4PMJA

Crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 in complex with nadp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
281
structure length
281
Chain Sequence
b'MHDPIPTIAFPDGRKVPALGQGTWRMGENRAKTADEVRSLQTGLDLGMTLIDTAEMYGDGAAERIVGEAIKGRRDEAFVVSKVLPSNASRAGTVAACERSLRNLGIDCVDLYLLHWRGGYPLAETVAAFEELKKAGKIRAWGVSNFDVDDMEELSAVPDGGNVAANQVLYNLARRGIEFDLLPRCRAQGVPVMAYSPLDEGRLLHDADLIHIAKAHQATPAQVALAFLKTCSGVISIPKTGSPERARENRDAMDIHLTTENLAELDRHFPPPRRKTRLEVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative oxidoreductase
publication title Crystal structure of a putative oxidoreductase from Sinorhizobiummeliloti 1021 in complex with NADP
rcsb
source organism Rhizobium meliloti
molecule tags Oxidoreductase
total genus 102
structure length 281
sequence length 281
ec nomenclature ec 1.1.1.-:
pdb deposition date 2014-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4pmjA00
4FA3A 4GQGA 1Z9AA 5LIXX 3LD5A 4JQ3A 2ISFA 2PDNA 2PDMA 2PEVA 1EXBA 2HE8A 3F7JA 3UZYA 4PUUA 4GABA 3FJNA 2A79A 2BP1A 3M4HA 4HMNA 1VP5A 4RPQA 3R43A 4WRHA 2FZDA 4FAMA 2HDJA 4DBSA 2PDLA 4WEVX 4JTDA 5HNUA 2NVDA 3N2TA 1FRBA 4G5DA 3UWEA 5M2FX 3V35A 2IPGA 4LBRA 4JQAA 2VDGA 3RX2A 5AZ1A 3V0SA 1UR3M 4JQ2A 1Z8AA 1T41A 5LIKX 2AGTA 1AZ2A 4YS1A 2PD9A 2PDQA 5AZ0A 3LUTA 1XF0A 4XVEA 2PDIA 3LN3A 3C3UA 3M64A 4JQ4A 4PRTA 4XZIA 2PDCA 4QR6A 3DOPA 2IKIA 4XO6A 1S1RA 3MB9A 1MI3A 2INEA 3NTYA 1Q5MA 3DN5A 1LWIA 2DV0A 4FALA 1K8CA 3P2VA 3V0TA 4IJCA 2IQ0A 3R94A 2R9RA 1QWKA 3O3RA 2PDHA 3M0IA 3CAVA 2BGSA 4ICCX 5JH1A 3H7UA 1AFSA 3GUGA 1QRQA 3LEPA 2INZA 3GHRA 4JIIX 3UZZA 1X97A 3V36A 3GHUA 3R8HA 4AUBA 1IEIA 3ERPA 4QBXA 2PDBA 3LNMA 4IGSA 3R58A 1HQTA 5LIUX 3D3FA 3WBXA 2BGQA 1RY8A 4JTAA 2F38A 4XZNX 2IPWA 5DANA 4YVPA 3LZ5A 5HNTA 3EB3A 4XVDA 2PD5A 4JTCA 3R6IA 2PDKA 2I17A 3UYIA 4GQ0A 3KRBA 3R7MA 3LZ3A 4WDWA 2ACQA 4WDTA 1EL3A 4XO7A 5JH2A 2NVCA 4HBKA 4JTRA 4PR4A 4LAUA 2HVNA 3MC5A 1YE6A 3WBYA 2PDPA 4PRRA 2PDWA 1T40A 3COTA 1MRQA 4PMJA 2IS7A 4F40A 1LQAA 3LBOA 1XJBA 4H7CA 4IJRA 1PWLA 5LIWX 4XK2A 2ACUA 4DBWA 3EB4A 2PDJA 1EF3A 1IHIA 3V0UA 3CV6A 2ALRA 2IKJA 3CV7A 1X98A 3CASA 3H7RA 2IKGA 1GVEA 4LB3A 4DZ5A 3QKZA 2IKHA 4L1WA 2PDFA 4WGHA 2ACSA 3WBWA 5KETA 4YU1A 2PZNA 3BCJA 3BV7A 3RX3A 4JIHA 3G1RA 3ONCA 3VXGA 4QXIA 1Z89A 1R38A 4XZMX 3CAQA 3U2CA 4XZLX 5LIYX 1EKOA 4JQ1A 2PDYA 3UP8A 2WZMA 4JTQA 1MZRA 1X96A 3BURA 1S2AA 4MHBA 1US0A 3S3GA 1ZSXA 3RX4A 2FGBA 4Q3MA 1PYFA 1JEZA 1C9WA 2CLPA 1RY0A 5C7HA 1A80A 2FZ8A 1ADSA 1HW6A 4ZFCA 1AZ1A 1M9HA 1PWMA 2C91A 5HA7A 3LENA 3Q65A 3O0KA 3H4GA 2HV5A 4XZHA 4WDXA 1Q13A 1YE4A 1VBJA 1S2CA 4I5XA 4GCAA 2I16A 4OTKA 4L1XA 4R9OA 4LB4A 4EXBA 4LAZA 3CMFA 2PDGA 2QXWA 4WDUA 2HVOA 2FZ9A 3ONBA 4GACA 1ZGDA 3LQLA 3N6QA 1ZQ5A 3WG6A 4DBUA 4YVVA 2F2KA 4GA8A 2J8TA 2P5NA 3LQGA 2FZBA 4LBSA 2WZTA 3Q67A 3UZWA 3T42A 1YNPA 2FVLA 2PF8A 1PZ1A 2DUZA 2PDUA 4PUWA 2IQDA 3EAUA 2PDXA 1RALA 1SM9A 4NKCA 2PFHA 1XGDA 3FX4A 3WCZA 3UZXA 4FZIA 1PZ0A 4EXAA 1J96A 4H8NA 1OG6A 3UFYA 1AH3A 4Q7BA 1AH4A 3G5EA 2IPJA 3R8GA 2ACRA 4ASTA 2HE5A 3B3DA 4YVXA 3BUVA 2DUXA 3UGRA 3GHTA 1ZUAX 1YNQA 2IPFA 4QX4A 1S1PA 4GIEA 1AH0A 2HEJA 3UG8A 1Z3NA 2R24A 4JIRA 4XAPA 3GHSA
chains in the Genus database with same CATH superfamily
1F6PA 4ZQNA 2J25A 2HBVA 3VGDA 3LS9A 4EWND 3N2OA 5ABFA 1XCWA 2VUYA 1JUKA 4UOQA 3NQCA 3B8UA 1G4TA 1XRFA 4LNCA 4RPQA 4Z2IA 3S1XA 1MEHA 2PDLA 3H2CA 3ECQA 4PMYA 3T07A 3TN6A 4QFUA 3EMCA 3NURA 3EPOA 4L61A 3QEZA 5C71A 3A9BA 3LBMA 5T9CE 4HPHA 5BOFA 4V27A 3LG3A 4UQDA 3G2GA 4UFMA 2UV8G 3C0SA 4MWAE 1GW9A 4XTIA 5HMFA 4NY2A 4RDZA 3A3HA 3TONA 4UB9A 3RPTA 1T41A 2OX4A 1C8YA 1SSGA 3W85A 2WC7A 1JXKA 1OCJA 4Q8TA 2W61A 3PUEA 4BHYA 4FIRA 6REQA 5CZJA 3O16A 1KGXA 3T4WA 4GZ7A 1QASA 1LL4A 2VEIA 3VIIA 1ZU8A 4LU0A 3E0VA 3DOPA 3VCCA 1CLKA 1IZJA 4LUTA 3G1FA 3B9EA 4QE1A 2FYMA 1ECEA 1N2VA 2XWEA 3RR1A 4MLRA 3MMWA 4PB4A 1E9ZB 1Q6EA 4WY0F 4FX7A 3OW1A 4CCEA 4E8DA 2RJGA 3SRFA 3M07A 1E6QM 4UTIA 3FAXA 4O50A 1DQXA 1MNZA 3A4AA 2XISA 1G94A 2F7FA 1G69A 1E55A 4B92A 4HZ8A 1UR2A 2J88A 4Z1YA 4KRUA 4IP7A 4M7SA 3U4AA 2CWNA 2O9TA 1KFLA 4HU4A 2CBVA 2X1IA 3K4AA 3B4UA 2XH2A 3V5CA 1YXDA 1EFZA 1REQA 4IXXA 3WKZA 3KLKA 3ATYA 4KERA 1Q4NX 3VNZA 2NUYA 1ISWA 1ONRA 1UKQA 1UKTA 3SCUA 2G3FA 4Z08A 2Y88A 4L7ZA 5F1VA 4LCSA 3WLLA 3WLTA 2NSXA 3UG3A 5CZSA 1E4LA 3LHVA 1JUBA 2UY3A 3PB2A 3VM5A 3MSDA 2R1LA 4FNSA 1H7OA 4D72A 3COTA 4BEUA 3THQA 3W6LA 1PZ3A 1VBUA 3N2CA 2PWVA 3AUJA 3DHPA 5KMYA 2MNRA 3N13A 2VVSA 3KLLA 2GQ9A 3A64A 1DQWA 1BSIA 3PJUA 2VOMA 1EC7A 4WKAA 5ECUA 1XD1A 1R3YA 1UR8A 3U0HA 1V08A 1CXLA 2EO7A 2G4FA 1DQUA 3MO4A 2GVEA 1DIEA 4HNUA 2W6RA 5M3WA 1E15A 2F6XA 2BLEA 1V8EA 3QLLA 2VYOA 5FJUA 4MOZA 1RH9A 1BTMA 1S38A 4GISA 2NWSA 4MY8A 4MKNA 5FESA 3B9OA 1UR4A 3EWDA 3C8FA 2YYUA 1V77A 3EXTA 1JRCA 3OU8A 4FMVA 2V81A 2ZRXA 2VD9A 5FOOA 1SZFA 5D2WA 1L2QA 2X1UA 1LUCB 4MG4A 1EPXA 1W9PA 1PDYA 1D3CA 5AVNA 1TWZA 4GVFA 4C91A 3LENA 4U10A 4Y9NA 2NV9A 4DYJA 4IFRA 3G1AA 3MJMA 4GBDA 3QGAC 5D05A 2EGZA 4LS1A 4LH8A 2A21A 4I5XA 4MFEA 4U28A 3PTQA 1F76A 3VIJA 3SIZA 4FF7A 5BWAA 3TP4A 3WQPA 1RHCA 1UA3A 3SIMA 3AIEA 3ZM8A 4CQCA 4MB4A 3CT2A 1CXKA 4NP7A 1KWKA 2WNWA 1JAEA 