  5LBR A;  1BTL A;  3AGE A;  4JXG A;  4S2L A;  5FAT A;  3BY9 A;  2HDR A;  4EUZ A;  2W1T B;  4B88 A;  2J9P A;  1NZU A;  3A3F A;  2OSU A;  1MBL A;  1RP5 A;  4GN2 A;  1CF0 A;  2XLN A;  4DE2 A;  1HZO A;  1XPB A;  4L0L A;  3OCL A;  1VM1 A;  5DTK A;  1D7E A;  1NLZ A;  4WMC D;  1JTD A;  2INW A;  1XJ3 A;  1GSV A;  5KSH A;  2W0N A;  3AGD A;  4U0X A;  3VSL A;  4WZ4 A;  2J8Y A;  3E2K A;  5HPI A;  4MN5 A;  4R3J A;  2XR0 A;  3V5M A;  1TS6 A;  2XA7 S;  3S4X A;  4F94 A;  4UA7 A;  3A3I A;  3HVF A;  4DF6 A;  1MY8 A;  4IBX A;  4E6X A;  3IX3 A;  3N6I A;  3LUQ A;  4P6Z M;  5EFW A;  3QHY A;  3NI9 A;  3RXW A;  3PHY A;  2W3G A;  2ZMA A;  2WGW B;  3H82 B;  3M2K A;  5FAO A;  4U3T A;  5CGW A;  2Y2L A;  4BBU A;  1BYW A;  1ES3 A;  5EUA A;  2OWH A;  1G68 A;  2Z6C A;  4KZ7 A;  2JKR M;  3LR4 A;  3V3S A;  1N9B A;  2IA2 A;  1XKZ A;  3BEC A;  4OP5 A;  5TR7 A;  3ZG7 B;  3GEC A;  1K6R A;  3T1R A;  5FQK A;  3CWF A;  5A8B A;  4YFM A;  3O87 A;  4FH2 A;  4JXS A;  3HCY A;  3LY4 A;  4HES A;  5F83 A;  4DN0 A;  3GVB A;  5DJU A;  3MMH A;  1YKD A;  5M19 A;  1MWT A;  4EET B;  4R3A A;  3UB9 A;  4R6L A;  3ZFZ A;  2BG1 A;  5E2G A;  3OBF A;  1G6O A;  4OPZ A;  3IH9 A;  1VEU A;  4OPY A;  3WS4 A;  3HJI A;  3LO7 A;  4JPM A;  2HDQ A;  4ZDX A;  3TRC A;  4WN5 A;  3O88 A;  4EQ1 A;  2WZZ A;  1K54 C;  4QWO A;  4Q0J A;  3C30 A;  2JHE A;  3F1N B;  1K54 A;  4X55 A;  1Z6F A;  2Y2I A;  4M4X A;  5HSQ A;  2Y55 A;  1DRM A;  2ZC5 B;  2A24 A;  2P7J A;  3ZYT A;  2ZC3 B;  3ZQ5 A;  1SKO A;  3MZF A;  1BUE A;  2ZM2 A;  1HLU P;  4X69 A;  1LL9 A;  4EBP A;  1N9O A;  1FSY A;  4HY8 A;  4WF0 A;  5HL1 A;  4UHU A;  4KQQ A;  3IWO A;  5IT5 A;  2L4R A;  1OTD A;  3D9Y A;  3MKE A;  2EA9 A;  2PU2 A;  2QZ6 A;  1EWZ A;  3NC8 A;  2XDM A;  3T4J A;  3NEC A;  5GLD A;  3KX0 X;  2MJ6 A;  1L0E A;  3BFE A;  4WEJ A;  2JE5 A;  5CTN A;  1OT9 A;  4PM7 A;  4QPR A;  4PPR A;  3VFH A;  3VV4 A;  4JGO A;  4YIN A;  5IHV A;  3T4Q A;  3P7N A;  2EXA A;  3U4L P;  4LPZ A;  1PWC A;  2PR5 A;  4IED A;  3VSK A;  3VFF A;  1FQG A;  5FEF A;  5FSR A;  4CQH A;  3G6O A;  5FA7 A;  5E2E A;  3W4O A;  2O9A A;  2VK3 A;  3C4O A;  4DXB A;  5FDS A;  3ZG0 A;  5EVI D;  1WA9 A;  4UEY A;  2ZQC A;  4LV1 A;  2X71 A;  1AWI A;  4ID4 A;  4PM8 A;  1N9N A;  1IFQ A;  1TS7 A;  1XFQ A;  4HJ4 A;  5CED A;  5FQ9 A;  4HNB A;  3SOI A;  3ITA A;  2DRW A;  4UA9 A;  4WYY A;  3FC7 A;  2ZM0 A;  3T1Q B;  2LB5 A;  3BW6 A;  1TDG A;  1CEG A;  2W3H A;  3UO9 A;  5FAP A;  4AFI A;  1KOU A;  2Y4A A;  4B93 A;  3H9W A;  2O99 A;  4JGQ A;  5FAQ A;  2XFS A;  4LV0 A;  1SDN A;  5TBM B;  3IF5 A;  2KDK A;  3LFV A;  2Y2N A;  3KYZ A;  4G3W A;  3MSH A;  1DJC A;  4C6Y A;  1ESI A;  3UME A;  3Q82 A;  2ZQA A;  4ZRR A;  3A0R A;  4S2K A;  4HBU A;  3Q81 A;  3HUN A;  1F2K A;  4ETZ A;  2ZMF A;  1KE3 A;  3CMZ A;  4ETX A;  3UB8 A;  3N4I A;  3DWK A;  2IWC A;  1YMX A;  4QHC A;  5CEB