4PMAA

Crystal structure of ctx-m-14 s70g:s237a:r276a beta-lactamase at 1.39 angstroms resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
b'QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGAGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRADVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-14
molecule tags Hydrolase
source organism Klebsiella pneumoniae subsp. pneumoniae
publication title Molecular Basis for the Catalytic Specificity of the CTX-M Extended-Spectrum beta-Lactamases.
pubmed doi rcsb
total genus 93
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4pmaA00
1PZPA 3N4IA 4RVAA 3UY6A 2ZM8A 1LL5A 1W7FA 1JTGA 4BENA 1Z6FA 4KZBA 5HAQA 3DTMA 2Y2MA 3SS5A 1DJCA 4OQGA 5D3OA 1M40A 5AQBA 1ZC2A 2Y4AA 2WK0A 4JXVA 1RGYA 5DTTA 2WKIA 3ZG5A 1K4EA 4M3KA 1XA1A 4RYEA 2WUQA 3HLCA 3Q82A 3SH7A 3ZVTA 2WYXA 1NZOA 1KGGA 3GSGA 5EVIA 2ZM2A 4MEZA 2ZJ9A 3IF6C 1FSYA 3VFFA 2WGVA 2DRWA 4IBXA 4OLGA 2XFSA 3LY4A 3NBLA 4KZ3A 2WKHA 4IVKA 2CC1A 2J9OA 3BFGA 1K54C 2ZLYA 1BUEA 2ZQDA 3C4OA 4GN2A 3BRMA 4WZ4A 2WZZA 5A91A 1JWPA 5E2FA 3HLGA 1CEFA 1CK3A 1KE4A 3N7WA 1FOFA 4HBTA 5EVID 1KVMA 4OVDA 1S0WA 3LO7A 5CTNA 4DE1A 4KZ6A 4KG5A 5FI7A 4X55A 3RXWA 3OPRA 3ZG7B 1PZOA 4GD8A 3SH8A 2ZQ9A 4XUXA 1TDGA 2HP9A 1J9MA 4JF4A 1W8QA 5L2FA 4C6YA 4E3KA 5FA7A 1H8YA 5AQ7A 2QPNA 1NY0A 4OOLA 4P87A 5CECA 4P6BA 1MBLA 1LLBA 1K56A 3HLWA 1SDEA 1MWSA 3UPNA 2Q9NA 4R4SA 1K4FA 5M19A 1XPBA 1DY6A 1MPLA 1N9BA 1ONHA 3NI9A 4LV3A 5CGXA 3FKVA 5EE8A 3BECA 4RX3A 3MXSA 2DCFA 1K56D 4X53A 3UNWA 1HZOA 4FH2A 1I5QA 3BM6A 3GV9A 4PM7A 4JF5A 4S2NA 5F82A 4OH0A 1IYOA 2XEPA 3VOZA 5GHZA 3ZG0A 4U3TA 2Y2IA 3TSGA 5U47A 3NC8A 3CZDA 1PWCA 3PBOA 4DF6A 4E6WA 3I7JA 2HPBA 2XQZA 1BLCA 1FCMA 2A3UA 3MZDA 5CRFA 1TDLA 3IQAA 4S2PA 4Y0TA 1H5XA 5G18A 3PBSA 4S2LA 3V5MA 4UA9A 3PAGA 1I2WA 4BD0A 1ES4A 4DXBA 1KGEA 4GD6A 4OP5A 3BFEA 4PM6A 2EX2A 1ES2A 3N8LA 4LV0A 3UDXA 5E43A 4WEJA 2EXAA 3VP3A 3G2YA 3QNCA 4JKTA 1BLHA 4ZBEA 2JBFA 4MBKA 1SDNA 5IHVA 2WADA 3VOYA 3A3EA 1IELA 1W5DA 3M6BA 3ITBA 3MFDA 1IYPA 4ZJ1A 3UN7A 3W8KA 3FV7A 4YFMA 4EBNA 4RX2A 4FCFA 5FSRA 1XXMA 4C75A 4ID4A 2EFUA 5F1GA 3UO9A 4F94A 1AXBA 1W79A 1GCEA 1QMEA 3CG5A 3VMAA 2WZXA 5DF7A 4QY6A 2QZ6A 5FQJA 3HUMA 1I2SA 3ITAA 2IWDA 3HUNA 3MZFA 5M1AA 1IKIA 1K6RA 1PIOA 4WMCD 3IXGA 5GHXA 2JCHA 4PM9A 5HL1A 1S6RA 2Y2QA 3FZCA 2WAFA 4N92A 4PPRA 3ZDJA 4OPYA 4A5RA 2VGJA 4GDNA 3E2LA 1MWRA 3ISGA 5JYPA 3VP4A 1QMFA 1HTZA 3LCEA 4KENB 3C7UA 4D2OA 5GLAA 3OC2A 4FH4A 4X68A 4E3OA 2EXBA 3HLBA 5CERA 1L0FA 4QHCA 2PBYA 3BEBA 2VGKA 5CTMA 4CJNA 3UE1A 5CHMA 4WM9A 4N1XA 1LL9A 1YT4A 4DE3A 1IYSA 3WS1A 2XK1A 1H8ZA 3G31A 2ZMAA 5BOHA 3SOIA 1KDWA 3G34A 1FSWA 2EX8A 5DF9A 2WKEA 5GL9A 3V39A 3A3IA 3HLDA 3ZGAB 1CEGA 2OLVA 4ZTKA 3ZG8B 1VM1A 4U0XA 2WAEA 4KG2A 1K54A 5FQKA 2Y91A 4EUZA 1K25A 4IBRA 2UWXA 4OPZA 1HVBA 1VQQA 5TR7A 4QY5A 3IH8A 2G2UA 3GR2A 3E2KA 3M2JA 4IVIA 3FWLA 5KZHA 3IXHA 4Y0OA 1MWUA 2ZD8A 4EQIA 4KZ8A 1KGFA 1ESIA 3GMWA 3Q81A 5GLBA 4Y7PA 5A90A 4KZ5A 1YLPA 5FAOA 1NRFA 5F1FA 2HDSA 4S2OA 1XX2A 2Z2MB 3WS2A 4OP8A 5KSCA 1GA9A 4S2MA 4JPMA 4BL3A 5A93A 4KZ7A 3IXDA 3N8SA 4DDSA 5CEDA 1YLZA 3OPPA 4EBLA 1XA7A 2HDUA 1FR1A 3FYZA 5EPHA 2ZC5B 4BL2A 4R4RA 4UA6A 4S2JA 2Y2JA 2X01A 5DTKA 2ZQ7A 3IF5A 1NYYA 2HP6A 2C6WB 5E2EA 3ZFZA 1K57A 3UDIA 1MY8A 4IEDA 5HAIA 3W4OA 1E3UD 4EV4A 4OQIA 5HAPA 3AGDA 2X02A 4NETA 4S2NC 4KZ4A 2EFXA 1MXOA 2E8IA 2A49A 2HP5A 2ZM0A 1CI8A 4QD4A 1C3BA 4E6XA 2Y2NA 3WS5A 5F83A 2XD5A 5EVIC 3ZVWA 4KQQA 3DWKA 4OPRA 4HESA 3N6IA 3IF6A 1SHVA 2G2WA 2HDRA 3UE3A 3SH9A 3AGEA 3OCNA 4KQRA 3SS4A 3EQUA 2PU4A 5CGWA 2Y2HA 1ZG6A 2XH9A 3PBTA 1W8YA 4GDBA 4X6TA 1IYQA 3B3XA 1XGIA 4WYYA 5FQIA 3HLEA 3CJMA 3VP2A 4B4ZA 4P0MA 1FR6A 1JWVA 1PI5A 1ZG4A 4KZ9A 5HW3A 1XGJA 3HLFA 4LV1A 3O86A 3QNBA 3MZEA 5CXWA 3RJUA 2P74A 4XXRA 5KSHA 3TG9A 3IWOA 3MKEA 4WEKA 3HUOA 2BLSA 2EX9A 4X69A 1KE3A 4ZAMA 2EX6A 1ERMA 1NXYA 3C7VA 1YMSA 4B4XA 4JXWA 1CI9A 1BT5A 2WGIA 5JYOA 2XGNA 1GHMA 3P09A 4E3JA 3VP0A 4KG6A 4FSFA 1YLTA 5HFOA 2RCXA 3OZHA 3V3RA 4DKIA 3OCLA 2XDMA 4UAAA 1ESUA 5GLCA 5AQ9A 1SCWA 1SKFA 1Q2QA 4Q8IA 2P9VA 2I72A 3C5AA 1WYBA 4MNRA 5GLDA 4K0WA 2JC7A 4DDYA 3W4QA 1K6SA 3DW0A 2XLNA 2ZQCA 3DWZA 1L0EA 3IWQA 3S22A 2Y2GA 4FD8A 1BLSA 2V2FF 5E2HA 4RA7A 3UDFA 5EVLA 2R9WA 2H5SA 1K38A 1K55A 5CGSA 4DRTA 1YLYA 3VP1A 4KQOA 3UPPA 3PTEA 3UPOA 2B5RA 1ERQA 2RL3A 3D4FA 4N9KA 4JBFA 5EECA 3MXRA 1M6KA 2XD1A 4ZJ3A 3O88A 4GB7A 4NK3A 5DTSA 1PYYA 2DNSA 4H8RA 3BYDA 2H0YA 3V3SA 4S2IA 5EVIB 4ZDXA 3W4PA 4BQMA 4OKPA 1BSGA 1ALQA 4WMCA 5J8XA 4OONA 1DJBA 2ZQ8A 3IHBA 5AQAA 1LI9A 3O3VA 5FAPA 3UE0A 2V1ZA 1PWGA 1PW8A 3LY3A 2X71A 3PBNA 4R3JA 3WRTA 1IKGA 5GHYA 5I94A 1OMEA 4N9LA 1LHYA 1ONGA 3M2KA 3PBRA 3VSLA 1K57C 1BZAA 2XF3A 4WZ5C 1KE0A 1KVLA 1XKZA 1TEMA 1YMXA 1PI4A 4JF6A 4QU3A 4R3BA 3M6HA 1KDSA 1E25A 4JXGA 2V20A 3WS4A 5EOEA 5HARA 3ZHHA 4L0LA 1U60A 4YINA 4MBHA 1IEMA 1JWZA 2ZQAA 4DE0A 2FFYA 3RXXA 1NJ4A 1YLWA 1N4OA 2OSUA 5CHUA 2OLUA 2H0TA 4K0XA 5FQ9A 4GOGA 5EUAA 4WELA 1E3UA 1ES3A 4X56A 3O87A 5FDHA 4OQHA 3S1YA 4P85A 3ZCZA 5FI2A 4WZ5A 2FFFB 1L0GA 1GHPA 5FAQA 3IH9A 4LCLA 1G6AA 3QHYA 1Y54A 4UA7A 3TOIA 3IWIA 3Q7VB 2PU2A 3G35A 3MBZA 1RGZA 1K55C 3Q7VA 1GHIA 3NDGA 5TGFA 1PW1A 4PM5A 3C4PA 4JXSA 3GTCA 5TFQA 4BLMA 2JE5A 4E3NA 3JYIA 3BLMA 2Y2LA 2ZC3B 5A92A 4Z9QA 3S4XA 4LENA 3V50A 3A3JA 3PAEA 4OLDA 3BFDA 2J9PA 5DF8A 5M18A 4UHUA 1O7EA 3LEZA 3MKFA 3NY4A 3OPLA 1BTLA 3PBQA 1MKIA 4JLFA 2Y2OA 3AGFA 4B88A 4BD1A 4DE2A 2H10A 3WWXA 4ZJ2A 2ZC7A 4R23A 3P98A 4E3IA 4E3MA 4BJPA 2P9VB 4WBGA 1YQSA 2ZC6B 1WYCA 3A3DA 1ES5A 2WGWA 3IHAA 1FCOA 1ZKJA 2ZC4B 3GVBA 2WGWB 4QB8A 4OPQA 5FASA 3CMZA 4O7DA 3SS3A 2QMIA 3NIAA 4XUZA 5FATA 3IXBA 1MWTA 1O07A 1LI0A 1FCNA 3IT9A 2IWBA 5CEBA 1WE4A 4OQ0A 2Z2LB 3HBRA 2Y2PA 3HVFA 5KMWA 2HDQA 4OOYA 1TVFA 4DXCA 1PWDA 4U0TA 4R0QA 3Q7ZA 3G2ZA 1RP5A 2IWCA 3IF6B 1E4DA 2BG1A 4HEFA 3EQVA 5E2GA 1L2SA 2OV5A 3BLSA 1G68A 5EOOA 1BLPA 2Q9MA 3G4PA 4OOMA 3ZNTA 2J7VA 1XP4A 4KZAA 4PM8A 4GKUA 2Y55A 4S2KA 1EWZA 3FKWA 4Y0UA 1YM1A 3ZNYA 3NCKA 1RCJA 3VFHA 4MLLA 5HX9A 4CPKA 4E3LA 4MBFA 2J8YA 3Q07A 4C3QA 4N1HA 1JTDA 1YLJA 4PMAA 4R1GA 1L0DA 4GZBA 1NZUA 1EI5A 2XR0A 1EROA 5DVAA 3ZG9B 1NYMA 4GNUA 1JVJA 3BFCA 1BULA 4EWFA 1FQGA 4LCMA 3HREA 3GQZA 2GDNA 3GRJA 3WRZA 4EBPA 3OPHA 4HBUA 5CHJA 1GA0A 3A3FA 3HL9A 1HD8A 2C5WB 3BFFA 4K91A 3WS0A 3VSKA 4QJGA 2Y59A 5FQMA 5FQQA 1Q2PA 3NDEA 3G32A 4LV2A 2XFTA 3N8RA 5FI6A 3Q1FA 1DJAA 2R9XA 2Y2KA 3G30A
chains in the Genus database with same CATH superfamily
