4PMAA

Crystal structure of ctx-m-14 s70g:s237a:r276a beta-lactamase at 1.39 angstroms resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGAGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRADVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-14
publication title Molecular Basis for the Catalytic Specificity of the CTX-M Extended-Spectrum beta-Lactamases.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Hydrolase
total genus 93
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4pmaA00
1BLSA 5A92A 2WKIA 4XUZA 1FSWA 3GMWA 1YQSA 1SHVA 4K91A 5CTMA 2Y91A 5DF7A 4N9KA 3V50A 1FCNA 1NZUA 3Q7ZA 1YLPA 4UAAA 1WYBA 4QU3A 3ZG7B 3E2LA 3UDIA 3ZG5A 2V1ZA 3GV9A 3HREA 4JF6A 3S4XA 1ESIA 4EBLA 1JWZA 4KQQA 5HFOA 5DF9A 3WS2A 1YLTA 3UO9A 5KSCA 3SS3A 4X56A 1HTZA 3MZFA 4FSFA 4LV3A 2FFYA 3FZCA 3FV7A 3TSGA 1ZKJA 4E6XA 1G6AA 1IEMA 1S0WA 4S2JA 4NETA 1BUEA 3N6IA 1BSGA 3ZNYA 3A3EA 3MXSA 3NI9A 3P09A 1KVLA 4DE2A 4DXBA 2HDUA 2ZQCA 3VFHA 3UE3A 3BFGA 2Y2KA 1TEMA 4E3MA 3G30A 3VSKA 4QY5A 3TOIA 2ZQ8A 1DY6A 4IVIA 3O87A 3B3XA 4BENA 2OLUA 3TG9A 1DJAA 2Z2LB 3OCNA 1CI8A 1MWSA 1KE3A 1GHMA 2VGJA 3ZVWA 3VP1A 2WGIA 2IWCA 4N9LA 1S6RA 1G68A 1FCMA 1NZOA 4DE3A 5J8XA 3VP3A 3IWOA 4IVKA 1YLZA 1L2SA 4K0WA 2V2FF 1KE4A 1FOFA 1ERMA 2HDSA 2FFFB 3WRZA 3SS4A 3AGEA 4JXGA 3N8LA 2HDRA 1IELA 2P9VA 1MWTA 3C4OA 4S2NA 5HX9A 2BLSA 2GDNA 1YM1A 1BULA 1U60A 4FD8A 4JKTA 1SDEA 4S2PA 5E2HA 1NXYA 1PZOA 3GVBA 2XFTA 1IYSA 4BL2A 3BRMA 1C3BA 3HLGA 5DTSA 2Y2HA 4N1XA 4X55A 4HBUA 5F1GA 4B4ZA 1TDLA 4Y0UA 4MBFA 1WYCA 5EVLA 4Y0TA 4GDNA 2Y4AA 3C7VA 5CECA 2PBYA 4U0TA 4O7DA 3W4OA 1N9BA 5GHXA 4B88A 4QD4A 4P6BA 4UHUA 2ZC5B 2DRWA 4CJNA 1E4DA 3ZDJA 1YLJA 2Z2MB 2H0YA 4OOYA 1IKIA 1RCJA 3IHBA 2WYXA 1W5DA 4OPYA 4HBTA 5CERA 1K55A 3CJMA 4DDYA 1XA1A 5AQ9A 2XDMA 1PI5A 1WE4A 5IHVA 2IWBA 3ZG8B 4GDBA 4OP5A 4EV4A 1Q2QA 5CHMA 2X71A 1ESUA 1BLPA 3HUMA 4A5RA 3BFFA 3QHYA 4S2NC 4QY6A 1ES2A 4NK3A 3RXXA 4B4XA 1XA7A 4JBFA 2B5RA 1MKIA 3ZCZA 5DTKA 3BLSA 1ES3A 3NCKA 4C3QA 4EBNA 3O3VA 5EVID 2ZM2A 1IYQA 3G34A 3G35A 4OQ0A 4DF6A 1XGJA 3QNBA 4UA6A 3GTCA 4KZ5A 1KDSA 1IKGA 3HLBA 4WM9A 4IEDA 1IYPA 1XPBA 1KGEA 4MEZA 5FDHA 2ZM8A 5GHZA 1K25A 2Q9MA 1FR6A 4IBXA 5FSRA 5G18A 2E8IA 4LCMA 3VP0A 5FQKA 4WELA 4PPRA 3S22A 1ZC2A 4R3BA 3WS1A 2J7VA 5HAIA 4C6YA 1K55C 4HEFA 4DDSA 4CPKA 3GR2A 3M6HA 1K6RA 3MZDA 4LV1A 4ZDXA 1CK3A 3IWIA 1GA9A 4GD6A 4UA9A 3ZVTA 4E3OA 2IWDA 4KZ3A 3MZEA 3ZGAB 2H10A 3IH9A 2P74A 3HLDA 4MNRA 1YLYA 4U3TA 4PM7A 2HP5A 3LY4A 3LCEA 1K4EA 3G31A 3ZG9B 3S1YA 3GSGA 1PW8A 5M1AA 3BFCA 1FCOA 1H8YA 1XGIA 3IXHA 1SCWA 5JYOA 3BFEA 2Y2JA 5CGWA 3A3IA 3O88A 4KZ8A 2J9OA 3A3JA 3CMZA 3LO7A 4QB8A 4E3KA 3DWZA 1L0FA 3G2YA 3LY3A 1KGFA 3NBLA 3CZDA 4N1HA 4N92A 5FATA 4S2MA 5A91A 3NY4A 2A3UA 5FQIA 3WS5A 3A3FA 4EWFA 4R3JA 4WEJA 5FQQA 3VMAA 5HAQA 5F83A 5GL9A 1KGGA 1CEGA 4OQGA 2JC7A 3NIAA 5CHUA 3OC2A 3OPRA 5FASA 2Y2QA 3AGFA 1JWPA 2HPBA 5EE8A 3Q1FA 3SOIA 3VSLA 4LCLA 3W4PA 4FH2A 2ZQ9A 2X01A 4C75A 4Q8IA 4FH4A 2WZZA 4DKIA 2QMIA 4U0XA 1GA0A 4JXSA 5HARA 2XK1A 1H5XA 1JWVA 1PWCA 3I7JA 5GLCA 2HDQA 3V39A 4BLMA 3VP4A 5CGSA 2ZC7A 1LL9A 5FAQA 4OP8A 1W7FA 3CG5A 3Q7VA 2Y2IA 1YMSA 5KZHA 4OOLA 3HVFA 2EX8A 2Y2PA 3HLEA 3PBNA 4M3KA 5HL1A 3WRTA 1K4FA 2RCXA 1FSYA 2OV5A 4JLFA 3W4QA 1KVMA 4GNUA 4DE1A 4ZJ1A 2P9VB 1ES4A 4OH0A 3EQVA 5CHJA 2EFXA 4KQRA 2C5WB 4WZ5A 3ITBA 4GZBA 4PM5A 4KZ4A 2WKHA 4BD0A 4KENB 2EX9A 4E3NA 4E6WA 4MBKA 2Y2MA 4EUZA 2XQZA 3HLFA 3RJUA 2XD5A 1LI0A 4KZ7A 3Q07A 5FAPA 4Y0OA 1L0GA 4R1GA 5DTTA 3D4FA 2XH9A 2XF3A 4WMCD 5AQ7A 3UDXA 2I72A 4GB7A 5A93A 5FQMA 3UPPA 5TFQA 5FI7A 4R4SA 3DWKA 1NRFA 2J9PA 2ZD8A 4WEKA 5E2EA 4DRTA 5BOHA 4JF5A 1SKFA 1RGZA 2PU2A 2Y2LA 4OQHA 5HW3A 4D2OA 1L0DA 4WZ4A 1EROA 4PM8A 3V5MA 1Z6FA 2WKEA 1E3UD 3HUOA 3NDGA 5HAPA 5KSHA 4X69A 5FQJA 3UN7A 1IYOA 2Y2OA 4WYYA 3C7UA 5EOEA 2C6WB 1OMEA 5EECA 1I2WA 5EOOA 4P87A 5I94A 2EXAA 4OPQA 1HD8A 4JXWA 3PAGA 4WZ5C 5EVIA 4ZJ3A 3BM6A 2ZC6B 1MWUA 2WGWA 3N8RA 5CTNA 4YINA 1PI4A 5D3OA 3VFFA 2Y2NA 2ZLYA 2XLNA 4UA7A 1K54A 2Y2GA 4S2LA 3ZNTA 5CEBA 2Y59A 3IF6A 3G2ZA 4GN2A 4OLDA 2X02A 2WGVA 3BYDA 1NYMA 4ZJ2A 5U47A 2JCHA 2EX6A 1PWGA 1JTGA 3UPNA 1BLHA 5GLAA 1QMFA 3FKWA 3OPLA 3IXBA 4MLLA 2V20A 4MBHA 2ZMAA 2RL3A 1LLBA 4DXCA 3PAEA 3WWXA 1MY8A 5CXWA 3PBTA 1BZAA 3OCLA 2XGNA 1DJCA 1K56D 3P98A 4BJPA 2EX2A 3HLCA 1BT5A 3V3SA 1TVFA 4P85A 3PBOA 3HL9A 3ZG0A 3W8KA 2ZQ7A 4EQIA 3DW0A 3Q82A 3EQUA 3IXDA 5EVIC 5FA7A 3GQZA 5M19A 1ERQA 4HESA 1K54C 4S2KA 2ZC3B 3ZFZA 1H8ZA 2OLVA 2ZQDA 3IF6C 1MWRA 2JBFA 1M40A 3IXGA 3MXRA 5CGXA 2H5SA 3UNWA 4PM9A 4YFMA 4RA7A 1AXBA 3UY6A 2ZM0A 1SDNA 3BLMA 4GD8A 2WZXA 3SH8A 4XXRA 4EBPA 4KG2A 3C5AA 4RYEA 4F94A 3DTMA 5DVAA 3MFDA 2H0TA 5FQ9A 2WUQA 3FWLA 4KG6A 1ZG6A 4GKUA 1NY0A 4E3JA 5FAOA 1FQGA 3BECA 1LL5A 1E25A 1XXMA 4IBRA 1MBLA 1N4OA 4FCFA 1GCEA 3FYZA 1K57A 3G32A 2R9WA 4R4RA 4DE0A 3HBRA 2JE5A 4LV0A 4XUXA 3PBRA 5F82A 5E2FA 4QJGA 1O07A 1ALQA 2Y55A 3BEBA 4QHCA 4L0LA 1HZOA 3C4PA 4H8RA 2VGKA 4ZTKA 4R23A 4JF4A 2ZJ9A 3Q81A 3VOYA 4X53A 3E2KA 1DJBA 1YLWA 2ZQAA 3G4PA 3ISGA 4RX2A 2DCFA 2ZC4B 4OKPA 1LI9A 4RX3A 2J8YA 4ID4A 3Q7VB 3N8SA 1HVBA 3PBQA 4KZ9A 2WK0A 3O86A 5FI2A 5FI6A 2QZ6A 3N4IA 1LHYA 5GLDA 3WS0A 3ZHHA 4OLGA 3N7WA 5M18A 1VQQA 5TR7A 2CC1A 3ITAA 3UE1A 1CI9A 2XEPA 4R0QA 4BQMA 2BG1A 1EI5A 1I5QA 3HUNA 3IT9A 5EUAA 3VP2A 1QMEA 3NC8A 1I2SA 1W79A 3LEZA 1K57C 2EXBA 2EFUA 3M2JA 3VOZA 4OOMA 5GLBA 4E3IA 4WBGA 4Y7PA 1JVJA 3MKEA 1PZPA 5DF8A 4E3LA 1BLCA 4S2OA 4WMCA 1J9MA 2UWXA 2XFSA 1Y54A 5E2GA 2DNSA 4OVDA 2WADA 4K0XA 3BFDA 4OPZA 3RXWA 4PM6A 5CEDA 1K6SA 2A49A 3NDEA 5L2FA 3SH7A 1TDGA 4Z9QA 1RGYA 1CEFA 1KDWA 3M6BA 5E43A 5TGFA 3UDFA 1KE0A 1ONHA 3IF5A 1PW1A 1JTDA 4KZ6A 3A3DA 1E3UA 1PYYA 3UPOA 1NJ4A 2OSUA 2QPNA 4ZBEA 3SH9A 4BL3A 5F1FA 1K38A 1YT4A 2HP9A 3PBSA 4X6TA 1ZG4A 1FR1A 3GRJA 1W8QA 4KZAA 5A90A 5AQBA 1XP4A 1MPLA 1Q2PA 3JYIA 3M2KA 1EWZA 1XKZA 3OPHA 4P0MA 4S2IA 2XR0A 2Q9NA 5EVIB 2WAEA 3PTEA 3SS5A 2WGWB 3IH8A 1PWDA 2WAFA 1ONGA 3FKVA 4OONA 1L0EA 4JXVA 4JPMA 5AQAA 4BD1A 4KQOA 3IF6B 3IQAA 1XX2A 3V3RA 4KZBA 5EPHA 3OPPA 4GOGA 3OZHA 4KG5A 2HP6A 1W8YA 4LENA 4RVAA 2G2UA 1ES5A 3IHAA 4PMAA 2XD1A 5CRFA 5KMWA 4LV2A 4ZAMA 1RP5A 1GHIA 3HLWA 5JYPA 2R9XA 1K56A 1O7EA 3AGDA 4OPRA 1M6KA 1YMXA 1MXOA 1PIOA 4OQIA 1NYYA 3MBZA 3WS4A 4X68A 1GHPA 5GHYA 3QNCA 2G2WA 3IWQA 1BTLA 3MKFA 3UE0A 2PU4A 1VM1A
chains in the Genus database with same CATH superfamily