A;  1D06 A;  4OQH A;  4EES A;  3G35 A;  2M7U A;  4JGP A;  2VGK A;  2VJW A;  1FIK A;  3RH8 B;  1G5U A;  4OPQ A;  5L2F A;  4Q0I A;  3GRJ A;  3ISG A;  2WAE A;  1CI8 A;  2HF6 A;  2FZ0 A;  3GR2 A;  3N8S A;  2G2U A;  4QD4 A;  3MFX A;  4E3J A;  2P04 A;  2IWD A;  5HDD A;  3E2L A;  4IUK A;  1RCJ A;  3LYX A;  4UQI M;  1XA1 A;  3HUO A;  1GA9 A;  2UV0 E;  4BQM A;  2XQZ A;  4PHT A;  2Y91 A;  3N8L A;  3UDI A;  1S66 L;  4Q0H A;  3UNW A;  1PI5 A;  3R7W A;  3C4P A;  1GA0 A;  4GS9 B;  4LFU A;  1KGE A;  5GLC A;  1LSV A;  1SDE A;  1MXO A;  4YNR A;  4UQI S;  4F3L A;  3G30 A;  5EOO A;  5GL9 A;  3MXR A;  5EVI A;  2V8F A;  3NOP C;  1TS0 A;  4L9G A;  4CPK A;  4PM5 A;  3CPT A;  4FOF A;  5I94 A;  2Y8H A;  2CMN A;  5FAS A;  5F69 A;  1NRJ A;  2V9A A;  4DJ2 A;  5JYO A;  1D1J A;  3LCE A;  5DTS A;  4FH4 A;  5HWW A;  5J7E A;  4C75 A;  1KVL A;  2OLV A;  2Y2M A;  3A0V A;  4NG2 A;  3CIT A;  3HL9 A;  2ZC6 B;  2WZX A;  5FI2 A;  1KE4 A;  4LCL A;  3S22 A;  3OCN A;  1MPL A;  3DTE A;  5AVE A;  2HZ5 A;  2W1T A;  1L0F A;  1ERO A;  5KZH A;  4NXG A;  3SW1 A;  5EVL A;  4QB8 A;  4QJG A;  4LRY C;  3VMA A;  3HRE A;  3IX4 A;  3NDG A;  4O8G A;  5G4Z A;  2VX8 A;  5HD3 A;  3UPP A;  1DP9 A;  1L3L A;  3F1P B;  1ALQ A;  5A93 A;  1VB6 A;  5DF9 A;  3TOI A;  2HDU A;  2Y59 A;  3BY8 A;  5HAQ A;  3IF6 C;  4H6J B;  4U0T A;  1BLC A;  4KEN B;  3S7O A;  3SZT A;  1OPX A;  4KG5 A;  3IF6 A;  3PXP A;  2H0Y A;  5CHJ A;  1JWZ A;  4S2P A;  1GSW A;  3BQA A;  3M2J A;  4MN6 A;  3HLG A;  2WGW A;  4LRZ E;  2H10 A;  3O86 A;  2OV5 A;  1JNU A;  3HLW A;  4RX3 A;  3W8K A;  2Y2J A;  3Q7V B;  4EXO A;  2XSS A;  3RJU A;  2ZMV A;  3Q1F A;  3EQV A;  2YKH A;  1XFN A;  4LLO B;  3WS0 A;  1F9I A;  2I72 A;  4I39 A;  2P9V B;  3U2A A;  2YKF A;  2ZL1 A;  4KZ5 A;  1OTE A;  4N1X A;  3UE1 A;  4P85 A;  1ONH A;  5L10 A;  4Y2F A;  4EEU A;  3OOV A;  4IVK A;  5KMW A;  2PU4 A;  2M7V A;  2M1C A;  5J8X A;  4QY6 A;  2LB9 A;  5A92 A;  2VV7 A;  2Q9N A;  4BD1 A;  1NWZ A;  4BLM A;  2V1A A;  3GTC A;  5FL3 A;  4HH2 A;  4BMW A;  3BYD A;  5F1F A;  1EI5 A;  3FYZ A;  4BL3 A;  4CLC B;  5J3W A;  1WYC A;  5M1A A;  2J3W A;  2JKT I;  3O5Y A;  3MR0 A;  2PD7 A;  3IT9 A;  1NRF A;  2XD5 A;  3K3D A;  4OLG A;  5K5B A;  3IWI A;  1X0O A;  1CQA A;  4X1M A;  4LV2 A;  2XA7 M;  1MC0 A;  3CLO A;  2BLS A;  3QP2 A;  3KSH A;  4Z1W A;  4Y17 A;  4BWI A;  3UPN A;  3CUE A;  2K7S A;  4H8R A;  3CZD A;  4GZB A;  2WKP A;  4DJ3 A;  4ME4 A;  3CJM A;  1YMS A;  1H3Q A;  1H8M A;  5TJJ A;  4HOI A;  2H5S A;  3WRT A;  1PW8 A;  3WS5 A;  5FQJ A;  5E43 A;  5DFX A;  4XT2 A;  3Q07 A;  4X56 A;  2FFF B;  3NBL A;  2XRN A;  2GX5 A;  4JLF A;  2EX9 A;  5F82 A;  3OC2 A;  4N9K A;  4HQA A;  2I9V A;  2EWW A;  2FFY A;  1TS8 A;  4JF6 A;  1K25 A;  3NDE A;  1LLB A;  4X68 A;  4ZJ1 A;  1OTA A;  4WM9 A;  3CAX A;  3PBS A;  2QJ7 A;  5AQ9 A;  3JVV A;  3Q7Z A;  2J80 A;  4JKT