4RVAA 2VKSA 3QP2A 3D3OA 3IBJA 5HAQA 1F9IA 1XJ3A 3S7QA 5D3OA 1M40A 2LB9A 1RGYA 5DTTA 2WKIA 1XA1A 2WKQA 2WYXA 5HWVA 1KGGA 2WGVA 2XFSA 4PHTA 4IVKA 4G3KA 2B02A 2B95A 3T50A 4O0PA 4WZ4A 3LIBA 1JWPA 4PKYG 1KE4A 3N7WA 4HBTA 4OVDA 1S0WA 5CTNA 4KZ6A 3TE8A 5FI7A 4X55A 3RXWA 3ZG7B 2MJ6A 2OWHA 3SH8A 1J9MA 1X0OA 4LRZE 2V1AA 4JF4A 4GLQA 1H8YA 5AQ7A 4P6BA 5CGXA 1XPBA 1ONHA 2XA7M 3MXSA 4G3WA 1N9OA 4FH2A 4PM7A 4JF5A 4OH0A 3VOZA 2VLGA 3ZG0A 4U3TA 3PBOA 4EXOA 2HPBA 1BLCA 3E4QA 3MZDA 3IQAA 4Y0TA 5DFXA 3V5MA 3VE4A 1N9LA 4UA9A 2O9BA 4GD6A 4OP5A 3BFEA 2Z6DA 3UDXA 3G6OA 4JKTA 3GDIA 4ZBEA 4MBKA 2WADA 3VOYA 3A3EA 3MFDA 3W8KA 3UN7A 3K3CA 2EFUA 5F1GA 3UO9A 1AXBA 2PHYA 1DP9A 1QMEA 3VMAA 5DF7A 3HUMA 4PKYA 5HDCA 4LPZA 5GHXA 4PM9A 3FZCA 4OPYA 3PR6A 4Q0HA 3ISGA 1IOUA 3LCEA 4KENB 3C7UA 5GLAA 4FH4A 4GW9A 2R78A 1IFQA 5CTMA 5DJUA 4WM9A 2XK1A 4P6ZM 1N9NA 2PD7A 3LIFA 4R70A 1KDWA 5DF9A 2WKEA 5GL9A 3A3IA 3ZGAB 2VV7A 4YOFA 4DN0A 3VOLA 4EUZA 5TR7A 3IH8A 3HJKA 3M2JA 4IVIA 3QP1A 3FWLA 5KZHA 2ZD8A 4EQIA 4EERA 4KZ8A 1UGUA 5A90A 1YLPA 1SKOA 4X25A 1MZUA 4S2OA 4Q0JA 1XX2A 2Z2MB 4OP8A 1GA9A 3T1QB 3IXDA 3N8SA 2BASA 4DDSA 5EPHA 4R38A 4R4RA 2X01A 4S2JA 2GZAA 1Y4OA 4E04A 1S1YA 2C6WB 1K57A 2Z6CA 3UB8A 5HAPA 1V9YA 4S2NC 2HP5A 5HSQA 4FOFA 5F83A 3DWKA 4CLCB 2PAVP 3N6IA 3IS2A 3H7WA 3C30A 2ZMFA 3SH9A 4KQRA 1OTBA 1UWPX 1ZG6A 4GHIA 4IUHA 1IYQA 3B3XA 5FQIA 1NWZA 4B4ZA 1FR6A 1JWVA 4LV1A 5KSHA 2P7JA 5CXWA 4XXRA 3TG9A 1ZHHB 3IWOA 3T4QA 4WEKA 4X1LA 1BT5A 2PD8A 4E3JA 4AFIA 2OAQ1 2QYBA 3LEQA 1ESUA 5AQ9A 4NXBA 2I72A 3C5AA 1WYBA 2JC7A 2PBDP 2J80A 2QJ7A 3W4QA 1K6SA 3FC7A 2XLNA 1L0EA 3S22A 4FD8A 4RA7A 3TJZC 1K55A 3S7OA 2O0YA 3LGOA 5DKKA 2RL3A 3MXRA 2XD1A 2W1TA 3O88A 3KSIA 2E8JA 2M7VA 5DTSA 3T4JA 4F3LB 3BYDA 2H0YA 5EVIB 4ZDXA 3P01A 1P9WA 1OTIA 5AQAA 1LI9A 5FAPA 1PWGA 1PW8A 3LY3A 5IT5A 4Z1WA 1IKGA 3CWFA 1K57C 1BZAA 2XF3A 4ZRRA 4II7A 2KX6A 4JF6A 3B42A 1MC0A 2V20A 2ZL1A 4YINA 3T4TA 3KSFA 5AVFA 4F3LA 3MFXA 2OLUA 5FQ9A 1DP6A 4I3JA 2ZOHA 2KLIA 5FI2A 4WZ5A 1L0GA 1GHPA 3K2NA 3QHYA 1Y54A 4UA7A 3TOIA 3IWIA 1CQAA 2PU2A 1K0KA 1GHIA 2PRFA 5G4YA 4PM5A 1XFNA 4E3NA 2Y2LA 4Z9QA 4LENA 3LICA 3A3JA 4D60A 5M18A 3MKFA 1MKIA 4JLFA 2Y2OA 1S4SA 2H10A 3WWXA 4R23A 3EGDC 2P9VB 2ZC6B 4HJ4A 4WF0A 1ES5A 2WGWA 2OOLA 2ZC4B 3GVBA 3CMZA 2QMIA 4XUZA 5IS1A 1LI0A 1P97A 1WE4A 2Y2PA 3PHYA 3T4OA 4HQAA 1YSQA 3GECA 1PWDA 2Y79A 4BBTA 3Q7ZA 3IF6B 2BG1A 5IU1A 5EOOA 1BLPA 3G4PA 4OOMA 3ZNTA 1H8MA 2J7VA 3MQOA 4NEED 4GKUA 2Y55A 3MJQA 1EWZA 3KSGA 4MCWA 4MLLA 3A0SA 4CPKA 4E3LA 2J8YA 3EWKA 3Q07A 1YLJA 5J4EA 1L0DA 1NZUA 5DJTA 2EWWA 3O5YA 3BFCA 1SZVA 3HREA 2GDNA 4HOIA 3A3FA 3HL9A 1HD8A 2GNXA 2YKHA 4K91A 4ARZB 3VSKA 1UWNX 1BYWA 5FQQA 1Q2PA 5HDDA 2A24B 3NDEA 4LV2A 1DJAA 2Y2KA 1W63Q 3N4IA 3UY6A 3MQQA 1LL5A 5HPFA 5KIZA 2Y2MA 1DJCA 2HF6A 4OQGA 2JKFA 2A2LA 3HLCA 3SH7A 2ZM2A 2DRWA 2A24A 3BY8A 4KZ3A 3BFGA 3LI9A 1BUEA 4GN2A 3BRMA 5E2FA 1L3LA 1CEFA 1CK3A 1FOFA 3CPTA 1KVMA 4DJ2A 4DE1A 4KG5A 1PZOA 3NECA 4GCZA 1VB6A 3C8CA 2HP9A 5L2FA 4C6YA 3ZYTA 5FA7A 5L10A 1NY0A 5CECA 3B33A 5TJJA 3UB9A 3U4LP 4X53A 1K56D 4JGQA 3QP4A 3BM6A 4S2NA 5F82A 2XEPA 2L4RA 5GHZA 1VETB 3MF0A 3NC8A 3CZDA 1PWCA 4E6WA 3KYEA 3LR3A 2XQZA 4S2PA 1H5XA 3VE3A 5G18A 3PBSA 5L09A 2BTFP 1OJ5A 2PDRA 2GJ3A 1I2WA 4BD0A 1ES4A 3KO6A 2EX2A 5E43A 4WEJA 2EXAA 3G2YA 1BLHA 1Z09A 2W1RA 4YWZA 4BBVA 1IELA 1W5DA 1IYPA 3FV7A 3H82A 4RX2A 4FCFA 3DAVA 5TBMB 1PFLA 4M4XA 2VGLS 3CG5A 1YSPA 5FL3A 5FQJA 4HP9A 1I2SA 3ITAA 5M1AA 1IKIA 3IXGA 2JCHA 3UMDA 4GDNA 2INWA 1HTZA 3OC2A 4QWOA 2EXBA 5CERA 4QHCA 4CJNA 2VGKA 2PYRA 4N1XA 4DE3A 4DMZA 4WL9A 2ZMAA 5FEFA 5BOHA 1FSWA 2EX8A 3V39A 1A0KA 1VHMA 2OLVA 5FQKA 1K25A 4IBRA 4O01A 1HVBA 5DKLA 4QY5A 3PXPA 4HJ6A 2QKPA 2ZOIA 1MWUA 1GSWA 1KGFA 3GMWA 1Y28A 4Y7PA 4KZ5A 1OT9A 5A93A 5CEDA 1YLZA 4EU0A 5F6AA 2HDUA 3C2WA 2ZC5B 4BL2A 4UA6A 1FIKA 3JPUA 3K3DA 2ZQ7A 1NYYA 4CLCD 4ME4A 5HAIA 1E3UD 4HI4A 4OQIA 4NETA 4R3AA 2EFXA 1G28A 1MXOA 3F1NA 3ZVWA 4HESA 1SHVA 1V9ZA 3UE3A 3AGEA 3SS4A 3EEAA 4PAUA 1NLZA 2PU4A 2Y2HA 4NXFA 3T1RA 3PBTA 1W8YA 4GDBA 3VV4A 1XGIA 4WYYA 4O8GA 3CJMA 2WKPA 4P0MA 5HW3A 3FPWA 3O86A 4B9OA 3MKEA 2BLSA 2EX9A 1NXYA 3C7VA 3T4LA 2W3EA 1CI9A 2ZMVA 2WGIA 1S4RA 3CITA 4LFUA 3IX3A 4FSFA 4KG6A 3V3RA 2P08A 3OCLA 5F69A 4UAAA 1SKFA 4BBUA 1DP8A 4K0WA 4DDYA 4UQIS 3DW0A 3BY9A 5E2HA 1VEUA 4RQ9A 5EVLA 3QP6A 1K38A 4IUKA 5CGSA 4GS9B 1TD5A 3VP1A 4KQOA 3UPPA 3MXQA 3UPOA 1ERQA 3D4FA 3LIEA 1LSXA 4ZJ3A 4NK3A 1PYYA 5AJGA 4S2IA 4ARZA 1BSGA 1ALQA 5J8XA 4OONA 3O3VA 1H3QA 2V1ZA 3PBNA 3E0YA 4R3JA 1LHYA 3PBRA 1XKZA 4WLAA 1PI4A 4R3BA 2M7UA 1KDSA 1E25A 4JXGA 4EETB 3DTEA 5HWTA 1YPRA 4L0LA 1U60A 1IEMA 1JWZA 3HCYA 5EM1A 4GOGA 3SZTA 1E3UA 1ES3A 3O87A 5FDHA 4OQHA 3ZCZA 5FAQA 3W2ZA 3LFVA 1OT6A 3Q7VB 3QP8A 2NUTC 3DTKA 1K55C 3UB6A 3NDGA 2D02A 3GTCA 5TFQA 4BLMA 2JKRI 3KYZA 3JYIA 2ZC3B 1NRJA 4OLDA 5DF8A 3NOUC 1T19A 4UHUA 1O7EA 3LEZA 1BTLA 4B88A 4DE2A 4JGOA 4ZJ2A 4E3MA 3UB7A 3KSHA 4DJ3A 4I3IA 3TW8A 2WGWB 3CUEC 4Y5FA 5FASA 3JVUA 2KDKA 3ULFA 4LLOB 1MWTA 3IT9A 4IHQA 5CEBA 2JKTM 2PR6A 2FZ0A 2Z2LB 3HVFA 4MN6A 5HWWA 4I3AA 1T18A 5KMWA 4OOYA 4HH2A 4R0QA 3E98A 4LGWA 1RP5A 2IWCA 4HEFA 5E2GA 5HD5A 1OTEA 2OV5A 2Q9MA 3MMHA 3CI6A 1XP4A 4KZAA 2V0WA 3FKWA 1GSVA 3NCKA 5J3WA 3IX4A 3LIAA 4MBFA 4QPRA 1JTDA 3CHWP 4GZBA 1EI5A 1NYMA 1BULA 4EWFA 3F1PB 1FQGA 1H0MA 5DFYA 3WRZA 5HZHA 2J3TD 3Q1FA 4WMCA 5FAOA 3BLMA 2R9XA 4NKPA 2IA2A 2ZM8A 1JTGA 1Z6FA 3DTMA 3SS5A 5AQBA 2Y4AA 3F1PA 1K4EA 4M3KA 4RYEA 2WUQA 3Q82A 5LBRA 1NZOA 3GSGA 4MEZA 1FSYA 2QWSA 3VFFA 4IBXA 4OLGA 5L07A 2CC1A 3LYXA 4H6JA 4ETZA 2ZLYA 2W27A 2W3FA 3C4OA 3RH8B 5A91A 3HLGA 1D7EA 2ACGA 2OWJA 3LO7A 2VA0A 3OPRA 4XUXA 1TDGA 1KOUA 3T12B 4E3KA 2QPNA 2V8CA 4OOLA 1MBLA 1LLBA 3HLWA 1SDEA 1MWSA 3UPNA 2Q9NA 4HJ3A 3DBAA 1DY6A 1MPLA 4LV3A 3BWLA 5EE8A 4RX3A 2DCFA 1D1JA 1F98A 1IYOA 3TSGA 5U47A 1SKOB 3I7JA 3RTYA 5CRFA 1TDLA 3P7NA 2HGVA 3UMEA 3PAGA 2VZWA 1KGEA 4Y2FA 4LV0A 3LI8A 3QNCA 1SDNA 3CPTB 3M6BA 4ZJ1A 4EBNA 3E4OA 4YFMA 5FSRA 1XXMA 1CF0A 4F94A 2WZXA 2IWDA 3HUNA 3MZFA 1K6RA 2D01A 4WMCD 2W0NA 5HL1A 4PPRA 3CUEA 1S66L 5G4ZA 1PRQA 2V8FA 1MWRA 1STZA 4X1MA 4I38A 3L7HA 4X68A 4E3OA 2PBYA 3BEBA 5CHMA 1IYSA 1H8ZA 3G31A 2J3WA 1D06A 2Y8HA 2VV6A 3HLDA 3ZG8B 2WAEA 1K54A 2GX5A 2UWXA 4OPZA 5C5KA 2G2UA 3GR2A 3IXHA 4Y0OA 1ESIA 4GJ4A 2W3HA 4EUVA 1FILA 1NRFA 5F1FA 2HDSA 5K5BA 5MC7A 3WS2A 1LSWA 4JPMA 2JN7A 1LT0A 4EBLA 3FYZA 5DTKA 3IF5A 3F1OB 5E2EA 2W3GA 3UDIA 4EW7A 4IEDA 4EV4A 4CLCE 3AGDA 2X02A 4YNRA 2E8IA 2A49A 2ZM0A 4QD4A 1CI8A 4E6XA 3BW6A 3WS5A 3D9YA 4OPRA 3IF6A 3IBRA 2XH9A 4X6TA 5EFWA 5A8BA 1TS8A 3VP2A 1ZG4A 1XGJA 3RJUA 1P0ZA 3MZEA 1WA9A 4I39A 3H82B 3HUOA 4X69A 1KE3A 2PT7A 2EX6A 1ERMA 2QJ5A 1YMSA 5FEGA 4JXWA 5JYOA 2XGNA 1GHMA 3VP0A 5HFOA 3OZHA 4Y17A 5CX7A 1SCWA 4Q8IA 1G5UA 2P9VA 2UV0E 5GLDA 4I5SA 2ZQCA 4L9GA 2V2FF 4EEUA 3UDFA 2R9WA 4IJGA 1YLYA 3PTEA 2B5RA 5EM0A 2V1BA 4JBFA 4R6LA 2HJEA 4GB7A 4HHDA 2DNSA 4H8RA 4OKPA 2EA9A 1PNEA 2ZQ8A 3OLOA 2X71A 5I94A 1ONGA 4WZ5C 1J3WA 1KVLA 2XSSA 1YMXA 2HZ5A 4QU3A 1YKDA 3M6HA 3WS4A 3A0VA 5HARA 3ZHHA 1OPXA 4MBHA 3UB5P 2FFYA 4EQ1A 1YLWA 1TF1A 1N4OA 5EVEA 2OSUA 2H0TA 4K0XA 2LB5A 4WELA 4X56A 4P85A 1OTDA 2FFFB 2JKTI 4JGRA 3U2AA 1VEUB 4BWIA 3G35A 3MBZA 1XJ4A 3Q7VA 5TGFA 1PW1A 3C4PA 5A92A 3T4KA 3S4XA 5HL6A 3BFDA 3KYQA 3EEHA 3HJIA 2J9PA 