1ACFA 1FSWA 4GS9B 2ZL1A 5DF7A 3V50A 1FCNA 1S67L 1MKMA 4UAAA 2XSSA 3E2LA 3T4SA 1ESIA 5HFOA 5DF9A 3WS2A 2O99A 3UO9A 5KSCA 1HTZA 3MZFA 3IBRA 4UEYA 3FV7A 1K0KA 3TSGA 1IEMA 1S0WA 1BSGA 3A3EA 3P09A 3NI9A 3EOIA 3VSKA 4O01A 4IVIA 3TG9A 3ZVWA 2IWCA 4N9LA 1FCMA 5J8XA 5HD5A 3VP3A 2PHYA 1YLZA 1L2SA 1ERMA 2D02A 5F68A 4PAUA 1MWTA 4S2NA 4YNRA 3EWKA 1U60A 1SDEA 2XFTA 1C3BA 5DTSA 3NOPC 5F1GA 4B4ZA 4MBFA 1W63Q 3F1NB 3F1PA 4GDNA 3C7VA 4P6ZS 2PBYA 4U0TA 4B88A 4QD4A 2ZC5B 4WN5A 4OOYA 1IKIA 3IHBA 4OPYA 3S7NA 4HBTA 3TW8A 1XA1A 1STZA 5AQ9A 1PI5A 5IHVA 4Y17A 4OP5A 5CHMA 1BLPA 3HUMA 3T12B 3BFFA 4S2NC 4MN6A 4QY6A 2VEAA 4B4XA 1XA7A 4C3QA 4EBNA 3MSHA 4GHIA 5EVID 2ZM2A 1IYQA 3G34A 4BMWA 4DF6A 1KDSA 3UB7A 2QWSA 1FIKA 5GHZA 2ZM8A 3VE4A 2Q9MA 4IBXA 4LCMA 5FQKA 3S22A 4UQIS 5EM1A 4LV1A 3LR3A 3MZDA 3H7WA 4HH3A 4E3OA 3MZEA 3ZGAB 4MN5A 2H10A 4JGRA 3HLDA 1YLYA 4U3TA 4PM7A 3LCEA 4P6ZM 3S1YA 4WUJA 4BBUA 1PW8A 1FCOA 3IXHA 1SCWA 3BFEA 2Y2JA 3A3IA 2A24B 4E3KA 3DWZA 1KGFA 4N92A 1S1ZA 2KLIA 3B47A 3A3FA 4WEJA 5FQQA 4Z1WA 5GL9A 4OQGA 1CEGA 2JKRI 3W2ZA 1ZHHB 3OPRA 5IU1A 5FASA 3BW6A 1JWPA 4LCLA 3CPTB 2K2NA 2QMIA 3OLOA 4JXSA 2BTFP 1H5XA 1PWCA 5CGSA 1LL9A 5FDSA 4OP8A 2HF6A 4GCZA 4CLCA 4E04A 3T4TA 3HVFA 3PBNA 4M3KA 4Q0IA 3IX8A 1T18A 1K4FA 2RCXA 3CLOA 2M7VA 2P9VB 2EFXA 4QPRA 4KZ4A 3P7NA 1OJGA 4MBKA 4CQHA 2XD5A 1BYWA 5HD3A 2I72A 4GB7A 5A93A 5F6AA 2ZD8A 5BOHA 2W1TA 1F5MA 4CLCC 2I9VA 4JF5A 2K7SA 2Y2LA 1L0DA 1EROA 3TE8A 2W1RA 3S7QA 5HAPA 1OTDA 1IYOA 4WYYA 2C6WB 5EOOA 4HIAA 1J3WA 3BM6A 4YINA 2J3WA 2XLNA 4S2LA 4NEED 5CEBA 2Y59A 4OLDA 1LSVA 2WGVA 3CITA 4ZJ2A 2NUPC 1CF0A 2JCHA 1PWGA 2ZMVA 2XRNA 3FKWA 2J3TD 3OPLA 4I39A 4MBHA 2ZMAA 2RL3A 4DXCA 5CXWA 2VV7A 2XGNA 1DJCA 2PR6A 1TVFA 4IUHA 4BWIA 1UGUA 2ZQ7A 2JHEA 1V9YA 1N9NA 4EQIA 3Q82A 3D3OA 3IXDA 4YWZA 1S66L 5FA7A 5F5YA 5M19A 4GS9A 4HESA 2O9CA 4S2KA 2WKRA 2ZC3B 5J4EA 4YFMA 1SDNA 3MMHA 1D1JA 3QP5A 4RYEA 4BBVA 3MFDA 5F69A 2J80A 5FQ9A 4KG6A 2E8JA 1NY0A 5FAOA 1FQGA 1E25A 4I3IA 4R4RA 4G3VA 2JE5A 2HGVA 5F82A 5E2FA 1ALQA 2Y55A 3A0VA 3ZYTA 1HZOA 1KOUA 2VJWA 3CAXA 4H8RA 3LICA 1S4RA 3DBAA 2JKFA 3V67A 3VOYA 4X53A 1DJBA 1YLWA 3ISGA 2ZC4B 3R4KA 1LI9A 2LB9A 2J8YA 3MJQA 3QP1A 4H6JB 5L07A 1LHYA 3WS0A 3ZHHA 1VQQA 3ITAA 3UE1A 1CI9A 2WKQA 2VV6A 3NC8A 1W79A 1T19A 2DMWA 5GLBA 3R7WB 3LIAA 1PZPA 1CQAA 1G28A 1T1AA 1MC0A 3BY9A 4D60A 4FTXA 2QJ7A 3SH7A 1TDGA 1CEFA 2VV8A 4HH2A 2WKPA 1ONHA 4QWOA 5TBMB 4KZ6A 3A3DA 3SH9A 4R70A 5F1FA 1K38A 1OPXA 2HP9A 4X6TA 1ZG4A 3GRJA 4GHIB 3KSFA 4ME4A 1MPLA 4P0MA 2WAEA 1OTEA 5LBRA 2Z6CA 3RFBA 1N9LA 1L0EA 3L9KA 4KQOA 3U2AA 3V3RA 3OZHA 4NXEA 5FEFA 5JYPA 2R9XA 4ARZB 3KYEA 2LB5A 5J7EA 4OQIA 3MBZA 5GHYA 1PRQA 2G2WA 2W3GA 1BTLA 1OTIA 3C38A 3NECA 3UE0A 5HZHA 1BLSA 5A92A 3GMWA 4K91A 2Y91A 5TJJA 3Q7ZA 4QU3A 3T4QA 3S4XA 1AWIA 1JWZA 4KQQA 2BASA 1YLTA 3LIFA 3FZCA 1T1CA 5DFXA 4E6XA 4M4XA 2D01A 3CPTA 3PR6A 4NETA 4WF0A 2Q0OA 1PFLA 3N6IA 3ZNYA 1KVLA 4DXBA 2ZQCA 3LYXA 3BFGA 2Y2KA 3NOUC 4E3MA 3G30A 3B3XA 2OLUA 1MWSA 3VP1A 2WGIA 1S6RA 1NZOA 4DE3A 4WL9A 1P97A 2V2FF 3FPWA 1KE4A 1FOFA 3WRZA 4JXGA 2P9VA 1IELA 5HX9A 2OWJA 2GDNA 1YPRA 1YM1A 4FD8A 1PZOA 1W63M 2L1MA 4BL2A 3HLGA 3GECA 3P01A 2H28A 2Y4AA 3W4OA 1N9BA 2XA7M 4GW9A 2DRWA 1YLJA 2B02A 2H0YA 5CERA 1K55A 3QP6A 1UWNX 2XDMA 3C2WA 1WE4A 1Q2QA 2X71A 3FG8A 3QHYA 3S7PA 3B42A 4HOIA 3RXXA 2B5RA 1ES3A 3MR0A 3G35A 4ESPA 4KUKA 3GTCA 4FOFA 1XPBA 4MEZA 5DJTA 2E8IA 3VP0A 1ZC2A 4R3BA 2J7VA 1NWZA 1K55C 3K3CA 4X1MA 3GR2A 1TF1A 1GA9A 4K08A 3O5YA 2IWDA 2P74A 3SZTA 3T1RA 2V9AA 3GSGA 4X1LA 5CX7A 3O88A 4KZ8A 2J9OA 1L0FA 4EEPA 1Z09A 5A91A 4EWFA 3VMAA 1G6OA 2VK3A 2OOLA 4EEUA 2EA9A 3PYPA 2JC7A 1DRMA 3ICYA 2Y2QA 3AGFA 2HPBA 5EE8A 3SOIA 4O8GA 3W4PA 2ZQ9A 4C75A 4FH4A 4DKIA 4U0XA 5HARA 4PKYA 4HNBA 5GLCA 1NRJA 5L09A 3VP4A 1OT6A 4DN0A 5FAQA 3S7OA 2HZ5A 5KZHA 4H6JA 3DAVA 2Y2PA 1KVMA 4GNUA 4DE1A 2YKHA 4OH0A 1DP6A 4KQRA 4WZ5A 3ITBA 4NG2A 3R7WA 2O9AA 1LI0A 3UB6A 5FAPA 4Y0OA 2XF3A 4WMCD 5AQ7A 5FQMA 3UMEA 2ZBBA 5FI7A 5E2EA 1NRFA 4WEKA 2VZWA 5TBMA 3HJIA 4OQHA 4DJ3A 1E3UD 2P04A 5FQJA 5EOEA 3T1QB 4P87A 2EXAA 3PXPA 4OPQA 5G4YA 4WZ5C 2ZC6B 1PI4A 2ZLYA 4UA7A 2Y2GA 4B93A 2JKTI 3LR4A 2X02A 1H3QA 3BYDA 1P9WA 3KO6A 3MXQA 3UPNA 5GLAA 4EQ1A 1QMFA 4MLLA 2V1BA 3QP2A 1BZAA 4IUKA 4ARZA 4ETXA 3OCLA 3P98A 4HJ6A 2EX2A 3ZG0A 3V3SA 4P85A 3W8KA 4ETZA 3DW0A 3EQUA 3K2NA 3TJZC 5I5LA 3ZFZA 1LL8A 2JBFA 2H5SA 1AXBA 4PKYG 3KSGA 3BLMA 4Y15A 1OT9A 2WZXA 4XXRA 4F94A 2H0TA 4O0PA 2WUQA 3FWLA 4E3JA 3BECA 1LL5A 3T4JA 2YKFA 5DKLA 3FYZA 1K57A 4ZRRA 3HBRA 2INWA 3SW1A 4LV0A 4PHTA 3LIDA 4QJGA 1YAXA 4QHCA 4UQIM 2VGKA 4JF4A 2ZJ9A 3Q81A 2HJ9C 1JNUA 2ZQAA 4OKPA 5KIZA 4ID4A 2JKTM 1GSVA 5DJUA 5FI2A 4CLCE 2V0WA 2QZ6A 5M18A 5HPIA 2CC1A 2OAQ1 4BQMA 1EI5A 1QMEA 1K57C 3M2JA 1UWPX 3LEQA 3MKEA 1TS8A 5DF8A 1BLCA 3LI8A 1J9MA 2UWXA 2XFSA 1Y54A 5E2GA 2PYPA 1LT0A 5CEDA 2A49A 4Z9QA 2W3EA 5TGFA 1PYYA 2OSUA 4HHDA 3PBSA 2PAVP 2PRFA 5AQBA 1XP4A 1Q2PA 3JYIA 5EVIB 1GSXA 2QKPA 3E4QA 2MJ6A 4JXVA 5AQAA 4BD1A 1XX2A 2PDRA 4KZBA 4L9GA 1D06A 4GOGA 2FZ0A 4KG5A 4RVAA 3IHAA 3MQ0A 3EEAA 2XD1A 4LV2A 2ACGA 1K56A 1O7EA 3AGDA 1T1BA 3K3DA 3WS4A 1NYYA 5HWWA 1GHPA 2UV0E 5A8BA 5CGXA 5AVEA 5G4ZA 5DKKA 1YQSA 1SHVA 1N9OA 5CTMA 4I3JA 1DP9A 4I38A 4N9KA 3DTEA 1WYBA 3ZG7B 3ZG5A 3UDIA 3GV9A 3HREA 4EBLA 3SS3A 5DFYA 4FSFA 1LSWA 4LV3A 2FFYA 4RQ9A 3KYZA 1G6AA 1HLUP 3MXSA 4DE2A 2HDUA 3VFHA 3UE3A 1TEMA 4JGOA 2ZQ8A 1DY6A 3O87A 3DTIA 2ZOHA 4BENA 2Z2LB 1G68A 4CLCD 3IWOA 4LRZE 1SKOA 2R78A 3N8LA 2BLSA 1XJ4A 4S2PA 5E2HA 3IBJA 5HL6A 1IYSA 4N1XA 2O9BA 4YOFA 1TDLA 4Y0UA 3TRCA 1WYCA 4Y0TA 3ZQ5A 2Y8HA 3C30A 4O7DA 4P6BA 2VX8A 4IHQA 2Z2MB 2WYXA 1W5DA 4R3AA 3IS2B 3KSIA 4DDYA 4DJ2A 4EV4A 1ESUA 1YKDA 1ES2A 4JBFA 1MKIA 5DTKA 1DP8A 3BLSA 4HJ4A 3E4PA 4OQ0A 3NHQA 1XGJA 4UA6A 2KOIA 4WM9A 3HLBA 4IEDA 1KGEA 3VOLA 1K25A 5FSRA 5G18A 5HPFA 1VB6A 3LUQA 4PPRA 3WS1A 4DDSA 5HAIA 4C6YA 1K6RA 1TD5A 4GD6A 5L10A 4GLQA 4UA9A 4MNRA 3PHYA 3U4LP 2HP5A 3LY4A 1K4EA 1H8MA 4Y5FA 1VEUB 1H8YA 1XGIA 5JYOA 1OTAA 2L0WA 4XT2B 3CMZA 3NULA 4QB8A 3G2YA 1A0KA 3NBLA 3A0RA 5FATA 4HJ3A 5FQIA 3WS5A 5HAQA 5F83A 5FEGA 5CHUA 3OC2A 3T1XA 3Q1FA 4FH2A 2X01A 2B18A 4Q8IA 5HDDA 3JVUA 1GA0A 3I7JA 2HDQA 3V39A 4BLMA 1X0OA 4R38A 3CG5A 5AVFA 3UMDA 2EX8A 5HL1A 3LR0A 3JVVA 3KSHA 5MC7A 1L3LA 3CI6A 3W4QA 1ES4A 3EQVA 1XFNA 5CHJA 4KQDA 4BD0A 2EX9A 4E3NA 4E6WA 3HLFA 3RJUA 3EGDC 3QP8A 4EUVA 4R1GA 5DTTA 3D4FA 3T4LA 3T4KA 3UPPA 5TFQA 4LFUA 1D7EA 1F2KA 4DRTA 3IX3A 3BQAA 5HSQA 2PU2A 4NKPA 5HWVA 4WZ4A 4PM8A 5KSHA 3NDGA 2JN7A 4X69A 3UN7A 2Y2OA 5EECA 2PD7A 2HV1A 5AJGA 5HDCA 5EVIA 5CTNA 1MWUA 3VFFA 1P9RA 2PBDP 2Y2NA 3ZNTA 3T4OA 4X25A 3G2ZA 4GN2A 5U47A 2EX6A 3BY8A 2V20A 2PYRA 1LLBA 3WWXA 1MY8A 1NLZA 4BJPA 2QHKA 4Q0HA 3HL9A 2ZOIA 5EVIC 3GQZA 5J3WA 4B9OA 4IJGA 2GJ3A 4Q0JA 1M40A 4I5SA 1OJ5A 3UNWA 3UY6A 4GD8A 3SH8A 4KG2A 3DTMA 3BJNA 1MBLA 1N4OA 4FCFA 1GCEA 1GSWA 1Y4OA 4HI4A 4F3LB 2V0UA 3PBRA 1O07A 3BEBA 4Y2FA 3C4PA 4R23A 3UB8A 4LLOB 1FILA 3OBFA 3E2KA 3QP4A 2CMNA 1WA9A 2JKGA 1SKOB 3A0SA 3Q7VB 3N8SA 3PBQA 4KZ9A 2WK0A 3O86A 2Z6DA 3N4IA 5GLDA 3VE3A 3N7WA 1P0ZA 2BG1A 3IT9A 3VP2A 1YSPA 3LEZA 1I2SA 1VETA 3IX4A 3KX0X 4EERA 3VOZA 4WBGA 4Y7PA 3DTKA 3E4OA 4S2OA 1PNEA 3GDIA 3BFDA 1F98A 3UB5P 5L2FA 1KDWA 1S1YA 5E43A 3M6BA 3IS2A 3IF5A 2FH5A 1PW1A 3UPOA 2QPNA 4BBTA 4L9FA 3H82B 5EFWA 1FR1A 5IT5A 3B33A 5A90A 4KZAA 5HWTA 3OPHA 2EWWA 4S2IA 