A;  1LL8 A;  4PM9 A;  5A91 A;  2Z2M B;  4ESP A;  4HIA A;  1PZO A;  4YWZ A;  1IYQ A;  1W5D A;  4GNU A;  4NXE A;  4WZ5 C;  3FZC A;  4LRX C;  2VLG A;  1XA7 A;  3OPP A;  1PIO A;  3C38 A;  3MXS A;  3NJA A;  4WZ5 A;  1H0M A;  1K56 D;  3PBR A;  1PZP A;  3CHW P;  5AQB A;  1K4F A;  4I3J A;  2XFT A;  1NXY A;  3ZGA B;  1YAX A;  3PBO A;  2B5R A;  4Y7P A;  1W7F A;  3UY6 A;  3PBT A;  4R70 A;  4I38 A;  3T1S A;  2A49 A;  2E8I A;  3V3R A;  2L1M A;  2XK1 A;  3DW0 A;  3HLE A;  2R78 A;  3MJQ A;  3QP1 A;  1TF1 A;  4UA6 A;  1LSX A;  4BBV A;  5GLA A;  1STZ A;  2OAQ 1;  2PRF A;  3W4Q A;  2NUP C;  2ZM8 A;  1BZA A;  1GSX A;  2Y2Q A;  1HTZ A;  4FTX A;  4WMC A;  5EEC A;  5MC7 A;  3KO6 A;  3T50 A;  3C7V A;  5KSC A;  4OPR A;  3VP2 A;  3GV9 A;  2ZQ8 A;  1I2W A;  3B3X A;  1SHV A;  2X01 A;  5FEG A;  3KYQ A;  2ZC7 A;  3PBQ A;  1PFL A;  4JBF A;  4E3I A;  3P01 A;  4D2O A;  4RVA A;  3G2Z A;  3RFB A;  3BLS A;  3T4T A;  5AQ7 A;  4DDY A;  3A3D A;  3OPH A;  4OVD A;  1KE0 A;  4NEE D;  2D02 A;  1NJ4 A;  1FR1 A;  4GHI B;  1P97 A;  2OWJ A;  1S1Y A;  3GSG A;  3P09 A;  4S2I A;  4MMN A;  3LIA A;  4WBG A;  5DTT A;  4OP8 A;  2WAD A;  4GS9 A;  5J4E A;  1P0Z A;  4IVI A;  3MQ0 A;  1GCE A;  4DRT A;  4DE1 A;  1TD5 A;  2G2W A;  3MKF A;  3FG8 A;  2C5W B;  4G3V A;  1T1A A;  3IXD A;  4JXW A;  5KIZ A;  1NYM A;  3ZNT A;  3WWX A;  1VET B;  2RL3 A;  3CI6 A;  1SZV A;  1OJG A;  4OKP A;  3MQQ A;  3EEH A;  3E4O A;  5C5K A;  3WS1 A;  4CLC D;  1IYS A;  1TVF A;  2W3F A;  1JVJ A;  4JGR A;  2Q9M A;  4CJN A;  2Q0O A;  4OOM A;  1K55 C;  2EX6 A;  2G7U A;  4GJ4 A;  5GLB A;  4I3A A;  4IBR A;  5CGS A;  3G2Y A;  1YLZ A;  3F1O A;  1K55 A;  4HP4 A;  3EGD C;  3UB6 A;  3VE4 A;  1YM1 A;  3S1Y A;  2W3E A;  4PM6 A;  4GKU A;  1ES2 A;  4NXB A;  4HJ3 A;  1IYP A;  1SKF A;  3ITB A;  1LSW A;  4WEL A;  2A24 B;  1H5X A;  1SKO B;  3LR5 A;  1QME A;  2J3T D;  4GCZ A;  4BBT A;  1J3W A;  4QY5 A;  1MZU A;  4DDS A;  4MDZ A;  4OLD A;  1HVB A;  5E2H A;  1OME A;  1KGF A;  4ZTK A;  5FI6 A;  4XUX A;  2EX8 A;  1FR6 A;  1JWV A;  1PI4 A;  4H6J A;  2JC7 A;  3QNB A;  5DJT A;  2ZC4 B;  5EM0 A;  1W8Q A;  5G4Y A;  1T1B A;  3B42 A;  2XRO A;  4FCF A;  2WKR A;  3A3E A;  2ZBB A;  3E4P A;  3K2N A;  4EBL A;  4K91 A;  3H7W A;  3UE6 A;  3FKV A;  4E3O A;  4Y0T A;  1S67 L;  1PNE A;  3TJZ C;  1BT5 A;  1ZKJ A;  3DBA A;  1N4O A;  1WYB A;  3BRM A;  5HD5 A;  2K31 A;  3HLD A;  1XJ4 A;  3ICY A;  4R1G A;  3LY3 A;  5EVI C;  1MKM A;  3KSG A;  1IKG A;  1XXM A;  1ZG4 A;  2XEP A;  3PR6 A;  5DVA A;  3EQU A;  1TEM A;  3LGO A;  1EW0 A;  4GD8 A;  5IU1 A;  3S7P A;  3ZG8 B;  1FCO A;  4Y0U A;  2RCX A;  4ARZ A;  4MBK A;  2CC1 A;  4FUW A;  4EBN A;  3C5A A;  2JKR I;  1XGJ A;  2GDN A;  3FPW A;  4OQG A;  2ZOH A;  2P74 A;  1K38 A;  4PKY G;  5L8M A;  1S4R A;  4RYE A;  1BSG A;  3ZDJ A;  3S7N A;  3IHA A;  3EEA A;  1IEL A;  1VHM A;  1PYY A;  3BFC