3LUQA 3PBQA 3OPLA 4BD1A 3AGFA 2ZC7A 3P98A 1XJ6A 4BJPA 4WBGA 2HJ9C 1WYCA 3NULA 2PYPA 3A3DA 2L1MA 4QB8A 2YKFA 3D72A 4O7DA 4MN7A 3SS3A 3NIAA 5FATA 3IXBA 1TS6A 1S1ZA 1FCNA 3OOVA 3HBRA 4FTXA 4LRXC 3JVVA 4HY8A 2EWVA 3MS6A 4U0TA 1E4DA 4ETXA 2K31A 3EQVA 4Y3IA 3BLSA 1G68A 1DRMA 3R4KA 3PYPA 4G3VA 2VJWA 4S2KA 4Y0UA 1YM1A 1OTAA 1EW0A 3FPVA 5HX9A 4N1HA 4GNUA 1JVJA 3OBFA 1YAXA 2ZL1B 1XFQA 3FG8A 4Y13A 3GQZA 4WN5A 2O9CA 3OPHA 3WS0A 1ZTUA 3LIDA 5FQMA 4CLCC 2JHEA 3E4PA 1LSVA 2XFTA 3N8RA 4DXBA 1PZPA 2K2NA 3BQAA 1W7FA 4BENA 4KZBA 1ZC2A 2WK0A 4JXVA 3NOTC 1LL8A 5EV0A 5AVEA 4BMWA 3ZVTA 5EVIA 3NHQA 1JNUA 2ZJ9A 3IF6C 2VGLM 4L9FA 3LY4A 3CLOA 3NBLA 2WKHA 2J9OA 1CJFA 5HD3A 1K54C 1GSXA 2ZQDA 2WZZA 4ESPA 2V0UA 3EGXC 5EVID 5HPIA 2VK3A 2OAP1 4GD8A 2ZQ9A 4NXEA 2O9AA 1NLYA 3F1NB 1W8QA 4P87A 1K56A 1ODVA 4R4SA 1K4FA 5M19A 3F1OA 1N9BA 3LR4A 3NI9A 3FKVA 2Q0OA 3BECA 3UNWA 2G7UA 1HZOA 4NG2A 1I5QA 3GV9A 4EEPA 2Y2IA 2VX8A 4DF6A 2A3UA 1FCMA 2L0WA 2NUPC 4S2LA 1G6OA 4CLCA 3S7PA 3RFBA 4PM6A 1ES2A 3N8LA 3VP3A 4MDZA 2JBFA 3CAXA 5IHVA 2XRNA 3ITBA 2P04A 4C75A 4ID4A 4UQIM 2W3DA 1W79A 2AVXA 1GCEA 4QY6A 2QZ6A 4MMNA 1PIOA 3NJAA 3A0RA 1S6RA 2Y2QA 2WAFA 4N92A 5J7EA 3ZDJA 4A5RA 2VGJA 4LRYC 3E2LA 5JYPA 3VP4A 1QMFA 3B47A 4D2OA 1F5MA 2K7SA 3HLBA 3LR5A 1L0FA 3UE1A 2KOIA 3T1SA 1LL9A 1YT4A 3V67A 1F2KA 3WS1A 3T1XA 3S7NA 3H7WB 3SOIA 3G34A 4GHIB 4NXGA 1CEGA 4ZTKA 3TRCA 1VM1A 4U0XA 4KG2A 2Y91A 4KQDA 2J3TC 1VQQA 4MN5A 2H28A 3E2KA 4KUOA 3NOPC 2ZBBA 3Q81A 3ZQ5A 5GLBA 4EESA 2FH5A 4HIAA 5KSCA 4S2MA 4BL3A 4KZ7A 3OPPA 1XA7A 1FR1A 4KUKA 2Y2JA 2DMWA 2HP6A 3ZFZA 1MY8A 3W4OA 4KZ4A 1TS7A 1C3BA 2Y2NA 2W1TB 1XJ2A 2XD5A 5EVIC 4KQQA 3MR0A 2G2WA 2HDRA 1P9RA 3OCNA 3EQUA 3UE6A 5CGWA 3MQ0A 3HLEA 5HDSA 1PI5A 4KZ9A 1T1AA 4UEYA 3HLFA 4JGPA 1ACFA 3QNBA 2P74A 4Y15A 4ZAMA 1VETA 4B4XA 2PR5A 1S67L 3P09A 1YLTA 2RCXA 4DKIA 1W63M 2XDMA 5FDSA 5GLCA 1Q2QA 4MNRA 3IWQA 3DWZA 2M1CA 2Y2GA 1BLSA 2JKRM 1OJGA 2H5SA 3EOIA 4WUJA 4DRTA 5TBMA 4N9KA 5EECA 1M6KA 4XT2B 3V3SA 3W4PA 4BQMA 3SW1A 1DJBA 3IHBA 2V9AA 3R7WA 3UE0A 3WRTA 5GHYA 4HP4A 1OMEA 4N9LA 3VSLA 3M2KA 3T4SA 1KE0A 1TEMA 4HNBA 3ICYA 1MKMA 5EOEA 4DE0A 2ZQAA 1HLUP 3RXXA 1NJ4A 4XT2A 4L9EA 3DTIA 5CHUA 5EUAA 2QHKA 2O99A 3R7WB 3S1YA 3C38A 3IH9A 4LCLA 1G6AA 1RGZA 4HH3A 4JXSA 2JE5A 3V50A 3PAEA 3ZG5A 3LR0A 3NY4A 2CMNA 2I9VA 2JKGA 3IS2B 4E3IA 1TS0A 1YQSA 4H6JB 4Q0IA 3IHAA 1FCOA 2VV8A 1ZKJA 4B93A 5I5LA 4OPQA 5F5YA 1O07A 5L8MA 2IWBA 4OQ0A 4GS9A 2B18A 1T1CA 2HDQA 2WKRA 1TVFA 4DXCA 2HV1A 4CQHA 3G2ZA 2XROA 1L2SA 3H9WA 4PM8A 3ZNYA 1RCJA 3VFHA 3L9KA 3IX8A 4K08A 4C3QA 1AWIA 4PMAA 4R1GA 3BJNA 2XR0A 1EROA 5DVAA 3ZG9B 3KX0X 2VEAA 3BQ8A 2XA7S 4LCMA 3GRJA 4EBPA 3QP5A 5F68A 4P6ZS 4HBUA 5CHJA 1GA0A 4FUWA 3MSHA 3BFFA 2C5WB 4QJGA 2Y59A 3G32A 5FI6A 3G30A 1T1BA
chains in the Genus database with same CATH topology
1PZPA 3N4IA 4RVAA 3UY6A 2ZM8A 1LL5A 1W7FA 1JTGA 4BENA 1Z6FA 4KZBA 5HAQA 3DTMA 2Y2MA 3SS5A 1DJCA 4OQGA 5D3OA 1M40A 5AQBA 1ZC2A 2Y4AA 2WK0A 4JXVA 1RGYA 5DTTA 2WKIA 3ZG5A 1K4EA 4M3KA 1XA1A 4RYEA 2WUQA 3HLCA 3Q82A 3SH7A 3ZVTA 2WYXA 1NZOA 1KGGA 3GSGA 5EVIA 2ZM2A 4MEZA 2ZJ9A 3IF6C 1FSYA 3VFFA 2WGVA 2DRWA 4IBXA 4OLGA 2XFSA 3LY4A 3NBLA 4KZ3A 2WKHA 4IVKA 2CC1A 2J9OA 3BFGA 1K54C 2ZLYA 1BUEA 2ZQDA 3C4OA 4GN2A 3BRMA 4WZ4A 2WZZA 5A91A 1JWPA 5E2FA 3HLGA 1CEFA 1CK3A 1KE4A 3N7WA 1FOFA 4HBTA 5EVID 1KVMA 4OVDA 1S0WA 3LO7A 5CTNA 4DE1A 4KZ6A 4KG5A 5FI7A 4X55A 3RXWA 3OPRA 3ZG7B 1PZOA 4GD8A 3SH8A 2ZQ9A 4XUXA 1TDGA 2HP9A 1J9MA 4JF4A 1W8QA 5L2FA 4C6YA 4E3KA 5FA7A 1H8YA 5AQ7A 2QPNA 1NY0A 4OOLA 4P87A 5CECA 4P6BA 1MBLA 1LLBA 1K56A 3HLWA 1SDEA 1MWSA 3UPNA 2Q9NA 4R4SA 1K4FA 5M19A 1XPBA 1DY6A 1MPLA 1N9BA 1ONHA 3NI9A 4LV3A 5CGXA 3FKVA 5EE8A 3BECA 4RX3A 3MXSA 2DCFA 1K56D 4X53A 3UNWA 1HZOA 4FH2A 1I5QA 3BM6A 3GV9A 4PM7A 4JF5A 4S2NA 5F82A 4OH0A 1IYOA 2XEPA 3VOZA 5GHZA 3ZG0A 4U3TA 2Y2IA 3TSGA 5U47A 3NC8A 3CZDA 1PWCA 3PBOA 4DF6A 4E6WA 3I7JA 2HPBA 2XQZA 1BLCA 1FCMA 2A3UA 3MZDA 5CRFA 1TDLA 3IQAA 4S2PA 4Y0TA 1H5XA 5G18A 3PBSA 4S2LA 3V5MA 4UA9A 3PAGA 1I2WA 4BD0A 1ES4A 4DXBA 1KGEA 4GD6A 4OP5A 3BFEA 4PM6A 2EX2A 1ES2A 3N8LA 4LV0A 3UDXA 5E43A 4WEJA 2EXAA 3VP3A 3G2YA 3QNCA 4JKTA 1BLHA 4ZBEA 2JBFA 4MBKA 1SDNA 5IHVA 2WADA 3VOYA 3A3EA 1IELA 1W5DA 3M6BA 3ITBA 3MFDA 1IYPA 4ZJ1A 3UN7A 3W8KA 3FV7A 4YFMA 4EBNA 4RX2A 4FCFA 5FSRA 1XXMA 4C75A 4ID4A 2EFUA 5F1GA 3UO9A 4F94A 1AXBA 1W79A 1GCEA 1QMEA 3CG5A 3VMAA 2WZXA 5DF7A 4QY6A 2QZ6A 5FQJA 3HUMA 1I2SA 3ITAA 2IWDA 3HUNA 3MZFA 5M1AA 1IKIA 1K6RA 1PIOA 4WMCD 3IXGA 5GHXA 2JCHA 4PM9A 5HL1A 1S6RA 2Y2QA 3FZCA 2WAFA 4N92A 4PPRA 3ZDJA 4OPYA 4A5RA 2VGJA 4GDNA 3E2LA 1MWRA 3ISGA 5JYPA 3VP4A 1QMFA 1HTZA 3LCEA 4KENB 3C7UA 4D2OA 5GLAA 3OC2A 4FH4A 4X68A 4E3OA 2EXBA 3HLBA 5CERA 1L0FA 4QHCA 2PBYA 3BEBA 2VGKA 5CTMA 4CJNA 3UE1A 5CHMA 4WM9A 4N1XA 1LL9A 1YT4A 4DE3A 1IYSA 3WS1A 2XK1A 1H8ZA 3G31A 2ZMAA 5BOHA 3SOIA 1KDWA 3G34A 1FSWA 2EX8A 5DF9A 2WKEA 5GL9A 3V39A 3A3IA 3HLDA 3ZGAB 1CEGA 2OLVA 4ZTKA 3ZG8B 1VM1A 4U0XA 2WAEA 4KG2A 1K54A 5FQKA 2Y91A 4EUZA 1K25A 4IBRA 2UWXA 4OPZA 1HVBA 1VQQA 5TR7A 4QY5A 3IH8A 2G2UA 3GR2A 3E2KA 3M2JA 4IVIA 3FWLA 5KZHA 3IXHA 4Y0OA 1MWUA 2ZD8A 4EQIA 4KZ8A 1KGFA 1ESIA 3GMWA 3Q81A 5GLBA 4Y7PA 5A90A 4KZ5A 1YLPA 5FAOA 1NRFA 5F1FA 2HDSA 4S2OA 1XX2A 2Z2MB 3WS2A 4OP8A 5KSCA 1GA9A 4S2MA 4JPMA 4BL3A 5A93A 4KZ7A 3IXDA 3N8SA 4DDSA 5CEDA 1YLZA 3OPPA 4EBLA 1XA7A 2HDUA 1FR1A 3FYZA 5EPHA 2ZC5B 4BL2A 4R4RA 4UA6A 4S2JA 2Y2JA 2X01A 5DTKA 2ZQ7A 3IF5A 1NYYA 2HP6A 2C6WB 5E2EA 3ZFZA 1K57A 3UDIA 1MY8A 4IEDA 5HAIA 3W4OA 1E3UD 4EV4A 4OQIA 5HAPA 3AGDA 2X02A 4NETA 4S2NC 4KZ4A 2EFXA 1MXOA 2E8IA 2A49A 2HP5A 2ZM0A 1CI8A 4QD4A 1C3BA 4E6XA 2Y2NA 3WS5A 5F83A 2XD5A 5EVIC 3ZVWA 4KQQA 3DWKA 4OPRA 4HESA 3N6IA 3IF6A 1SHVA 2G2WA 2HDRA 3UE3A 3SH9A 3AGEA 3OCNA 4KQRA 3SS4A 3EQUA 2PU4A 5CGWA 2Y2HA 1ZG6A 2XH9A 3PBTA 1W8YA 4GDBA 4X6TA 1IYQA 3B3XA 1XGIA 4WYYA 5FQIA 3HLEA 3CJMA 3VP2A 4B4ZA 4P0MA 1FR6A 1JWVA 1PI5A 1ZG4A 4KZ9A 5HW3A 1XGJA 3HLFA 4LV1A 3O86A 3QNBA 3MZEA 5CXWA 3RJUA 2P74A 4XXRA 5KSHA 3TG9A 3IWOA 3MKEA 4WEKA 3HUOA 2BLSA 2EX9A 4X69A 1KE3A 4ZAMA 2EX6A 1ERMA 1NXYA 3C7VA 1YMSA 4B4XA 4JXWA 1CI9A 1BT5A 2WGIA 5JYOA 2XGNA 1GHMA 3P09A 4E3JA 3VP0A 4KG6A 4FSFA 1YLTA 5HFOA 2RCXA 3OZHA 3V3RA 4DKIA 3OCLA 2XDMA 4UAAA 1ESUA 5GLCA 5AQ9A 1SCWA 1SKFA 1Q2QA 4Q8IA 2P9VA 2I72A 3C5AA 1WYBA 4MNRA 5GLDA 4K0WA 2JC7A 4DDYA 3W4QA 1K6SA 3DW0A 2XLNA 2ZQCA 3DWZA 1L0EA 3IWQA 3S22A 2Y2GA 4FD8A 1BLSA 2V2FF 5E2HA 4RA7A 3UDFA 5EVLA 2R9WA 2H5SA 1K38A 1K55A 5CGSA 4DRTA 1YLYA 3VP1A 4KQOA 3UPPA 3PTEA 3UPOA 2B5RA 1ERQA 2RL3A 3D4FA 4N9KA 4JBFA 5EECA 3MXRA 1M6KA 2XD1A 4ZJ3A 3O88A 4GB7A 4NK3A 5DTSA 1PYYA 2DNSA 4H8RA 3BYDA 2H0YA 3V3SA 4S2IA 5EVIB 4ZDXA 3W4PA 4BQMA 4OKPA 1BSGA 1ALQA 4WMCA 5J8XA 4OONA 1DJBA 2ZQ8A 3IHBA 5AQAA 1LI9A 3O3VA 5FAPA 3UE0A 2V1ZA 1PWGA 1PW8A 3LY3A 2X71A 3PBNA 4R3JA 3WRTA 1IKGA 5GHYA 5I94A 1OMEA 4N9LA 1LHYA 1ONGA 