3PTEA 3SS5A 2WGWB 3IH8A 1PWDA 4OONA 4JPMA 3IF6B 3IQAA 3D72A 2QJ5A 4MMNA 3LGOA 1TS7A 3KYQA 1ES5A 2W27A 3T50A 1GHIA 1M6KA 1PIOA 2W0NA 1ODVA 3IWQA 5HDSA 3MKFA 4MDZA 4GDBA 2WKIA 4XUZA 1VEUA 1G5UA 2XROA 4XT2A 1NZUA 5IS1A 1YLPA 2J3TC 3MF0A 2V1ZA 4JF6A 2PD8A 4HP4A 4X56A 4EESA 3F1OA 2PR5A 3E98A 1ZKJA 4II7A 4S2JA 1BUEA 4KUOA 1VHMA 2V8FA 4QY5A 3TOIA 4NXFA 1DJAA 3OCNA 1CI8A 1KE3A 1GHMA 2VGJA 4MCWA 4IVKA 4K0WA 2GZAA 2HDSA 2FFFB 3SS4A 3AGEA 1EW0A 4EETB 2HDRA 3C4OA 2A2LA 1BULA 4JKTA 1NXYA 3GVBA 3LIBA 3BRMA 2Y2HA 4G3KA 4X55A 3E0YA 4HBUA 5EVLA 2V1AA 2Y79A 2M7UA 5CECA 5GHXA 4UHUA 4CJNA 1E4DA 3ZDJA 1RCJA 2V8CA 3CUEA 3T1SA 5C5KA 4LPZA 3CJMA 2P7JA 2IWBA 3ZG8B 2GX5A 2L4RA 2VLGA 4LRXC 5L8MA 3JPUA 4A5RA 4NXGA 4NK3A 1Y28A 4DMZA 3ZCZA 5EV0A 3NCKA 3O3VA 4AFIA 3QNBA 4KZ5A 2JKRM 4G3WA 1IKGA 1IYPA 1SZVA 5FDHA 1FR6A 1IFQA 4WELA 2OWHA 3CUEC 4HEFA 1TS6A 4CPKA 3M6HA 4ZDXA 5EM0A 1CK3A 3IWIA 4GJ4A 3ZVTA 3MFXA 4KZ3A 3IH9A 1S4SA 2VGLS 3H9WA 3G31A 5FL3A 3ZG9B 1MZUA 5M1AA 3BFCA 2B95A 2ZL1B 2KDKA 5CGWA 3A3JA 3LO7A 1CJFA 3LY3A 3CZDA 4N1HA 4LGWA 5K5BA 4S2MA 2W3HA 3NY4A 2A3UA 1V9ZA 3CHWP 4R3JA 3D9YA 1KGGA 3BWLA 3ULFA 3NIAA 3VSLA 1XJ2A 4F3LA 2KX6A 2WZZA 2XK1A 1JWVA 3FC7A 4Y3IA 2ZC7A 1YSQA 1W7FA 3Q7VA 2Y2IA 1YMSA 4L9EA 3EEHA 4OOLA 3HLEA 4R6LA 1TS0A 3WRTA 4JGQA 2OV5A 1FSYA 2VGLM 1VETB 4JLFA 4ZJ1A 2M1CA 3LR5A 1XJ6A 2C5WB 4GZBA 4PM5A 2WKHA 4KENB 1NLYA 2Y2MA 4EUZA 2G7UA 2XQZA 1LSXA 4KZ7A 3Q07A 2EWVA 1L0GA 3F1PB 3UDXA 2XH9A 3F1NA 4HQAA 4R4SA 3DWKA 2J9PA 1SKFA 1RGZA 5HW3A 4D2OA 2VKSA 3V5MA 1IOUA 1Z6FA 2WKEA 3HUOA 3H82A 1F9IA 3C7UA 1OMEA 5I94A 1I2WA 2NUTC 1HD8A 4JXWA 3PAGA 3CWFA 4ZJ3A 3NJAA 2WGWA 3N8RA 5D3OA 3G6OA 1K54A 3IF6A 4FUWA 4Y13A 1NYMA 4HP9A 1JTGA 1BLHA 3FPVA 3IXBA 3RTYA 3NOTC 3PAEA 1ZTUA 2OAP1 3PBTA 4EXOA 3H7WB 4NXBA 1K56D 3HLCA 1BT5A 3PBOA 1ERQA 2AVXA 3HJKA 3LIEA 1K54C 4HY8A 1H8ZA 2OLVA 2ZQDA 3IF6C 1MWRA 3MXRA 3IXGA 4PM9A 4RA7A 2ZM0A 3MQQA 3VV4A 4EBPA 2A24A 3F1OB 3C5AA 5DVAA 4EW7A 3C8CA 2XA7S 1ZG6A 4GKUA 1XFQA 1XXMA 4IBRA 3G32A 2R9WA 4DE0A 4XUXA 2HJEA 4L0LA 4MN7A 4ZTKA 2VA0A 4WLAA 3G4PA 4RX2A 2DCFA 2ZMFA 4RX3A 1OTBA 3MS6A 4CLCB 1HVBA 5FI6A 3HCYA 3UB9A 2QYBA 4LRYC 4OLGA 5TR7A 3OOVA 4R0QA 2XEPA 3EGXC 1I5QA 3HUNA 5EUAA 1H0MA 2EXBA 2EFUA 4OOMA 4E3IA 3LFVA 1JVJA 5EVEA 4E3LA 4WMCA 2DNSA 4OVDA 2WADA 3UE6A 4K0XA 4OPZA 3RXWA 4PM6A 1K6SA 3NDEA 3MQOA 1RGYA 3UDFA 2W1TB 1KE0A 1JTDA 2GNXA 1E3UA 1NJ4A 4ZBEA 4BL3A 2K31A 2W3DA 1YT4A 2IA2A 1W8QA 3M2KA 1EWZA 1XKZA 2XR0A 3LI9A 2Q9NA 3RH8B 2O0YA 1XJ3A 2WAFA 1ONGA 3FKVA 3L7HA 5EPHA 3OPPA 2HP6A 1W8YA 4LENA 2G2UA 4PMAA 5CRFA 5KMWA 4ZAMA 1RP5A 4JGPA 3HLWA 4I3AA 4OPRA 1YMXA 1MXOA 4EU0A 2PT7A 4X68A 2P08A 3BQ8A 3QNCA 2W3FA 2PU4A 1VM1A
chains in the Genus database with same CATH topology
1BLSA 5A92A 2WKIA 4XUZA 1FSWA 3GMWA 1YQSA 1SHVA 4K91A 5CTMA 2Y91A 5DF7A 4N9KA 3V50A 1FCNA 1NZUA 3Q7ZA 1YLPA 4UAAA 1WYBA 4QU3A 3ZG7B 3E2LA 3UDIA 3ZG5A 2V1ZA 3GV9A 3HREA 4JF6A 3S4XA 1ESIA 4EBLA 1JWZA 4KQQA 5HFOA 5DF9A 3WS2A 1YLTA 3UO9A 5KSCA 3SS3A 4X56A 1HTZA 3MZFA 4FSFA 4LV3A 2FFYA 3FZCA 3FV7A 3TSGA 1ZKJA 4E6XA 1G6AA 1IEMA 1S0WA 4S2JA 4NETA 1BUEA 3N6IA 1BSGA 3ZNYA 3A3EA 3MXSA 3NI9A 3P09A 1KVLA 4DE2A 4DXBA 2HDUA 2ZQCA 3VFHA 3UE3A 3BFGA 2Y2KA 1TEMA 4E3MA 3G30A 3VSKA 4QY5A 3TOIA 2ZQ8A 1DY6A 4IVIA 3O87A 3B3XA 4BENA 2OLUA 3TG9A 1DJAA 2Z2LB 3OCNA 1CI8A 1MWSA 1KE3A 1GHMA 2VGJA 3ZVWA 3VP1A 2WGIA 2IWCA 4N9LA 1S6RA 1G68A 1FCMA 1NZOA 4DE3A 5J8XA 3VP3A 3IWOA 4IVKA 1YLZA 1L2SA 4K0WA 2V2FF 1KE4A 1FOFA 1ERMA 2HDSA 2FFFB 3WRZA 3SS4A 3AGEA 4JXGA 3N8LA 2HDRA 1IELA 2P9VA 1MWTA 3C4OA 4S2NA 5HX9A 2BLSA 2GDNA 1YM1A 1BULA 1U60A 4FD8A 4JKTA 1SDEA 4S2PA 5E2HA 1NXYA 1PZOA 3GVBA 2XFTA 1IYSA 4BL2A 3BRMA 1C3BA 3HLGA 5DTSA 2Y2HA 4N1XA 4X55A 4HBUA 5F1GA 4B4ZA 1TDLA 4Y0UA 4MBFA 1WYCA 5EVLA 4Y0TA 4GDNA 2Y4AA 3C7VA 5CECA 2PBYA 4U0TA 4O7DA 3W4OA 1N9BA 5GHXA 4B88A 4QD4A 4P6BA 4UHUA 2ZC5B 2DRWA 4CJNA 1E4DA 3ZDJA 1YLJA 2Z2MB 2H0YA 4OOYA 1IKIA 1RCJA 3IHBA 2WYXA 1W5DA 4OPYA 4HBTA 5CERA 1K55A 3CJMA 4DDYA 1XA1A 5AQ9A 2XDMA 1PI5A 1WE4A 5IHVA 2IWBA 3ZG8B 4GDBA 4OP5A 4EV4A 1Q2QA 5CHMA 2X71A 1ESUA 1BLPA 3HUMA 4A5RA 3BFFA 3QHYA 4S2NC 4QY6A 1ES2A 4NK3A 3RXXA 4B4XA 1XA7A 4JBFA 2B5RA 1MKIA 3ZCZA 5DTKA 3BLSA 1ES3A 3NCKA 4C3QA 4EBNA 3O3VA 5EVID 2ZM2A 1IYQA 3G34A 3G35A 4OQ0A 4DF6A 1XGJA 3QNBA 4UA6A 3GTCA 4KZ5A 1KDSA 1IKGA 3HLBA 4WM9A 4IEDA 1IYPA 1XPBA 1KGEA 4MEZA 5FDHA 2ZM8A 5GHZA 1K25A 2Q9MA 1FR6A 4IBXA 5FSRA 5G18A 2E8IA 4LCMA 3VP0A 5FQKA 4WELA 4PPRA 3S22A 1ZC2A 4R3BA 3WS1A 2J7VA 5HAIA 4C6YA 1K55C 4HEFA 4DDSA 4CPKA 3GR2A 3M6HA 1K6RA 3MZDA 4LV1A 4ZDXA 1CK3A 3IWIA 1GA9A 4GD6A 4UA9A 3ZVTA 4E3OA 2IWDA 4KZ3A 3MZEA 3ZGAB 2H10A 3IH9A 2P74A 3HLDA 4MNRA 1YLYA 4U3TA 4PM7A 2HP5A 3LY4A 3LCEA 1K4EA 3G31A 3ZG9B 3S1YA 3GSGA 1PW8A 5M1AA 3BFCA 1FCOA 1H8YA 1XGIA 3IXHA 1SCWA 5JYOA 3BFEA 2Y2JA 5CGWA 3A3IA 3O88A 4KZ8A 2J9OA 3A3JA 3CMZA 3LO7A 4QB8A 4E3KA 3DWZA 1L0FA 3G2YA 3LY3A 1KGFA 3NBLA 3CZDA 4N1HA 4N92A 5FATA 4S2MA 5A91A 3NY4A 2A3UA 5FQIA 3WS5A 3A3FA 4EWFA 4R3JA 4WEJA 5FQQA 3VMAA 5HAQA 5F83A 5GL9A 1KGGA 1CEGA 4OQGA 2JC7A 3NIAA 5CHUA 3OC2A 3OPRA 5FASA 2Y2QA 3AGFA 1JWPA 2HPBA 5EE8A 3Q1FA 3SOIA 3VSLA 4LCLA 3W4PA 4FH2A 2ZQ9A 2X01A 4C75A 4Q8IA 4FH4A 2WZZA 4DKIA 2QMIA 4U0XA 1GA0A 4JXSA 5HARA 2XK1A 1H5XA 1JWVA 1PWCA 3I7JA 5GLCA 2HDQA 3V39A 4BLMA 3VP4A 5CGSA 2ZC7A 1LL9A 5FAQA 4OP8A 1W7FA 3CG5A 3Q7VA 2Y2IA 1YMSA 5KZHA 4OOLA 3HVFA 2EX8A 2Y2PA 3HLEA 3PBNA 4M3KA 5HL1A 3WRTA 1K4FA 2RCXA 1FSYA 2OV5A 4JLFA 3W4QA 1KVMA 4GNUA 4DE1A 4ZJ1A 2P9VB 1ES4A 4OH0A 3EQVA 5CHJA 2EFXA 4KQRA 2C5WB 4WZ5A 3ITBA 4GZBA 4PM5A 4KZ4A 2WKHA 4BD0A 4KENB 2EX9A 4E3NA 4E6WA 4MBKA 2Y2MA 4EUZA 2XQZA 3HLFA 3RJUA 2XD5A 1LI0A 4KZ7A 3Q07A 5FAPA 4Y0OA 1L0GA 4R1GA 5DTTA 3D4FA 2XH9A 2XF3A 4WMCD 5AQ7A 3UDXA 2I72A 4GB7A 5A93A 5FQMA 3UPPA 5TFQA 5FI7A 4R4SA 3DWKA 1NRFA 2J9PA 2ZD8A 4WEKA 5E2EA 4DRTA 5BOHA 4JF5A 1SKFA 1RGZA 2PU2A 2Y2LA 4OQHA 5HW3A 4D2OA 1L0DA 4WZ4A 1EROA 4PM8A 3V5MA 1Z6FA 2WKEA 1E3UD 3HUOA 3NDGA 5HAPA 5KSHA 4X69A 5FQJA 3UN7A 1IYOA 2Y2OA 4WYYA 3C7UA 5EOEA 2C6WB 1OMEA 5EECA 1I2WA 5EOOA 4P87A 5I94A 2EXAA 4OPQA 1HD8A 4JXWA 3PAGA 4WZ5C 5EVIA 4ZJ3A 3BM6A 2ZC6B 1MWUA 2WGWA 3N8RA 5CTNA 4YINA 1PI4A 5D3OA 3VFFA 2Y2NA 2ZLYA 2XLNA 4UA7A 1K54A 2Y2GA 4S2LA 3ZNTA 5CEBA 2Y59A 3IF6A 3G2ZA 4GN2A 4OLDA 2X02A 2WGVA 3BYDA 1NYMA 4ZJ2A 5U47A 2JCHA 2EX6A 1PWGA 1JTGA 3UPNA 1BLHA 5GLAA 1QMFA 3FKWA 3OPLA 3IXBA 4MLLA 2V20A 4MBHA 2ZMAA 2RL3A 1LLBA 4DXCA 3PAEA 3WWXA 1MY8A 5CXWA 3PBTA 1BZAA 3OCLA 2XGNA 1DJCA 1K56D 3P98A 4BJPA 2EX2A 3HLCA 1BT5A 3V3SA 1TVFA 4P85A 3PBOA 3HL9A 3ZG0A 3W8KA 2ZQ7A 4EQIA 3DW0A 3Q82A 3EQUA 3IXDA 5EVIC 5FA7A 3GQZA 5M19A 1ERQA 4HESA 1K54C 4S2KA 2ZC3B 3ZFZA 1H8ZA 2OLVA 2ZQDA 3IF6C 1MWRA 2JBFA 1M40A 3IXGA 3MXRA 5CGXA 2H5SA 3UNWA 4PM9A 4YFMA 4RA7A 1AXBA 3UY6A 2ZM0A 1SDNA 3BLMA 4GD8A 2WZXA 3SH8A 4XXRA 4EBPA 4KG2A 3C5AA 