A;  2VA0 A;  3TG9 A;  3M6H A;  4HEF A;  2EXB A;  4DXC A;  4GDN A;  3SH9 A;  2XGN A;  4OOL A;  4Y3I A;  5JYP A;  3BEB A;  2XD1 A;  3JYI A;  2JBF A;  1P9R A;  4WEK A;  3MS6 A;  3UN7 A;  4DE3 A;  1FSW A;  1ODV A;  1H8Z A;  2GJ3 A;  2PR6 A;  2HJ9 C;  5CGX A;  3SS4 A;  1T19 A;  1YQS A;  3LIF A;  3IHB A;  3LID A;  1V9Z A;  4IJG A;  4OOY A;  2HPB A;  1IOU A;  2E8J A;  4EEP A;  2K2N A;  4E3N A;  2DCF A;  4P6B A;  3DTM A;  1NYY A;  3H82 A;  2VGL S;  4IUH A;  4XXR A;  3G4P A;  1K4E A;  5CER A;  4EER A;  1MWU A;  1XP4 A;  2A3U A;  1JTG A;  4GD6 A;  4HJ6 A;  2VKS A;  2FH5 A;  4G3K A;  3MBZ A;  4K0X A;  5I5L A;  3ZCZ A;  3T4L A;  3SS5 A;  1ESU A;  4S2N C;  4ZAM A;  2WAF A;  2ZQ7 A;  2ZQ9 A;  4S2J A;  3P98 A;  4S2N A;  3L7H A;  1W63 M;  4O7D A;  4KQR A;  2Y2H A;  4JXV A;  4DKI A;  2R9X A;  3ZHH A;  1WE4 A;  3MF0 A;  2ZJ9 A;  1GHP A;  3PAG A;  1LI9 A;  1PW1 A;  3GQZ A;  3W2Z A;  2Y2O A;  2PBD P;  4C3Q A;  1C3B A;  2W1R A;  3PBN A;  1F5M A;  1LL5 A;  1KVM A;  2DMW A;  1ERQ A;  2D01 A;  3CPT B;  5HWT A;  3BJN A;  1TDL A;  2WKH A;  1K0K A;  2OLU A;  3QP8 A;  5FQI A;  1S4S A;  2WK0 A;  3FKW A;  3F1N A;  4UAA A;  3VOY A;  1RGZ A;  2HP5 A;  4X1L A;  3IXB A;  4X25 A;  4BL2 A;  3BM6 A;  4LGW A;  3CUE C;  4R4S A;  1HD8 A;  4B4Z A;  5F5Y A;  5F6A A;  1DY6 A;  3HLB A;  4X53 A;  2QMI A;  3VP1 A;  1NZO A;  3VP0 A;  3BQ8 A;  5DKK A;  4WLA A;  3UE0 A;  5CHU A;  1OTB A;  3KSI A;  4QU3 A;  4HP9 A;  5HL6 A;  1PWG A;  2B02 A;  1Y4O A;  2WGI A;  1CJF A;  3D72 A;  4Y0O A;  1XJ2 A;  3VP4 A;  2BTF P;  3N8R A;  3R4K A;  3TSG A;  5CRF A;  1Y28 A;  2XF3 A;  4FSF A;  4KQD A;  4GB7 A;  4PMA A;  4FD8 A;  1BLH A;  1DJA A;  1MKI A;  4NKP A;  4LV3 A;  3LIB A;  2WKQ A;  3RXX A;  4MNR A;  2ACG A;  3BFF A;  3UE3 A;  4WUJ A;  5TGF A;  2JCH A;  3IF6 B;  5F1G A;  4LEN A;  3DAV A;  4Q8I A;  4GHI A;  2JKF A;  1O07 A;  3WS2 A;  3GDI A;  2H28 A;  3HUM A;  3LI8 A;  4NK3 A;  1YLW A;  3IXG A;  1IEM A;  1ZHH B;  2HGV A;  2Z6D A;  2V0W A;  1BUL A;  3A0S A;  5GHY A;  1Q2Q A;  1MWR A;  5G18 A;  4P6Z S;  3DWZ A;  4K08 A;  4GDB A;  2HP9 A;  1YPR A;  1YSP A;  5AQA A;  2ZL1 B;  2HV1 A;  2V2F F;  4M3K A;  3IX8 A;  1YLJ A;  1T18 A;  1ZG6 A;  3IH8 A;  1H8Y A;  4Y13 A;  1VET A;  4HI4 A;  1NLY A;  3D4F A;  3NHQ A;  3L9K A;  3EOI A;  5GHZ A;  2KX6 A;  1GHM A;  1XGI A;  2PHY A;  1I5Q A;  3IS2 B;  4EW7 A;  3TE8 A;  1YLT A;  2W3D A;  2WUQ A;  5CXW A;  1VQQ A;  4KQO A;  5FQM A;  2WKI A;  1W63 Q;  2PDR A;  2VGJ A;  4S2M A;  3W4P A;  2JKG A;  4BEN A;  3UMD A;  4ZJ3 A;  3NUL A;  3E4Q A;  5TFQ A;  2V8C A;  5TBM A;  3LEZ A;  4N1H A;  1Z09 A;  2UWX A;  2O9C A;  5AJG A;  4OON A;  3G32 A;  4JF5 A;  1CK3 A;  4E6W A;  5HAP A;  1UWP X;  3DTI A;  2VZW A;  4I5S A;  3M6B A;  1RGY A;  4BD0 A;  3ZVT A;  3DTK A;  3LIC A;  2KLI A;  1QMF A;  3BLM A;  4KZ3 A;  4KUO A;  1FCM A;  3PTE A;  4WL9 