2WXDM 5CPTA 1S2VA 1HL9A 3MSRA 2W3ZA 1G4SA 3APYA 3N25A 1QPQA 3UZWA 4GINA 5KZ6A 1VZWA 1LORA 4FOKA 1KA9F 1R47A 3FJLA 1HJXA 4W84A 3LM3A 1H5VA 4NT0A 1B5TA 4WCJA 2PDXA 3FEQA 2Z2AA 3DDMA 3MCMA 3WNMA 5CAHA 2E0PA 3DERA 3F2DA 4NJIA 5T9BG 2BX7A 2WHKA 3UWVA 1B90A 1E3XA 1WZMA 3S1WA 1E5JA 3LRMA 3PY2A 4M3PA 1AQHA 3C86A 3B04A 1RPKA 1JPKA 4EF8A 2WVUA 3GIYA 3TV8A 3VKAA 3NGJA 5I3HA 3PNUA 3BLLA 4F9DA 1UWQA 2FMNA 1M7OA 1UPPA 2GQAA 3GDBA 4H41A 3UETA 2Z28A 3ARRA 3VKDA 1JFHA 4O18A 2PU1A 1BD0A 4HHPA 4TR9A 4JTEA 4NI3A 3GRIA 4DRSA 1XD0A 4X9SA 1HN1A 5M03A 2EPKX 2XM2A 2DP3A 4KESA 3ZO9A 4JTLA 2F2HA 2Z4GA 4KEVA 3TFCA 2WMIA 3ELFA 3NAVA 4GQGA 3OJGA 5LIXX 1OJXA 1Q65A 2Z1SA 3IACA 1CYGA 1JPIA 3UJSA 3OQEA 2PDMA 2GSEA 3VOJA 1L0PA 5GNYA 3S1GA 1EXBA 4MNJA 2HE8A 4PZVA 3FJNA 2BP1A 3C56A 2PWEA 2VEGA 4DIAA 4OFCA 3TYUA 3QYSA 5AY7A 1V51A 4JTDA 4O11A 1W1A1 3UY7A 1C90A 1J9YA 4A8RA 1U5JA 3HQNA 2ZADA 3RX2A 4MYXA 1EJWC 1JYXA 3GNNA 3B97A 2AKMA 3BW3A 5G1TA 1IIGA 4V2XA 2CPUA 5M1TA 1EYEA 4ZO6A 1WDPA 1XLHA 4OBSA 1TA3B 2KX9A 3CQIA 3WDQA 4FIQA 1Y0EA 1QPNA 1A0EA 1DP0A 3ES8A 3HV9A 3SCWA 3T78A 2P53A 1O60A 2C71A 2WANA 5G2HA 4MPKA 1S1RA 3W7HA 3GXTA 3LYEA 4F79A 4QEHA 1FA2A 4FXJA 2REQB 4W7WA 4ZQRA 4TV5A 4QAWA 3D46A 3WLOA 3O6CA 1FH9A 4Q4MA 2X7VA 4QG6A 4ZBCA 1XC6A 3S47A 2FLIA 4JNYA 2YDAA 1H60A 2PWHA 3B8DA 1B4KA 2INZA 2VELA 1EWDA 4X61A 1I9CB 4FXRA 4G1KA 4UQEA 1SZNA 1IEIA 1V6YA 1XIIA 5C9RA 4HPJA 1LQ2A 2E9LA 1BGAA 3BTNA 1O4UA 3VTRA 5A6BD 1J2BA 3W1NA 3M5VA 4CD7A 1I60A 1OEPA 2E77A 4IGMA 4YVPA 1B9BA 3FHAA 4GQRA 4NQ1A 4G2DA 5B80A 2VRJA 2GGEA 4M6QA 3BLIA 4UCGA 5KZEA 3MO7A 5TQLA 1WDQA 3F4DA 1VAHA 5D02A 3N12A 1I0DA 4ZXOA 3O63A 1LWHA 4HOWA 4LAUA 3AC0A 1RQHA 3CO8A 3GW0A 3W28A 2Z1KA 5K2ZA 3GTNA 3URBA 1ZJIA 1Y8BA 2HROA 2VHLA 3MUZ1 1M68A 1MW1A 1TUFA 4FNQA 3K1GA 1OABA 3Q94A 2HMCA 3UXDA 1XG4A 3NO5A 1E4MM 4IJBA 1DXFA 3W6MA 4ACYA 4AZGA 3ZSSA 1WB0A 5I5RA 3C3NA 4OECA 2J77A 1DXIA 4XUGA 4XD4A 2ZA3A 2RUSA 3HPFA 1P43A 2QDEA 3IAPA 1NVMA 4TX6A 4DZHA 1X8CA 3WK3A 2HPIA 1XLKA 4AD3A 4ENLA 3U5UA 5D2VA 2AMGA 2V2DA 2V5DA 4FR6A 1JUEA 1Q7QA 2PC4A 3R1ZA 3HPZA 1IXPA 3ORWA 6TIMA 4L4PA 3T8LA 4H3DA 3UR5A 2Y7EA 3VXGA 4ZE4A 1GOXA 1FWIC 2NT1A 1KFJA 2E25A 2YX0A 1PJ9A 3WF0A 3VNKA 4E2DA 3MKVA 2PDYA 2VEMA 5LNVA 1Q45A 3BURA 1ZZMA 3WUEA 3FGCA 2O9OA 5FF2A 3AALA 2VFIA 5DN1A 1QNOA 2CLPA 4IUGA 3GNRA 3VE9A 1XYBA 2J7BA 2YA0A 4AZHA 1CGYA 3G6LA 4CUCA 1MDLA 1WKFA 2PGRA 2OT0A 4W5ZA 2Y24A 2C91A 3O9NA 3L0KA 4H2HA 1HP5A 1RPXA 4XKYA 3LOTA 2CETA 3BJFA 3OB8A 3OZYA 3WD4A 2HV5A 3DFPA 1OFQA 1FWWA 2WCAA 3L4UA 3KL5A 2YZRA 1GQKA 3RG6A 3AS3A 1FHUA 1EX5A 4KGLA 5E6YA 5C55A 4J3TA 1KWGA 2HVMA 1PO9A 2RDWA 2E7FA 2OEMA 1NARA 4DUVA 1JCNA 2CHNA 4OJYA 1IYXA 2EKCA 2O4MA 4E0CA 4RE4A 3P82A 3BGGA 1G4EA 5BXPA 1QNVA 5H2ZA 4F4RA 1SW7A 1RBLA 4C1NA 3C2EA 1J93A 1YNPA 2CW6A 4NZFA 2ZE0A 2VENA 3E5BA 2ZICA 3P6LA 1SZEA 1EJVC 1CB7B 2QJGA 5DFAA 1QNQA 3IS4A 2EJAA 2QJMA 4IHCA 4ZQCA 4AH7A 2JKAA 3TTYA 1Z44A 4RPPA 3AHXA 3URAA 2QDDA 4GYKA 3OG2A 3MUIA 3NEHA 4IL2A 4N42A 1YEYA 2ZZ6A 2QF7A 3TJXA 1YW1A 1FWSA 3JUGA 4OT7A 5CQ1A 5DMNA 1PAMA 2VT0A 2OGJA 2NXGA 3HMJG 1XYMA 2XGBA 3RAOA 3VZXA 4JX4A 1O1HA 5I03A 1M03A 4UTLA 4A3RA 1A49A 1B1YA 5FF7A 1QBBA 1TRDA 3GFYA 1YNQA 4S3JA 2QJNA 4OV4A 2FVKA 1QW7A 3P0WA 1PSCA 1GUVA 3MVIA 1R86A 1JVNA 2VFFA 1RVKA 3LHTA 1T8QA 2B7NA 3ZIZA 3VNLA 4C6MA 2WSPA 3MANA 4IT1A 1R2SA 1R85A 5DF0A 2RKXA 3UZYA 2Q02A 2Z1VA 3GG7A 3NYDA 4X0VA 3EZ4A 3VABA 3W7CA 4XZWA 4AISA 2GQ8A 3VVGA 2NVDA 2HNEA 2I9UA 4PMVA 3MBFA 5CKSA 2IPGA 4LBRA 1PTAA 3HURA 4BQ2A 2DW7A 3WH5A 1OWQA 3AWOA 1CENA 1QCWA 1IEQA 1C8QA 4XBJA 3I4EA 3DI0A 5A8NA 4WD0A 4WXZA 1EJUC 5AKQA 3PG8A 1S5NA 2NQ5A 5GJMA 5JQ9A 2WW5A 3T2PA 4M0XA 4B90A 3ME3A 2XN0A 5GQBA 4QR6A 3CAWA 5LA1A 4DBDA 4E3VA 5C9UA 4H01A 4XSLA 1OFOA 3XISA 8RUCA 1JZ5A 1GVIA 2G37A 5FI8A 3M0IA 5BROA 1XIDA 2QMKA 4HSHA 3FXYA 3STPA 4S23A 1H7PA 4W93A 1U22A 2E5BA 3AIBA 1ZFJA 1F3XA 1UOKA 4HCLA 3UA3A 2H8ZA 4GVIA 2CZDA 3FFSA 3IJQA 2E1WA 3W87A 3C0LA 2EHHA 3LGEA 4NJJA 1BRLB 3R58A 1PKLA 4XZ9A 5AHLA 2Y0FA 1HQTA 3UJ2A 1R46A 1NQ6A 3TOYA 1QNSA 2HQAA 4BJHA 2V9DA 4J3SA 1W2VA 2BVDA 3LY0A 2OOGA 4CCCA 3EB3A 3FKRA 7REQA 1YDYA 4KETA 1F4HA 3ARXA 3VNMA 1I2NA 4J3WA 5K9CA 2OSYA 4UFIA 1A4MA 3LZ3A 4AZBA 4KCUA 5AC7A 2Q6ZA 3MHFA 1H1YA 3K46A 1EL3A 3LCGA 2B81A 3SJ3A 5J04A 2ZX8A 2CLOA 5KITA 2DJXA 3FV9A 4NRSA 1G67A 4Q8UA 1DEDA 1SMAA 2VR2A 3XIMA 3T8QA 2X16A 3E12A 3OLIA 5CSUA 4PTXA 3W4RA 5LIWX 4TO8A 1HXJA 3BLOA 1KRBC 4OOZA 5ECVA 4US5A 3N4AA 4PMOA 1K77A 3CLMA 1WOBA 3GVRA 3SCPA 4RZ6A 3TC3A 1XFBA 4KW2A 2C0HA 3R10A 3QKZA 4F0RA 4S3FA 3W75A 2FJKA 3WH8A 4RV8A 5CGMA 4O4WA 3TC6A 3CV1A 3MKCA 3VNJA 2VI0A 3W1AA 3SCSA 3TDFA 4R7WA 2PBOA 4RZ4A 4YYFA 4E38A 2DH2A 3O0FA 2A2IA 1QOQA 3BGJA 1K6AA 5I3IA 3PZMA 1H49A 2DT0A 5TNVA 3CHCA 4TV6A 4ACZA 5BMXA 1FQ0A 1XUZA 5DELA 1E56A 2DIJA 4R7OA 2V3DA 2D73A 3II1A 3WLJA 3C0JA 3I65A 1LWJA 4MJ2A 4LX4A 3DGBA 2D0FA 4LNYA 1YMYA 1M5WA 3WLPA 1D7FA 4YJ5A 2QCCA 4BKNA 3K13A 4ZSTA 5AYIA 4YWSA 5EYWA 1Q13A 1UQYA 1YE4A 4R33A 1WO2A 3TSDA 5C2XA 4GCAA 4BS0A 1PIGA 1UQZA 4PB5A 2HTMA 5EMLA 1MRAA 1FP9A 3RLUA 3WQEA 3RO6A 3MV01 4B4FA 5DCBA 1FXPA 1J11A 5A8MA 4RNIA 