4PMJA

Crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 in complex with nadp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
281
structure length
281
Chain Sequence
MHDPIPTIAFPDGRKVPALGQGTWRMGENRAKTADEVRSLQTGLDLGMTLIDTAEMYGDGAAERIVGEAIKGRRDEAFVVSKVLPSNASRAGTVAACERSLRNLGIDCVDLYLLHWRGGYPLAETVAAFEELKKAGKIRAWGVSNFDVDDMEELSAVPDGGNVAANQVLYNLARRGIEFDLLPRCRAQGVPVMAYSPLDEGRLLHDADLIHIAKAHQATPAQVALAFLKTCSGVISIPKTGSPERARENRDAMDIHLTTENLAELDRHFPPPRRKTRLEVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative oxidoreductase from Sinorhizobiummeliloti 1021 in complex with NADP
rcsb
source organism Rhizobium meliloti
molecule tags Oxidoreductase
molecule keywords Putative oxidoreductase
total genus 102
structure length 281
sequence length 281
ec nomenclature ec 1.1.1.-:
pdb deposition date 2014-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4pmjA00
3LQGA 3VXGA 2INZA 4JQ2A 4QR6A 4FZIA 3R43A 2A79A 2J8TA 4XZMX 3CAQA 1XJBA 4DBUA 2AGTA 3UGRA 2HE5A 2R24A 3M4HA 4JQ4A 2HVNA 4YU1A 4FAMA 4WDWA 4LAZA 4IJRA 4ASTA 1EL3A 3FJNA 1YE6A 4GQGA 3M64A 3O0KA 4PRTA 2F38A 5LIUX 4WRHA 3UZWA 4ICCX 4FALA 3LZ5A 3UP8A 2PDWA 4F40A 3U2CA 3UZZA 4MHBA 1S1RA 4NKCA 1C9WA 1J96A 3D3FA 5DANA 3EB3A 2P5NA 3UZYA 3UYIA 3LENA 3FX4A 2FGBA 1OG6A 2PDQA 3H7UA 4GIEA 1X96A 2HEJA 5HA7A 4XAPA 4XO7A 4HMNA 1ZUAX 2PDUA 1S2CA 3CV6A 4I5XA 4XZLX 4G5DA 4JIHA 3UG8A 4GABA 3GUGA 1ZSXA 3Q67A 2PDMA 2IKIA 3DN5A 1AH3A 3T42A 4PMJA 4RPQA 2ACQA 2PF8A 4JTCA 1AZ2A 1YE4A 1Q13A 2NVCA 3LN3A 3WBYA 3R58A 2BGSA 2CLPA 3H4GA 3NTYA 2IKHA 3F7JA 1EKOA 4Q7BA 3V0TA 4LBSA 2DUZA 2IPGA 2PDPA 2ISFA 2PDXA 3WG6A 3MC5A 1SM9A 3WBXA 2DUXA 3V36A 2ACSA 2I17A 4PUUA 1ADSA 4JTRA 4JQ3A 3H7RA 3R8GA 1QWKA 4IGSA 1Z9AA 3RX2A 3CAVA 4QX4A 1K8CA 4JTDA 3RX4A 4DBSA 2FVLA 3DOPA 3MB9A 3UZXA 1MZRA 3B3DA 3G5EA 2INEA 4GA8A 3UWEA 4GQ0A 5AZ0A 2IQ0A 5LIWX 2PDGA 3COTA 3M0IA 4QBXA 1Q5MA 1RALA 2ALRA 2R9RA 3BCJA 3P2VA 5LIKX 2PDNA 1VP5A 3LNMA 1PYFA 4Q3MA 3KRBA 3CASA 3GHRA 4JQ1A 4YVVA 1R38A 3ERPA 3V0UA 1MI3A 5C7HA 4GACA 3CV7A 1YNQA 2PDBA 2VDGA 2PDKA 1PWMA 2I16A 2PFHA 4DZ5A 4WEVX 4H7CA 1Z89A 1IEIA 4IJCA 3UFYA 5JH1A 1HW6A 4LBRA 1HQTA 3ONBA 3BURA 4XK2A 1EF3A 3GHTA 1EXBA 3LEPA 3LD5A 1XGDA 3GHUA 1US0A 1YNPA 3CMFA 4WDTA 1PZ1A 4DBWA 4GCAA 1FRBA 3EB4A 5LIXX 1RY8A 4LB3A 5JH2A 1AFSA 4WGHA 1A80A 4XVDA 