3M2KA 3PBRA 3VSLA 1K57C 1BZAA 2XF3A 4WZ5C 1KE0A 1KVLA 1XKZA 1TEMA 1YMXA 1PI4A 4JF6A 4QU3A 4R3BA 3M6HA 1KDSA 1E25A 4JXGA 2V20A 3WS4A 5EOEA 5HARA 3ZHHA 4L0LA 1U60A 4YINA 4MBHA 1IEMA 1JWZA 2ZQAA 4DE0A 2FFYA 3RXXA 1NJ4A 1YLWA 1N4OA 2OSUA 5CHUA 2OLUA 2H0TA 4K0XA 5FQ9A 4GOGA 5EUAA 4WELA 1E3UA 1ES3A 4X56A 3O87A 5FDHA 4OQHA 3S1YA 4P85A 3ZCZA 5FI2A 4WZ5A 2FFFB 1L0GA 1GHPA 5FAQA 3IH9A 4LCLA 1G6AA 3QHYA 1Y54A 4UA7A 3TOIA 3IWIA 3Q7VB 2PU2A 3G35A 3MBZA 1RGZA 1K55C 3Q7VA 1GHIA 3NDGA 5TGFA 1PW1A 4PM5A 3C4PA 4JXSA 3GTCA 5TFQA 4BLMA 2JE5A 4E3NA 3JYIA 3BLMA 2Y2LA 2ZC3B 5A92A 4Z9QA 3S4XA 4LENA 3V50A 3A3JA 3PAEA 4OLDA 3BFDA 2J9PA 5DF8A 5M18A 4UHUA 1O7EA 3LEZA 3MKFA 3NY4A 3OPLA 1BTLA 3PBQA 1MKIA 4JLFA 2Y2OA 3AGFA 4B88A 4BD1A 4DE2A 2H10A 3WWXA 4ZJ2A 2ZC7A 4R23A 3P98A 4E3IA 4E3MA 4BJPA 2P9VB 4WBGA 1YQSA 2ZC6B 1WYCA 3A3DA 1ES5A 2WGWA 3IHAA 1FCOA 1ZKJA 2ZC4B 3GVBA 2WGWB 4QB8A 4OPQA 5FASA 3CMZA 4O7DA 3SS3A 2QMIA 3NIAA 4XUZA 5FATA 3IXBA 1MWTA 1O07A 1LI0A 1FCNA 3IT9A 2IWBA 5CEBA 1WE4A 4OQ0A 2Z2LB 3HBRA 2Y2PA 3HVFA 5KMWA 2HDQA 4OOYA 1TVFA 4DXCA 1PWDA 4U0TA 4R0QA 3Q7ZA 3G2ZA 1RP5A 2IWCA 3IF6B 1E4DA 2BG1A 4HEFA 3EQVA 5E2GA 1L2SA 2OV5A 3BLSA 1G68A 5EOOA 1BLPA 2Q9MA 3G4PA 4OOMA 3ZNTA 2J7VA 1XP4A 4KZAA 4PM8A 4GKUA 2Y55A 4S2KA 1EWZA 3FKWA 4Y0UA 1YM1A 3ZNYA 3NCKA 1RCJA 3VFHA 4MLLA 5HX9A 4CPKA 4E3LA 4MBFA 2J8YA 3Q07A 4C3QA 4N1HA 1JTDA 1YLJA 4PMAA 4R1GA 1L0DA 4GZBA 1NZUA 1EI5A 2XR0A 1EROA 5DVAA 3ZG9B 1NYMA 4GNUA 1JVJA 3BFCA 1BULA 4EWFA 1FQGA 4LCMA 3HREA 3GQZA 2GDNA 3GRJA 3WRZA 4EBPA 3OPHA 4HBUA 5CHJA 1GA0A 3A3FA 3HL9A 1HD8A 2C5WB 3BFFA 4K91A 3WS0A 3VSKA 4QJGA 2Y59A 5FQMA 5FQQA 1Q2PA 3NDEA 3G32A 4LV2A 2XFTA 3N8RA 5FI6A 3Q1FA 1DJAA 2R9XA 2Y2KA 3G30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PZP A;  3N4I A;  4RVA A;  3UY6 A;  2ZM8 A;  1LL5 A;  1W7F A;  1JTG A;  4BEN A;  1Z6F A;  4KZB A;  5HAQ A;  3DTM A;  2Y2M A;  3SS5 A;  1DJC A;  4OQG A;  5D3O A;  1M40 A;  5AQB A;  1ZC2 A;  2Y4A A;  2WK0 A;  4JXV A;  1RGY A;  5DTT A;  2WKI A;  3ZG5 A;  1K4E A;  4M3K A;  1XA1 A;  4RYE A;  2WUQ A;  3HLC A;  3Q82 A;  3SH7 A;  3ZVT A;  2WYX A;  1NZO A;  1KGG A;  3GSG A;  5EVI A;  2ZM2 A;  4MEZ A;  2ZJ9 A;  3IF6 C;  1FSY A;  3VFF A;  2WGV A;  2DRW A;  4IBX A;  4OLG A;  2XFS A;  3LY4 A;  3NBL A;  4KZ3 A;  2WKH A;  4IVK A;  2CC1 A;  2J9O A;  3BFG A;  1K54 C;  2ZLY A;  1BUE A;  2ZQD A;  3C4O A;  4GN2 A;  3BRM A;  4WZ4 A;  2WZZ A;  5A91 A;  1JWP A;  5E2F A;  3HLG A;  1CEF A;  1CK3 A;  1KE4 A;  3N7W A;  1FOF A;  4HBT A;  5EVI D;  1KVM A;  4OVD A;  1S0W A;  3LO7 A;  5CTN A;  4DE1 A;  4KZ6 A;  4KG5 A;  5FI7 A;  4X55 A;  3RXW A;  3OPR A;  3ZG7 B;  1PZO A;  4GD8 A;  3SH8 A;  2ZQ9 A;  4XUX A;  1TDG A;  2HP9 A;  1J9M A;  4JF4 A;  1W8Q A;  5L2F A;  4C6Y A;  4E3K A;  5FA7 A;  1H8Y A;  5AQ7 A;  2QPN A;  1NY0 A;  4OOL A;  4P87 A;  5CEC A;  4P6B A;  1MBL A;  1LLB A;  1K56 A;  3HLW A;  1SDE A;  1MWS A;  3UPN A;  2Q9N A;  4R4S A;  1K4F A;  5M19 A;  1XPB A;  1DY6 A;  1MPL A;  1N9B A;  1ONH A;  3NI9 A;  4LV3 A;  5CGX A;  3FKV A;  5EE8 A;  3BEC A;  4RX3 A;  3MXS A;  2DCF A;  1K56 D;  4X53 A;  3UNW A;  1HZO A;  4FH2 A;  1I5Q A;  3BM6 A;  3GV9 A;  4PM7 A;  4JF5 A;  4S2N A;  5F82 A;  4OH0 A;  1IYO A;  2XEP A;  3VOZ A;  5GHZ A;  3ZG0 A;  4U3T A;  2Y2I A;  3TSG A;  5U47 A;  3NC8 A;  3CZD A;  1PWC A;  3PBO A;  4DF6 A;  4E6W A;  3I7J A;  2HPB A;  2XQZ A;  1BLC A;  1FCM A;  2A3U A;  3MZD A;  5CRF A;  1TDL A;  3IQA A;  4S2P A;  4Y0T A;  1H5X A;  5G18 A;  3PBS A;  4S2L A;  3V5M A;  4UA9 A;  3PAG A;  1I2W A;  4BD0 A;  1ES4 A;  4DXB A;  1KGE A;  4GD6 A;  4OP5 A;  3BFE A;  4PM6 A;  2EX2 A;  1ES2 A;  3N8L A;  4LV0 A;  3UDX A;  5E43 A;  4WEJ A;  2EXA A;  3VP3 A;  3G2Y A;  3QNC A;  4JKT A;  1BLH A;  4ZBE A;  2JBF A;  4MBK A;  1SDN A;  5IHV A;  2WAD A;  3VOY A;  3A3E A;  1IEL A;  1W5D A;  3M6B A;  3ITB A;  3MFD A;  1IYP A;  4ZJ1 A;  3UN7 A;  3W8K A;  3FV7 A;  4YFM A;  4EBN A;  4RX2 A;  4FCF A;  5FSR A;  1XXM A;  4C75 A;  4ID4 A;  2EFU A;  5F1G A;  3UO9 A;  4F94 A;  1AXB A;  1W79 A;  1GCE A;  1QME A;  3CG5 A;  3VMA A;  2WZX A;  5DF7 A;  4QY6 A;  2QZ6 A;  5FQJ A;  3HUM A;  1I2S A;  3ITA A;  2IWD A;  3HUN A;  3MZF A;  5M1A A;  1IKI A;  1K6R A;  1PIO A;  4WMC D;  3IXG A;  5GHX A;  2JCH A;  4PM9 A;  5HL1 A;  1S6R A;  2Y2Q A;  3FZC A;  2WAF A;  4N92 A;  4PPR A;  3ZDJ A;  4OPY A;  4A5R A;  2VGJ A;  4GDN A;  3E2L A;  1MWR A;  3ISG A;  5JYP A;  3VP4 A;  1QMF A;  1HTZ A;  3LCE A;  4KEN B;  3C7U A;  4D2O A;  5GLA A;  3OC2 A;  4FH4 A;  4X68 A;  4E3O A;  2EXB A;  3HLB A;  5CER A;  1L0F A;  4QHC A;  2PBY A;  3BEB A;  2VGK A;  5CTM A;  4CJN A;  3UE1 A;  5CHM A;  4WM9 A;  4N1X A;  1LL9 A;  1YT4 A;  4DE3 A;  1IYS A;  3WS1 A;  2XK1 A;  1H8Z A;  3G31 A;  2ZMA A;  5BOH A;  3SOI A;  1KDW A;  3G34 A;  1FSW A;  2EX8 A;  5DF9 A;  2WKE A;  5GL9 A;  3V39 A;  3A3I A;  3HLD A;  3ZGA B;  1CEG A;  2OLV A;  4ZTK A;  3ZG8 B;  1VM1 A;  4U0X A;  2WAE A;  4KG2 A;  1K54 A;  5FQK A;  2Y91 A;  4EUZ A;  1K25 A;  4IBR A;  2UWX A;  4OPZ A;  1HVB A;  1VQQ A;  5TR7 A;  4QY5 A;  3IH8 A;  2G2U A;  3GR2 A;  3E2K A;  3M2J A;  4IVI A;  3FWL A;  5KZH A;  3IXH A;  4Y0O A;  1MWU A;  2ZD8 A;  4EQI A;  4KZ8 A;  1KGF A;  1ESI A;  3GMW A;  3Q81 A;  5GLB A;  4Y7P A;  5A90 A;  4KZ5 A;  1YLP A;  5FAO A;  1NRF A;  5F1F A;  2HDS A;  4S2O A;  1XX2 A;  2Z2M B;  3WS2 A;  4OP8 A;  5KSC A;  1GA9 A;  4S2M A;  4JPM A;  4BL3 A;  5A93 A;  4KZ7 A;  3IXD A;  3N8S A;  4DDS A;  5CED A;  1YLZ A;  3OPP A;  4EBL A;  1XA7 A;  2HDU A;  1FR1 A;  3FYZ A;  5EPH A;  2ZC5 B;  4BL2 A;  4R4R A;  4UA6 A;  4S2J A;  2Y2J A;  2X01 A;  5DTK A;  2ZQ7 A;  3IF5 A;  1NYY A;  2HP6 A;  2C6W B;  5E2E A;  3ZFZ A;  1K57 A;  3UDI A;  1MY8 A;  4IED A;  5HAI A;  3W4O A;  1E3U D;  4EV4 A;  4OQI A;  5HAP A;  3AGD A;  2X02 A;  4NET A;  4S2N C;  4KZ4 A;  2EFX A;  1MXO A;  2E8I A;  2A49 A;  2HP5 A;  2ZM0 A;  1CI8 A;  4QD4 A;  1C3B A;  4E6X A;  2Y2N A;  3WS5 A;  5F83 A;  2XD5 A;  5EVI C;  3ZVW A;  4KQQ A;  3DWK A;  4OPR A;  4HES A;  3N6I A;  3IF6 A;  1SHV A;  2G2W A;  2HDR A;  3UE3 A;  3SH9 A;  3AGE A;  3OCN A;  4KQR A;  3SS4 A;  3EQU A;  2PU4 A;  5CGW A;  2Y2H A;  1ZG6 A;  2XH9 A;  3PBT A;  1W8Y A;  4GDB A;  4X6T A;  1IYQ A;  3B3X A;  1XGI A;  4WYY A;  5FQI A;  3HLE A;  3CJM A;  3VP2 A;  4B4Z A;  4P0M A;  1FR6 A;  1JWV A;  1PI5 A;  1ZG4 A;  4KZ9 A;  5HW3 A;  1XGJ A;  3HLF A;  4LV1 A;  3O86 A;  3QNB A;  3MZE A;  5CXW A;  3RJU A;  2P74 A;  4XXR A;  5KSH A;  3TG9 A;  3IWO A;  3MKE A;  4WEK A;  3HUO A;  2BLS A;  2EX9 A;  4X69 A;  1KE3 A;  4ZAM A;  2EX6 A;  1ERM A;  1NXY A;  3C7V A;  1YMS A;  4B4X A;  4JXW A;  1CI9 A;  1BT5 A;  2WGI A;  5JYO A;  2XGN A;  1GHM A;  3P09 A;  4E3J A;  3VP0 A;  4KG6 A;  4FSF A;  1YLT A;  5HFO A;  2RCX A;  3OZH A;  3V3R A;  4DKI A;  3OCL A;  