2X2YA 1V5XA 2J62A 3K8KA 1DHPA 3ALGA 3QR1A 1C8VA 4DXKA 1HJSA 1FUYA 3TA6A 2G50A 1SQ7A 4PGLA 5LNWA 3DFTA 3MZNA 1J18A 2VGFA 4M6VA 5LHEA 2PDUA 8CGTA 2Z1XA 2ZUMA 3SUTA 3S2NA 4HSOA 5I07A 1T8XA 2Y8VA 1XWYA 1UZDA 3IV3A 5IHRA 3GXDA 2OQLA 2PFHA 3KS5A 1OGBA 3W7LA 3AIVA 3U5YA 4ZEPA 4JN6A 5A94A 3MPGA 4HTBA 1CXIA 4MMWA 1OVDA 4EKJA 2BXYA 5D9PA 4EXAA 2A6NA 2NUWA 3PZNA 4PMZA 3HGOA 2BY1A 2X1SA 1XICA 3KOFA 4M1BA 4IG2B 3R8GA 2QYGA 3FJ6A 4A8IA 1KM3A 3PBWA 5JIWA 2O55A 3EXRA 1LJYA 4IP5A 3BMWA 2TODA 1YDVA 4Q4OA 3TWAA 5G2WA 1DKWA 2RGMA 3VGFA 4WSKA 2AMXA 3GHTA 3WD1A 1KFWA 3WQ8A 1Q2SA 2GUYA 3M41A 1QPKA 3U6WA 4BF7A 4FOJA 3BG3A 3FDKA 3VOGA 4RX0A 3AS2A 4C6OA 2X0YA 4AD1A 1CI1A 1SW3A 3M0YA 2VR4A 3O15A 3NJ3A 3GXFA 1VR6A 4JAWA 4AY1A 2ON3A 1UW9A 1XW8A 1H11A 1E0TA 3I6RA 1KXTA 4JDBA 4TXEA 5D8WA 2WOQA 4LYPA 3PP7A 4JTKA 2C0AA 4W86A 1I2PA 3AMKA 5LGZA 4ATDA 2J7EA 2DY3A 5LA0A 1R3RA 3T2QA 4HMCA 1Z69A 4JN7A 2V63A 2ASHA 2QVHA 2PU0A 1W2PA 1NWSA 1AQFA 4QDWA 1KD0A 1PX8A 1WCGA 1UH3A 2C15A 2BBFA 1GOQA 5DXXA 1ZHAA 1BAGA 3N2XA 4LUYA 4DZAA 3F03K 5HXMA 1EPVA 2VRQA 3S5SA 4B15A 3PUOA 1Q63A 3CUXA 3E5PA 4JHOA 1KBJA 2YLAA 1UOZA 5EMJA 4QDPA 3L5MA 1J5TA 5I3DA 2OZ3A 1JNEA 1I4NA 4GOAA 1WV2A 4FALA 1UP2A 2YKKA 1UWAA 4I7UA 1KFBA 3V0TA 2Y5JA 4NX5A 1MXGA 2BGSA 3QY7A 3GYEA 1WQ5A 1X1NA 3VIFA 3N3TA 1VENA 1WDRA 1RR2A 3TLLA 1JCTA 3TYEA 3GHRA 3WF1A 4LRTA 1Q6FA 4REQB 4QBXA 3O07A 2JEPA 4E4FA 3EYPA 3BMXA 3S4TA 1TTQA 3NQ7A 3WDPP 2BV9A 4MZ8A 5LIUX 2IPWA 1ZLPA 1OCNA 3VKBA 3WLHA 3S83A 3BJTA 2C1GA 3SFWA 4XVDA 3WL1A 3URQA 1F3WA 3WQGA 2A3EA 4PUKA 4ICNA 5CH9A 3W1TA 1LRTA 4PBGA 3RNDA 4B3LA 1GZJA 3CB3A 3KOZA 5D30A 1Q6CA 3UGVA 4DWSA 3W83A 3QV8A 1Q8JA 3NXFA 4PMNA 3ZFHA 4PR4A 2DUAA 3VGBA 3M7SA 3VI2A 1A0CA 1JCXA 1OBAA 3C4UA 1ZB5A 4C5YA 3UG5A 4A8LA 2C19A 3V3WA 3QM3A 4H4IA 4ECLA 4TTGA 4NNBA 1DORA 4D6GA 4OGZA 1EJ7L 1Q6LA 2X30A 4H9UA 3EDFA 3W02A 1OCQA 1F2JA 4NL1A 1QHZA 1SJDA 3AS1A 2PDJA 1Q6QA 1AODA 1Z7AA 1UWRA 3VIKA 3IVUA 2EQDA 2P0OA 3TWBA 2R91A 3N73A 3OBKA 4A3UA 4KEMA 1EOKA 2IKGA 2GZXA 1GJPA 4TU1A 5CBJA 4O8AA 1A5SA 2RHGA 5BRBA 3AXHA 5MHBA 4JTJA 3RX3A 4ERAA 3KOYA 1HKWA 2KAUC 5K4XA 1W1IE 3AYVA 4UFJA 3PB0A 4XAGA 3OIHA 4TIMA 2AGKA 2DT2A 1TTIA 1MWOA 1V3JA 3W2LA 5LSMA 4JIPA 3LX9A 4LAKA 1UKPA 1PVNA 1GOWA 4S38A 1OSEA 2FGBA 5DQPA 4X60A 2CBJA 3M0ZA 4U3AA 2PCQA 4WSHA 3BAXA 2DW6A 3VX1A 2G95A 2A7NA 4L6DA 4B2DD 2DJLA 1HGWA 3TCEA 1A5KC 1X7IA 2O4QA 2BSLA 2YCLB 3M6DA 1VYPX 4PUDA 1LG1A 3EWUA 1UWIA 2W9MA 3PBGA 1OK4A 2QGYA 1WZAA 1FHLA 3RILA 3LXAA 1TPC1 4NZCA 4GIRA 4PODA 1J0ZA 3C2FA 5AB3A 1X6LA 3F2BA 3CMGA 4GUFA 2YA2A 4L1XA 3R11A 2TPSA 4W7VA 1Z41A 4MNKA 3WMLA 2QXWA 3H2NA 2GWGA 5IHSA 4PEKA 1BGGA 1QJWA 2O92A 4QHRA 3HU7A 1O5XA 2CXEA 3VDCA 4WSJA 1JDAA 3TKFA 2WMHA 2A0NA 1GEHA 4L1GA 5HWMA 2DQWA 2WYSA 3W73A 4Z2HA 4BF5A 1PTDA 5A6JA 1HNYA 2FVLA 1PZ1A 3C6CA 3CPUA 4AZCB 4QLJA 5HJLA 4BQ3A 1DE6A 2E09A 4G8TA 4RW5A 4X0NA 3VAVA 2W92A 3QFEA 3DYOA 1XGDA 5DLCA 1CW2A 2ZXBA 4E8GA 4GH1A 1R9YA 4GJJA 2WKLA 1XH1A 1PTGA 5SWUA 1VPQA 3CGTA 1GTHA 1ZENA 2ZZ7A 4GX9A 4S3EA 2FQIA 1UMYA 7XIMA 4FF5A 3Q4DA 2V6AA 4GUHA 1YDNA 1SGJA 2YFOA 4R53A 3NCOA 4S3KA 2ZYFA 3CYVA 5ABTA 3MVTA 5I3JA 4YLWA 2E6DA 3H54A 3PBUA 3B0YA 5KZDA 1WXYA 3R8RA 4EP8C 2VTFA 3BUVA 1NDWA 5E93A 3IIOA 2BVYA 4DLFA 3AXXA 3LSCA 2VX5A 4Y96A 4QE5A 1UB3A 4HB7A 1FCBA 4U5KA 2HSAA 1TG7A 3UJFA 2P3EA 1TV5A 1E43A 1S2UA 4JCLA 7TIMA 5D38A 2D2GA 3SY5A 1A47A 1XV8A 4DB7A 4QTGA 1TB3A 7A3HA 1BHGA 1BVZA 4RXGA 2BFGA 1P4CA 4GO8A 1JDFA 1JGMA 2V3FA 3U8GA 1WYIA 3WFLA 3TROA 4QCEA 1W8SA 4WEVX 4IXHA 1JZ8A 2XN2A 4DO6A 1OC6A 3GD6A 1ONWA 1H7WA 4PC8A 3IGHX 3RCMA 5M2FX 3V35A 4KBXA 3GDLA 2Z7KA 4Q8NA 3URNA 1E0VA 1VF8A 3VA8A 4UUIA 4MKVA 4AMAA 3Q58A 4FX6M 1UR3M 1XBVA 2W27A 1POKA 3SECA 1B3OA 5HDRA 2ZZ5A 1ZBCA 3W76A 2BTMA 3JR2A 6TAAA 1W3JA 2YOCA 2POZA 1BXCA 3ISIX 3KCOA 3QY6A 1P0BA 1GQLA 2VFGA 3L4ZA 4LPCA 1JYNA 4FX8A 1KGUA 4ML9A 1ISXA 1TV7A 2XIMA 3AZSA 1MI3A 9RUBA 3PBMA 1W1PA 1D8CA 2J6VA 3N1AA 3UWZA 1P1XA 4UXDA 1HVQA 1D2KA 3RU8X 2BHYA 4L5ZA 5BU6A 1L6WA 5A6TC 3ZT5A 1FCUA 3L7RA 3LRKA 2I5QA 3OLGA 1AA1B 1ME8A 2ZX9A 2WSRA 1CGWA 2EJ1A 4FNUA 2R82A 3HG2A 3PUDA 3NQBA 3WF3A 4H6RA 2PDBA 4S3GA 3FEMA 1CWYA 2DT3A 4US5D 3W3OA 1FTXA 2BGQA 1YTEA 1RY8A 2Z7GA 4ZFMA 1F3TA 6A3HA 1YQ2A 2CWXA 5F4XA 4L4MA 3ID7A 2XIIA 4A29A 1QK2A 3ES7A 4IUOA 2Y61A 5DT5A 3PZVA 4DBEA 1IXNA 4MZ1A 1W5OA 2J7DA 1OCBA 3AIQA 5AVHA 1DJWA 1DJXA 4AHOA 1W3NA 3NL2A 4WGXA 3A13A 2DH3A 1XSIA 1E6ZA 2A4AA 4QQ3A 1K6WA 3ZVHB 3TFXA 2PDWA 3VIHA 5CLWA 3K4DA 1JDEA 1C29A 1W8GA 5CPSA 1V3IA 3WNOA 2E4TA 2C7FA 3R0UA 3LXBA 3A23A 5DRCA 3VD9A 4WKHA 1G6CA 3B40A 4UTTC 3ZQ9A 4DBWA 3EB4A 2ISVA 1DJQA 2GUUA 5CZKA 3W1RA 3UPMA 2X1RA 2ZBTA 4GUGA 2NQJA 3U7VA 7CGTA 4NAFA 1MW2A 4JPGA 1Z6KA 3ITVA 3EA1A 3UT0A 3KHDA 5AC4A 1PKYA 2G3NA 1KR1A 3UWYA 4P7QA 1P0DA 1FWCC 4O53A 1H63A 4JOMA 4FNPA 1ZRQA 4MDOA 4M7TA 4QSFA 4O1CA 4CEXC 3QC3A 4XZMX 3G1XA 3WEOA 4QROA 3B05A 4Q4SA 3W29A 1OFDA 4OZOA 1VYRA 4AW7A 2GJNA 1XFCA 2WZMA 1V4YA 1HL8A 3UPBA 1ZSXA 2F84A 1V03A 5F2GA 2VQTA 4D8ZA 4PYSA 3EWZA 1PHWA 4LS0A 3MI2A 3DYPA 4DYKA 1B3YA 3RLVA 2REQA 4P2VA 3HM7A 4BF9A 1VHNA 4FO4A 2XSAA 5JUVA 1V3LA 3WJSA 2QW5A 4U5IA 