4RYEA 4F94A 3DTMA 5DVAA 3MFDA 2H0TA 5FQ9A 2WUQA 3FWLA 4KG6A 1ZG6A 4GKUA 1NY0A 4E3JA 5FAOA 1FQGA 3BECA 1LL5A 1E25A 1XXMA 4IBRA 1MBLA 1N4OA 4FCFA 1GCEA 3FYZA 1K57A 3G32A 2R9WA 4R4RA 4DE0A 3HBRA 2JE5A 4LV0A 4XUXA 3PBRA 5F82A 5E2FA 4QJGA 1O07A 1ALQA 2Y55A 3BEBA 4QHCA 4L0LA 1HZOA 3C4PA 4H8RA 2VGKA 4ZTKA 4R23A 4JF4A 2ZJ9A 3Q81A 3VOYA 4X53A 3E2KA 1DJBA 1YLWA 2ZQAA 3G4PA 3ISGA 4RX2A 2DCFA 2ZC4B 4OKPA 1LI9A 4RX3A 2J8YA 4ID4A 3Q7VB 3N8SA 1HVBA 3PBQA 4KZ9A 2WK0A 3O86A 5FI2A 5FI6A 2QZ6A 3N4IA 1LHYA 5GLDA 3WS0A 3ZHHA 4OLGA 3N7WA 5M18A 1VQQA 5TR7A 2CC1A 3ITAA 3UE1A 1CI9A 2XEPA 4R0QA 4BQMA 2BG1A 1EI5A 1I5QA 3HUNA 3IT9A 5EUAA 3VP2A 1QMEA 3NC8A 1I2SA 1W79A 3LEZA 1K57C 2EXBA 2EFUA 3M2JA 3VOZA 4OOMA 5GLBA 4E3IA 4WBGA 4Y7PA 1JVJA 3MKEA 1PZPA 5DF8A 4E3LA 1BLCA 4S2OA 4WMCA 1J9MA 2UWXA 2XFSA 1Y54A 5E2GA 2DNSA 4OVDA 2WADA 4K0XA 3BFDA 4OPZA 3RXWA 4PM6A 5CEDA 1K6SA 2A49A 3NDEA 5L2FA 3SH7A 1TDGA 4Z9QA 1RGYA 1CEFA 1KDWA 3M6BA 5E43A 5TGFA 3UDFA 1KE0A 1ONHA 3IF5A 1PW1A 1JTDA 4KZ6A 3A3DA 1E3UA 1PYYA 3UPOA 1NJ4A 2OSUA 2QPNA 4ZBEA 3SH9A 4BL3A 5F1FA 1K38A 1YT4A 2HP9A 3PBSA 4X6TA 1ZG4A 1FR1A 3GRJA 1W8QA 4KZAA 5A90A 5AQBA 1XP4A 1MPLA 1Q2PA 3JYIA 3M2KA 1EWZA 1XKZA 3OPHA 4P0MA 4S2IA 2XR0A 2Q9NA 5EVIB 2WAEA 3PTEA 3SS5A 2WGWB 3IH8A 1PWDA 2WAFA 1ONGA 3FKVA 4OONA 1L0EA 4JXVA 4JPMA 5AQAA 4BD1A 4KQOA 3IF6B 3IQAA 1XX2A 3V3RA 4KZBA 5EPHA 3OPPA 4GOGA 3OZHA 4KG5A 2HP6A 1W8YA 4LENA 4RVAA 2G2UA 1ES5A 3IHAA 4PMAA 2XD1A 5CRFA 5KMWA 4LV2A 4ZAMA 1RP5A 1GHIA 3HLWA 5JYPA 2R9XA 1K56A 1O7EA 3AGDA 4OPRA 1M6KA 1YMXA 1MXOA 1PIOA 4OQIA 1NYYA 3MBZA 3WS4A 4X68A 1GHPA 5GHYA 3QNCA 2G2WA 3IWQA 1BTLA 3MKFA 3UE0A 2PU4A 1VM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLS A;  5A92 A;  2WKI A;  4XUZ A;  1FSW A;  3GMW A;  1YQS A;  1SHV A;  4K91 A;  5CTM A;  2Y91 A;  5DF7 A;  4N9K A;  3V50 A;  1FCN A;  1NZU A;  3Q7Z A;  1YLP A;  4UAA A;  1WYB A;  4QU3 A;  3ZG7 B;  3E2L A;  3UDI A;  3ZG5 A;  2V1Z A;  3GV9 A;  3HRE A;  4JF6 A;  3S4X A;  1ESI A;  4EBL A;  1JWZ A;  4KQQ A;  5HFO A;  5DF9 A;  3WS2 A;  1YLT A;  3UO9 A;  5KSC A;  3SS3 A;  4X56 A;  1HTZ A;  3MZF A;  4FSF A;  4LV3 A;  2FFY A;  3FZC A;  3FV7 A;  3TSG A;  1ZKJ A;  4E6X A;  1G6A A;  1IEM A;  1S0W A;  4S2J A;  4NET A;  1BUE A;  3N6I A;  1BSG A;  3ZNY A;  3A3E A;  3MXS A;  3NI9 A;  3P09 A;  1KVL A;  4DE2 A;  4DXB A;  2HDU A;  2ZQC A;  3VFH A;  3UE3 A;  3BFG A;  2Y2K A;  1TEM A;  4E3M A;  3G30 A;  3VSK A;  4QY5 A;  3TOI A;  2ZQ8 A;  1DY6 A;  4IVI A;  3O87 A;  3B3X A;  4BEN A;  2OLU A;  3TG9 A;  1DJA A;  2Z2L B;  3OCN A;  1CI8 A;  1MWS A;  1KE3 A;  1GHM A;  2VGJ A;  3ZVW A;  3VP1 A;  2WGI A;  2IWC A;  4N9L A;  1S6R A;  1G68 A;  1FCM A;  1NZO A;  4DE3 A;  5J8X A;  3VP3 A;  3IWO A;  4IVK A;  1YLZ A;  1L2S A;  4K0W A;  2V2F F;  1KE4 A;  1FOF A;  1ERM A;  2HDS A;  2FFF B;  3WRZ A;  3SS4 A;  3AGE A;  4JXG A;  3N8L A;  2HDR A;  1IEL A;  2P9V A;  1MWT A;  3C4O A;  4S2N A;  5HX9 A;  2BLS A;  2GDN A;  1YM1 A;  1BUL A;  1U60 A;  4FD8 A;  4JKT A;  1SDE A;  4S2P A;  5E2H A;  1NXY A;  1PZO A;  3GVB A;  2XFT A;  1IYS A;  4BL2 A;  3BRM A;  1C3B A;  3HLG A;  5DTS A;  2Y2H A;  4N1X A;  4X55 A;  4HBU A;  5F1G A;  4B4Z A;  1TDL A;  4Y0U A;  4MBF A;  1WYC A;  5EVL A;  4Y0T A;  4GDN A;  2Y4A A;  3C7V A;  5CEC A;  2PBY A;  4U0T A;  4O7D A;  3W4O A;  1N9B A;  5GHX A;  4B88 A;  4QD4 A;  4P6B A;  4UHU A;  2ZC5 B;  2DRW A;  4CJN A;  1E4D A;  3ZDJ A;  1YLJ A;  2Z2M B;  2H0Y A;  4OOY A;  1IKI A;  1RCJ A;  3IHB A;  2WYX A;  1W5D A;  4OPY A;  4HBT A;  5CER A;  1K55 A;  3CJM A;  4DDY A;  1XA1 A;  5AQ9 A;  2XDM A;  1PI5 A;  1WE4 A;  5IHV A;  2IWB A;  3ZG8 B;  4GDB A;  4OP5 A;  4EV4 A;  1Q2Q A;  5CHM A;  2X71 A;  1ESU A;  1BLP A;  3HUM A;  4A5R A;  3BFF A;  3QHY A;  4S2N C;  4QY6 A;  1ES2 A;  4NK3 A;  3RXX A;  4B4X A;  1XA7 A;  4JBF A;  2B5R A;  1MKI A;  3ZCZ A;  5DTK A;  3BLS A;  1ES3 A;  3NCK A;  4C3Q A;  4EBN A;  3O3V A;  5EVI D;  2ZM2 A;  1IYQ A;  3G34 A;  3G35 A;  4OQ0 A;  4DF6 A;  1XGJ A;  3QNB A;  4UA6 A;  3GTC A;  4KZ5 A;  1KDS A;  1IKG A;  3HLB A;  4WM9 A;  4IED A;  1IYP A;  1XPB A;  1KGE A;  4MEZ A;  5FDH A;  2ZM8 A;  5GHZ A;  1K25 A;  2Q9M A;  1FR6 A;  4IBX A;  5FSR A;  5G18 A;  2E8I A;  4LCM A;  3VP0 A;  5FQK A;  4WEL A;  4PPR A;  3S22 A;  1ZC2 A;  4R3B A;  3WS1 A;  2J7V A;  5HAI A;  4C6Y A;  1K55 C;  4HEF A;  4DDS A;  4CPK A;  3GR2 A;  3M6H A;  1K6R A;  3MZD A;  4LV1 A;  4ZDX A;  1CK3 A;  3IWI A;  1GA9 A;  4GD6 A;  4UA9 A;  3ZVT A;  4E3O A;  2IWD A;  4KZ3 A;  3MZE A;  3ZGA B;  2H10 A;  3IH9 A;  2P74 A;  3HLD A;  4MNR A;  1YLY A;  4U3T A;  4PM7 A;  2HP5 A;  3LY4 A;  3LCE A;  1K4E A;  3G31 A;  3ZG9 B;  3S1Y A;  3GSG A;  1PW8 A;  5M1A A;  3BFC A;  1FCO A;  1H8Y A;  1XGI A;  3IXH A;  1SCW A;  5JYO A;  3BFE A;  2Y2J A;  5CGW A;  3A3I A;  3O88 A;  4KZ8 A;  2J9O A;  3A3J A;  3CMZ A;  3LO7 A;  4QB8 A;  4E3K A;  3DWZ A;  1L0F A;  3G2Y A;  3LY3 A;  1KGF A;  3NBL A;  3CZD A;  4N1H A;  4N92 A;  5FAT A;  4S2M A;  5A91 A;  3NY4 A;  2A3U A;  5FQI A;  3WS5 A;  3A3F A;  4EWF A;  4R3J A;  4WEJ A;  5FQQ A;  3VMA A;  5HAQ A;  5F83 A;  5GL9 A;  1KGG A;  1CEG A;  4OQG A;  2JC7 A;  3NIA A;  5CHU A;  3OC2 A;  3OPR A;  5FAS A;  2Y2Q A;  3AGF A;  1JWP A;  2HPB A;  5EE8 A;  3Q1F A;  3SOI A;  3VSL A;  4LCL A;  3W4P A;  4FH2 A;  2ZQ9 A;  2X01 A;  4C75 A;  4Q8I A;  4FH4 A;  2WZZ A;  4DKI A;  2QMI A;  4U0X A;  1GA0 A;  4JXS A;  5HAR A;  2XK1 A;  1H5X A;  1JWV A;  1PWC A;  3I7J A;  5GLC A;  2HDQ A;  3V39 A;  4BLM A;  3VP4 A;  5CGS A;  2ZC7 A;  1LL9 A;  5FAQ A;  4OP8 A;  1W7F A;  3CG5 A;  3Q7V A;  2Y2I A;  1YMS A;  5KZH A;  4OOL A;  3HVF A;  2EX8 A;  2Y2P A;  3HLE A;  3PBN A;  4M3K A;  5HL1 A;  3WRT A;  1K4F A;  2RCX A;  1FSY A;  2OV5 A;  4JLF A;  3W4Q A;  1KVM A;  4GNU A;  4DE1 A;  4ZJ1 A;  2P9V B;  1ES4 A;  4OH0 A;  3EQV A;  5CHJ A;  2EFX A;  4KQR A;  2C5W B;  4WZ5 A;  3ITB A;  4GZB A;  4PM5 A;  4KZ4 A;  2WKH A;  4BD0 A;  4KEN B;  2EX9 A;  4E3N A;  4E6W A;  4MBK A;  2Y2M A;  4EUZ A;  2XQZ A;  3HLF A;  3RJU A;  2XD5 A;  1LI0 A;  4KZ7 A;  3Q07 A;  5FAP A;  4Y0O A;  1L0G A;  4R1G A;  5DTT A;  3D4F A;  2XH9 A;  2XF3 A;  4WMC D;  5AQ7 A;  3UDX A;  2I72 A;  4GB7 A;  5A93 A;  5FQM A;  3UPP A;  5TFQ A;  5FI7 A;  4R4S A;  3DWK A;  1NRF A;  2J9P A;  2ZD8 A;  4WEK A;  5E2E A;  4DRT A;  5BOH A;  4JF5 A;  1SKF A;  1RGZ A;  2PU2 A;  2Y2L A;  4OQH A;  5HW3 A;  4D2O A;  1L0D A;  4WZ4 A;  1ERO A;  4PM8 A;  3V5M A;  1Z6F A;  2WKE A;  1E3U D;  3HUO A;  3NDG A;  5HAP A;  5KSH A;  4X69 A;  5FQJ A;  3UN7 A;  1IYO A;  2Y2O A;  4WYY A;  3C7U A;  5EOE A;  2C6W B;  1OME A;  5EEC A;  1I2W A;  5EOO A;  4P87 A;  5I94 A;  2EXA A;  4OPQ A;  1HD8 A;  4JXW A;  3PAG A;  4WZ5 C;  5EVI A;  4ZJ3 A;  3BM6 A;  2ZC6 B;  1MWU A;  2WGW A;  3N8R A;  5CTN A;  4YIN A;  