2XDM A;  4UAA A;  1ESU A;  5GLC A;  5AQ9 A;  1SCW A;  1SKF A;  1Q2Q A;  4Q8I A;  2P9V A;  2I72 A;  3C5A A;  1WYB A;  4MNR A;  5GLD A;  4K0W A;  2JC7 A;  4DDY A;  3W4Q A;  1K6S A;  3DW0 A;  2XLN A;  2ZQC A;  3DWZ A;  1L0E A;  3IWQ A;  3S22 A;  2Y2G A;  4FD8 A;  1BLS A;  2V2F F;  5E2H A;  4RA7 A;  3UDF A;  5EVL A;  2R9W A;  2H5S A;  1K38 A;  1K55 A;  5CGS A;  4DRT A;  1YLY A;  3VP1 A;  4KQO A;  3UPP A;  3PTE A;  3UPO A;  2B5R A;  1ERQ A;  2RL3 A;  3D4F A;  4N9K A;  4JBF A;  5EEC A;  3MXR A;  1M6K A;  2XD1 A;  4ZJ3 A;  3O88 A;  4GB7 A;  4NK3 A;  5DTS A;  1PYY A;  2DNS A;  4H8R A;  3BYD A;  2H0Y A;  3V3S A;  4S2I A;  5EVI B;  4ZDX A;  3W4P A;  4BQM A;  4OKP A;  1BSG A;  1ALQ A;  4WMC A;  5J8X A;  4OON A;  1DJB A;  2ZQ8 A;  3IHB A;  5AQA A;  1LI9 A;  3O3V A;  5FAP A;  3UE0 A;  2V1Z A;  1PWG A;  1PW8 A;  3LY3 A;  2X71 A;  3PBN A;  4R3J A;  3WRT A;  1IKG A;  5GHY A;  5I94 A;  1OME A;  4N9L A;  1LHY A;  1ONG A;  3M2K A;  3PBR A;  3VSL A;  1K57 C;  1BZA A;  2XF3 A;  4WZ5 C;  1KE0 A;  1KVL A;  1XKZ A;  1TEM A;  1YMX A;  1PI4 A;  4JF6 A;  4QU3 A;  4R3B A;  3M6H A;  1KDS A;  1E25 A;  4JXG A;  2V20 A;  3WS4 A;  5EOE A;  5HAR A;  3ZHH A;  4L0L A;  1U60 A;  4YIN A;  4MBH A;  1IEM A;  1JWZ A;  2ZQA A;  4DE0 A;  2FFY A;  3RXX A;  1NJ4 A;  1YLW A;  1N4O A;  2OSU A;  5CHU A;  2OLU A;  2H0T A;  4K0X A;  5FQ9 A;  4GOG A;  5EUA A;  4WEL A;  1E3U A;  1ES3 A;  4X56 A;  3O87 A;  5FDH A;  4OQH A;  3S1Y A;  4P85 A;  3ZCZ A;  5FI2 A;  4WZ5 A;  2FFF B;  1L0G A;  1GHP A;  5FAQ A;  3IH9 A;  4LCL A;  1G6A A;  3QHY A;  1Y54 A;  4UA7 A;  3TOI A;  3IWI A;  3Q7V B;  2PU2 A;  3G35 A;  3MBZ A;  1RGZ A;  1K55 C;  3Q7V A;  1GHI A;  3NDG A;  5TGF A;  1PW1 A;  4PM5 A;  3C4P A;  4JXS A;  3GTC A;  5TFQ A;  4BLM A;  2JE5 A;  4E3N A;  3JYI A;  3BLM A;  2Y2L A;  2ZC3 B;  5A92 A;  4Z9Q A;  3S4X A;  4LEN A;  3V50 A;  3A3J A;  3PAE A;  4OLD A;  3BFD A;  2J9P A;  5DF8 A;  5M18 A;  4UHU A;  1O7E A;  3LEZ A;  3MKF A;  3NY4 A;  3OPL A;  1BTL A;  3PBQ A;  1MKI A;  4JLF A;  2Y2O A;  3AGF A;  4B88 A;  4BD1 A;  4DE2 A;  2H10 A;  3WWX A;  4ZJ2 A;  2ZC7 A;  4R23 A;  3P98 A;  4E3I A;  4E3M A;  4BJP A;  2P9V B;  4WBG A;  1YQS A;  2ZC6 B;  1WYC A;  3A3D A;  1ES5 A;  2WGW A;  3IHA A;  1FCO A;  1ZKJ A;  2ZC4 B;  3GVB A;  2WGW B;  4QB8 A;  4OPQ A;  5FAS A;  3CMZ A;  4O7D A;  3SS3 A;  2QMI A;  3NIA A;  4XUZ A;  5FAT A;  3IXB A;  1MWT A;  1O07 A;  1LI0 A;  1FCN A;  3IT9 A;  2IWB A;  5CEB A;  1WE4 A;  4OQ0 A;  2Z2L B;  3HBR A;  2Y2P A;  3HVF A;  5KMW A;  2HDQ A;  4OOY A;  1TVF A;  4DXC A;  1PWD A;  4U0T A;  4R0Q A;  3Q7Z A;  3G2Z A;  1RP5 A;  2IWC A;  3IF6 B;  1E4D A;  2BG1 A;  4HEF A;  3EQV A;  5E2G A;  1L2S A;  2OV5 A;  3BLS A;  1G68 A;  5EOO A;  1BLP A;  2Q9M A;  3G4P A;  4OOM A;  3ZNT A;  2J7V A;  1XP4 A;  4KZA A;  4PM8 A;  4GKU A;  2Y55 A;  4S2K A;  1EWZ A;  3FKW A;  4Y0U A;  1YM1 A;  3ZNY A;  3NCK A;  1RCJ A;  3VFH A;  4MLL A;  5HX9 A;  4CPK A;  4E3L A;  4MBF A;  2J8Y A;  3Q07 A;  4C3Q A;  4N1H A;  1JTD A;  1YLJ A;  4PMA A;  4R1G A;  1L0D A;  4GZB A;  1NZU A;  1EI5 A;  2XR0 A;  1ERO A;  5DVA A;  3ZG9 B;  1NYM A;  4GNU A;  1JVJ A;  3BFC A;  1BUL A;  4EWF A;  1FQG A;  4LCM A;  3HRE A;  3GQZ A;  2GDN A;  3GRJ A;  3WRZ A;  4EBP A;  3OPH A;  4HBU A;  5CHJ A;  1GA0 A;  3A3F A;  3HL9 A;  1HD8 A;  2C5W B;  3BFF A;  4K91 A;  3WS0 A;  3VSK A;  4QJG A;  2Y59 A;  5FQM A;  5FQQ A;  1Q2P A;  3NDE A;  3G32 A;  4LV2 A;  2XFT A;  3N8R A;  5FI6 A;  3Q1F A;  1DJA A;  2R9X A;  2Y2K A;  3G30 A; 
#chains in the Genus database with same CATH topology
 4RVA A;  2VKS A;  3QP2 A;  3D3O A;  3IBJ A;  5HAQ A;  1F9I A;  1XJ3 A;  3S7Q A;  5D3O A;  1M40 A;  2LB9 A;  1RGY A;  5DTT A;  2WKI A;  1XA1 A;  2WKQ A;  2WYX A;  5HWV A;  1KGG A;  2WGV A;  2XFS A;  4PHT A;  4IVK A;  4G3K A;  2B02 A;  2B95 A;  3T50 A;  4O0P A;  4WZ4 A;  3LIB A;  1JWP A;  4PKY G;  1KE4 A;  3N7W A;  4HBT A;  4OVD A;  1S0W A;  5CTN A;  4KZ6 A;  3TE8 A;  5FI7 A;  4X55 A;  3RXW A;  3ZG7 B;  2MJ6 A;  2OWH A;  3SH8 A;  1J9M A;  1X0O A;  4LRZ E;  2V1A A;  4JF4 A;  4GLQ A;  1H8Y A;  5AQ7 A;  4P6B A;  5CGX A;  1XPB A;  1ONH A;  2XA7 M;  3MXS A;  4G3W A;  1N9O A;  4FH2 A;  4PM7 A;  4JF5 A;  4OH0 A;  3VOZ A;  2VLG A;  3ZG0 A;  4U3T A;  3PBO A;  4EXO A;  2HPB A;  1BLC A;  3E4Q A;  3MZD A;  3IQA A;  4Y0T A;  5DFX A;  3V5M A;  3VE4 A;  1N9L A;  4UA9 A;  2O9B A;  4GD6 A;  4OP5 A;  3BFE A;  2Z6D A;  3UDX A;  3G6O A;  4JKT A;  3GDI A;  4ZBE A;  4MBK A;  2WAD A;  3VOY A;  3A3E A;  3MFD A;  3W8K A;  3UN7 A;  3K3C A;  2EFU A;  5F1G A;  3UO9 A;  1AXB A;  2PHY A;  1DP9 A;  1QME A;  3VMA A;  5DF7 A;  3HUM A;  4PKY A;  5HDC A;  4LPZ A;  5GHX A;  4PM9 A;  3FZC A;  4OPY A;  3PR6 A;  4Q0H A;  3ISG A;  1IOU A;  3LCE A;  4KEN B;  3C7U A;  5GLA A;  4FH4 A;  4GW9 A;  2R78 A;  1IFQ A;  5CTM A;  5DJU A;  4WM9 A;  2XK1 A;  4P6Z M;  1N9N A;  2PD7 A;  3LIF A;  4R70 A;  1KDW A;  5DF9 A;  2WKE A;  5GL9 A;  3A3I A;  3ZGA B;  2VV7 A;  4YOF A;  4DN0 A;  3VOL A;  4EUZ A;  5TR7 A;  3IH8 A;  3HJK A;  3M2J A;  4IVI A;  3QP1 A;  3FWL A;  5KZH A;  2ZD8 A;  4EQI A;  4EER A;  4KZ8 A;  1UGU A;  5A90 A;  1YLP A;  1SKO A;  4X25 A;  1MZU A;  4S2O A;  4Q0J A;  1XX2 A;  2Z2M B;  4OP8 A;  1GA9 A;  3T1Q B;  3IXD A;  3N8S A;  2BAS A;  4DDS A;  5EPH A;  4R38 A;  4R4R A;  2X01 A;  4S2J A;  2GZA A;  1Y4O A;  4E04 A;  1S1Y A;  2C6W B;  1K57 A;  2Z6C A;  3UB8 A;  5HAP A;  1V9Y A;  4S2N C;  2HP5 A;  5HSQ A;  4FOF A;  5F83 A;  3DWK A;  4CLC B;  2PAV P;  3N6I A;  3IS2 A;  3H7W A;  3C30 A;  2ZMF A;  3SH9 A;  4KQR A;  1OTB A;  1UWP X;  1ZG6 A;  4GHI A;  4IUH A;  1IYQ A;  3B3X A;  5FQI A;  1NWZ A;  4B4Z A;  1FR6 A;  1JWV A;  4LV1 A;  5KSH A;  2P7J A;  5CXW A;  4XXR A;  3TG9 A;  1ZHH B;  3IWO A;  3T4Q A;  4WEK A;  4X1L A;  1BT5 A;  2PD8 A;  4E3J A;  4AFI A;  2OAQ 1;  2QYB A;  3LEQ A;  1ESU A;  5AQ9 A;  4NXB A;  2I72 A;  3C5A A;  1WYB A;  2JC7 A;  2PBD P;  2J80 A;  2QJ7 A;  3W4Q A;  1K6S A;  3FC7 A;  2XLN A;  1L0E A;  3S22 A;  4FD8 A;  4RA7 A;  3TJZ C;  1K55 A;  3S7O A;  2O0Y A;  3LGO A;  5DKK A;  2RL3 A;  3MXR A;  2XD1 A;  2W1T A;  3O88 A;  3KSI A;  2E8J A;  2M7V A;  5DTS A;  3T4J A;  4F3L B;  3BYD A;  2H0Y A;  5EVI B;  4ZDX A;  3P01 A;  1P9W A;  1OTI A;  5AQA A;  1LI9 A;  5FAP A;  1PWG A;  1PW8 A;  3LY3 A;  5IT5 A;  4Z1W A;  1IKG A;  3CWF A;  1K57 C;  1BZA A;  2XF3 A;  4ZRR A;  4II7 A;  2KX6 A;  4JF6 A;  3B42 A;  1MC0 A;  2V20 A;  2ZL1 A;  4YIN A;  3T4T A;  3KSF A;  5AVF A;  4F3L A;  3MFX A;  2OLU A;  5FQ9 A;  1DP6 A;  4I3J A;  2ZOH A;  2KLI A;  5FI2 A;  4WZ5 A;  1L0G A;  1GHP A;  3K2N A;  3QHY A;  1Y54 A;  4UA7 A;  3TOI A;  3IWI A;  1CQA A;  2PU2 A;  1K0K A;  1GHI A;  2PRF A;  5G4Y A;  4PM5 A;  1XFN A;  4E3N A;  2Y2L A;  4Z9Q A;  4LEN A;  3LIC A;  3A3J A;  4D60 