3IV8A 3I7SA 4C7FA 7ODCA 4UWMA 3H4GA 4JFTA 3TE9A 1JXJA 1P0EA 2DORA 3KVKA 3I3BA 2ISDA 1POJA 4Q32A 4Y7EA 3MSGA 3RUBL 3WMCA 1KXQA 4HA4A 1JRBA 1CTNA 1I2OA 2OX1A 4C6KA 4LAOA 4TVDA 3FKKA 1GKPA 1AL8A 2ZUVA 1C8XA 5BNKA 3AYSA 3BLKA 1YYAA 3ONBA 1J5SA 1R5YA 1FOBA 4XZBA 4DF2A 3MBDA 3WF2A 2HCVA 3R13A 4J3VA 3PTKA 3AOFA 3TJLA 1QAPA 3UXLA 4LBSA 2WZTA 3RJYA 3WBAA 4BI7A 4DI9A 3PZIA 5LKYA 1PE1A 3T42A 1DWAM 2V5KA 5CC7A 2QCHA 1DVJA 4N6FA 3V16A 2CZEA 4N9EA 2A3CA 4DJFA 3WJWA 1Q6DA 1CBGA 4MWAB 1TTPA 1RALA 1QW9A 4K2SA 4EF9A 1G4PA 3LHWA 4ES4A 3S5OA 1R6WA 5IBXA 3EDJA 1R3VA 1JZ6A 4JFUA 1UUQA 3K4WA 3G1SA 4C6LA 3UZXA 4KKXA 3L68A 3LPGA 1J96A 3TTOA 1MQPA 1KFKA 4J3UA 1WZKA 4E2OA 2V8ZA 4LYRA 1QOXA 4GO9A 2IW0A 1RQEA 2QT3A 4C65A 3PAJA 3BOXA 4I6KA 3O1NA 3PVFA 5CJNA 1KM4A 5IBXC 3B3DA 3STGA 4GUJA 4B3ZA 1AVAA 4PSRA 2YCKX 3BK0A 3LLFA 2V38A 1HGYA 2XUCA 1KLZA 2OWCA 3PG9A 3TNBA 3VD3A 3HB9A 4U2ZA 3I10A 3T0DA 1BXNA 2PRHA 1WKEA 2CLKA 3EOLA 3RN6A 3VILA 1PHQA 2CESA 3PSWA 1DHKA 1AH0A 3MHGA 3PAOA 1JPHA 1TPB1 2R24A 1CGUA 4JYFA 3IJIA 2TYSA 4HGXA 4JHZA 4ZZ9A 3CUIA 4DJDC 3GNDA 3CQHA 3KL3A 3VFCA 2ZRUA 4BI5A 2F6UA 2DDXA 1I75A 1KFCA 4KCVA 2X41A 1FWHC 2X2GA 4PUUA 2ISSA 4LALA 3OLDA 1U1UA 1VB9A 2WSQA 3W1LA 4E4UA 1VRDA 2ATSA 4XAFA 2VQUA 3SR7A 2JK2A 3LTPA 1HJQA 3G1DA 3RK8A 3W24A 6XIMA 3CM4A 2VGIA 3PWIA 4JX5A 4KS0A 3SW6A 5IM51 5XIMA 4N4PA 2E1DA 1KV5A 2QUTA 2QVNA 3CUGA 1P1MA 5D8ZA 2DZBA 1OX4A 1W17A 3U2OA 1XS2A 3MI3A 4QGCA 4DNMA 2D24A 4LW7A 4HYWA 3MUY1 1BPLB 2JEQA 1L6GA 3CL7A 3WQCA 4O1AA 4RXFA 1R3TA 2JBMA 1DIDA 1A4LA 2AL2A 3GX9A 1OIMA 3NO1A 1U5VA 3M64A 5D03A 1U1JA 1UIOA 1K02A 1Z42A 4BZYA 3UY8A 4NASA 3WIJA 2GK1B 3NL6A 2YA1A 3TK7A 5D9OA 4DWSD 2ZWYA 3DN5A 7ENLA 4V1YA 1Q8AA 3OZMA 3PR2A 5MKGB 4IJCA 1C9DA 1IT0A 1UR1A 3QHMA 1V02A 4DHGA 5JH1A 5BU9A 4CQBA 2E40A 4Y2WA 4RNHA 3B0UX 4ZOAA 1E4IA 1ZCCA 1TPDA 1K8XA 3R8HA 5J8LA 4AU0A 4JTSA 4S39A 3WL0A 2VFHA 3P84A 4BFAA 1NFBA 4PTVA 3ENLA 1FH8A 3PBVA 1XIMA 2ZRZA 4OE7A 3HBLA 1XLLA 4CNSA 1KTCA 3POCA 3ZR5A 3QSTA 2OCZA 1X1ZA 3SO7A 5EFFA 3GXPA 5K3VA 2PWFA 4ZQMA 3CK5A 2GGHA 4O19A 3G1YA 4XO7A 5LGXA 4HBKA 5EKYA 3ZT7A 2JQXA 2RDTA 1XLEA 4WOQA 1QT1A 1EX1A 3WJXA 4A05A 1K9DA 3TLQA 1GHRA 1RV8A 1RLCL 4MAZA 2QUMA 4RNJA 1XC4A 3DFYA 3A3XA 1VFSA 2XG9A 2PMQA 1H3GA 1KCLA 1EUAA 1QI5A 3OG3A 1B2YA 1TJ0A 3W2JA 3FSTA 3W1UA 3BCFA 1OFRA 3LBCA 4CQ8A 2WLZA 1FWEC 1CB2A 3L2MA 4ZGYA 1MO0A 2XZ7A 1MUMA 4KF1A 4R5EA 1O94A 4MZYA 1HJVA 1W5QA 2PTZA 4A3YA 2W67A 2DEPA 1LF1A 3LV5A 3P61A 4GYPC 4QG9A 4ZB0A 2E9MA 3V1PA 4PEEA 4C6FA 3H2MA 3G1RA 2FTWA 2DGAA 3ONCA 3BJSA 2DQXA 1F6YA 4Q8MA 2QCMA 5AYYA 2VC9A 4O52A 1I2RA 4AZ5A 3TYAA 4IIEA 4GVGA 2CKSA 2ZVIA 3FCPA 1L8NA 4FXSA 2Q8ZA 3CJPA 1IGWA 2XINA 1PYFA 1TVNA 1E5NA 3CPGA 1RY0A 3OODA 4UZUA 3UXAA 1RVGA 4NUWA 1W3HA 4PTNA 3ARZA 3QY8A 2PE4A 3L4VA 5I79A 4C6QA 3W6YA 1Q7MA 3S6TA 4LJ3A 1GJWA 2J8GA 1B3VA 1ZAJA 2E6AA 3ZXWA 1JZ3A 3W84A 1V3HA 3N9RA 1V6XA 4DLMA 2NQHA 4H8HA 1CXFA 1K8YA 3CHFA 4HK5A 3DU0A 2G4JA 3KCJA 4JFVA 2CNCA 3CT7A 4UFHA 4DJEC 1ALDA 1J0YA 2PDGA 3UERA 2X1TA 4XAYA 5C6MA 1FWNA 4UBPC 4XKMA 1V7AA 2QAPA 4PTDA 4UTUA 4NYUA 3G3MA 3OYXA 3VD7A 3LLDA 3ARUA 4AXNA 1OGGA 3MKKA 3MDWA 3BXWA 2DUZA 3HJEA 3PULA 1WOAA 2CFFA 1V3KA 4H9VA 7TAAA 3QRHA 2SFPA 1LOQA 2QKFA 1SM9A 4MADA 1R30A 1GOOA 2GVYA 3WK0A 4AX7A 4NG3A 2J7CA 4QLKA 3CHEA 1YIXA 2V68A 3VIOA 3A22A 3EWWA 3OPSA 1JI1A 3NDZA 4JNMA 2XYLA 3O6DA 1FX6A 4WXYA 4JEQA 1PIIA 1PCKA 4K68A 2E67A 1A53A 4MJ4A 2CBIA 5H1WA 3BSHA 1ODZA 2Q8LA 3H8AA 5G1YA 3MV11 3S5YA 4O8RA 2G3JA 4F0SA 4GXMA 2FZMA 2NX1A 5CCZA 3GXMA 5D4YA 1L8PA 1OFBA 1W32A 1DXEA 2HJPA 3WJZA 2YCEA 2EXOA 1RA0A 3CBWA 4JHMA 1QK0A 1EJXC 3TR9A 2WNQA 2ZUNA 1SJBA 1JNDA 3IGXA 1Z9AA 2GSJA 4HMEA 3L4XA 1GZGA 2PEVA 4FXFA 3UCCA 4HN8A 2XU2A 1K7FA 2YB1A 4KGJA 4J40A 4GUIA 1EBHA 3D5HA 1GONA 2GOKA 4J28A 4FAMA 2VEPA 1H0GA 4DBSA 4FNTA 4IX0A 2ZVRA 2J7FA 1JAKA 3G77A 3NZRA 2DZWA 3W2NA 3W1PA 5EMKA 3JRKA 8XIMA 1Q2RA 1IQ8A 3LCFA 4LUTB 3SDOA 1TZ9A 2C16A 4JFSA 5A6AA 3NM3A 1ITUA 1KC7A 5E9XA 4UNIA 3G1VA 2CLFA 1TPFA 4MUPA 1GQJA 3ZJKA 3CPRA 7PTDA 1U83A 4EPKA 1JPMA 1KRCC 4CD8A 2G3MA 3CUFA 4J2PA 4YL2A 4LVBA 2G97A 4JBRA 5LYRA 4FSAA 4GI9A 3ANVA 1HKJA 3FHQA 2V5LA 4ATWA 4FB7A 4PCTA 4CD5A 2CYGA 2OZ0A 3GTHA 2C79A 3UR2A 3O8AA 4GI6A 4DM2A 3DFOA 2QEZA 4IISA 3MB9A 4W8BA 4MKSA 3W7MA 4O4VA 2WMKA 4UTWC 5EY5A 5I6SA 4YTRA 3WH9A 4LT9A 1X6UA 2DZXA 2IQ0A 2R9RA 1QWKA 1TCDA 5EBAA 3C5QA 3M44A 1M7JA 3RDKA 2DIEA 2OLHA 2CHOA 4QISA 4I9MA 5G4EA 2C8NA 5GJNA 4BR1A 3SEPA 5K7JA 1OFEA 2QCDB 2XVLA 4KWUA 3ERPA 2QCFA 5G1MA 1PBGA 3LHUA 3STFA 4KIRA 3W82A 2YJQA 4NNCA 3RO8A 3A12A 3SFKA 4AF0B 3CQ0A 4M6UA 4X63A 1LLOA 3D3FA 2OB3A 2YSWA 2YR1A 3RHGA 4HK7A 5DANA 1ENUA 2ZUUA 1H51A 1QTWA 4BK9A 2WVSA 4NRRA 3S6OA 1MQRA 3PFRA 5XINA 1K7XA 3EDDA 5D09A 1UIPA 4YN5A 3ARSA 2ACQA 4WDTA 4RE0A 3QH2A 3GU9A 3CIXA 4UFKA 4U4MA 2IUZA 1XRSA 2EAWA 3QW3A 1YRRA 3DBPA 3WZ0E 2PWUA 3QFWA 3DESA 3KE0A 4HA0A 1LM1A 3CHVA 3FVMA 1PX3A 1MVYA 2G5WA 3HZ3A 4GC3A 3SRHA 4HNOA 3NQMA 4B5WA 4V1XA 3GDKA 5A2CA 1EF3A 1IHIA 1HF6A 2XH7A 1TCMA 3WDRA 2YPIA 3AZTA 4MNLA 2NX3A 1PB0A 2X0HA 1EIXA 2UY4A 3H7RA 3AFBA 2OEKA 3A24A 1W3KA 3R2GA 1UUOA 4HA1A 4HPNA 