A;  5IS1 A;  1N9L A;  3ULF A;  5A90 A;  2Y2G A;  2B18 A;  3G34 A;  4R0Q A;  4II7 A;  4YOF A;  2V0U A;  5HZH A;  1LHY A;  1CI9 A;  3OLO A;  5U47 A;  4E3K A;  1L2S A;  2KOI A;  2QWS A;  5HW3 A;  3VOZ A;  3K3C A;  1E3U D;  4A5R A;  2HP6 A;  3O3V A;  5FQQ A;  4XT2 B;  3PAE A;  4GLQ A;  4DE0 A;  3EGX C;  3UB7 A;  3UDF A;  3V50 A;  4GOG A;  3VP3 A;  4LCM A;  1Y54 A;  3UPO A;  2B95 A;  4ZBE A;  3VOL A;  1FCN A;  1L0D A;  2C6W B;  5CTM A;  2VV6 A;  3T1X A;  1I2S A;  5HDS A;  1ACF A;  2PD8 A;  1J9M A;  4KZ6 A;  3B47 A;  2J9O A;  5HWV A;  1YSQ A;  2H0T A;  2JKT M;  5HFO A;  3QP5 A;  2EFU A;  2Y2P A;  3KSF A;  1DP8 A;  3MXQ A;  1DJB A;  4CLC E;  3HJK A;  3JPU A;  4RQ9 A;  2DNS A;  3LEQ A;  4EQI A;  4E3L A;  3V39 A;  5CHM A;  1K56 A;  4S2O A;  1IYO A;  2PYP A;  1IKI A;  3SH7 A;  2R9W A;  4HBT A;  3OPL A;  2VV8 A;  3G31 A;  3KYE A;  5HAI A;  4OQ0 A;  1NY0 A;  1M6K A;  3IXH A;  4O0P A;  3UB5 P;  3C7U A;  1VEU B;  4MCW A;  4PKY A;  1E4D A;  2W27 A;  5L07 A;  4KG6 A;  3UDX A;  2PT7 A;  4KZA A;  4RA7 A;  3HLF A;  1A0K A;  4R38 A;  4P87 A;  4Y5F A;  2Y79 A;  2HJE A;  2X02 A;  4R23 A;  5EPH A;  1YLY A;  3WRZ A;  4HH3 A;  3C2W A;  3LIE A;  3MZE A;  2V1B A;  2JN7 A;  4DMZ A;  2Y2K A;  4KZ9 A;  1K57 C;  3NOU C;  3F1P A;  2XH9 A;  2ZLY A;  5HX9 A;  1K57 A;  3S7Q A;  2ZQD A;  4E04 A;  1W79 A;  1T1C A;  4E3M A;  2ZD8 A;  3EWK A;  1SCW A;  3RTY A;  3ZVW A;  3NY4 A;  3ZNY A;  2QYB A;  5BOH A;  1E3U A;  5DKL A;  1KDW A;  2L0W A;  4I3I A;  1LI0 A;  3Q7V A;  3IWQ A;  4EUV A;  3SH8 A;  4EU0 A;  3SS3 A;  2OAP 1;  3LR3 A;  4MLL A;  3QNC A;  4KZ4 A;  4RX2 A;  4Z9Q A;  1XX2 A;  1U60 A;  3IBR A;  5FDH A;  2P9V A;  1P9W A;  3GMW A;  3HBR A;  1O7E A;  2V1Z A;  2PAV P;  2A2L A;  5EOE A;  4KG2 A;  2QKP A;  4HHD A;  2HDS A;  4PAU A;  4IHQ A;  1OJ5 A;  4X6T A;  2PBY A;  3T4S A;  4MBF A;  4N92 A;  3T4O A;  1FOF A;  5EVE A;  4CLC C;  3AGF A;  1L0G A;  3BFD A;  2QPN A;  3IQA A;  3NIA A;  3B33 A;  4CLC A;  5D3O A;  4L9E A;  4Y15 A;  1KDS A;  4ZJ2 A;  5AVF A;  1F98 A;  1BLS A;  3OZH A;  4XUZ A;  1ZTU A;  5HDC A;  3A3J A;  4MN7 A;  5HPF A;  3VE3 A;  3T12 B;  3C8C A;  2Z2L B;  1S1Z A;  4NXF A;  3T4K A;  3I7J A;  4P0M A;  3F1O B;  5FI7 A;  3IBJ A;  3QP4 A;  5DF7 A;  3D3O A;  1FIL A;  3V67 A;  3NOT C;  4MEZ A;  2J3T C;  1ES5 A;  1E25 A;  4R4R A;  1YT4 A;  5E2F A;  4KUK A;  2VGL M;  1DP6 A;  1PWD A;  2WKE A;  3BWL A;  4L9F A;  5DFY A;  5HAR A;  1OTI A;  2QJ5 A;  2IWB A;  1CEF A;  3OPR A;  2BAS A;  1S6R A;  4KZ8 A;  4OH0 A;  5EV0 A;  1AXB A;  2O9B A;  1ZC2 A;  5DF8 A;  1ONG A;  2AVX A;  3FV7 A;  3MFD A;  3PYP A;  2QHK A;  3E0Y A;  1ES4 A;  1Q2P A;  3ZG9 B;  5CEC A;  3N7W A;  5EM1 A;  2P08 A;  4MBH A;  1JWP A;  1BLP A;  4KZB A;  1OT6 A;  5L09 A;  1XJ6 A;  1GHI A;  2GNX A;  1YLP A;  2EWV A;  1K6S A; 
#chains in the Genus database with same CATH homology