A;  5M18 A;  3MKF A;  1MKI A;  4JLF A;  2Y2O A;  1S4S A;  2H10 A;  3WWX A;  4R23 A;  3EGD C;  2P9V B;  2ZC6 B;  4HJ4 A;  4WF0 A;  1ES5 A;  2WGW A;  2OOL A;  2ZC4 B;  3GVB A;  3CMZ A;  2QMI A;  4XUZ A;  5IS1 A;  1LI0 A;  1P97 A;  1WE4 A;  2Y2P A;  3PHY A;  3T4O A;  4HQA A;  1YSQ A;  3GEC A;  1PWD A;  2Y79 A;  4BBT A;  3Q7Z A;  3IF6 B;  2BG1 A;  5IU1 A;  5EOO A;  1BLP A;  3G4P A;  4OOM A;  3ZNT A;  1H8M A;  2J7V A;  3MQO A;  4NEE D;  4GKU A;  2Y55 A;  3MJQ A;  1EWZ A;  3KSG A;  4MCW A;  4MLL A;  3A0S A;  4CPK A;  4E3L A;  2J8Y A;  3EWK A;  3Q07 A;  1YLJ A;  5J4E A;  1L0D A;  1NZU A;  5DJT A;  2EWW A;  3O5Y A;  3BFC A;  1SZV A;  3HRE A;  2GDN A;  4HOI A;  3A3F A;  3HL9 A;  1HD8 A;  2GNX A;  2YKH A;  4K91 A;  4ARZ B;  3VSK A;  1UWN X;  1BYW A;  5FQQ A;  1Q2P A;  5HDD A;  2A24 B;  3NDE A;  4LV2 A;  1DJA A;  2Y2K A;  1W63 Q;  3N4I A;  3UY6 A;  3MQQ A;  1LL5 A;  5HPF A;  5KIZ A;  2Y2M A;  1DJC A;  2HF6 A;  4OQG A;  2JKF A;  2A2L A;  3HLC A;  3SH7 A;  2ZM2 A;  2DRW A;  2A24 A;  3BY8 A;  4KZ3 A;  3BFG A;  3LI9 A;  1BUE A;  4GN2 A;  3BRM A;  5E2F A;  1L3L A;  1CEF A;  1CK3 A;  1FOF A;  3CPT A;  1KVM A;  4DJ2 A;  4DE1 A;  4KG5 A;  1PZO A;  3NEC A;  4GCZ A;  1VB6 A;  3C8C A;  2HP9 A;  5L2F A;  4C6Y A;  3ZYT A;  5FA7 A;  5L10 A;  1NY0 A;  5CEC A;  3B33 A;  5TJJ A;  3UB9 A;  3U4L P;  4X53 A;  1K56 D;  4JGQ A;  3QP4 A;  3BM6 A;  4S2N A;  5F82 A;  2XEP A;  2L4R A;  5GHZ A;  1VET B;  3MF0 A;  3NC8 A;  3CZD A;  1PWC A;  4E6W A;  3KYE A;  3LR3 A;  2XQZ A;  4S2P A;  1H5X A;  3VE3 A;  5G18 A;  3PBS A;  5L09 A;  2BTF P;  1OJ5 A;  2PDR A;  2GJ3 A;  1I2W A;  4BD0 A;  1ES4 A;  3KO6 A;  2EX2 A;  5E43 A;  4WEJ A;  2EXA A;  3G2Y A;  1BLH A;  1Z09 A;  2W1R A;  4YWZ A;  4BBV A;  1IEL A;  1W5D A;  1IYP A;  3FV7 A;  3H82 A;  4RX2 A;  4FCF A;  3DAV A;  5TBM B;  1PFL A;  4M4X A;  2VGL S;  3CG5 A;  1YSP A;  5FL3 A;  5FQJ A;  4HP9 A;  1I2S A;  3ITA A;  5M1A A;  1IKI A;  3IXG A;  2JCH A;  3UMD A;  4GDN A;  2INW A;  1HTZ A;  3OC2 A;  4QWO A;  2EXB A;  5CER A;  4QHC A;  4CJN A;  2VGK A;  2PYR A;  4N1X A;  4DE3 A;  4DMZ A;  4WL9 A;  2ZMA A;  5FEF A;  5BOH A;  1FSW A;  2EX8 A;  3V39 A;  1A0K A;  1VHM A;  2OLV A;  5FQK A;  1K25 A;  4IBR A;  4O01 A;  1HVB A;  5DKL A;  4QY5 A;  3PXP A;  4HJ6 A;  2QKP A;  2ZOI A;  1MWU A;  1GSW A;  1KGF A;  3GMW A;  1Y28 A;  4Y7P A;  4KZ5 A;  1OT9 A;  5A93 A;  5CED A;  1YLZ A;  4EU0 A;  5F6A A;  2HDU A;  3C2W A;  2ZC5 B;  4BL2 A;  4UA6 A;  1FIK A;  3JPU A;  3K3D A;  2ZQ7 A;  1NYY A;  4CLC D;  4ME4 A;  5HAI A;  1E3U D;  4HI4 A;  4OQI A;  4NET A;  4R3A A;  2EFX A;  1G28 A;  1MXO A;  3F1N A;  3ZVW A;  4HES A;  1SHV A;  1V9Z A;  3UE3 A;  3AGE A;  3SS4 A;  3EEA A;  4PAU A;  1NLZ A;  2PU4 A;  2Y2H A;  4NXF A;  3T1R A;  3PBT A;  1W8Y A;  4GDB A;  3VV4 A;  1XGI A;  4WYY A;  4O8G A;  3CJM A;  2WKP A;  4P0M A;  5HW3 A;  3FPW A;  3O86 A;  4B9O A;  3MKE A;  2BLS A;  2EX9 A;  1NXY A;  3C7V A;  3T4L A;  2W3E A;  1CI9 A;  2ZMV A;  2WGI A;  1S4R A;  3CIT A;  4LFU A;  3IX3 A;  4FSF A;  4KG6 A;  3V3R A;  2P08 A;  3OCL A;  5F69 A;  4UAA A;  1SKF A;  4BBU A;  1DP8 A;  4K0W A;  4DDY A;  4UQI S;  3DW0 A;  3BY9 A;  5E2H A;  1VEU A;  4RQ9 A;  5EVL A;  3QP6 A;  1K38 A;  4IUK A;  5CGS A;  4GS9 B;  1TD5 A;  3VP1 A;  4KQO A;  3UPP A;  3MXQ A;  3UPO A;  1ERQ A;  3D4F A;  3LIE A;  1LSX A;  4ZJ3 A;  4NK3 A;  1PYY A;  5AJG A;  4S2I A;  4ARZ A;  1BSG A;  1ALQ A;  5J8X A;  4OON A;  3O3V A;  1H3Q A;  2V1Z A;  3PBN A;  3E0Y A;  4R3J A;  1LHY A;  3PBR A;  1XKZ A;  4WLA A;  1PI4 A;  4R3B A;  2M7U A;  1KDS A;  1E25 A;  4JXG A;  4EET B;  3DTE A;  5HWT A;  1YPR A;  4L0L A;  1U60 A;  1IEM A;  1JWZ A;  3HCY A;  5EM1 A;  4GOG A;  3SZT A;  1E3U A;  1ES3 A;  3O87 A;  5FDH A;  4OQH A;  3ZCZ A;  5FAQ A;  3W2Z A;  3LFV A;  1OT6 A;  3Q7V B;  3QP8 A;  2NUT C;  3DTK A;  1K55 C;  3UB6 A;  3NDG A;  2D02 A;  3GTC A;  5TFQ A;  4BLM A;  2JKR I;  3KYZ A;  3JYI A;  2ZC3 B;  1NRJ A;  4OLD A;  5DF8 A;  3NOU C;  1T19 A;  4UHU A;  1O7E A;  3LEZ A;  1BTL A;  4B88 A;  4DE2 A;  4JGO A;  4ZJ2 A;  4E3M A;  3UB7 A;  3KSH A;  4DJ3 A;  4I3I A;  3TW8 A;  2WGW B;  3CUE C;  4Y5F A;  5FAS A;  3JVU A;  2KDK A;  3ULF A;  4LLO B;  1MWT A;  3IT9 A;  4IHQ A;  5CEB A;  2JKT M;  2PR6 A;  2FZ0 A;  2Z2L B;  3HVF A;  4MN6 A;  5HWW A;  4I3A A;  1T18 A;  5KMW A;  4OOY A;  4HH2 A;  4R0Q A;  3E98 A;  4LGW A;  1RP5 A;  2IWC A;  4HEF A;  5E2G A;  5HD5 A;  1OTE A;  2OV5 A;  2Q9M A;  3MMH A;  3CI6 A;  1XP4 A;  4KZA A;  2V0W A;  3FKW A;  1GSV A;  3NCK A;  5J3W A;  3IX4 A;  3LIA A;  4MBF A;  4QPR A;  1JTD A;  3CHW P;  4GZB A;  1EI5 A;  1NYM A;  1BUL A;  4EWF A;  3F1P B;  1FQG A;  1H0M A;  5DFY A;  3WRZ A;  5HZH A;  2J3T D;  3Q1F A;  4WMC A;  5FAO A;  3BLM A;  2R9X A;  4NKP A;  2IA2 A;  2ZM8 A;  1JTG A;  1Z6F A;  3DTM A;  3SS5 A;  5AQB A;  2Y4A A;  3F1P A;  1K4E A;  4M3K A;  4RYE A;  2WUQ A;  3Q82 A;  5LBR A;  1NZO A;  3GSG A;  4MEZ A;  1FSY A;  2QWS A;  3VFF A;  4IBX A;  4OLG A;  5L07 A;  2CC1 A;  3LYX A;  4H6J A;  4ETZ A;  2ZLY A;  2W27 A;  2W3F A;  3C4O A;  3RH8 B;  5A91 A;  3HLG A;  1D7E A;  2ACG A;  2OWJ A;  3LO7 A;  2VA0 A;  3OPR A;  4XUX A;  1TDG A;  1KOU A;  3T12 B;  4E3K A;  2QPN A;  2V8C A;  4OOL A;  1MBL A;  1LLB A;  3HLW A;  1SDE A;  1MWS A;  3UPN A;  2Q9N A;  4HJ3 A;  3DBA A;  1DY6 A;  1MPL A;  4LV3 A;  3BWL A;  5EE8 A;  4RX3 A;  2DCF A;  1D1J A;  1F98 A;  1IYO A;  3TSG A;  5U47 A;  1SKO B;  3I7J A;  3RTY A;  5CRF A;  1TDL A;  3P7N A;  2HGV A;  3UME A;  3PAG A;  2VZW A;  1KGE A;  4Y2F A;  4LV0 A;  3LI8 A;  3QNC A;  1SDN A;  3CPT B;  3M6B A;  4ZJ1 A;  4EBN A;  3E4O A;  4YFM A;  5FSR A;  1XXM A;  1CF0 A;  4F94 A;  2WZX A;  2IWD A;  3HUN A;  3MZF A;  1K6R A;  2D01 A;  4WMC D;  2W0N A;  5HL1 A;  4PPR A;  3CUE A;  1S66 L;  5G4Z A;  1PRQ A;  2V8F A;  1MWR A;  1STZ A;  4X1M A;  4I38 A;  3L7H A;  4X68 A;  4E3O A;  2PBY A;  3BEB A;  5CHM A;  1IYS A;  1H8Z A;  3G31 A;  2J3W A;  1D06 A;  2Y8H A;  2VV6 A;  3HLD A;  3ZG8 B;  2WAE A;  1K54 A;  2GX5 A;  2UWX A;  4OPZ A;  5C5K A;  2G2U A;  3GR2 A;  3IXH A;  4Y0O A;  1ESI A;  4GJ4 A;  2W3H A;  4EUV A;  1FIL A;  1NRF A;  5F1F A;  2HDS A;  5K5B A;  5MC7 A;  3WS2 A;  1LSW A;  4JPM A;  2JN7 A;  1LT0 A;  4EBL A;  3FYZ A;  5DTK A;  3IF5 A;  3F1O B;  5E2E A;  2W3G A;  3UDI A;  4EW7 A;  4IED A;  4EV4 A;  4CLC E;  3AGD A;  2X02 A;  4YNR A;  2E8I A;  2A49 A;  2ZM0 A;  4QD4 A;  1CI8 A;  4E6X A;  3BW6 A;  3WS5 A;  3D9Y A;  4OPR A;  3IF6 A;  3IBR A;  2XH9 A;  4X6T A;  5EFW A;  5A8B A;  1TS8 A;  3VP2 A;  1ZG4 A;  1XGJ A;  3RJU A;  1P0Z A;  3MZE A;  1WA9 A;  4I39 A;  3H82 B;  3HUO A;  4X69 A;  1KE3 A;  2PT7 A;  2EX6 A;  1ERM A;  2QJ5 A;  1YMS A;  5FEG A;  4JXW A;  5JYO A;  2XGN A;  1GHM A;  3VP0 A;  5HFO A;  3OZH A;  4Y17 A;  5CX7 A;  1SCW A;  