2ZC1A 3WD3A 3TNOA 4C7DA 4JYEA 5AYZA 1YBQB 2VP8A 1TYGA 3IANA 1NP2A 4YU1A 2ODOA 1D3GA 1HFBA 4HD5A 3ABXA 3W23A 1LP6A 5FL0A 3W7GA 4L64A 4CLMA 5A6SA 2R1MA 1PPIA 3UA4A 1D8WA 2Y7GA 4C1LA 3W7EA 3TQPA 1RP9A 3AXMA 2B7OA 2AQWA 3CTTA 3NUKA 3HQPA 2GSHA 4PMDA 1JEZA 1NJJA 4ICMA 4GFSA 5C7HA 2YXGA 3UVAA 3ZWSA 2VR5A 3NR0A 2VX4A 4QS5A 3CH9A 1Q3NA 2B7PA 1AZ1A 3IPWA 3JU2A 1M9HA 1PIFA 4UZSA 2J79A 1WBHA 3K1DA 1K4GA 3T40A 4HN4A 1QMLA 3Q65A 2QPUA 3UCDA 1JCYA 2JIWA 1U2YA 1WKDA 4X22A 1CPUA 3OHIA 1OC7A 2XTKA 2G0WA 2ISWA 5I00A 4LEQA 4ONVA 1EDQA 4I6VA 5A2AA 4REQA 3TX9A 3EWXA 5JU6A 1KCXA 4OTKA 4Q8OA 2OU4A 5I02A 4ZO8A 4JTTA 2OELA 1ELSA 3VC6A 2INFA 3N2BA 4NAEB 1H41A 2PPGA 4H6EA 3W7QA 3BICA 4TOQA 4DJDD 3LQLA 1MFVA 5A8OA 1IWAA 3N15A 3E1F1 1I45A 4V28A 4QAIA 2NQ9A 4O1FA 5AC8A 3LQGA 4KEZA 2VZSA 4HCDA 3GG0A 4AQLA 5F4SA 5LA2A 3VZZA 3N4EA 4ORMA 4HYRA 3PBYA 1K8ZA 4DN1A 4RDYA 2XN1A 3QC0A 4HCHA 1B3ZA 3LTSA 3P81A 4RE3A 4PUNA 3WDIA 3QXBA 3JVAA 2WLYA 5HK4A 3IUHA 3W72A 4JX6A 1AJ2A 2LLEA 3V5FA 4JTIA 1B54A 1VBGA 1EO7A 2WMIB 1E6SM 1HJUA 3BH4A 3GZAA 1NSJA 3G5EA 4J7RA 2KZHA 3L23A 1CX9A 4E4PA 3VMNA 5K9XA 1G7UA 4DXXA 4MY9A 5F2MA 4ATLA 2WK2A 2DUXA 4IPIA 4LUJA 1CXHA 1ZP4A 2BWGA 3N3MA 1P6BA 4E2VA 1M01A 4O14A 2DVTA 2PLKA 4BCEA 4GQQA 4RV3A 3ITLA 2ZTJA 3UVIA 4XBSA 3BV4A 3T4CA 1F61A 1TR1A 1MEWA 3DBNA 4JR5A 4GZJA 2ADAA 2XIOA 5A6KA 4GGHA 1BYAA 1J0IA 1EBGA 3H6OA 3YPIA 1T0OA 3LV6A 3DYMA 1EGZA 2J24A 1W9VA 1OX6A 1SPQA 1A0DA 2HK0A 3GDTA 1XIBA 3AISA 1VFOA 3HG5A 3M0MA 3H2AA 3LD5A 2Y85A 3ZSTA 1MNSA 3KFTA 1JGIA 1FDYA 3HMCA 2G96A 3INPA 2A79A 4M5PA 3USZA 2QUUA 3TQKA 3GH5A 1VBHA 1HTIA 2ZA2A 1RA5A 4LY4A 3VD4A 3KW3A 3IARA 1HVXA 4XD5A 4NIRA 5HAOA 2YCLA 1UPMB 2ZRYA 1GEQA 2ICSA 1QR7A 4C6EA 3OVQA 3DHDA 1FWAC 4XSMA 4YWIA 4N9BA 1Q6RA 4Y8EA 4HNCA 3HGRA 1X1OA 1H7XA 3BZGA 3FSUA 1Z8AA 3R89A 2V3GA 1ISYA 3WDHA 4YTTA 1XBYA 2W79A 2OFJA 2Y7DA 3HPAA 3CUZA 3KP0A 3WQFA 4GBUA 3AJ7A 2NZLA 3LUTA 5IOBA 3GNOA 3CNYA 1M7XA 3PTMA 4RZBA 2OOFA 1NTHA 1XGZA 2E5DA 1IXOA 1D9EA 1VGAA 4PRTA 3OEXA 1GORA 3KZPA 4HQVA 3E96A 1XQKA 4LCQA 4Z42C 3FN9A 3MTWA 3WEZA 3WK2A 1JI2A 3BGAA 4AZCA 3CAVA 4ICCX 1WNOA 3ZR4A 2A7RA 4UIOA 5REQA 3GUGA 5DX7A 1QRQA 2EG7A 3LEPA 4IOTA 3KBWA 5FSEC 3NL3A 1ADDA 2XH0A 1MW3A 1MXSA 3CIWA 2C13A 4LUSB 4JZ5A 1M41A 2Q8XA 3ZOAA 3F4VA 3LNMA 5AYBA 4PRWA 2FDSA 5EU9A 1Y7VA 1F8MA 1OIFA 3OZOA 3DENA 3H24A 3QV9A 2PLJA 3UBPC 2GL5A 4F0MA 3UR8A 3NVTA 2PD5A 1GK8A 3R6IA 3GVWA 2VFDA 3ANYA 4N7QA 1HL2A 3VC5A 5LNSA 4HYVA 2X05A 3R7MA 2OYKA 3BC9A 4D6JA 4H7VA 4O0KA 4NF7A 4C6DA 2HVNA 4QM1A 1EC9A 2I9EA 3TAKA 1GKRA 1GOMA 3APTA 1T40A 3A4WA 4IMDA 1E71M 1R7OA 3LHYA 5H8MA 4F0KA 3WY1A 4GC4A 4F40A 3SSZA 3E38A 3AAMA 3IGSA 1XJBA 1PWLA 3CV2A 3L4TA 3RU6A 4WY0B 2IKJA 1S5MA 3SCOA 1TO3A 4DJED 3FGCB 3IJ9A 3NQFA 1UJQA 5I77A 1JL8A 1W37A 1GVEA 4DZ5A 4PN2A 3WQDA 4K1GA 3LRLA 3RGTA 3VUSA 1T5AA 2IKHA 4UOZA 5A95A 2VVNA 3GDMA 4R3UA 2XM1A 4QEEA 4O16A 3AICA 1YLVA 2WWDA 4PA8A 4WGHA 1VH7A 1BTCA 2YZ5A 4D2JA 3S2MA 4B9YA 4LVDA 3ITCA 4JIHA 3MP3A 1TRIA 1UP0A 1Y5WA 2J13A 1WUEA 1W91A 1VKFA 1G01A 4XKYB 3NOEA 5CPMA 1O12A 3TC7A 4IX2A 5EMUA 2BXZA 4QDMA 3FAWA 1DJZA 9XIAA 4JIEA 3FJ4A 3VGHA 1A5AA 4KFNA 1YNYA 2R1NA 3ZYZA 4HU0A 1R87A 4Z1BA 4IICA 1PV8A 3UNTA 1JDDA 5CC3A 3GR7A 2PAJA 1KBKA 4S2BA 2HS6A 4AC1X 1C7TA 3EX4A 2OEJA 4Q4RA 4S1FA 3V7PA 1W9BM 4JTGA 4P8WA 2R6OA 4D1IA 1J6OA 4RL3A 3BARA 4C1NB 2VZUA 4WIWA 1GOIA 3T05A 2V3EA 3VOHA 3T6CA 2PSNA 5ABHA 1S5VA 1RCQA 3G6MA 1YPIA 4OU1A 3T9PA 3N9SA 3P62A 1X7FA 4UQAA 4NILA 1XI3A 3NPXA 1DBTA 3OP2A 2VZVA 2PP1A 1ZGDA 3EKZA 2QULA 1WDDA 1DV7A 3T7VA 4DO4A 5B7YA 3IUIA 3EWBX 2IQTA 4ZL1A 3WLNA 2HWGA 2OG9A 4PCPA 4B5XA 4Q22A 2DVXA 2PF8A 2P0IA 4H9ZA 4PUWA 4C6PA 3T55A 1X39A 2WQPA 3N14A 2EPOA 1LBLA 1Y5VA 3CEPA 2QV5A 2I14A 3W2KA 3WSUA 2FTYA 4NKCA 3IJ6A 4ZQOA 4IPPA 1UKSA 3ZVHA 4UR9A 3DI1A 2Q01A 3N29A 5I3KA 2ZTKA 4XAZA 1PUDA 3IIPA 3E74A 1ZBKA 1CXEA 3IIZA 2VXNA 1U30A 1DIKA 3TOPA 3UFYA 4C6IA 3AU2A 2XIJA 1KKRA 4DI8A 4CD6A 4F66A 1O5RA 3KTSA 4B3KA 3GLCA 3LB0A 2OLSA 4HNTA 4Z2KA 2VMFA 4V15A 3WH6A 3OOQA 1XRVA 1XLIA 2ZC8A 2YDSA 3DKJA 3V1HA 4S3AA 3IGUA 2V82A 2Y2WA 4UQBA 1S1PA 2D3LA 1JF6A 1F6KA 1NP0A 1LT7A 1OGSA 1AW5A 1LTDA 3PTDA 3IK2A 1OZMA 4FA3A 3H12A 2QDHA 3H4XA 4IL0A 3LTYA 3M46A 3MUXA 4XB3A 3I6TA 4XISA 3M4HA 2XWDA 1OD0A 2BASA 5E0KA 3W0KA 3SAZA 2QCEA 3E02A 3TYBA 4Y9PA 1DWJM 3U3HA 3TSBA 3SCTA 3STCA 3QR3A 4J35A 1A3WA 1V0MA 4ZOEA 3UCQA 1AUSL 2DT1A 1CIUA 4P7LA 4X9YA 3Q45A 4XG1A 4ZR8A 2VURA 3F4CA 3V0SA 2C3ZA 4W89A 5FKYA 3FA5A 4R27A 2R1PA 3B0VC 2V2CA 2VZTA 3Q2DA 3JZUA 1A5UA 2ZDSA 4E5TA 3B9AA 1FDZA 4B5NA 4RKAA 2HXUA 3B8SA 1XLMA 1F9CA 1ZP3A 3LNPA 4JQ4A 5EMMA 4O0QA 4AYSA 2CLHA 2BNJA 1UD2A 3U57A 3LCWA 4XO6A 3GWQA 1XLBA 2GYIA 2DV0A 1N8FA 1J2WA 3EA3A 7REQB 1XYAA 1MUCA 4N6EA 1XKYA 5KTLA 3NSNA 1AFSA 4MWAA 2C1IA 1ZS2A 2YYTA 5DRIA 3EXSA 3BLDA 3UR7A 4LCRA 3QPEA 1GTEA 3GBEA 1R3WA 4YNGA 4AY7A 2RGLA 1H4PA 2WBGA 4O17A 3GSMA 1RCOB 4CU7A 2JF7A 3WQ5A 4PBFA 5AHNA 5E70A 3UZJA 4MWAC 4UMBA 4ROPA 1ITXA 1J01A 1IT8A 3OBAA 2PDKA 1KM2A 3L21A 1WXJA 1XIJA 2CLLA 4AIOA 4G1NA 4YXGA 4AB4A 1CGXA 3AU6A 1FKXA 1QHPA 3KRBA 2VRKA 1TR9A 3ZLHA 3J7HA 1RP8A 4EPDC 5CSSA 3MHUA 