1PI4 A;  5D3O A;  3VFF A;  2Y2N A;  2ZLY A;  2XLN A;  4UA7 A;  1K54 A;  2Y2G A;  4S2L A;  3ZNT A;  5CEB A;  2Y59 A;  3IF6 A;  3G2Z A;  4GN2 A;  4OLD A;  2X02 A;  2WGV A;  3BYD A;  1NYM A;  4ZJ2 A;  5U47 A;  2JCH A;  2EX6 A;  1PWG A;  1JTG A;  3UPN A;  1BLH A;  5GLA A;  1QMF A;  3FKW A;  3OPL A;  3IXB A;  4MLL A;  2V20 A;  4MBH A;  2ZMA A;  2RL3 A;  1LLB A;  4DXC A;  3PAE A;  3WWX A;  1MY8 A;  5CXW A;  3PBT A;  1BZA A;  3OCL A;  2XGN A;  1DJC A;  1K56 D;  3P98 A;  4BJP A;  2EX2 A;  3HLC A;  1BT5 A;  3V3S A;  1TVF A;  4P85 A;  3PBO A;  3HL9 A;  3ZG0 A;  3W8K A;  2ZQ7 A;  4EQI A;  3DW0 A;  3Q82 A;  3EQU A;  3IXD A;  5EVI C;  5FA7 A;  3GQZ A;  5M19 A;  1ERQ A;  4HES A;  1K54 C;  4S2K A;  2ZC3 B;  3ZFZ A;  1H8Z A;  2OLV A;  2ZQD A;  3IF6 C;  1MWR A;  2JBF A;  1M40 A;  3IXG A;  3MXR A;  5CGX A;  2H5S A;  3UNW A;  4PM9 A;  4YFM A;  4RA7 A;  1AXB A;  3UY6 A;  2ZM0 A;  1SDN A;  3BLM A;  4GD8 A;  2WZX A;  3SH8 A;  4XXR A;  4EBP A;  4KG2 A;  3C5A A;  4RYE A;  4F94 A;  3DTM A;  5DVA A;  3MFD A;  2H0T A;  5FQ9 A;  2WUQ A;  3FWL A;  4KG6 A;  1ZG6 A;  4GKU A;  1NY0 A;  4E3J A;  5FAO A;  1FQG A;  3BEC A;  1LL5 A;  1E25 A;  1XXM A;  4IBR A;  1MBL A;  1N4O A;  4FCF A;  1GCE A;  3FYZ A;  1K57 A;  3G32 A;  2R9W A;  4R4R A;  4DE0 A;  3HBR A;  2JE5 A;  4LV0 A;  4XUX A;  3PBR A;  5F82 A;  5E2F A;  4QJG A;  1O07 A;  1ALQ A;  2Y55 A;  3BEB A;  4QHC A;  4L0L A;  1HZO A;  3C4P A;  4H8R A;  2VGK A;  4ZTK A;  4R23 A;  4JF4 A;  2ZJ9 A;  3Q81 A;  3VOY A;  4X53 A;  3E2K A;  1DJB A;  1YLW A;  2ZQA A;  3G4P A;  3ISG A;  4RX2 A;  2DCF A;  2ZC4 B;  4OKP A;  1LI9 A;  4RX3 A;  2J8Y A;  4ID4 A;  3Q7V B;  3N8S A;  1HVB A;  3PBQ A;  4KZ9 A;  2WK0 A;  3O86 A;  5FI2 A;  5FI6 A;  2QZ6 A;  3N4I A;  1LHY A;  5GLD A;  3WS0 A;  3ZHH A;  4OLG A;  3N7W A;  5M18 A;  1VQQ A;  5TR7 A;  2CC1 A;  3ITA A;  3UE1 A;  1CI9 A;  2XEP A;  4R0Q A;  4BQM A;  2BG1 A;  1EI5 A;  1I5Q A;  3HUN A;  3IT9 A;  5EUA A;  3VP2 A;  1QME A;  3NC8 A;  1I2S A;  1W79 A;  3LEZ A;  1K57 C;  2EXB A;  2EFU A;  3M2J A;  3VOZ A;  4OOM A;  5GLB A;  4E3I A;  4WBG A;  4Y7P A;  1JVJ A;  3MKE A;  1PZP A;  5DF8 A;  4E3L A;  1BLC A;  4S2O A;  4WMC A;  1J9M A;  2UWX A;  2XFS A;  1Y54 A;  5E2G A;  2DNS A;  4OVD A;  2WAD A;  4K0X A;  3BFD A;  4OPZ A;  3RXW A;  4PM6 A;  5CED A;  1K6S A;  2A49 A;  3NDE A;  5L2F A;  3SH7 A;  1TDG A;  4Z9Q A;  1RGY A;  1CEF A;  1KDW A;  3M6B A;  5E43 A;  5TGF A;  3UDF A;  1KE0 A;  1ONH A;  3IF5 A;  1PW1 A;  1JTD A;  4KZ6 A;  3A3D A;  1E3U A;  1PYY A;  3UPO A;  1NJ4 A;  2OSU A;  2QPN A;  4ZBE A;  3SH9 A;  4BL3 A;  5F1F A;  1K38 A;  1YT4 A;  2HP9 A;  3PBS A;  4X6T A;  1ZG4 A;  1FR1 A;  3GRJ A;  1W8Q A;  4KZA A;  5A90 A;  5AQB A;  1XP4 A;  1MPL A;  1Q2P A;  3JYI A;  3M2K A;  1EWZ A;  1XKZ A;  3OPH A;  4P0M A;  4S2I A;  2XR0 A;  2Q9N A;  5EVI B;  2WAE A;  3PTE A;  3SS5 A;  2WGW B;  3IH8 A;  1PWD A;  2WAF A;  1ONG A;  3FKV A;  4OON A;  1L0E A;  4JXV A;  4JPM A;  5AQA A;  4BD1 A;  4KQO A;  3IF6 B;  3IQA A;  1XX2 A;  3V3R A;  4KZB A;  5EPH A;  3OPP A;  4GOG A;  3OZH A;  4KG5 A;  2HP6 A;  1W8Y A;  4LEN A;  4RVA A;  2G2U A;  1ES5 A;  3IHA A;  4PMA A;  2XD1 A;  5CRF A;  5KMW A;  4LV2 A;  4ZAM A;  1RP5 A;  1GHI A;  3HLW A;  5JYP A;  2R9X A;  1K56 A;  1O7E A;  3AGD A;  4OPR A;  1M6K A;  1YMX A;  1MXO A;  1PIO A;  4OQI A;  1NYY A;  3MBZ A;  3WS4 A;  4X68 A;  1GHP A;  5GHY A;  3QNC A;  2G2W A;  3IWQ A;  1BTL A;  3MKF A;  3UE0 A;  2PU4 A;  1VM1 A; 
#chains in the Genus database with same CATH topology
 1ACF A;  1FSW A;  4GS9 B;  2ZL1 A;  5DF7 A;  3V50 A;  1FCN A;  1S67 L;  1MKM A;  4UAA A;  2XSS A;  3E2L A;  3T4S A;  1ESI A;  5HFO A;  5DF9 A;  3WS2 A;  2O99 A;  3UO9 A;  5KSC A;  1HTZ A;  3MZF A;  3IBR A;  4UEY A;  3FV7 A;  1K0K A;  3TSG A;  1IEM A;  1S0W A;  1BSG A;  3A3E A;  3P09 A;  3NI9 A;  3EOI A;  3VSK A;  4O01 A;  4IVI A;  3TG9 A;  3ZVW A;  2IWC A;  4N9L A;  1FCM A;  5J8X A;  5HD5 A;  3VP3 A;  2PHY A;  1YLZ A;  1L2S A;  1ERM A;  2D02 A;  5F68 A;  4PAU A;  1MWT A;  4S2N A;  4YNR A;  3EWK A;  1U60 A;  1SDE A;  2XFT A;  1C3B A;  5DTS A;  3NOP C;  5F1G A;  4B4Z A;  4MBF A;  1W63 Q;  3F1N B;  3F1P A;  4GDN A;  3C7V A;  4P6Z S;  2PBY A;  4U0T A;  4B88 A;  4QD4 A;  2ZC5 B;  4WN5 A;  4OOY A;  1IKI A;  3IHB A;  4OPY A;  3S7N A;  4HBT A;  3TW8 A;  1XA1 A;  1STZ A;  5AQ9 A;  1PI5 A;  5IHV A;  4Y17 A;  4OP5 A;  5CHM A;  1BLP A;  3HUM A;  3T12 B;  3BFF A;  4S2N C;  4MN6 A;  4QY6 A;  2VEA A;  4B4X A;  1XA7 A;  4C3Q A;  4EBN A;  3MSH A;  4GHI A;  5EVI D;  2ZM2 A;  1IYQ A;  3G34 A;  4BMW A;  4DF6 A;  1KDS A;  3UB7 A;  2QWS A;  1FIK A;  5GHZ A;  2ZM8 A;  3VE4 A;  2Q9M A;  4IBX A;  4LCM A;  5FQK A;  3S22 A;  4UQI S;  5EM1 A;  4LV1 A;  3LR3 A;  3MZD A;  3H7W A;  4HH3 A;  4E3O A;  3MZE A;  3ZGA B;  4MN5 A;  2H10 A;  4JGR A;  3HLD A;  1YLY A;  4U3T A;  4PM7 A;  3LCE A;  4P6Z M;  3S1Y A;  4WUJ A;  4BBU A;  1PW8 A;  1FCO A;  3IXH A;  1SCW A;  3BFE A;  2Y2J A;  3A3I A;  2A24 B;  4E3K A;  3DWZ A;  1KGF A;  4N92 A;  1S1Z A;  2KLI A;  3B47 A;  3A3F A;  4WEJ A;  5FQQ A;  4Z1W A;  5GL9 A;  4OQG A;  1CEG A;  2JKR I;  3W2Z A;  1ZHH B;  3OPR A;  5IU1 A;  5FAS A;  3BW6 A;  1JWP A;  4LCL A;  3CPT B;  2K2N A;  2QMI A;  3OLO A;  4JXS A;  2BTF P;  1H5X A;  1PWC A;  5CGS A;  1LL9 A;  5FDS A;  4OP8 A;  2HF6 A;  4GCZ A;  4CLC A;  4E04 A;  3T4T A;  3HVF A;  3PBN A;  4M3K A;  4Q0I A;  3IX8 A;  1T18 A;  1K4F A;  2RCX A;  3CLO A;  2M7V A;  2P9V B;  2EFX A;  4QPR A;  4KZ4 A;  3P7N A;  1OJG A;  4MBK A;  4CQH A;  2XD5 A;  1BYW A;  5HD3 A;  2I72 A;  4GB7 A;  5A93 A;  5F6A A;  2ZD8 A;  5BOH A;  2W1T A;  1F5M A;  4CLC C;  2I9V A;  4JF5 A;  2K7S A;  2Y2L A;  1L0D A;  1ERO A;  3TE8 A;  2W1R A;  3S7Q A;  5HAP A;  1OTD A;  1IYO A;  4WYY A;  2C6W B;  5EOO A;  4HIA A;  1J3W A;  3BM6 A;  4YIN A;  2J3W A;  2XLN A;  4S2L A;  4NEE D;  5CEB A;  2Y59 A;  4OLD A;  1LSV A;  2WGV A;  3CIT A;  4ZJ2 A;  2NUP C;  1CF0 A;  2JCH A;  1PWG A;  2ZMV A;  2XRN A;  3FKW A;  2J3T D;  3OPL A;  4I39 A;  4MBH A;  2ZMA A;  2RL3 A;  4DXC A;  5CXW A;  2VV7 A;  2XGN A;  1DJC A;  2PR6 A;  1TVF A;  4IUH A;  4BWI A;  1UGU A;  2ZQ7 A;  2JHE A;  1V9Y A;  1N9N A;  4EQI A;  3Q82 A;  3D3O A;  3IXD A;  4YWZ A;  1S66 L;  5FA7 A;  5F5Y A;  5M19 A;  4GS9 A;  4HES A;  2O9C A;  4S2K A;  2WKR A;  2ZC3 B;  5J4E A;  4YFM A;  1SDN A;  3MMH A;  1D1J A;  3QP5 A;  4RYE A;  4BBV A;  3MFD A;  5F69 A;  2J80 A;  5FQ9 A;  4KG6 A;  2E8J A;  1NY0 A;  5FAO A;  1FQG A;  1E25 A;  4I3I A;  4R4R A;  4G3V A;  2JE5 A;  2HGV A;  5F82 A;  5E2F A;  1ALQ A;  2Y55 A;  3A0V A;  3ZYT A;  1HZO A;  1KOU A;  2VJW A;  3CAX A;  4H8R A;  3LIC A;  1S4R A;  3DBA A;  2JKF A;  3V67 A;  3VOY A;  4X53 A;  1DJB A;  1YLW A;  3ISG A;  2ZC4 B;  3R4K A;  1LI9 A;  2LB9 A;  2J8Y