4Q8I A;  1G5U A;  2P9V A;  2UV0 E;  5GLD A;  4I5S A;  2ZQC A;  4L9G A;  2V2F F;  4EEU A;  3UDF A;  2R9W A;  4IJG A;  1YLY A;  3PTE A;  2B5R A;  5EM0 A;  2V1B A;  4JBF A;  4R6L A;  2HJE A;  4GB7 A;  4HHD A;  2DNS A;  4H8R A;  4OKP A;  2EA9 A;  1PNE A;  2ZQ8 A;  3OLO A;  2X71 A;  5I94 A;  1ONG A;  4WZ5 C;  1J3W A;  1KVL A;  2XSS A;  1YMX A;  2HZ5 A;  4QU3 A;  1YKD A;  3M6H A;  3WS4 A;  3A0V A;  5HAR A;  3ZHH A;  1OPX A;  4MBH A;  3UB5 P;  2FFY A;  4EQ1 A;  1YLW A;  1TF1 A;  1N4O A;  5EVE A;  2OSU A;  2H0T A;  4K0X A;  2LB5 A;  4WEL A;  4X56 A;  4P85 A;  1OTD A;  2FFF B;  2JKT I;  4JGR A;  3U2A A;  1VEU B;  4BWI A;  3G35 A;  3MBZ A;  1XJ4 A;  3Q7V A;  5TGF A;  1PW1 A;  3C4P A;  5A92 A;  3T4K A;  3S4X A;  5HL6 A;  3BFD A;  3KYQ A;  3EEH A;  3HJI A;  2J9P A;  3LUQ A;  3PBQ A;  3OPL A;  4BD1 A;  3AGF A;  2ZC7 A;  3P98 A;  1XJ6 A;  4BJP A;  4WBG A;  2HJ9 C;  1WYC A;  3NUL A;  2PYP A;  3A3D A;  2L1M A;  4QB8 A;  2YKF A;  3D72 A;  4O7D A;  4MN7 A;  3SS3 A;  3NIA A;  5FAT A;  3IXB A;  1TS6 A;  1S1Z A;  1FCN A;  3OOV A;  3HBR A;  4FTX A;  4LRX C;  3JVV A;  4HY8 A;  2EWV A;  3MS6 A;  4U0T A;  1E4D A;  4ETX A;  2K31 A;  3EQV A;  4Y3I A;  3BLS A;  1G68 A;  1DRM A;  3R4K A;  3PYP A;  4G3V A;  2VJW A;  4S2K A;  4Y0U A;  1YM1 A;  1OTA A;  1EW0 A;  3FPV A;  5HX9 A;  4N1H A;  4GNU A;  1JVJ A;  3OBF A;  1YAX A;  2ZL1 B;  1XFQ A;  3FG8 A;  4Y13 A;  3GQZ A;  4WN5 A;  2O9C A;  3OPH A;  3WS0 A;  1ZTU A;  3LID A;  5FQM A;  4CLC C;  2JHE A;  3E4P A;  1LSV A;  2XFT A;  3N8R A;  4DXB A;  1PZP A;  2K2N A;  3BQA A;  1W7F A;  4BEN A;  4KZB A;  1ZC2 A;  2WK0 A;  4JXV A;  3NOT C;  1LL8 A;  5EV0 A;  5AVE A;  4BMW A;  3ZVT A;  5EVI A;  3NHQ A;  1JNU A;  2ZJ9 A;  3IF6 C;  2VGL M;  4L9F A;  3LY4 A;  3CLO A;  3NBL A;  2WKH A;  2J9O A;  1CJF A;  5HD3 A;  1K54 C;  1GSX A;  2ZQD A;  2WZZ A;  4ESP A;  2V0U A;  3EGX C;  5EVI D;  5HPI A;  2VK3 A;  2OAP 1;  4GD8 A;  2ZQ9 A;  4NXE A;  2O9A A;  1NLY A;  3F1N B;  1W8Q A;  4P87 A;  1K56 A;  1ODV A;  4R4S A;  1K4F A;  5M19 A;  3F1O A;  1N9B A;  3LR4 A;  3NI9 A;  3FKV A;  2Q0O A;  3BEC A;  3UNW A;  2G7U A;  1HZO A;  4NG2 A;  1I5Q A;  3GV9 A;  4EEP A;  2Y2I A;  2VX8 A;  4DF6 A;  2A3U A;  1FCM A;  2L0W A;  2NUP C;  4S2L A;  1G6O A;  4CLC A;  3S7P A;  3RFB A;  4PM6 A;  1ES2 A;  3N8L A;  3VP3 A;  4MDZ A;  2JBF A;  3CAX A;  5IHV A;  2XRN A;  3ITB A;  2P04 A;  4C75 A;  4ID4 A;  4UQI M;  2W3D A;  1W79 A;  2AVX A;  1GCE A;  4QY6 A;  2QZ6 A;  4MMN A;  1PIO A;  3NJA A;  3A0R A;  1S6R A;  2Y2Q A;  2WAF A;  4N92 A;  5J7E A;  3ZDJ A;  4A5R A;  2VGJ A;  4LRY C;  3E2L A;  5JYP A;  3VP4 A;  1QMF A;  3B47 A;  4D2O A;  1F5M A;  2K7S A;  3HLB A;  3LR5 A;  1L0F A;  3UE1 A;  2KOI A;  3T1S A;  1LL9 A;  1YT4 A;  3V67 A;  1F2K A;  3WS1 A;  3T1X A;  3S7N A;  3H7W B;  3SOI A;  3G34 A;  4GHI B;  4NXG A;  1CEG A;  4ZTK A;  3TRC A;  1VM1 A;  4U0X A;  4KG2 A;  2Y91 A;  4KQD A;  2J3T C;  1VQQ A;  4MN5 A;  2H28 A;  3E2K A;  4KUO A;  3NOP C;  2ZBB A;  3Q81 A;  3ZQ5 A;  5GLB A;  4EES A;  2FH5 A;  4HIA A;  5KSC A;  4S2M A;  4BL3 A;  4KZ7 A;  3OPP A;  1XA7 A;  1FR1 A;  4KUK A;  2Y2J A;  2DMW A;  2HP6 A;  3ZFZ A;  1MY8 A;  3W4O A;  4KZ4 A;  1TS7 A;  1C3B A;  2Y2N A;  2W1T B;  1XJ2 A;  2XD5 A;  5EVI C;  4KQQ A;  3MR0 A;  2G2W A;  2HDR A;  1P9R A;  3OCN A;  3EQU A;  3UE6 A;  5CGW A;  3MQ0 A;  3HLE A;  5HDS A;  1PI5 A;  4KZ9 A;  1T1A A;  4UEY A;  3HLF A;  4JGP A;  1ACF A;  3QNB A;  2P74 A;  4Y15 A;  4ZAM A;  1VET A;  4B4X A;  2PR5 A;  1S67 L;  3P09 A;  1YLT A;  2RCX A;  4DKI A;  1W63 M;  2XDM A;  5FDS A;  5GLC A;  1Q2Q A;  4MNR A;  3IWQ A;  3DWZ A;  2M1C A;  2Y2G A;  1BLS A;  2JKR M;  1OJG A;  2H5S A;  3EOI A;  4WUJ A;  4DRT A;  5TBM A;  4N9K A;  5EEC A;  1M6K A;  4XT2 B;  3V3S A;  3W4P A;  4BQM A;  3SW1 A;  1DJB A;  3IHB A;  2V9A A;  3R7W A;  3UE0 A;  3WRT A;  5GHY A;  4HP4 A;  1OME A;  4N9L A;  3VSL A;  3M2K A;  3T4S A;  1KE0 A;  1TEM A;  4HNB A;  3ICY A;  1MKM A;  5EOE A;  4DE0 A;  2ZQA A;  1HLU P;  3RXX A;  1NJ4 A;  4XT2 A;  4L9E A;  3DTI A;  5CHU A;  5EUA A;  2QHK A;  2O99 A;  3R7W B;  3S1Y A;  3C38 A;  3IH9 A;  4LCL A;  1G6A A;  1RGZ A;  4HH3 A;  4JXS A;  2JE5 A;  3V50 A;  3PAE A;  3ZG5 A;  3LR0 A;  3NY4 A;  2CMN A;  2I9V A;  2JKG A;  3IS2 B;  4E3I A;  1TS0 A;  1YQS A;  4H6J B;  4Q0I A;  3IHA A;  1FCO A;  2VV8 A;  1ZKJ A;  4B93 A;  5I5L A;  4OPQ A;  5F5Y A;  1O07 A;  5L8M A;  2IWB A;  4OQ0 A;  4GS9 A;  2B18 A;  1T1C A;  2HDQ A;  2WKR A;  1TVF A;  4DXC A;  2HV1 A;  4CQH A;  3G2Z A;  2XRO A;  1L2S A;  3H9W A;  4PM8 A;  3ZNY A;  1RCJ A;  3VFH A;  3L9K A;  3IX8 A;  4K08 A;  4C3Q A;  1AWI A;  4PMA A;  4R1G A;  3BJN A;  2XR0 A;  1ERO A;  5DVA A;  3ZG9 B;  3KX0 X;  2VEA A;  3BQ8 A;  2XA7 S;  4LCM A;  3GRJ A;  4EBP A;  3QP5 A;  5F68 A;  4P6Z S;  4HBU A;  5CHJ A;  1GA0 A;  4FUW A;  3MSH A;  3BFF A;  2C5W B;  4QJG A;  2Y59 A;  3G32 A;  5FI6 A;  3G30 A;  1T1B A; 
#chains in the Genus database with same CATH homology
 1PZP A;  3N4I A;  4RVA A;  3UY6 A;  2ZM8 A;  1LL5 A;  1W7F A;  1JTG A;  4BEN A;  1Z6F A;  4KZB A;  5HAQ A;  3DTM A;  2Y2M A;  3SS5 A;  1DJC A;  4OQG A;  5D3O A;  1M40 A;  5AQB A;  1ZC2 A;  2Y4A A;  2WK0 A;  4JXV A;  1RGY A;  5DTT A;  2WKI A;  3ZG5 A;  1K4E A;  4M3K A;  1XA1 A;  4RYE A;  2WUQ A;  3HLC A;  3Q82 A;  3SH7 A;  3ZVT A;  2WYX A;  1NZO A;  1KGG A;  3GSG A;  5EVI A;  2ZM2 A;  4MEZ A;  2ZJ9 A;  3IF6 C;  1FSY A;  3VFF A;  2WGV A;  2DRW A;  4IBX A;  4OLG A;  2XFS A;  3LY4 A;  3NBL A;  4KZ3 A;  2WKH A;  4IVK A;  2CC1 A;  2J9O A;  3BFG A;  1K54 C;  2ZLY A;  1BUE A;  2ZQD A;  3C4O A;  4GN2 A;  3BRM A;  4WZ4 A;  2WZZ A;  5A91 A;  1JWP A;  5E2F A;  3HLG A;  1CEF A;  1CK3 A;  1KE4 A;  3N7W A;  1FOF A;  4HBT A;  5EVI D;  1KVM A;  4OVD A;  1S0W A;  3LO7 A;  5CTN A;  4DE1 A;  4KZ6 A;  4KG5 A;  5FI7 A;  4X55 A;  3RXW A;  3OPR A;  3ZG7 B;  1PZO A;  4GD8 A;  3SH8 A;  2ZQ9 A;  4XUX A;  1TDG A;  2HP9 A;  1J9M A;  4JF4 A;  1W8Q A;  5L2F A;  4C6Y A;  4E3K A;  5FA7 A;  1H8Y A;  5AQ7 A;  2QPN A;  1NY0 A;  4OOL A;  4P87 A;  5CEC A;  4P6B A;  1MBL A;  1LLB A;  1K56 A;  3HLW A;  1SDE A;  1MWS A;  3UPN A;  2Q9N A;  4R4S A;  1K4F A;  5M19 A;  1XPB A;  1DY6 A;  1MPL A;  1N9B A;  1ONH A;  3NI9 A;  4LV3 A;  5CGX A;  3FKV A;  5EE8 A;  3BEC A;  4RX3 A;  3MXS A;  2DCF A;  1K56 D;  4X53 A;  3UNW A;  1HZO A;  4FH2 A;  1I5Q A;  3BM6 A;  3GV9 A;  4PM7 A;  4JF5 A;  4S2N A;  5F82 A;  4OH0 A;  1IYO A;  2XEP A;  3VOZ A;  5GHZ A;  3ZG0 A;  4U3T A;  2Y2I A;  3TSG A;  5U47 A;  3NC8 A;  3CZD A;  1PWC A;  3PBO A;  4DF6 A;  4E6W A;  3I7J A;  2HPB A;  2XQZ A;  1BLC A;  1FCM A;  2A3U A;  3MZD A;  5CRF A;  1TDL A;  3IQA A;  4S2P A;  4Y0T A;  1H5X A;  5G18 A;  3PBS A;  4S2L A;  3V5M A;  4UA9 A;  3PAG A;  1I2W A;  4BD0 A;  1ES4 A;  4DXB A;  1KGE A;  