 1FR1 A;  1KGG A;  4Q8I A;  1XA1 A;  1O07 A;  3HUO A;  3WS2 A;  4EV4 A;  1GA9 A;  3CG5 A;  3HUM A;  4BQM A;  2XQZ A;  4B4X A;  2Y91 A;  3GSG A;  4NK3 A;  3N8L A;  3UDI A;  1YLW A;  3IXG A;  3ZG5 A;  1IEM A;  3P09 A;  4S2I A;  3UNW A;  1PI5 A;  4WBG A;  5DTT A;  4OP8 A;  1BUL A;  3C4P A;  2WAD A;  5GHY A;  1GA0 A;  1KGE A;  1Q2Q A;  4IVI A;  1GCE A;  5GLC A;  1MWR A;  4DRT A;  2J7V A;  5G18 A;  4DE1 A;  2G2W A;  3DWZ A;  3MKF A;  1MWS A;  1SDE A;  1ERM A;  4GDB A;  2HP9 A;  1MXO A;  2C5W B;  5AQA A;  5M18 A;  2V2F F;  3G30 A;  4M3K A;  5EOO A;  4EWF A;  1W8Y A;  4OQI A;  3IXD A;  5GL9 A;  1YLJ A;  3MXR A;  2WYX A;  3IH8 A;  1ZG6 A;  1H8Y A;  4JXW A;  2WGV A;  5EVI A;  5EVI B;  1NYM A;  3ZNT A;  5EE8 A;  3WWX A;  3D4F A;  1M40 A;  3BFG A;  4CPK A;  2RL3 A;  4PM5 A;  3NCK A;  5GHZ A;  1GHM A;  5I94 A;  4OKP A;  1XGI A;  4JF4 A;  1I5Q A;  3MZD A;  5FAS A;  3WS1 A;  3FWL A;  5JYO A;  2EX2 A;  2V20 A;  1YLT A;  2EFX A;  1IYS A;  2WUQ A;  5CXW A;  1TVF A;  3LCE A;  1JVJ A;  1VQQ A;  4FH4 A;  4KQO A;  1S0W A;  5DTS A;  4C75 A;  5FQM A;  4NET A;  2Q9M A;  5GHX A;  2WKI A;  4R3B A;  4CJN A;  1KVL A;  2OLV A;  2VGJ A;  4BJP A;  4S2M A;  3W4P A;  1G6A A;  2Y2M A;  4OOM A;  4BEN A;  3HL9 A;  2ZC6 B;  2WZX A;  1K55 C;  2EX6 A;  5FI2 A;  4K0W A;  1KE4 A;  4LCL A;  5GLB A;  4N9L A;  4ZJ3 A;  3S22 A;  4IBR A;  5CGS A;  5TFQ A;  3G2Y A;  3HLC A;  1YLZ A;  3OCN A;  1BTL A;  3AGE A;  4JXG A;  4S2L A;  5FAT A;  3LEZ A;  1K55 A;  1MPL A;  4N1H A;  2HDR A;  2UWX A;  4EUZ A;  4OON A;  4B88 A;  3G32 A;  4JF5 A;  1L0F A;  1ERO A;  2J9P A;  1NZU A;  5KZH A;  1CK3 A;  4E6W A;  5HAP A;  3A3F A;  1YM1 A;  3S1Y A;  2OSU A;  1MBL A;  1RP5 A;  4PM6 A;  4GN2 A;  4GKU A;  1ES2 A;  5EVL A;  4QB8 A;  2XLN A;  3M6B A;  4DE2 A;  4QJG A;  1HZO A;  1RGY A;  1XPB A;  1IYP A;  1SKF A;  3ITB A;  3OCL A;  4L0L A;  3ZVT A;  1VM1 A;  4BD0 A;  4WEL A;  1QMF A;  3BLM A;  5DTK A;  3HRE A;  4WMC D;  3VMA A;  4KZ3 A;  1JTD A;  1FCM A;  1H5X A;  3PTE A;  5KSH A;  1QME A;  5A90 A;  2Y2G A;  3AGD A;  4QY5 A;  3G34 A;  3NDG A;  4R0Q A;  4U0X A;  3VSL A;  4DDS A;  4OLD A;  4WZ4 A;  2J8Y A;  3E2K A;  3UPP A;  1HVB A;  5E2H A;  1LHY A;  1CI9 A;  4R3J A;  2XR0 A;  1ALQ A;  3V5M A;  1OME A;  5U47 A;  4E3K A;  1KGF A;  4ZTK A;  5A93 A;  5FI6 A;  1L2S A;  4XUX A;  5DF9 A;  3TOI A;  2EX8 A;  2HDU A;  3S4X A;  2Y59 A;  1FR6 A;  4F94 A;  4UA7 A;  3A3I A;  3HVF A;  5HAQ A;  3IF6 C;  1JWV A;  1PI4 A;  1MY8 A;  4DF6 A;  4U0T A;  4IBX A;  3VOZ A;  1BLC A;  5HW3 A;  2JC7 A;  3QNB A;  4KEN B;  4E6X A;  3N6I A;  4A5R A;  1E3U D;  2ZC4 B;  2HP6 A;  3O3V A;  4KG5 A;  1W8Q A;  5FQQ A;  3IF6 A;  3PAE A;  4DE0 A;  3QHY A;  3NI9 A;  3RXW A;  3UDF A;  2H0Y A;  3V50 A;  5CHJ A;  4GOG A;  1JWZ A;  4LCM A;  3VP3 A;  1Y54 A;  4FCF A;  4S2P A;  3UPO A;  3A3E A;  3M2J A;  2ZMA