A;  3MJQ A;  3QP1 A;  4H6J B;  5L07 A;  1LHY A;  3WS0 A;  3ZHH A;  1VQQ A;  3ITA A;  3UE1 A;  1CI9 A;  2WKQ A;  2VV6 A;  3NC8 A;  1W79 A;  1T19 A;  2DMW A;  5GLB A;  3R7W B;  3LIA A;  1PZP A;  1CQA A;  1G28 A;  1T1A A;  1MC0 A;  3BY9 A;  4D60 A;  4FTX A;  2QJ7 A;  3SH7 A;  1TDG A;  1CEF A;  2VV8 A;  4HH2 A;  2WKP A;  1ONH A;  4QWO A;  5TBM B;  4KZ6 A;  3A3D A;  3SH9 A;  4R70 A;  5F1F A;  1K38 A;  1OPX A;  2HP9 A;  4X6T A;  1ZG4 A;  3GRJ A;  4GHI B;  3KSF A;  4ME4 A;  1MPL A;  4P0M A;  2WAE A;  1OTE A;  5LBR A;  2Z6C A;  3RFB A;  1N9L A;  1L0E A;  3L9K A;  4KQO A;  3U2A A;  3V3R A;  3OZH A;  4NXE A;  5FEF A;  5JYP A;  2R9X A;  4ARZ B;  3KYE A;  2LB5 A;  5J7E A;  4OQI A;  3MBZ A;  5GHY A;  1PRQ A;  2G2W A;  2W3G A;  1BTL A;  1OTI A;  3C38 A;  3NEC A;  3UE0 A;  5HZH A;  1BLS A;  5A92 A;  3GMW A;  4K91 A;  2Y91 A;  5TJJ A;  3Q7Z A;  4QU3 A;  3T4Q A;  3S4X A;  1AWI A;  1JWZ A;  4KQQ A;  2BAS A;  1YLT A;  3LIF A;  3FZC A;  1T1C A;  5DFX A;  4E6X A;  4M4X A;  2D01 A;  3CPT A;  3PR6 A;  4NET A;  4WF0 A;  2Q0O A;  1PFL A;  3N6I A;  3ZNY A;  1KVL A;  4DXB A;  2ZQC A;  3LYX A;  3BFG A;  2Y2K A;  3NOU C;  4E3M A;  3G30 A;  3B3X A;  2OLU A;  1MWS A;  3VP1 A;  2WGI A;  1S6R A;  1NZO A;  4DE3 A;  4WL9 A;  1P97 A;  2V2F F;  3FPW A;  1KE4 A;  1FOF A;  3WRZ A;  4JXG A;  2P9V A;  1IEL A;  5HX9 A;  2OWJ A;  2GDN A;  1YPR A;  1YM1 A;  4FD8 A;  1PZO A;  1W63 M;  2L1M A;  4BL2 A;  3HLG A;  3GEC A;  3P01 A;  2H28 A;  2Y4A A;  3W4O A;  1N9B A;  2XA7 M;  4GW9 A;  2DRW A;  1YLJ A;  2B02 A;  2H0Y A;  5CER A;  1K55 A;  3QP6 A;  1UWN X;  2XDM A;  3C2W A;  1WE4 A;  1Q2Q A;  2X71 A;  3FG8 A;  3QHY A;  3S7P A;  3B42 A;  4HOI A;  3RXX A;  2B5R A;  1ES3 A;  3MR0 A;  3G35 A;  4ESP A;  4KUK A;  3GTC A;  4FOF A;  1XPB A;  4MEZ A;  5DJT A;  2E8I A;  3VP0 A;  1ZC2 A;  4R3B A;  2J7V A;  1NWZ A;  1K55 C;  3K3C A;  4X1M A;  3GR2 A;  1TF1 A;  1GA9 A;  4K08 A;  3O5Y A;  2IWD A;  2P74 A;  3SZT A;  3T1R A;  2V9A A;  3GSG A;  4X1L A;  5CX7 A;  3O88 A;  4KZ8 A;  2J9O A;  1L0F A;  4EEP A;  1Z09 A;  5A91 A;  4EWF A;  3VMA A;  1G6O A;  2VK3 A;  2OOL A;  4EEU A;  2EA9 A;  3PYP A;  2JC7 A;  1DRM A;  3ICY A;  2Y2Q A;  3AGF A;  2HPB A;  5EE8 A;  3SOI A;  4O8G A;  3W4P A;  2ZQ9 A;  4C75 A;  4FH4 A;  4DKI A;  4U0X A;  5HAR A;  4PKY A;  4HNB A;  5GLC A;  1NRJ A;  5L09 A;  3VP4 A;  1OT6 A;  4DN0 A;  5FAQ A;  3S7O A;  2HZ5 A;  5KZH A;  4H6J A;  3DAV A;  2Y2P A;  1KVM A;  4GNU A;  4DE1 A;  2YKH A;  4OH0 A;  1DP6 A;  4KQR A;  4WZ5 A;  3ITB A;  4NG2 A;  3R7W A;  2O9A A;  1LI0 A;  3UB6 A;  5FAP A;  4Y0O A;  2XF3 A;  4WMC D;  5AQ7 A;  5FQM A;  3UME A;  2ZBB A;  5FI7 A;  5E2E A;  1NRF A;  4WEK A;  2VZW A;  5TBM A;  3HJI A;  4OQH A;  4DJ3 A;  1E3U D;  2P04 A;  5FQJ A;  5EOE A;  3T1Q B;  4P87 A;  2EXA A;  3PXP A;  4OPQ A;  5G4Y A;  4WZ5 C;  2ZC6 B;  1PI4 A;  2ZLY A;  4UA7 A;  2Y2G A;  4B93 A;  2JKT I;  3LR4 A;  2X02 A;  1H3Q A;  3BYD A;  1P9W A;  3KO6 A;  3MXQ A;  3UPN A;  5GLA A;  4EQ1 A;  1QMF A;  4MLL A;  2V1B A;  3QP2 A;  1BZA A;  4IUK A;  4ARZ A;  4ETX A;  3OCL A;  3P98 A;  4HJ6 A;  2EX2 A;  3ZG0 A;  3V3S A;  4P85 A;  3W8K A;  4ETZ A;  3DW0 A;  3EQU A;  3K2N A;  3TJZ C;  5I5L A;  3ZFZ A;  1LL8 A;  2JBF A;  2H5S A;  1AXB A;  4PKY G;  3KSG A;  3BLM A;  4Y15 A;  1OT9 A;  2WZX A;  4XXR A;  4F94 A;  2H0T A;  4O0P A;  2WUQ A;  3FWL A;  4E3J A;  3BEC A;  1LL5 A;  3T4J A;  2YKF A;  5DKL A;  3FYZ A;  1K57 A;  4ZRR A;  3HBR A;  2INW A;  3SW1 A;  4LV0 A;  4PHT A;  3LID A;  4QJG A;  1YAX A;  4QHC A;  4UQI M;  2VGK A;  4JF4 A;  2ZJ9 A;  3Q81 A;  2HJ9 C;  1JNU A;  2ZQA A;  4OKP A;  5KIZ A;  4ID4 A;  2JKT M;  1GSV A;  5DJU A;  5FI2 A;  4CLC E;  2V0W A;  2QZ6 A;  5M18 A;  5HPI A;  2CC1 A;  2OAQ 1;  4BQM A;  1EI5 A;  1QME A;  1K57 C;  3M2J A;  1UWP X;  3LEQ A;  3MKE A;  1TS8 A;  5DF8 A;  1BLC A;  3LI8 A;  1J9M A;  2UWX A;  2XFS A;  1Y54 A;  5E2G A;  2PYP A;  1LT0 A;  5CED A;  2A49 A;  4Z9Q A;  2W3E A;  5TGF A;  1PYY A;  2OSU A;  4HHD A;  3PBS A;  2PAV P;  2PRF A;  5AQB A;  1XP4 A;  1Q2P A;  3JYI A;  5EVI B;  1GSX A;  2QKP A;  3E4Q A;  2MJ6 A;  4JXV A;  5AQA A;  4BD1 A;  1XX2 A;  2PDR A;  4KZB A;  4L9G A;  1D06 A;  4GOG A;  2FZ0 A;  4KG5 A;  4RVA A;  3IHA A;  3MQ0 A;  3EEA A;  2XD1 A;  4LV2 A;  2ACG A;  1K56 A;  1O7E A;  3AGD A;  1T1B A;  3K3D A;  3WS4 A;  1NYY A;  5HWW A;  1GHP A;  2UV0 E;  5A8B A;  5CGX A;  5AVE A;  5G4Z A;  5DKK A;  1YQS A;  1SHV A;  1N9O A;  5CTM A;  4I3J A;  1DP9 A;  4I38 A;  4N9K A;  3DTE A;  1WYB A;  3ZG7 B;  3ZG5 A;  3UDI A;  3GV9 A;  3HRE A;  4EBL A;  3SS3 A;  5DFY A;  4FSF A;  1LSW A;  4LV3 A;  2FFY A;  4RQ9 A;  3KYZ A;  1G6A A;  1HLU P;  3MXS A;  4DE2 A;  2HDU A;  3VFH A;  3UE3 A;  1TEM A;  4JGO A;  2ZQ8 A;  1DY6 A;  3O87 A;  3DTI A;  2ZOH A;  4BEN A;  2Z2L B;  1G68 A;  4CLC D;  3IWO A;  4LRZ E;  1SKO A;  2R78 A;  3N8L A;  2BLS A;  1XJ4 A;  4S2P A;  5E2H A;  3IBJ A;  5HL6 A;  1IYS A;  4N1X A;  2O9B A;  4YOF A;  1TDL A;  4Y0U A;  3TRC A;  1WYC A;  4Y0T A;  3ZQ5 A;  2Y8H A;  3C30 A;  4O7D A;  4P6B A;  2VX8 A;  4IHQ A;  2Z2M B;  2WYX A;  1W5D A;  4R3A A;  3IS2 B;  3KSI A;  4DDY A;  4DJ2 A;  4EV4 A;  1ESU A;  1YKD A;  1ES2 A;  4JBF A;  1MKI A;  5DTK A;  1DP8 A;  3BLS A;  4HJ4 A;  3E4P A;  4OQ0 A;  3NHQ A;  1XGJ A;  4UA6 A;  2KOI A;  4WM9 A;  3HLB A;  4IED A;  1KGE A;  3VOL A;  1K25 A;  5FSR A;  5G18 A;  5HPF A;  1VB6 A;  3LUQ A;  4PPR A;  3WS1 A;  4DDS A;  5HAI A;  4C6Y A;  1K6R A;  1TD5 A;  4GD6 A;  5L10 A;  4GLQ A;  4UA9 A;  4MNR A;  3PHY A;  3U4L P;  2HP5 A;  3LY4 A;  1K4E A;  1H8M A;  4Y5F A;  1VEU B;  1H8Y A;  1XGI A;  5JYO A;  1OTA A;  2L0W A;  4XT2 B;  3CMZ A;  3NUL A;  4QB8 A;  3G2Y A;  1A0K A;  3NBL A;  3A0R A;  5FAT A;  4HJ3 A;  5FQI A;  3WS5 A;  5HAQ A;  5F83 A;  5FEG A;  5CHU A;  3OC2 A;  3T1X A;  3Q1F A;  4FH2 A;  2X01 A;  2B18 A;  4Q8I A;  5HDD A;  3JVU A;  1GA0 A;  3I7J A;  2HDQ A;  3V39 A;  4BLM A;  1X0O A;  4R38 A;  3CG5 A;  5AVF A;  3UMD A;  2EX8 A;  5HL1 A;  3LR0 A;  3JVV A;  3KSH A;  5MC7 A;  1L3L A;  3CI6 A;  3W4Q A;  1ES4 A;  3EQV A;  1XFN A;  5CHJ A;  4KQD A;  4BD0 A;  2EX9 A;  4E3N A;  4E6W A;  3HLF A;  3RJU A;  3EGD C;  3QP8 A;  4EUV A;  4R1G A;  5DTT A;  3D4F A;  3T4L A;  3T4K A;  3UPP A;  5TFQ A;  4LFU A;  1D7E A;  1F2K A;  4DRT A;  3IX3 A;  3BQA A;  5HSQ A;  2PU2 A;  4NKP A;  5HWV A;  4WZ4 A;  4PM8 A;  5KSH A;  3NDG A;  2JN7 A;  4X69 A;  3UN7 A;  2Y2O A;  5EEC A;  2PD7 A;  2HV1 A;  5AJG A;  5HDC A;  5EVI A;  5CTN A;  1MWU A;  3VFF A;  1P9R A;  2PBD P;  2Y2N A;  3ZNT A;  3T4O A;  4X25 A;  3G2Z A;  4GN2 A;  5U47 A;  2EX6 A;  3BY8 A;  2V20 A;  2PYR A;  1LLB A;  3WWX A;  1MY8 A;  1NLZ A;  4BJP A;  2QHK A;  4Q0H A;  3HL9 A;  2ZOI A;  5EVI C;  3GQZ A;  5J3W A;  4B9O A;  4IJG A;  2GJ3 A;  4Q0J