2GGJA 1ZL1A 3BOLA 2OT1A 3PNZA 2W5FA 3VGEA 5L6UA 1E51A 5D04C 1XLFA 2BMBA 2DVUA 1Q4WA 3BQ5A 3BW4A 1MRQA 3GVQA 1KQZA 3EGJA 2VD8A 3UXKA 1E72M 4FNRA 4M24A 3QVQA 3IRDA 2P1FA 3KTXA 4J3XA 2OODA 2GVJA 4GD0A 2XDFA 2NW0A 1J0KA 3QN3A 3KVMA 2NV1A 4TQTA 4MM1A 5LHFA 2BB0A 1E6PA 1JYWA 3LPOA 4LB3A 1QO2A 4B2DA 1PYMA 3GS6A 3I6EA 3OTRA 5HULA 3PC0A 4ZXLA 3B0PA 3MY9A 3FK4A 4ZO7A 6ENLA 4PMQA 1V0LA 3GQYA 3SY8A 2NV2A 3RLHA 1B0IA 1TX0A 2P88A 4L65A 5CC6A 2PC8A 3V5OA 3FY1A 4OWGA 4GMEA 3W25A 1R8LA 4BY3A 4UTMA 1FH7A 3LCLA 1E1EA 3QOKA 3S5ZA 3WLIA 4DVOA 5I3FA 3WNPA 3SUVA 5JBDA 4TX9A 4FLSA 4WLCA 5I7GA 3S9IA 1V6WA 4NHVA 3VMPA 3P0XA 3W1MA 2BOFX 4RDVA 4HOXA 2ATMA 1O5KA 1X38A 3SN0A 4I5RA 3NWRA 1BFNA 4L9YA 4GGBA 3N04A 1ADSA 1AW1A 3WUGA 5H8UA 1NDYA 1F8IA 3EWCA 2EPNA 3JZEA 4M80A 1VFTA 2DSUA 3CQKA 3UF9A 3LI1A 5MKGA 1PXGA 3E49A 1E6XM 2CZ5A 5A6MA 4QNEA 3VD5A 3WLMA 3E0FA 1QATA 2ZZ2A 3A4XA 2D3NA 4Q4KA 1XX1A 2WC3A 1HG3A 3ITXA 4GIAA 4IWWA 4IFOA 4R9OA 2OR2A 3NDOA 5D32A 1LOLA 2B31A 2HVOA 2FKPA 2A3BA 1W3TA 5FACA 3A47A 3PZTA 4DEFA 4MYAA 4U2YA 3RYSA 3H70A 3WNNA 1H0IA 5E0FA 1RK5A 1TVPA 3TZFA 3RPDA 3PS7A 1W3IA 3C2YA 5CG0A 4LFYA 4AEEA 3GUWA 3FYYA 3DFSA 3MCNA 2NQLA 3IUDA 1DJNA 3EEZA 3F4WA 2OGYA 3SJNA 2ZX6A 4PCSA 2FH6A 3NDYA 1DL3A 2D20A 1XYCA 2WM0A 4QITA 1OYAA 4KCTA 4GRSA 2GUBA 4GYJA 1OG6A 1OT1A 5GNZA 3THUA 1AH4A 4F2BA 3CAKA 1JYVA 3ARPA 1KBLA 3CUHA 3MUAA 2ANUA 4NSBA 5C54A 3HPXA 3VDAA 3DFNA 1ML1A 2A3AA 2VGBA 1KNWA 1Q85A 2E28A 3HG3A 3NG3A 5F2IA 5LXXA 1FP8A 5M5DA 3HA1A 3UG8A 3EX3A 1Q7ZA 4IZGA 3WX7A 3UJRA 4UOJA 1XINA 5FJOA 2PS2A 3KM8A 3CWOX 3BMVA 4U3CA 2PDNA 3OHMB 1LBMA 1W1B1 4CU8A 1ODUA 1WZLA 1HP4A 4XIAA 1P48A 1K9FA 4HHMA 5GVJA 2WVTA 2Z0IA 1R2RA 1JD7A 2GOUA 4GJIA 4F0LA 1C7SA 1A5BA 3WFZA 2ZUSA 4HU3A 5J5DA 2DPEA 1M53A 2DSZA 4ZOCA 1O1ZA 4K39A 4EAYA 4G7EB 3OGSA 2BS9A 1D3HA 3LCXA 4LVAA 4D6EA 3QOMA 3TW6A 4WR3A 4HNVA 1FWDC 5FEPA 4H6QA 4QJ5B 3ITTA 3DCPA 4D9PA 4LV9A 2CLMA 3LGDA 1XH2A 3DFQA 4D1JA 2AGTA 4RK8A 4ZO9A 1P7TA 3HFTA 1XF0A 3QPZA 1EC8A 3LN3A 2H8XA 4GZIA 2E9BA 4QG8A 4GG9A 3PPCA 2NX9A 4H8VA 1SO4A 2PWGA 2XFFA 4YIWA 4R34A 2OQHA 2PURA 1A5MC 2ZZ4A 2GJRA 1CLXA 4OHQA 4KIEA 3SQSA 2INEA 2WWCA 3R5EA 3DAQA 4NZ4A 3L5LA 1JJKA 2GGIA 4QNWA 3WQOA 2J4GA 3RLGA 4OQVA 3BO9A 4TMBA 4H6KA 4JIIX 4IIGA 4MJMA 2Y5EA 3RR4A 2Z26A 4KFOA 4EIVA 3RIKA 4DUOA 1YTKA 3MA8A 1JG9A 3WBXA 5AHMA 4BWLA 5DCEA 5ABGA 3B8TA 4XZNX 4HMDA 3W7NA 1ZTVA 3RMEA 1EXPA 3LZ5A 1LLZA 3WF4A 4NJGA 4H1ZA 3UNDA 1BQCA 5LNRA 1SR9A 2V2HA 1VCGA 1TPVA 3V4BA 5AHEA 4Q7NA 1XLCA 6XIAA 4NZ1A 2NVCA 4WK9A 4BWLC 2I56A 3EOOA 3PK7A 5FF4A 1UBPC 2HRWA 4PRRA 3WQVA 3I7RA 4QJ3B 4Q33A 2GDQA 5FCZA 4PCNA 2PZ0A 1XIGA 1GT8A 3UESA 1OF8A 2VOTA 1R7AA 1GOKA 2WZHA 4MAVA 4EE9A 3NQGA 2BVTA 4ALDA 1MDRA 3WJYA 1AK5A 2IXUA 4QCFA 4X3ZA 2J6XA 3V18A 4GXPA 4D6HA 1X98A 4LANA 2X7WA 4FS9A 4JYDA 3VGGA 2OQYA 2CBUA 4WKFA 3TN3A 1GVSA 3R4IA 4EOUA 5FF0A 4L1WA 3MMTA 1T96A 3GZ3A 3HTWA 1SFTA 3SCVA 3GKFA 3IJ8A 3VDGA 1TMHA 1EEXA 3BAIA 3BV7A 2NLYA 4GWEA 2UBPC 4ZOBA 3SM0A 4W5UA 3UJEA 1R38A 2WSYA 3CAQA 3U2CA 3W86A 5DY2A 5RUBA 3N19B 3LI0A 3R25A 1EKOA 4CQDA 5E1QA 4JFWA 4NI8A 2Y89A 2VEFA 2GVLA 2JKEA 1ADOA 3ATZA 1UJPA 3KVLA 3P74A 1OYCA 3WNLA 2WB5A 4N4QA 3S3GA 1UD3A 4HA3A 4DM1A 3S8HA 1XIFA 3HJZA 4AHPA 1KR0A 5BMWA 3E0WA 4AEOA 4F48A 2GJXB 4AD2A 3CZ8A 3TN5A 5EGRA 1H09A 1ZAIA 3MZ2A 1UZ4A 2ZCGA 4K8HA 3FLUA 4H9MA 1QI0A 1HKVA 2V69A 1MFUA 4E6MA 4Q6XA 3THAA 3WBEA 1ZCOA 3AMDA 5M17A 2WV8A 4LYKA 3LMYA 5HATA 3G0XA 2XFRA 1IZCA 1I0BA 2V30A 2XIBA 3FYPA 4HTYA 4UQCA 2QCDA 2Z6JA 3EX6A 3DH7A 3M9YA 1TPH1 3ZWTA 2QS8A 4EAMA 5KEZA 4LB4A 4AF0A 2YFNA 1KBBA 4NJKA 3KRSA 1ZQ5A 1DWFM 3MWAA 4H8UA 2VC7A 2F2KA 3ZJ6A 4GA8A 2Z1WA 3FA3A 4Z1DA 3W38A 3KDOA 3QGKC 1ONEA 1VPXA 3DC8A 2ESCA 4W9TA 1KFEA 1TV3A 2FIQA 2V67A 2HNHA 3TW7A 2O56A 5KINA 4K38A 4UC5A 1EWEA 5FA5A 5AN7A 4YHGA 3NQ6A 1K1DA 4ZODA 1A5OC 2J9ZA 2QJHA 1EP1A 5U7SA 2NT0A 5CXPA 3SCQA 1AD1A 1QU4A 1N8IA 3WUBA 1N82A 1UWSA 1P6CA 5HMDA 1S3HA 3M47A 3SI9A 1O95A 1H1ZA 2UY5A 4WOZA 1RZMA 4ADTA 1F5ZA 1W9UA 1DOSA 1XBXA 1CLVA 1ZJAA 5BOEA 3T08A 2NSOA 1TPWA 3A21A 5AYXA 3ABSA 2P8BA 5C9WA 1J10A 1F73A 4GXWA 3CEUA 2OMAA 1MXDA 3S5NA 2Z00A 4Y6GA 2IPFA 3SSJA 3KX6A 2WZEA 2HZGA 2VC5A 1YBQA 3VKJA 2YIHA 5C0QA 1QO5A 4IMEA 3DG3A 4LF1A 1AMYA 2WVVB 4XAPA 2QUVA 1W54A 2I7GA 3QHNA 3CTLA 5FAGA 2HS8A 3OIXA 4LGXA 2EKGA 3HIJA 2RJHA 3GAYA 1RJQA 1IEWA 1QOPA 3WQ6A 2BZNA 1V93A 1XLDA 3L12A 3EMZA 2I5GA 3LK6A 4MSSA 2G8ZA 4FOUA 1BWKA 1DWIM 4J4KA 4AZIA 3CYJA 2BG5A 4MWAD 2XVNA 1VCVA 3PZ9A 2A3HA 4LXFA 2A85A 3W7RA 1S5TA 3XINA 1SYTA 3HO8A 3TUUA 1M1BA 3VK5A 8A3HA 4GKTA 3SCNA 4UTJA 2CKRA 3E2RA 3UYCA 1L9WA 3AXIA 1AZ2A 2PD9A 4LUIA 1WXZA 1P5BA 1VEOA 2QUNA 2P50A 3HQ1A 4NAEA 3B03A 3Q37A 3GIQA 4AIBA 2E8ZA 1E4NA 4AMCA 1A50A 3WEMA 3MCOA 3EEGA 3GFXA 3HGJA 2O7QA 2AQOA 3W88A 1Q5MA 1XISA 1VPYA 2FHFA 2OSWA 4LC8A 2C6QA 2R1KA 3PZGA 3USBA 2GFTA 1IR2A 4P7NA 4GE8A 1HKMA 3C52A 3KVJA 4O13A 3NZ1A 3CXOA 4AUBA 1AW2A 5D37A 1SU5A 1VEMA 3NQEA 3ZJ7A 2ABBA 3QTGA 3LA4A 3OBEA 1DIOA 1UG6A 2F38A 4PMXA 5CPOA 1FVPA 3QSRA 1NIUA 1ME7A 1G5AA 2Z1BA 1J0HA 1YXCA 4YTUA 5A8GA 2DZPA 2JGYA 1E70M 4IF2A 5HNNA 1S5WA 4NAFB 1NDVA 4M29A 3RITA 