A;  3HLG A;  2WGW A;  2WGW B;  4ZBE A;  2OV5 A;  2H10 A;  3O86 A;  3M2K A;  5FAO A;  1FCN A;  1L0D A;  3HLW A;  2C6W B;  4RX3 A;  5CTM A;  4EBL A;  3W8K A;  2Y2J A;  4K91 A;  4U3T A;  3Q7V B;  1I2S A;  3RJU A;  3FKV A;  5CGW A;  4E3O A;  2Y2L A;  4Y0T A;  3Q1F A;  3EQV A;  1BT5 A;  1ES3 A;  5EUA A;  1J9M A;  1ZKJ A;  1N4O A;  1WYB A;  4KZ6 A;  3BRM A;  2J9O A;  3WS0 A;  1G68 A;  3HLD A;  2H0T A;  2I72 A;  4KZ7 A;  4R1G A;  3V3S A;  1N9B A;  5HFO A;  2P9V B;  3LY3 A;  5EVI C;  1IKG A;  1XXM A;  4KZ5 A;  2EFU A;  1XKZ A;  1ZG4 A;  2Y2P A;  2XEP A;  3BEC A;  4N1X A;  4OP5 A;  5TR7 A;  3ZG7 B;  3UE1 A;  5DVA A;  4P85 A;  1ONH A;  1DJB A;  1K6R A;  3EQU A;  2DNS A;  4IVK A;  1TEM A;  5FQK A;  4YFM A;  4EQI A;  4E3L A;  5KMW A;  3O87 A;  2PU4 A;  4FH2 A;  3V39 A;  4GD8 A;  4JXS A;  5CHM A;  1K56 A;  3ZG8 B;  5J8X A;  3LY4 A;  4HES A;  4QY6 A;  5F83 A;  4S2O A;  1IYO A;  1IKI A;  5A92 A;  3GVB A;  3SH7 A;  2R9W A;  4HBT A;  1FCO A;  4Y0U A;  3OPL A;  2Q9N A;  2RCX A;  4BD1 A;  5M19 A;  3G31 A;  1MWT A;  2CC1 A;  4MBK A;  4BLM A;  3GTC A;  3ZFZ A;  5F1F A;  2BG1 A;  3BYD A;  5HAI A;  5E2G A;  4EBN A;  1EI5 A;  4OQ0 A;  1NY0 A;  3FYZ A;  4BL3 A;  1WYC A;  3C5A A;  5M1A A;  1XGJ A;  4OPZ A;  3IH9 A;  1M6K A;  3IXH A;  3C7U A;  2GDN A;  4OQG A;  4OPY A;  3WS4 A;  3LO7 A;  2P74 A;  2HDQ A;  4JPM A;  4ZDX A;  1K38 A;  3IT9 A;  1NRF A;  3O88 A;  2XD5 A;  1E4D A;  2WZZ A;  1K54 C;  4RYE A;  1BSG A;  3ZDJ A;  4OLG A;  3IWI A;  4KG6 A;  3IHA A;  1IEL A;  1PYY A;  1K54 A;  4X55 A;  1Z6F A;  3BFC A;  3UDX A;  2Y2I A;  4LV2 A;  3TG9 A;  4KZA A;  4RA7 A;  3M6H A;  4HEF A;  2EXB A;  3HLF A;  2Y55 A;  4DXC A;  4P87 A;  4GDN A;  3SH9 A;  2XGN A;  2X02 A;  2ZC5 B;  4OOL A;  4R23 A;  5EPH A;  1YLY A;  2BLS A;  3WRZ A;  2ZC3 B;  5JYP A;  3MZF A;  3BEB A;  1BUE A;  2XD1 A;  3MZE A;  2ZM2 A;  3JYI A;  4X69 A;  3UPN A;  1LL9 A;  2Y2K A;  2JBF A;  1K57 C;  4H8R A;  4KZ9 A;  4WEK A;  3UN7 A;  4DE3 A;  3CZD A;  1FSW A;  4GZB A;  2XH9 A;  4EBP A;  1H8Z A;  2ZLY A;  3CJM A;  1YMS A;  5HX9 A;  5CGX A;  3SS4 A;  1K57 A;  1FSY A;  1YQS A;  2ZQD A;  1W79 A;  4E3M A;  5HL1 A;  2ZD8 A;  1SCW A;  2H5S A;  3IHB A;  4UHU A;  4KQQ A;  3WRT A;  3IWO A;  1PW8 A;  4OOY A;  3WS5 A;  2HPB A;  5FQJ A;  5E43 A;  3ZVW A;  3Q07 A;  3NY4 A;  4X56 A;  3MKE A;  2PU2 A;  4E3N A;  2QZ6 A;  1EWZ A;  3NC8 A;  2FFF B;  3ZNY A;  3NBL A;  2XDM A;  2DCF A;  4P6B A;  5GLD A;  5BOH A;  3DTM A;  1E3U A;  4JLF A;  1NYY A;  1KDW A;  2EX9 A;  5F82 A;  3OC2 A;  1L0E A;  3BFE A;  4WEJ A;  4N9K A;  1LI0 A;  2JE5 A;  3Q7V A;  3G4P A;  4XXR A;  5CTN A;  1K4E A;  5CER A;  3IWQ A;  4PM7 A;  3SH8 A;  2FFY A;  4JF6 A;  4PPR A;  1MWU A;  1K25 A;  1XP4 A;  3NDE A;  2A3U A;  1LLB A;  1JTG A;  4GD6 A;  3SS3 A;  3VFH A;  4MLL A;  3QNC A;  4X68 A;  3MBZ A;  4KZ4 A;  4ZJ1 A;  4WM9 