A;  1M40 A;  4I5S A;  1OJ5 A;  3UNW A;  3UY6 A;  4GD8 A;  3SH8 A;  4KG2 A;  3DTM A;  3BJN A;  1MBL A;  1N4O A;  4FCF A;  1GCE A;  1GSW A;  1Y4O A;  4HI4 A;  4F3L B;  2V0U A;  3PBR A;  1O07 A;  3BEB A;  4Y2F A;  3C4P A;  4R23 A;  3UB8 A;  4LLO B;  1FIL A;  3OBF A;  3E2K A;  3QP4 A;  2CMN A;  1WA9 A;  2JKG A;  1SKO B;  3A0S A;  3Q7V B;  3N8S A;  3PBQ A;  4KZ9 A;  2WK0 A;  3O86 A;  2Z6D A;  3N4I A;  5GLD A;  3VE3 A;  3N7W A;  1P0Z A;  2BG1 A;  3IT9 A;  3VP2 A;  1YSP A;  3LEZ A;  1I2S A;  1VET A;  3IX4 A;  3KX0 X;  4EER A;  3VOZ A;  4WBG A;  4Y7P A;  3DTK A;  3E4O A;  4S2O A;  1PNE A;  3GDI A;  3BFD A;  1F98 A;  3UB5 P;  5L2F A;  1KDW A;  1S1Y A;  5E43 A;  3M6B A;  3IS2 A;  3IF5 A;  2FH5 A;  1PW1 A;  3UPO A;  2QPN A;  4BBT A;  4L9F A;  3H82 B;  5EFW A;  1FR1 A;  5IT5 A;  3B33 A;  5A90 A;  4KZA A;  5HWT A;  3OPH A;  2EWW A;  4S2I A;  3PTE A;  3SS5 A;  2WGW B;  3IH8 A;  1PWD A;  4OON A;  4JPM A;  3IF6 B;  3IQA A;  3D72 A;  2QJ5 A;  4MMN A;  3LGO A;  1TS7 A;  3KYQ A;  1ES5 A;  2W27 A;  3T50 A;  1GHI A;  1M6K A;  1PIO A;  2W0N A;  1ODV A;  3IWQ A;  5HDS A;  3MKF A;  4MDZ A;  4GDB A;  2WKI A;  4XUZ A;  1VEU A;  1G5U A;  2XRO A;  4XT2 A;  1NZU A;  5IS1 A;  1YLP A;  2J3T C;  3MF0 A;  2V1Z A;  4JF6 A;  2PD8 A;  4HP4 A;  4X56 A;  4EES A;  3F1O A;  2PR5 A;  3E98 A;  1ZKJ A;  4II7 A;  4S2J A;  1BUE A;  4KUO A;  1VHM A;  2V8F A;  4QY5 A;  3TOI A;  4NXF A;  1DJA A;  3OCN A;  1CI8 A;  1KE3 A;  1GHM A;  2VGJ A;  4MCW A;  4IVK A;  4K0W A;  2GZA A;  2HDS A;  2FFF B;  3SS4 A;  3AGE A;  1EW0 A;  4EET B;  2HDR A;  3C4O A;  2A2L A;  1BUL A;  4JKT A;  1NXY A;  3GVB A;  3LIB A;  3BRM A;  2Y2H A;  4G3K A;  4X55 A;  3E0Y A;  4HBU A;  5EVL A;  2V1A A;  2Y79 A;  2M7U A;  5CEC A;  5GHX A;  4UHU A;  4CJN A;  1E4D A;  3ZDJ A;  1RCJ A;  2V8C A;  3CUE A;  3T1S A;  5C5K A;  4LPZ A;  3CJM A;  2P7J A;  2IWB A;  3ZG8 B;  2GX5 A;  2L4R A;  2VLG A;  4LRX C;  5L8M A;  3JPU A;  4A5R A;  4NXG A;  4NK3 A;  1Y28 A;  4DMZ A;  3ZCZ A;  5EV0 A;  3NCK A;  3O3V A;  4AFI A;  3QNB A;  4KZ5 A;  2JKR M;  4G3W A;  1IKG A;  1IYP A;  1SZV A;  5FDH A;  1FR6 A;  1IFQ A;  4WEL A;  2OWH A;  3CUE C;  4HEF A;  1TS6 A;  4CPK A;  3M6H A;  4ZDX A;  5EM0 A;  1CK3 A;  3IWI A;  4GJ4 A;  3ZVT A;  3MFX A;  4KZ3 A;  3IH9 A;  1S4S A;  2VGL S;  3H9W A;  3G31 A;  5FL3 A;  3ZG9 B;  1MZU A;  5M1A A;  3BFC A;  2B95 A;  2ZL1 B;  2KDK A;  5CGW A;  3A3J A;  3LO7 A;  1CJF A;  3LY3 A;  3CZD A;  4N1H A;  4LGW A;  5K5B A;  4S2M A;  2W3H A;  3NY4 A;  2A3U A;  1V9Z A;  3CHW P;  4R3J A;  3D9Y A;  1KGG A;  3BWL A;  3ULF A;  3NIA A;  3VSL A;  1XJ2 A;  4F3L A;  2KX6 A;  2WZZ A;  2XK1 A;  1JWV A;  3FC7 A;  4Y3I A;  2ZC7 A;  1YSQ A;  1W7F A;  3Q7V A;  2Y2I A;  1YMS A;  4L9E A;  3EEH A;  4OOL A;  3HLE A;  4R6L A;  1TS0 A;  3WRT A;  4JGQ A;  2OV5 A;  1FSY A;  2VGL M;  1VET B;  4JLF A;  4ZJ1 A;  2M1C A;  3LR5 A;  1XJ6 A;  2C5W B;  4GZB A;  4PM5 A;  2WKH A;  4KEN B;  1NLY A;  2Y2M A;  4EUZ A;  2G7U A;  2XQZ A;  1LSX A;  4KZ7 A;  3Q07 A;  2EWV A;  1L0G A;  3F1P B;  3UDX A;  2XH9 A;  3F1N A;  4HQA A;  4R4S A;  3DWK A;  2J9P A;  1SKF A;  1RGZ A;  5HW3 A;  4D2O A;  2VKS A;  3V5M A;  1IOU A;  1Z6F A;  2WKE A;  3HUO A;  3H82 A;  1F9I A;  3C7U A;  1OME A;  5I94 A;  1I2W A;  2NUT C;  1HD8 A;  4JXW A;  3PAG A;  3CWF A;  4ZJ3 A;  3NJA A;  2WGW A;  3N8R A;  5D3O A;  3G6O A;  1K54 A;  3IF6 A;  4FUW A;  4Y13 A;  1NYM A;  4HP9 A;  1JTG A;  1BLH A;  3FPV A;  3IXB A;  3RTY A;  3NOT C;  3PAE A;  1ZTU A;  2OAP 1;  3PBT A;  4EXO A;  3H7W B;  4NXB A;  1K56 D;  3HLC A;  1BT5 A;  3PBO A;  1ERQ A;  2AVX A;  3HJK A;  3LIE A;  1K54 C;  4HY8 A;  1H8Z A;  2OLV A;  2ZQD A;  3IF6 C;  1MWR A;  3MXR A;  3IXG A;  4PM9 A;  4RA7 A;  2ZM0 A;  3MQQ A;  3VV4 A;  4EBP A;  2A24 A;  3F1O B;  3C5A A;  5DVA A;  4EW7 A;  3C8C A;  2XA7 S;  1ZG6 A;  4GKU A;  1XFQ A;  1XXM A;  4IBR A;  3G32 A;  2R9W A;  4DE0 A;  4XUX A;  2HJE A;  4L0L A;  4MN7 A;  4ZTK A;  2VA0 A;  4WLA A;  3G4P A;  4RX2 A;  2DCF A;  2ZMF A;  4RX3 A;  1OTB A;  3MS6 A;  4CLC B;  1HVB A;  5FI6 A;  3HCY A;  3UB9 A;  2QYB A;  4LRY C;  4OLG A;  5TR7 A;  3OOV A;  4R0Q A;  2XEP A;  3EGX C;  1I5Q A;  3HUN A;  5EUA A;  1H0M A;  2EXB A;  2EFU A;  4OOM A;  4E3I A;  3LFV A;  1JVJ A;  5EVE A;  4E3L A;  4WMC A;  2DNS A;  4OVD A;  2WAD A;  3UE6 A;  4K0X A;  4OPZ A;  3RXW A;  4PM6 A;  1K6S A;  3NDE A;  3MQO A;  1RGY A;  3UDF A;  2W1T B;  1KE0 A;  1JTD A;  2GNX A;  1E3U A;  1NJ4 A;  4ZBE A;  4BL3 A;  2K31 A;  2W3D A;  1YT4 A;  2IA2 A;  1W8Q A;  3M2K A;  1EWZ A;  1XKZ A;  2XR0 A;  3LI9 A;  2Q9N A;  3RH8 B;  2O0Y A;  1XJ3 A;  2WAF A;  1ONG A;  3FKV A;  3L7H A;  5EPH A;  3OPP A;  2HP6 A;  1W8Y A;  4LEN A;  2G2U A;  4PMA A;  5CRF A;  5KMW A;  4ZAM A;  1RP5 A;  4JGP A;  3HLW A;  4I3A A;  4OPR A;  1YMX A;  1MXO A;  4EU0 A;  2PT7 A;  4X68 A;  2P08 A;  3BQ8 A;  3QNC A;  2W3F A;  2PU4 A;  1VM1 A; 
#chains in the Genus database with same CATH homology
 1BLS A;  5A92 A;  2WKI A;  4XUZ A;  1FSW A;  3GMW A;  1YQS A;  1SHV A;  4K91 A;  5CTM A;  2Y91 A;  5DF7 A;  4N9K A;  3V50 A;  1FCN A;  1NZU A;  3Q7Z A;  1YLP A;  4UAA A;  1WYB A;  4QU3 A;  3ZG7 B;  3E2L A;  3UDI A;  3ZG5 A;  2V1Z A;  3GV9 A;  3HRE A;  4JF6 A;  3S4X A;  1ESI A;  4EBL A;  1JWZ A;  4KQQ A;  5HFO A;  5DF9 A;  3WS2 A;  1YLT A;  3UO9 A;  5KSC A;  3SS3 A;  4X56 A;  1HTZ A;  3MZF A;  4FSF A;  4LV3 A;  2FFY A;  3FZC A;  3FV7 A;  3TSG A;  1ZKJ A;  4E6X A;  1G6A A;  1IEM A;  1S0W A;  4S2J A;  4NET A;  1BUE A;  3N6I A;  1BSG A;  3ZNY A;  3A3E A;  3MXS A;  3NI9 A;  3P09 A;  1KVL A;  4DE2 A;  4DXB A;  2HDU A;  2ZQC A;  3VFH A;  3UE3 A;  3BFG A;  2Y2K A;  1TEM A;  4E3M A;  3G30 A;  3VSK A;  4QY5 A;  3TOI A;  2ZQ8 A;  1DY6 A;  4IVI A;  3O87 A;  3B3X A;  4BEN A;  2OLU A;  3TG9 A;  1DJA A;  2Z2L B;  3OCN A;  1CI8 A;  1MWS A;  1KE3 A;  1GHM A;  2VGJ A;  3ZVW A;  3VP1 A;  2WGI A;  2IWC A;  4N9L A;  1S6R A;  1G68 A;  1FCM A;  1NZO A;  4DE3 A;  5J8X A;  3VP3 A;  3IWO A;  4IVK A;  1YLZ A;  1L2S A;  4K0W A;  2V2F F;  1KE4 A;  1FOF A;  1ERM A;  2HDS A;  2FFF B;  3WRZ A;  3SS4 A;  3AGE A;  4JXG A;  3N8L A;  2HDR A;  1IEL A;  2P9V A;  1MWT A;  3C4O A;  4S2N A;  5HX9 A;  2BLS A;  2GDN A;  1YM1 A;  1BUL A;  1U60 A;  4FD8 A;  4JKT A;  1SDE A;  4S2P A;  5E2H A;  1NXY A;  1PZO A;  3GVB A;  2XFT A;  1IYS A;  4BL2 A;  3BRM A;  1C3B A;  3HLG A;  5DTS A;  2Y2H A;  4N1X A;  4X55 A;  4HBU A;  5F1G A;  4B4Z A;  1TDL A;  4Y0U A;  4MBF A;  1WYC A;  5EVL A;  4Y0T A;  4GDN A;  2Y4A A;  3C7V A;  5CEC A;  2PBY A;  4U0T A;  4O7D A;  3W4O A;  1N9B A;  5GHX A;  4B88 A;  4QD4 A;  4P6B A;  4UHU A;  2ZC5 B;  2DRW A;  4CJN A;  1E4D A;  3ZDJ A;  1YLJ A;  2Z2M B;  2H0Y A;  4OOY A;  1IKI A;  1RCJ A;  3IHB A;  2WYX A;  1W5D A;  4OPY A;  4HBT A;  5CER A;  