1KGWA 2JF6A 1TIMA 1XR2A 2Z24A 2OWXA 3SY1A 3WN6A 1PKMA 1DJYA 3MC5A 1YHTA 2Z29A 1A3HA 3LPFA 1THFD 4IPLA 2PTXA 3ZLGA 4GI4A 4B5TA 1V6VA 4C1KA 5HINA 1Q66A 5IDIA 3BSGA 3TSMA 1RLDA 2PLCA 1LYXA 3NPVA 1J79A 4UTHA 2D2HA 4F2UA 5JBEA 4RR4A 4PFHA 4M51A 3WQ4A 1Z32X 5C2GA 1IR1A 3IWPA 3RM9A 1UD4A 3AS0A 1JQXA 3VIGA 1FHDA 4C90A 3CV6A 4GQBA 3FYOA 5DEZA 3ZS4A 1WP6A 1AL7A 4C6CA 2V0TA 3SN4A 1JFXA 3UG4A 3I3DA 2PI6A 1NQKA 1KW1A 2L5HA 4DO7A 3AIUA 1VJSA 1W3LA 4GI8A 4UQ9A 3MYOA 5HR7A 3O6AA 3IIXA 3TMLA 1P0NA 1WX0A 3LSBA 4OOUA 4A8NA 3NVDA 4QXIA 5IRPA 3WLRA 2XVPA 1RBAA 2WKGA 5BWFA 3IVTA 2RH9A 3TYCA 3BANA 1FWFC 5BOOA 2BY3A 2VC6A 1HKKA 2DZUA 2QQ6A 4ZE5A 5A1AA 3PF3A 1WAUA 1G1YA 4IPJA 1C9WA 3DEQA 2PF0A 3KBNA 1O66A 1AQ0A 1RCXB 1HW6A 5CPQA 4LC6A 1VCFA 1JF5A 2PWDA 1EHAA 3ZVIA 4MNMA 1E1CB 4AYGA 1UZHA 1C91A 1U1HA 3RCYA 2I57A 3S0CA 3B9DA 1IWPA 3ARWA 3KOXA 2WPBA 4HT3A 4UCFA 2I16A 4LUSA 3M0HA 3OVPA 3TTEA 4EXBA 3P5YA 5TF0A 2QZRA 1XYFA 2QR6A 4FR1A 3CZJA 3E2VA 4F9JA 1XUUA 3DC0A 3RM4A 1LUCA 2P8CA 3MYPA 5HJXA 1OFAA 1R0MA 1XYZA 2FZBA 2Y7FA 4RW3A 2P76A 5I78A 4A21A 1TSIA 2J27A 3EA2A 1N55A 3HV8A 2F9RA 1IEXA 3NQDA 1W1TA 3AMLA 4RCXA 3VOIA 1FXQA 4ROQA 1B4EA 3E3HA 3MMDA 4GCXA 2A3LA 2WCSA 3M0JA 2VCCA 4MB1A 3K5XA 3KP1A 4N2YA 3W7OA 4HPGA 1QW8A 5G4HC 3GC2A 1FKWA 4IIDA 3GAKA 3UWWA 4TTUA 2JIEA 3P8IA 3PHAA 3TTSA 1UD8A 4AC7C 3M5YA 3OYZA 3UW6A 4WY0A 4I7VA 1UWUA 2FH8A 3TA9A 1KM1A 4XD3A 3TJIA 4ASTA 1F05A 4WJEA 2HE5A 4YVXA 1H61A 1LBFA 5HPCA 3UQNA 5E9AA 1XSKA 1CNVA 3BLEA 1R2TA 1ZUAX 2ZKMX 1GZ1A 2QIIA 2PGEA 4MB5A 5AHIA 2PCEA 4R85A 3UWQA 5BZAA 1BYBA 1DWGM 1KTBA 4ZVJA 5FF3A 1OX4B 1BVWA 1OM0A 4YTSA 1H7NA 3N34A 3CC1A 1SZGA 2ISFA 3CZGA 4Q8QA 4D6FA 1E9IA 3T0BA 3F7JA 1JCJA 1ISVA 4CN6A 4GABA 5H6HA 2B7QA 1SR0A 2YDRA 3G1HA 2CXGA 3W01A 3O7UA 2AL2B 3BLFA 3MP4A 1LOSA 4UTTA 2W0UA 5HNUA 3TR2A 5DY3A 5HWJA 5C9XA 1UH2A 4B5VA 3BE7A 2P3ZA 1UWTA 1KKOA 5XIAA 1UBSA 1SW0A 5D2XA 4DQWA 2D2OA 2VDGA 4H2CA 2WHJA 3MS8A 1L6YA 3AJXA 3BVJA 1G7VA 4J3ZA 3T0TA 4UTFA 3DKLA 3KRZA 4BEQA 2I5IA 4XUYA 1EYWA 3KDNA 1ME9A 1XRTA 2GGGA 4PUJA 2PDQA 4EPBC 2O9RA 3QMTA 4JN8A 3W26A 3DGRA 3MJYA 3M5XA 4MDPA 4YCOA 1W1ZA 4KEUA 2CC0A 1TV8A 4EWJA 1KM5A 4I90A 3O06A 5AECA 1KTNA 1ZPTA 4GPNA 1LL7A 3MQTA 3QZAA 4K37A 2DZTA 1FWRA 2OXNA 2ZE3A 4GNJA 4ZSUA 2Y62A 4HKPA 2ZZ3A 5EBUA 3R94A 4D6IA 3RRAA 3AZRA 3GR4A 1EA0A 4F0HA 1FY6A 4O1BA 1TA3A 4L9ZA 3EPMA 4GHRA 5CSYA 1ZAHA 1GVQA 1XIEA 1OT2A 1N7KA 3CS2A 3FVDA 3UZZA 3V36A 4B9ZA 2UWFA 3RF9A 2YBVA 1EDGA 4W87A 4A4AA 5CLTA 3BAKA 1CEOA 5I3GA 1P0KA 1MYRA 2C1HA 3CQJA 4ZA0A 4INFA 3R0KA 4JTAA 4W88A 3UD6A 2VCBA 4LRSA 1US2A 1MZHA 5BXSA 1XCXA 5HNTA 4H04A 1R3QA 3PJWA 3PWAA 3P93A 2I17A 1UMLA 3FDGA 5DMMA 1QUMA 4FI4A 5DBTA 3E9AA 4M81A 4NXSA 4AG0A 3CHDA 4WDWA 3L4YA 3QZEA 3CZEA 4HU8A 4DUWA 3NQ2A 3EKGA 5B7ZA 3QF0A 3PZUA 4GJ1A 5EA9A 4N9DA 3D6NA 4AWUA 2UZ9A 3C0QA 2WJEA 3P67A 5TD4A 1VFHA 4GY1A 4Q4PA 3QTPA 1SO6A 4RLIA 3GNPA 4QRNA 4FP1A 4PUMA 3O05A 4JTUA 1VFLA 3E2QA 3QGVA 1QI2A 6CGTA 3KBSA 1W1YA 4NJHA 3RFAA 2BXVA 5I23A 3V0UA 4NXKA 2YW3A 3EDKA 3T0CA 2DSKA 3VINA 2ZFAA 4S3DA 1XPGA 1ICPA 2J75A 4IQLA 1SFJA 3BZJA 3OA5A 5A8QA 1EB3A 3VZYA 1B31A 4CD4A 3KRUA 5KETA 4IGHA 4MJZA 2PZNA 3REQB 3W37A 1UASA 3B8VA 3TVAA 3CH0A 4XZLX 5LIYX 4D8AA 3EOUA 3TZNA 3VOCA 3MMUA 1I1WA 4WQ6A 4JTQA 4HJFA 3TQ0A 1BQGA 3N17A 1S2AA 4Q8PA 4DJDA 4K8GA 1UC5A 1RJPA 1ICQA 2J74A 3H2FA 1E6RA 2XFWA 1OYBA 2ZZ1A 4WVXA 5A8PA 1LT8A 1H5YA 2D1ZA 4O12A 3NQAA 3RCNA 2FZ8A 5JIPA 5L9FA 3F5LA 3AHVA 4ERGA 3V75A 3KBJA 3U2ZA 3ARTA 4C6NA 1PWMA 3AI0A 4H9YA 1NOWA 1T6MA 3S2JA 4IP4A 4XZHA 1W6TA 2XFYA 5U4NA 3MUCA 2TRSA 2NXIA 1E0XA 3LXCA 3KUMA 1GKQA 1KCKA 5CC5A 4GNVA 1CZ1A 1RJRA 1TZ7A 1FWBC 1JCMP 4UFLA 2FVMA 4DBUA 3M0XA 4CQ9A 4HZ6A 4OIFA 4RZ5A 3ITOA 5FD0A 3N4FA 4IFKB 1H62A 1PEZA 1RBOB 2CLEA 4J9JA 2OKOA 2WJFA 1VFMA 4O15A 1HKIA 3GU1A 1RD6A 3GO2A 3TMQA 4LVFA 3DECA 3NL5A 4R88A 3CWHA 2VWTA 2WJZA 5H8PA 1SJCA 3FX4A 3WCZA 3K30A 1JULA 1ZJBA 3KTCA 1UR0A 3BAJA 4FZIA 1IV8A 2Z6IA 4Z17A 3SCRA 4JDYA 4Q7BA 4QLLA 4CNUA 3LM7A 3VIMA 1YADA 4IMCA 3UEQA 4PCFA 1IGSA 3ANUA 4IQEA 4N9CA 2CU0A 4JKKA 4LY8A 3U7BA 2XHYA 2WKJA 1KQYA 1EQCA 3OVRA 1IT7A 2XH4A 3G3DA 2JFEX 1QBAA 1A3XA 2DZSA 1GJUA 1O68A 1SO3A 4K1WA 3GH7A 5C8BB 4ZB5A 1XG3A 1BKHA 3H53A 2XGZA 4GKLA 1UP3A 5ABEA 1O6IA 3HGSA 1DYSA 9CGTA 1V6TA 4O54A 4AIUA 4DAFA 3AMCA 4AEFA 3TCSA 2WZIA 4JNZA 4QE4A 3NSMA 1E6NA 1F7BA 3EPNA 1XSJA 4CNPA 3G24A 2R8WA 1FWTA 3BAWA 4ZB2A 1O5QA 2HXTA 3R43A 1TE1A 1TZZA 2YW4A 3ABQA 1NEYA 4HVXA 1PL9A 1NY1A 1QNRA 3N11A 4LQ1A 2YBTA 3BLPX 2QDGA 1V3MA 1FFRA 1L6FA 1XXXA 2DFAA 1TWIA 2VGGA 5CAKA 2ZOXA 3VFLA 3VUPA 1TWWA 3FNDA 2HBXA 1NELA 4Q8WA 4GYPA 2VX6A 3W53A 2D69A 1SVDA 1W9DM 1KBIA 1NM9A 2YL5A 3GB6A 4KCWA 4GH3A 1GHSA 2TSYA 3BW2A 3B06A 3TXZA 3ICJA 1UA7A 3GC5A 3UXIA 4KH2A 2C18A 1IWBA 3CIVA 2QJIA 4BI6A 1BWLA 3KBMA 3NEVA 2NVAA 1DTUA 2FZNA 1K8CA 4YMZA 4AHQA 1XHGA 3S2CA 5I24A 4Y9OA 1NFPA 1VFFA 1WKYA 1NF0A 1EIBA 3T44A 1PKNA 5HQEA 4ZQPA 2Y6ZA 3W74A 2GJPA 4WF7A 4G7FA 2QGHA 4MY1A 2WPGA 4W4QA 1XKJA 1IEVA 4IGSA 1TWSA 4DX3A 4LBUA 2R14A 4C6BA 3O6YX 1ICSA 1LRNA 4X2PA 4PH6A 2CLIA 1SZRA 3R79A 3VKKA 3WLKX 2H9AB 4DJEA 3FOKA 4DWDA 