A;  4RX2 A;  4YIN A;  4K0X A;  5IHV A;  4Z9Q A;  3PBS A;  1XX2 A;  1U60 A;  5FDH A;  2P9V A;  5AQ9 A;  4LEN A;  3ZCZ A;  3Q7Z A;  2EXA A;  3SS5 A;  4DDY A;  3GMW A;  4JKT A;  1ESU A;  4S2N C;  3HBR A;  4ZAM A;  1PWC A;  4IED A;  1O7E A;  2WAF A;  2ZQ7 A;  2V1Z A;  4PM9 A;  3VSK A;  3VFF A;  5A91 A;  1FQG A;  2ZQ9 A;  4S2J A;  5FSR A;  2Z2M B;  3P98 A;  5EOE A;  4KG2 A;  5FA7 A;  4S2N A;  5E2E A;  1PZO A;  3W4O A;  3C4O A;  1IYQ A;  4O7D A;  4DXB A;  1W5D A;  3ZG0 A;  4GNU A;  2HDS A;  4KQR A;  2Y2H A;  5EVI D;  4WZ5 C;  4JXV A;  3FZC A;  4DKI A;  4X6T A;  2R9X A;  3ZHH A;  1XA7 A;  3OPP A;  1WE4 A;  2PBY A;  1PIO A;  4MBF A;  3MXS A;  4N92 A;  2ZJ9 A;  1GHP A;  2ZQC A;  3PAG A;  2X71 A;  4LV1 A;  4ID4 A;  4WZ5 A;  1FOF A;  1LI9 A;  1PW1 A;  3GQZ A;  2Y2O A;  4PM8 A;  1K56 D;  1C3B A;  3AGF A;  3PBR A;  1PZP A;  1L0G A;  4C3Q A;  3PBN A;  5AQB A;  3BFD A;  1K4F A;  1KVM A;  1LL5 A;  2QPN A;  3IQA A;  3NIA A;  2XFT A;  5CED A;  1ERQ A;  1NXY A;  5D3O A;  3ZGA B;  1KDS A;  5FQ9 A;  4ZJ2 A;  1TDL A;  3ITA A;  3SOI A;  2WKH A;  1BLS A;  2DRW A;  4UA9 A;  3OZH A;  3PBO A;  2B5R A;  4XUZ A;  4Y7P A;  4WYY A;  2OLU A;  1W7F A;  5FQI A;  3A3J A;  4E3J A;  3UY6 A;  3PBT A;  2ZM0 A;  2WK0 A;  2A49 A;  2E8I A;  3V3R A;  3FKW A;  2XK1 A;  3DW0 A;  1TDG A;  3HLE A;  1CEG A;  2Z2L B;  3UO9 A;  4UAA A;  3VOY A;  1RGZ A;  5FAP A;  2HP5 A;  2Y4A A;  3IXB A;  5FAQ A;  3I7J A;  2XFS A;  4LV0 A;  1SDN A;  4P0M A;  4BL2 A;  5FI7 A;  4UA6 A;  3IF5 A;  3BM6 A;  5GLA A;  2Y2N A;  5DF7 A;  4R4S A;  1HD8 A;  3W4Q A;  4B4Z A;  1DJC A;  4C6Y A;  1ESI A;  3Q82 A;  2ZM8 A;  1BZA A;  2ZQA A;  1DY6 A;  3HLB A;  4X53 A;  2QMI A;  4MEZ A;  3VP1 A;  1NZO A;  2Y2Q A;  3VP0 A;  1ES5 A;  1E25 A;  4S2K A;  4R4R A;  1YT4 A;  4HBU A;  1HTZ A;  5E2F A;  4WMC A;  3Q81 A;  3UE0 A;  5CHU A;  3HUN A;  1KE3 A;  1PWD A;  3CMZ A;  2WKE A;  4QU3 A;  1PWG A;  5EEC A;  3N4I A;  5HAR A;  2WGI A;  3C7V A;  3DWK A;  2IWC A;  5KSC A;  1YMX A;  1CEF A;  2IWB A;  4Y0O A;  4QHC A;  3OPR A;  4OPR A;  5CEB A;  3VP2 A;  3GV9 A;  1S6R A;  4KZ8 A;  4OH0 A;  4OQH A;  2ZQ8 A;  1I2W A;  3G35 A;  3VP4 A;  1AXB A;  3B3X A;  1ZC2 A;  5DF8 A;  3N8R A;  3TSG A;  1ONG A;  1SHV A;  2VGK A;  2X01 A;  5CRF A;  2XF3 A;  3FV7 A;  3MFD A;  4FSF A;  2ZC7 A;  3PBQ A;  4GB7 A;  4OPQ A;  5L2F A;  4PMA A;  1ES4 A;  3GRJ A;  4FD8 A;  1BLH A;  1DJA A;  1MKI A;  1Q2P A;  3ZG9 B;  3ISG A;  5CEC A;  4JBF A;  4LV3 A;  4E3I A;  3N7W A;  3RXX A;  4D2O A;  4RVA A;  2WAE A;  1CI8 A;  3G2Z A;  3BLS A;  5AQ7 A;  4MNR A;  1JWP A;  3BFF A;  3GR2 A;  1BLP A;  2G2U A;  3N8S A;  3A3D A;  4KZB A;  3OPH A;  4MBH A;  4OVD A;  4QD4 A;  5TGF A;  2JCH A;  3UE3 A;  2IWD A;  1KE0 A;  3E2L A;  3IF6 B;  1GHI A;  1YLP A;  5F1G A;  1RCJ A;  1NJ4 A;  1K6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...