1K55 A;  3CJM A;  4DDY A;  1XA1 A;  5AQ9 A;  2XDM A;  1PI5 A;  1WE4 A;  5IHV A;  2IWB A;  3ZG8 B;  4GDB A;  4OP5 A;  4EV4 A;  1Q2Q A;  5CHM A;  2X71 A;  1ESU A;  1BLP A;  3HUM A;  4A5R A;  3BFF A;  3QHY A;  4S2N C;  4QY6 A;  1ES2 A;  4NK3 A;  3RXX A;  4B4X A;  1XA7 A;  4JBF A;  2B5R A;  1MKI A;  3ZCZ A;  5DTK A;  3BLS A;  1ES3 A;  3NCK A;  4C3Q A;  4EBN A;  3O3V A;  5EVI D;  2ZM2 A;  1IYQ A;  3G34 A;  3G35 A;  4OQ0 A;  4DF6 A;  1XGJ A;  3QNB A;  4UA6 A;  3GTC A;  4KZ5 A;  1KDS A;  1IKG A;  3HLB A;  4WM9 A;  4IED A;  1IYP A;  1XPB A;  1KGE A;  4MEZ A;  5FDH A;  2ZM8 A;  5GHZ A;  1K25 A;  2Q9M A;  1FR6 A;  4IBX A;  5FSR A;  5G18 A;  2E8I A;  4LCM A;  3VP0 A;  5FQK A;  4WEL A;  4PPR A;  3S22 A;  1ZC2 A;  4R3B A;  3WS1 A;  2J7V A;  5HAI A;  4C6Y A;  1K55 C;  4HEF A;  4DDS A;  4CPK A;  3GR2 A;  3M6H A;  1K6R A;  3MZD A;  4LV1 A;  4ZDX A;  1CK3 A;  3IWI A;  1GA9 A;  4GD6 A;  4UA9 A;  3ZVT A;  4E3O A;  2IWD A;  4KZ3 A;  3MZE A;  3ZGA B;  2H10 A;  3IH9 A;  2P74 A;  3HLD A;  4MNR A;  1YLY A;  4U3T A;  4PM7 A;  2HP5 A;  3LY4 A;  3LCE A;  1K4E A;  3G31 A;  3ZG9 B;  3S1Y A;  3GSG A;  1PW8 A;  5M1A A;  3BFC A;  1FCO A;  1H8Y A;  1XGI A;  3IXH A;  1SCW A;  5JYO A;  3BFE A;  2Y2J A;  5CGW A;  3A3I A;  3O88 A;  4KZ8 A;  2J9O A;  3A3J A;  3CMZ A;  3LO7 A;  4QB8 A;  4E3K A;  3DWZ A;  1L0F A;  3G2Y A;  3LY3 A;  1KGF A;  3NBL A;  3CZD A;  4N1H A;  4N92 A;  5FAT A;  4S2M A;  5A91 A;  3NY4 A;  2A3U A;  5FQI A;  3WS5 A;  3A3F A;  4EWF A;  4R3J A;  4WEJ A;  5FQQ A;  3VMA A;  5HAQ A;  5F83 A;  5GL9 A;  1KGG A;  1CEG A;  4OQG A;  2JC7 A;  3NIA A;  5CHU A;  3OC2 A;  3OPR A;  5FAS A;  2Y2Q A;  3AGF A;  1JWP A;  2HPB A;  5EE8 A;  3Q1F A;  3SOI A;  3VSL A;  4LCL A;  3W4P A;  4FH2 A;  2ZQ9 A;  2X01 A;  4C75 A;  4Q8I A;  4FH4 A;  2WZZ A;  4DKI A;  2QMI A;  4U0X A;  1GA0 A;  4JXS A;  5HAR A;  2XK1 A;  1H5X A;  1JWV A;  1PWC A;  3I7J A;  5GLC A;  2HDQ A;  3V39 A;  4BLM A;  3VP4 A;  5CGS A;  2ZC7 A;  1LL9 A;  5FAQ A;  4OP8 A;  1W7F A;  3CG5 A;  3Q7V A;  2Y2I A;  1YMS A;  5KZH A;  4OOL A;  3HVF A;  2EX8 A;  2Y2P A;  3HLE A;  3PBN A;  4M3K A;  5HL1 A;  3WRT A;  1K4F A;  2RCX A;  1FSY A;  2OV5 A;  4JLF A;  3W4Q A;  1KVM A;  4GNU A;  4DE1 A;  4ZJ1 A;  2P9V B;  1ES4 A;  4OH0 A;  3EQV A;  5CHJ A;  2EFX A;  4KQR A;  2C5W B;  4WZ5 A;  3ITB A;  4GZB A;  4PM5 A;  4KZ4 A;  2WKH A;  4BD0 A;  4KEN B;  2EX9 A;  4E3N A;  4E6W A;  4MBK A;  2Y2M A;  4EUZ A;  2XQZ A;  3HLF A;  3RJU A;  2XD5 A;  1LI0 A;  4KZ7 A;  3Q07 A;  5FAP A;  4Y0O A;  1L0G A;  4R1G A;  5DTT A;  3D4F A;  2XH9 A;  2XF3 A;  4WMC D;  5AQ7 A;  3UDX A;  2I72 A;  4GB7 A;  5A93 A;  5FQM A;  3UPP A;  5TFQ A;  5FI7 A;  4R4S A;  3DWK A;  1NRF A;  2J9P A;  2ZD8 A;  4WEK A;  5E2E A;  4DRT A;  5BOH A;  4JF5 A;  1SKF A;  1RGZ A;  2PU2 A;  2Y2L A;  4OQH A;  5HW3 A;  4D2O A;  1L0D A;  4WZ4 A;  1ERO A;  4PM8 A;  3V5M A;  1Z6F A;  2WKE A;  1E3U D;  3HUO A;  3NDG A;  5HAP A;  5KSH A;  4X69 A;  5FQJ A;  3UN7 A;  1IYO A;  2Y2O A;  4WYY A;  3C7U A;  5EOE A;  2C6W B;  1OME A;  5EEC A;  1I2W A;  5EOO A;  4P87 A;  5I94 A;  2EXA A;  4OPQ A;  1HD8 A;  4JXW A;  3PAG A;  4WZ5 C;  5EVI A;  4ZJ3 A;  3BM6 A;  2ZC6 B;  1MWU A;  2WGW A;  3N8R A;  5CTN A;  4YIN A;  1PI4 A;  5D3O A;  3VFF A;  2Y2N A;  2ZLY A;  2XLN A;  4UA7 A;  1K54 A;  2Y2G A;  4S2L A;  3ZNT A;  5CEB A;  2Y59 A;  3IF6 A;  3G2Z A;  4GN2 A;  4OLD A;  2X02 A;  2WGV A;  3BYD A;  1NYM A;  4ZJ2 A;  5U47 A;  2JCH A;  2EX6 A;  1PWG A;  1JTG A;  3UPN A;  1BLH A;  5GLA A;  1QMF A;  3FKW A;  3OPL A;  3IXB A;  4MLL A;  2V20 A;  4MBH A;  2ZMA A;  2RL3 A;  1LLB A;  4DXC A;  3PAE A;  3WWX A;  1MY8 A;  5CXW A;  3PBT A;  1BZA A;  3OCL A;  2XGN A;  1DJC A;  1K56 D;  3P98 A;  4BJP A;  2EX2 A;  3HLC A;  1BT5 A;  3V3S A;  1TVF A;  4P85 A;  3PBO A;  3HL9 A;  3ZG0 A;  3W8K A;  2ZQ7 A;  4EQI A;  3DW0 A;  3Q82 A;  3EQU A;  3IXD A;  5EVI C;  5FA7 A;  3GQZ A;  5M19 A;  1ERQ A;  4HES A;  1K54 C;  4S2K A;  2ZC3 B;  3ZFZ A;  1H8Z A;  2OLV A;  2ZQD A;  3IF6 C;  1MWR A;  2JBF A;  1M40 A;  3IXG A;  3MXR A;  5CGX A;  2H5S A;  3UNW A;  4PM9 A;  4YFM A;  4RA7 A;  1AXB A;  3UY6 A;  2ZM0 A;  1SDN A;  3BLM A;  4GD8 A;  2WZX A;  3SH8 A;  4XXR A;  4EBP A;  4KG2 A;  3C5A A;  4RYE A;  4F94 A;  3DTM A;  5DVA A;  3MFD A;  2H0T A;  5FQ9 A;  2WUQ A;  3FWL A;  4KG6 A;  1ZG6 A;  4GKU A;  1NY0 A;  4E3J A;  5FAO A;  1FQG A;  3BEC A;  1LL5 A;  1E25 A;  1XXM A;  4IBR A;  1MBL A;  1N4O A;  4FCF A;  1GCE A;  3FYZ A;  1K57 A;  3G32 A;  2R9W A;  4R4R A;  4DE0 A;  3HBR A;  2JE5 A;  4LV0 A;  4XUX A;  3PBR A;  5F82 A;  5E2F A;  4QJG A;  1O07 A;  1ALQ A;  2Y55 A;  3BEB A;  4QHC A;  4L0L A;  1HZO A;  3C4P A;  4H8R A;  2VGK A;  4ZTK A;  4R23 A;  4JF4 A;  2ZJ9 A;  3Q81 A;  3VOY A;  4X53 A;  3E2K A;  1DJB A;  1YLW A;  2ZQA A;  3G4P A;  3ISG A;  4RX2 A;  2DCF A;  2ZC4 B;  4OKP A;  1LI9 A;  4RX3 A;  2J8Y A;  4ID4 A;  3Q7V B;  3N8S A;  1HVB A;  3PBQ A;  4KZ9 A;  2WK0 A;  3O86 A;  5FI2 A;  5FI6 A;  2QZ6 A;  3N4I A;  1LHY A;  5GLD A;  3WS0 A;  3ZHH A;  4OLG A;  3N7W A;  5M18 A;  1VQQ A;  5TR7 A;  2CC1 A;  3ITA A;  3UE1 A;  1CI9 A;  2XEP A;  4R0Q A;  4BQM A;  2BG1 A;  1EI5 A;  1I5Q A;  3HUN A;  3IT9 A;  5EUA A;  3VP2 A;  1QME A;  3NC8 A;  1I2S A;  1W79 A;  3LEZ A;  1K57 C;  2EXB A;  2EFU A;  3M2J A;  3VOZ A;  4OOM A;  5GLB A;  4E3I A;  4WBG A;  4Y7P A;  1JVJ A;  3MKE A;  1PZP A;  5DF8 A;  4E3L A;  1BLC A;  4S2O A;  4WMC A;  1J9M A;  2UWX A;  2XFS A;  1Y54 A;  5E2G A;  2DNS A;  4OVD A;  2WAD A;  4K0X A;  3BFD A;  4OPZ A;  3RXW A;  4PM6 A;  5CED A;  1K6S A;  2A49 A;  3NDE A;  5L2F A;  3SH7 A;  1TDG A;  4Z9Q A;  1RGY A;  1CEF A;  1KDW A;  3M6B A;  5E43 A;  5TGF A;  3UDF A;  1KE0 A;  1ONH A;  3IF5 A;  1PW1 A;  1JTD A;  4KZ6 A;  3A3D A;  1E3U A;  1PYY A;  3UPO A;  1NJ4 A;  2OSU A;  2QPN A;  4ZBE A;  3SH9 A;  4BL3 A;  5F1F A;  1K38 A;  1YT4 A;  2HP9 A;  3PBS A;  4X6T A;  1ZG4 A;  1FR1 A;  3GRJ A;  1W8Q A;  4KZA A;  5A90 A;  5AQB A;  1XP4 A;  1MPL A;  1Q2P A;  3JYI A;  3M2K A;  1EWZ A;  1XKZ A;  3OPH A;  4P0M A;  4S2I A;  2XR0 A;  2Q9N A;  5EVI B;  2WAE A;  3PTE A;  3SS5 A;  2WGW B;  3IH8 A;  1PWD A;  2WAF A;  1ONG A;  3FKV A;  4OON A;  1L0E A;  4JXV A;  4JPM A;  5AQA A;  4BD1 A;  4KQO A;  3IF6 B;  3IQA A;  1XX2 A;  3V3R A;  4KZB A;  5EPH A;  3OPP A;  4GOG A;  3OZH A;  4KG5 A;  2HP6 A;  1W8Y A;  4LEN A;  4RVA A;  2G2U A;  1ES5 A;  3IHA A;  4PMA A;  2XD1 A;  5CRF A;  5KMW A;  4LV2 A;  4ZAM A;  1RP5 A;  1GHI A;  3HLW A;  5JYP A;  2R9X A;  1K56 A;  1O7E A;  3AGD A;  4OPR A;  1M6K A;  1YMX A;  1MXO A;  1PIO A;  4OQI A;  1NYY A;  3MBZ A;  3WS4 A;  4X68 A;  1GHP A;  5GHY A;  3QNC A;  2G2W A;  3IWQ A;  1BTL A;  3MKF A;  3UE0 A;  2PU4 A;  1VM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...