4GD6 A;  4OP5 A;  3BFE A;  4PM6 A;  2EX2 A;  1ES2 A;  3N8L A;  4LV0 A;  3UDX A;  5E43 A;  4WEJ A;  2EXA A;  3VP3 A;  3G2Y A;  3QNC A;  4JKT A;  1BLH A;  4ZBE A;  2JBF A;  4MBK A;  1SDN A;  5IHV A;  2WAD A;  3VOY A;  3A3E A;  1IEL A;  1W5D A;  3M6B A;  3ITB A;  3MFD A;  1IYP A;  4ZJ1 A;  3UN7 A;  3W8K A;  3FV7 A;  4YFM A;  4EBN A;  4RX2 A;  4FCF A;  5FSR A;  1XXM A;  4C75 A;  4ID4 A;  2EFU A;  5F1G A;  3UO9 A;  4F94 A;  1AXB A;  1W79 A;  1GCE A;  1QME A;  3CG5 A;  3VMA A;  2WZX A;  5DF7 A;  4QY6 A;  2QZ6 A;  5FQJ A;  3HUM A;  1I2S A;  3ITA A;  2IWD A;  3HUN A;  3MZF A;  5M1A A;  1IKI A;  1K6R A;  1PIO A;  4WMC D;  3IXG A;  5GHX A;  2JCH A;  4PM9 A;  5HL1 A;  1S6R A;  2Y2Q A;  3FZC A;  2WAF A;  4N92 A;  4PPR A;  3ZDJ A;  4OPY A;  4A5R A;  2VGJ A;  4GDN A;  3E2L A;  1MWR A;  3ISG A;  5JYP A;  3VP4 A;  1QMF A;  1HTZ A;  3LCE A;  4KEN B;  3C7U A;  4D2O A;  5GLA A;  3OC2 A;  4FH4 A;  4X68 A;  4E3O A;  2EXB A;  3HLB A;  5CER A;  1L0F A;  4QHC A;  2PBY A;  3BEB A;  2VGK A;  5CTM A;  4CJN A;  3UE1 A;  5CHM A;  4WM9 A;  4N1X A;  1LL9 A;  1YT4 A;  4DE3 A;  1IYS A;  3WS1 A;  2XK1 A;  1H8Z A;  3G31 A;  2ZMA A;  5BOH A;  3SOI A;  1KDW A;  3G34 A;  1FSW A;  2EX8 A;  5DF9 A;  2WKE A;  5GL9 A;  3V39 A;  3A3I A;  3HLD A;  3ZGA B;  1CEG A;  2OLV A;  4ZTK A;  3ZG8 B;  1VM1 A;  4U0X A;  2WAE A;  4KG2 A;  1K54 A;  5FQK A;  2Y91 A;  4EUZ A;  1K25 A;  4IBR A;  2UWX A;  4OPZ A;  1HVB A;  1VQQ A;  5TR7 A;  4QY5 A;  3IH8 A;  2G2U A;  3GR2 A;  3E2K A;  3M2J A;  4IVI A;  3FWL A;  5KZH A;  3IXH A;  4Y0O A;  1MWU A;  2ZD8 A;  4EQI A;  4KZ8 A;  1KGF A;  1ESI A;  3GMW A;  3Q81 A;  5GLB A;  4Y7P A;  5A90 A;  4KZ5 A;  1YLP A;  5FAO A;  1NRF A;  5F1F A;  2HDS A;  4S2O A;  1XX2 A;  2Z2M B;  3WS2 A;  4OP8 A;  5KSC A;  1GA9 A;  4S2M A;  4JPM A;  4BL3 A;  5A93 A;  4KZ7 A;  3IXD A;  3N8S A;  4DDS A;  5CED A;  1YLZ A;  3OPP A;  4EBL A;  1XA7 A;  2HDU A;  1FR1 A;  3FYZ A;  5EPH A;  2ZC5 B;  4BL2 A;  4R4R A;  4UA6 A;  4S2J A;  2Y2J A;  2X01 A;  5DTK A;  2ZQ7 A;  3IF5 A;  1NYY A;  2HP6 A;  2C6W B;  5E2E A;  3ZFZ A;  1K57 A;  3UDI A;  1MY8 A;  4IED A;  5HAI A;  3W4O A;  1E3U D;  4EV4 A;  4OQI A;  5HAP A;  3AGD A;  2X02 A;  4NET A;  4S2N C;  4KZ4 A;  2EFX A;  1MXO A;  2E8I A;  2A49 A;  2HP5 A;  2ZM0 A;  1CI8 A;  4QD4 A;  1C3B A;  4E6X A;  2Y2N A;  3WS5 A;  5F83 A;  2XD5 A;  5EVI C;  3ZVW A;  4KQQ A;  3DWK A;  4OPR A;  4HES A;  3N6I A;  3IF6 A;  1SHV A;  2G2W A;  2HDR A;  3UE3 A;  3SH9 A;  3AGE A;  3OCN A;  4KQR A;  3SS4 A;  3EQU A;  2PU4 A;  5CGW A;  2Y2H A;  1ZG6 A;  2XH9 A;  3PBT A;  1W8Y A;  4GDB A;  4X6T A;  1IYQ A;  3B3X A;  1XGI A;  4WYY A;  5FQI A;  3HLE A;  3CJM A;  3VP2 A;  4B4Z A;  4P0M A;  1FR6 A;  1JWV A;  1PI5 A;  1ZG4 A;  4KZ9 A;  5HW3 A;  1XGJ A;  3HLF A;  4LV1 A;  3O86 A;  3QNB A;  3MZE A;  5CXW A;  3RJU A;  2P74 A;  4XXR A;  5KSH A;  3TG9 A;  3IWO A;  3MKE A;  4WEK A;  3HUO A;  2BLS A;  2EX9 A;  4X69 A;  1KE3 A;  4ZAM A;  2EX6 A;  1ERM A;  1NXY A;  3C7V A;  1YMS A;  4B4X A;  4JXW A;  1CI9 A;  1BT5 A;  2WGI A;  5JYO A;  2XGN A;  1GHM A;  3P09 A;  4E3J A;  3VP0 A;  4KG6 A;  4FSF A;  1YLT A;  5HFO A;  2RCX A;  3OZH A;  3V3R A;  4DKI A;  3OCL A;  2XDM A;  4UAA A;  1ESU A;  5GLC A;  5AQ9 A;  1SCW A;  1SKF A;  1Q2Q A;  4Q8I A;  2P9V A;  2I72 A;  3C5A A;  1WYB A;  4MNR A;  5GLD A;  4K0W A;  2JC7 A;  4DDY A;  3W4Q A;  1K6S A;  3DW0 A;  2XLN A;  2ZQC A;  3DWZ A;  1L0E A;  3IWQ A;  3S22 A;  2Y2G A;  4FD8 A;  1BLS A;  2V2F F;  5E2H A;  4RA7 A;  3UDF A;  5EVL A;  2R9W A;  2H5S A;  1K38 A;  1K55 A;  5CGS A;  4DRT A;  1YLY A;  3VP1 A;  4KQO A;  3UPP A;  3PTE A;  3UPO A;  2B5R A;  1ERQ A;  2RL3 A;  3D4F A;  4N9K A;  4JBF A;  5EEC A;  3MXR A;  1M6K A;  2XD1 A;  4ZJ3 A;  3O88 A;  4GB7 A;  4NK3 A;  5DTS A;  1PYY A;  2DNS A;  4H8R A;  3BYD A;  2H0Y A;  3V3S A;  4S2I A;  5EVI B;  4ZDX A;  3W4P A;  4BQM A;  4OKP A;  1BSG A;  1ALQ A;  4WMC A;  5J8X A;  4OON A;  1DJB A;  2ZQ8 A;  3IHB A;  5AQA A;  1LI9 A;  3O3V A;  5FAP A;  3UE0 A;  2V1Z A;  1PWG A;  1PW8 A;  3LY3 A;  2X71 A;  3PBN A;  4R3J A;  3WRT A;  1IKG A;  5GHY A;  5I94 A;  1OME A;  4N9L A;  1LHY A;  1ONG A;  3M2K A;  3PBR A;  3VSL A;  1K57 C;  1BZA A;  2XF3 A;  4WZ5 C;  1KE0 A;  1KVL A;  1XKZ A;  1TEM A;  1YMX A;  1PI4 A;  4JF6 A;  4QU3 A;  4R3B A;  3M6H A;  1KDS A;  1E25 A;  4JXG A;  2V20 A;  3WS4 A;  5EOE A;  5HAR A;  3ZHH A;  4L0L A;  1U60 A;  4YIN A;  4MBH A;  1IEM A;  1JWZ A;  2ZQA A;  4DE0 A;  2FFY A;  3RXX A;  1NJ4 A;  1YLW A;  1N4O A;  2OSU A;  5CHU A;  2OLU A;  2H0T A;  4K0X A;  5FQ9 A;  4GOG A;  5EUA A;  4WEL A;  1E3U A;  1ES3 A;  4X56 A;  3O87 A;  5FDH A;  4OQH A;  3S1Y A;  4P85 A;  3ZCZ A;  5FI2 A;  4WZ5 A;  2FFF B;  1L0G A;  1GHP A;  5FAQ A;  3IH9 A;  4LCL A;  1G6A A;  3QHY A;  1Y54 A;  4UA7 A;  3TOI A;  3IWI A;  3Q7V B;  2PU2 A;  3G35 A;  3MBZ A;  1RGZ A;  1K55 C;  3Q7V A;  1GHI A;  3NDG A;  5TGF A;  1PW1 A;  4PM5 A;  3C4P A;  4JXS A;  3GTC A;  5TFQ A;  4BLM A;  2JE5 A;  4E3N A;  3JYI A;  3BLM A;  2Y2L A;  2ZC3 B;  5A92 A;  4Z9Q A;  3S4X A;  4LEN A;  3V50 A;  3A3J A;  3PAE A;  4OLD A;  3BFD A;  2J9P A;  5DF8 A;  5M18 A;  4UHU A;  1O7E A;  3LEZ A;  3MKF A;  3NY4 A;  3OPL A;  1BTL A;  3PBQ A;  1MKI A;  4JLF A;  2Y2O A;  3AGF A;  4B88 A;  4BD1 A;  4DE2 A;  2H10 A;  3WWX A;  4ZJ2 A;  2ZC7 A;  4R23 A;  3P98 A;  4E3I A;  4E3M A;  4BJP A;  2P9V B;  4WBG A;  1YQS A;  2ZC6 B;  1WYC A;  3A3D A;  1ES5 A;  2WGW A;  3IHA A;  1FCO A;  1ZKJ A;  2ZC4 B;  3GVB A;  2WGW B;  4QB8 A;  4OPQ A;  5FAS A;  3CMZ A;  4O7D A;  3SS3 A;  2QMI A;  3NIA A;  4XUZ A;  5FAT A;  3IXB A;  1MWT A;  1O07 A;  1LI0 A;  1FCN A;  3IT9 A;  2IWB A;  5CEB A;  1WE4 A;  4OQ0 A;  2Z2L B;  3HBR A;  2Y2P A;  3HVF A;  5KMW A;  2HDQ A;  4OOY A;  1TVF A;  4DXC A;  1PWD A;  4U0T A;  4R0Q A;  3Q7Z A;  3G2Z A;  1RP5 A;  2IWC A;  3IF6 B;  1E4D A;  2BG1 A;  4HEF A;  3EQV A;  5E2G A;  1L2S A;  2OV5 A;  3BLS A;  1G68 A;  5EOO A;  1BLP A;  2Q9M A;  3G4P A;  4OOM A;  3ZNT A;  2J7V A;  1XP4 A;  4KZA A;  4PM8 A;  4GKU A;  2Y55 A;  4S2K A;  1EWZ A;  3FKW A;  4Y0U A;  1YM1 A;  3ZNY A;  3NCK A;  1RCJ A;  3VFH A;  4MLL A;  5HX9 A;  4CPK A;  4E3L A;  4MBF A;  2J8Y A;  3Q07 A;  4C3Q A;  4N1H A;  1JTD A;  1YLJ A;  4PMA A;  4R1G A;  1L0D A;  4GZB A;  1NZU A;  1EI5 A;  2XR0 A;  1ERO A;  5DVA A;  3ZG9 B;  1NYM A;  4GNU A;  1JVJ A;  3BFC A;  1BUL A;  4EWF A;  1FQG A;  4LCM A;  3HRE A;  3GQZ A;  2GDN A;  3GRJ A;  3WRZ A;  4EBP A;  3OPH A;  4HBU A;  5CHJ A;  1GA0 A;  3A3F A;  3HL9 A;  1HD8 A;  2C5W B;  3BFF A;  4K91 A;  3WS0 A;  3VSK A;  4QJG A;  2Y59 A;  5FQM A;  5FQQ A;  1Q2P A;  3NDE A;  3G32 A;  4LV2 A;  2XFT A;  3N8R A;  5FI6 A;  3Q1F A;  1DJA A;  2R9X A;  2Y2K A;  3G30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...