1HUVA 1M65A 2FHCA 2VDHA 3UYIA 4GX8A 3HOJA 1TELA 2OYMA 4LAMA 5CEWA 3WMBA 1K4HA 1UYQA 3W07A 4E3TA 2CITA 5GNXA 3FXGA 3S46A 2O9PA 1W5MA 1JR1A 1R9XA 3PZQA 5HANA 4OBTA 1ZBVA 4WHBA 3POHA 4V33A 1BRLA 4ORIA 3KCLA 6PTDA 3B0XA 1FCQA 1E9LA 4AWEA 2WC4A 2WMGA 3B4YA 4IJRA 1GQNA 1LZOA 2VWSA 3SGZA 1UHVA 2ACUA 4WJXA 4DPQA 3NSXA 3BPWA 2OJPA 3QYQA 1O7AA 1SSDA 3EDEA 1NWUA 5BRQA 4FPSA 3W70A 3GXIA 3SRDA 3ARQA 2FHBA 1GGOA 3U48A 1US3A 2H90A 2XZ9A 1IXQA 2H6RA 1BWVA 1GYNA 2GDVA 4G7EA 1SFSA 3ZT6A 3CMJA 1TQJA 4TVUA 2VKZG 2ZIDA 3WBWA 3PPFA 3CB8A 1F4AA 3VKCA 4ADSA 1TJPA 4QIUA 2YDQA 1GG0A 4A3HA 1MZRA 5ABFB 1K9TA 1I8JA 2BODX 5FSDC 1OB0A 3RX4A 1JD9A 3VNDA 1FDJA 1Q6OA 4K8EA 5ENLA 1G9HA 1W1VA 3DHFA 2OVLA 4K6AA 3GFZA 4Z2LA 5J5RA 5AC5A 3L2LA 1FHVA 1SFLA 1T99A 4MPQA 3IJLA 3DHUA 4K7VA 1G0CA 1E0UA 2VL4A 5HA7A 4XD6A 3I3EA 4AIEA 1GYLA 4X2RA 3H4WA 3W00A 3VX0A 4IGNA 4JEJA 3RXZA 1ZALA 3F5JA 2J7GA 2YCJA 1OX5A 3NA8A 3NZPA 1XGEA 4WDXA 3TYDA 2NXHA 4P8UA 1EZWA 3HN3A 1E3ZA 1VBJA 5HMSA 2Z25A 5C2CA 4LS2A 3CU2A 4LVGA 5I0DA 3IRSA 3E2SA 1IIHA 3F5KA 4IPNB 2JGQA 1AD4A 2WM1A 4O28A 4PMRA 6REQB 2FZ9A 4GACA 4OKDA 5CBBA 4Z2JA 4GLEA 2PGFA 2OPJA 2DSWA 1TFVA 4AY8A 5BYWA 4DWSC 4KWWA 2OZ8A 4AZ7A 3W7KA 3BSMA 1F3EA 2XPKA 1KRMA 2V5JA 4GYFA 4N02A 4ERIA 3TQVA 3ZMRA 4UTWA 3W2UA 2RDUA 1VFUA 3QV6A 3NIYA 2X09A 3ITGA 2GDUA 4XV0A 2HPMA 1M7PA 2FPYA 1IF2A 3LPPA 1H7RA 2E5CA 5A69A 2J9XA 3GM8A 4KPLA 4UMCA 4J5NA 3H22A 3WLQA 2WHLA 4NYYA 5HQLA 1K9EA 3EX2A 5F1UA 2WNNA 4I8DA 1DJHA 4JY8A 3P8JA 1YX1A 5PTDA 3P3BA 3OGRA 3VNYA 1DWHM 3GY1A 4YCPA 1KO0A 5G5IA 1CCWB 2BVWA 4L9XA 4A22A 1REQB 4KWVA 3WD2A 4O10A 4A6GA 5FJJA 4C60A 1DE5A 5TAOA 3KL0A 4W8LA 3UGRA 4M6PA 4M56A 1QFEA 5E5CA 2AOSA 3HQOA 2J7HA 4LYQA 3GG1A 4UMAA 3SN1A 2E6YA 2Q3RA 5EL1A 5IXEA 1VLWA 3RJXA 1XH0A 3ARYA 4PL1A 3BAYA 4HJWA 2P10A 3GHSA 5F4WA 1HX0A 2W4XA 1QHOA 3U4FA 3DX5A 2YBUA 3W1XA 1LRQA 4IG2A 4AVNA 3ABRA 2ABAA 5CZ0A 1GPWA 4NZ5A 1DTNA 1W5PA 1QDSA 3C2RA 1VP5A 2QPXA 4MGGA 2A1YA 2FZDA 1YPFA 1MQQA 4KQNA 4YYCA 4G56A 4HIBA 2GJXA 1MMFA 4A35A 4P7OA 4EXQA 1TUXA 3QPYA 4P8XA 4W85A 1FRBA 2QV4A 4R7JA 2GVGA 3D0CA 4LF2A 4C5ZA 4CVUA 1JIBA 4IH3A 2VM8A 2BY2A 1V02E 4PTMA 4TVCA 2EG6A 2ZX5A 4B5UA 2QLYA 1GVRA 3D3AA 3BG9A 3THCA 1OADA 4JY9A 4P7RA 5REQB 2D0GA 1MUWA 1BSLA 4HK6A 1GNXA 3E6EA 3G18A 1XCFA 3EMQA 3FA4A 4XVEA 5GJPA 4AXKA 3VNIA 5I2UA 2PDIA 4CN4A 4URIA 3C3UA 1GCYA 2Z27A 5EB8A 3W27A 3E0IA 3C2VA 4CNNA 5K9DA 2IKIA 3RM8A 2EPHA 4K3ZA 3AHTA 1YDOA 2G41A 2VFEA 4O57A 4MUZA 3EBVA 3DZ1A 2Q71A 3P2VA 4LTSA 2AAMA 1TTJA 4H9XA 2UY2A 2YXXA 1NU5A 1KCZA 4D8LA 1BYDA 5BCAA 4E8CA 2AAAA 2WHMA 3W7JA 1E9YB 3I7QA 3SQMA 3JS3A 1OHLA 3SB0A 1TKKA 3PSVA 2ZA1A 3F1QA 5HNRA 2CEQA 4EPEC 2ZRVA 4HP5A 4IQDA 5BXRA 1E1FA 3PZOA 4ILSA 2XVGA 1PS9A 1NWTA 1FWGC 3PPHA 3PPGA 4JTCA 1VJZA 1EDTA 3B8WA 1K7EA 4KMQA 3DFHA 2DZVA 4L80A 2VX7A 4UNKA 5IFTA 3WENA 3LU2A 3GVGA 2BOGX 1UUMA 3M1ZA 1A5LC 3NYZA 3F2CA 1QVBA 3ALFA 1EJRC 1K70A 4IMFA 4WZHA 2FFCA 4PUEA 4PMUA 4EK7A 3IVSA 2PDPA 1YKWA 3VO0A 1YXYA 2WVVA 3GH4A 3CZKA 5FJPA 5H91A 3L5AA 3VYLA 4A3QA 1ESWA 3QZ6A 1L6SA 3LBOA 1GWJA 2DIKA 4UR8A 3K2GA 4H7CA 2FGZA 2WAGA 1HT6A 1AQMA 3I4KA 4JCMA 3KHJA 5EPDA 1ECQA 2XGIA 3W22A 3WELA 2JKPA 1C3FA 3CV7A 2W63A 3F4NA 3CASA 4IMAA 1NWRA 4U33A 5DT7A 2J66A 3I68A 4JTFA 2A5HA 2RAGA 1KM0A 4XBKA 2W91A 3RPMA 3PANA 3TXVA 3STEA 1DJGA 3KWXA 4EANA 2PDFA 1GQIA 2ACSA 1PDZA 2ZUTA 1B3WA 2Y5SA 3TU9A 5F7UA 2ZDRA 2GLKA 2QCGA 3H55A 1GG1A 1OK6A 4JQ1A 2IMRA 2DZAA 4RNFA 3LCHA 4ML4A 4CNTA 3TTQA 4US6A 5HPOA 1WAWA 1US0A 4IIHA 3VE7A 3W71A 4EVZA 1JCLA 2EPLX 1HIZA 5DXYA 4Q3MA 4KRTA 2HISA 1VBRA 4JGDA 3AQUA 4RE2A 3NXLA 4JL2A 4XIMA 1FFQA 3BG5A 5D33A 3VU2A 3UWUA 4CVWA 1KXVA 4XWUA 2CZFA 1W5NA 2FGLA 1VJIA 2OO6A 3ARVA 1RSCA 1RD5A 1S2CA 1U33A 3TYZA 1LL6A 4S3BA 5DO8A 2OKTA 5C7VA 4W7UA 3AYTA 3QV7A 1E73M 3VOFA 1UZ1A 3GU2A 3W1QA 3C8NA 5D9MA 2Y8KA 3KOWA 5F2LA 3HFYA 4I9JA 3P5ZA 3CMFA 4LEFA 1CDGA 4WDUA 4DUXA 3PJXA 2OYLA 4DF1A 4JD4A 1XBZA 1J8VA 3NFUA 3W7PA 4AWTA 4I9AA 3AHZA 1KB3A 5D2YA 2O0TA 2PUZA 3L0GA 1QI4A 1QPOA 2DU2A 3IAQA 4QP0A 3H7VA 5HUPA 2HK1A 3N6JA 4IQJA 4PL2A 1GVOA 3EAUA 1NF7A 2OWWA 1RAKA 2FTPA 1JPDX 4DZIA 3U2EA 5TIMA 4Y9MA 1VHCA 4AVFA 2H3BA 2BHUA 2PTYA 1EJSC 1QPRA 5FEZA 1HO4A 3T09A 2F8QA 4ZCWA 4BQ5A 3DUGA 1P6WA 3SADA 1V6UA 3WFAA 2G3IA 1PCWA 1AMKA 4H8NA 3G22A 1WDWA 2QIWA 5LXEA 4LWWA 1NAL1 4GFIA 5DCDA 2BY0A 3K8MA 5AHFA 2XSXA 1ISZA 4N0RA 3SUSA 9XIMA 2VDIA 1RK6A 2POTA 1BYCA 4FEZA 4S3CA 1KV8A 3QQ0A 4Q7IA 4FHAA 2BOEX 3S9YA 3VCNA 3E0LA 3GXNA 3L67A 1S2WA 4P61A 4UTKA 4OBRA 1TV4A 3T81A 2O7SA 1UD5A 3A5VA 3MSYA 2HEJA 4DYEA 5HBFA 4HZMA 3P14A 3BDKA 4L56A 1UC4A 3SGGA 4NNAA 3L66A 3M16A 4TMCA 3QQWA 1AJ0A 4ZTYA 3APGA 2Y4SA 3THDA 3WD0A 4JQ3A 3PJTA 3QQ1A 4ZENA 3SRKA 3CLWA 2PP0A 4Z2GA 3OO2A 1XLGA 2X40A 3AROA 4GVHA 1J0JA 3S42A 4L6HA 3KXQA 3H26A 3ZR6A 2FMOA 4J27A 4O1EA 2PRLA 3ZZ1A 2NQZA 5HJYA 2WMJA 2QF8A 3N2TA 1F07A 2ZX7A 4CEUC 5E6ZA 4QJ4B 3UWEA 1W56A 3LERA 1XLJA 3QBUA 4KFPA 3PUGA 1KXHA 2DSVA 2Z2BA 1AJZA 1ONXA 4ZMGA 1E1CA 1GVYA 2WJDA 4IMGA 3QHOA 1SMDA 4CCDA 3L9CA 1BKSA 3GTFA 4MIMA 5LIKX 2WNZA 2ZRWA 4YS1A 4D71A 3GNXA 1IE7C 4AD5A 1B9ZA 3TN4A 3L4WA 2J8FA 2GWNA 4JIQA