1ZQ5A 2PEVA 3O3RA 3R8HA 2PDJA 4H8NA 1JEZA 2C91A 1VBJA 1QRQA 2PDFA 5M2FX 2FZ9A 4PR4A 4JIRA 3N6QA 1S1PA 4WDXA 2IPJA 4JQAA 2PDLA 2FZ8A 2PDHA 2ACRA 4EXAA 1UR3M 2FZDA 2BP1A 2PDIA 4YVXA 2ACUA 4LAUA 3BV7A 2IPWA 2IQDA 4XVEA 4HBKA 2WZMA 3GHSA 1AZ1A 4LB4A 4XZNX 5KETA 3R7MA 4PUWA 4XZHA 3C3UA 3BUVA 3EAUA 2IKJA 3QKZA 4L1XA 1AH4A 4AUBA 4JIIX 1MRQA 4FA3A 2FZBA 5LIYX 4XZIA 2DV0A 4XO6A 3WCZA 3LZ3A 3LUTA 2IKGA 2HDJA 2PZNA 3LBOA 1AH0A 4YS1A 4WDUA 3RX3A 2WZTA 4EXBA 4PRRA 1PWLA 4R9OA 1IHIA 1T41A 2F2KA 4QXIA 2PDCA 1S2AA 3V0SA 2IPFA 2PDYA 5AZ1A 1Z3NA 4L1WA 1LWIA 3S3GA 3G1RA 1Z8AA 1T40A 2BGQA 3ONCA 1X98A 3R6IA 4YVPA 2IS7A 3V35A 1M9HA 4OTKA 2QXWA 1ZGDA 1LQAA 1PZ0A 1RY0A 3N2TA 4ZFCA 3R94A 1XF0A 5HNUA 2HV5A 2PD5A 2NVDA 1GVEA 3Q65A 4JTQA 3WBWA 4JTAA 5HNTA 2HE8A 2HVOA 3LQLA 1X97A 2PD9A
chains in the Genus database with same CATH superfamily
3GB6A 4JTKA 5F4SA 2J9YA 3VXGA 5BXRA 3WH9A 3L2MA 1QI4A 3EX4A 4QR6A 1HL2A 1LRTA 3NDOA 1A50A 5A6TC 5CSSA 5IFPA 5LA1A 4JHOA 5EMYA 3GG1A 5U7SA 3HG3A 2EEXA 3STEA 1V08A 3T9PA 1VQTA 5HQLA 5HWNA 1V3LA 2E5CA 3QC0A 1Q8AA 4QQUA 1AJ2A 3FXGA 1PX4A 3WK1A 4OV9A 4J5NA 1Z44A 2HZGA 1W1YA 1OFQA 3LZ5A 1ZJHA 3TQ0A 4NZ1A 4BK9A 3KCOA 4R7JA 2GWNA 3BC9A 3FYPA 4RPPA 4B5NA 1I1WA 2P53A 2JBMA 2PF0A 1LUCA 1O94A 2GOKA 4DX3A 1WOAA 5T91A 3DI0A 3UXAA 3W6MA 1EQPA 1UR9A 2W92A 3P3BA 1LL4A 3SCQA 4F48A 4GYFA 1KA9F 4QTGA 4I5XA 3TP4A 1V6XA 3OGSA 2GJLA 3MY9A 3WBAA 1H0IA 2E28A 3TTEA 2XIMA 1ZSXA 1YIXA 4GBUA 3EWCA 3UWVA 4JN8A 5J5DA 3Q67A 4WZHA 4HSNA 1C92A 4M6VA 1K1DA 2Z1XA 2DGAA 8XIMA 1FUYA 2H9AA 3PP7A 3S6OA 3HQ1A 3PBVA 1UWIA 2IUZA 2P3EA 1JDDA 3BG9A 3SECA 2CHNA 2CZEA 2DUZA 3M6DA 4H9YA 1B57A 3AXIA 1B9ZA 1AL7A 2B81A 4Y9MA 1US2A 2C1HA 1XKYA 3LM7A 2GQ8A 4BA0A 4D2JA 4LNCA 1F61A 1WCGA 5FJRA 2Z6IA 1G1YA 3OGRA 1HXJA 1F5ZA 4N4PA 2DJLA 2QV5A 2A4AA 3ZM8A 3LCLA 2G95A 3V1PA 4DBSA 4TO8A 1SMDA 2W62A 2EG7A 3NWRA 5C9ZA 3B40A 3B0UX 2QNEA 1K8YA 1UBPC 3CZEA 2GVJA 3S4TA 3MWCA 3O9NA 3QSTA 3BK0A 3N17A 4HU0A 3MI3A 4GO9A 3L5MA 4R85A 1PYFA 2ATMA 4ICMA 2QKFA 1SW3A 4N6FA 5EMLA 1KRMA 3N4EA 1FA2A 2J7EA 3LHYA 3QHMA 2UY3A 3T0CA 4DN1A 4KCTA 4DPQA 1FWDC 3CV7A 4P8UA 2DY3A 3IGHX 2BB0A 1JCMP 3MZ2A 2P0IA 2NZLA 4B3LA 2QMKA 4DZ5A 3NQDA 4W85A 1GQKA 2NX3A 2DP3A 3GXDA 1EPXA 2WBGA 4IUGA 3ARUA 4IJCA 4E8CA 1M7JA 4LCRA 2JIEA 2GPTA 4FO4A 3OLEA 5H6HA 1PEZA 1QVBA 3WNNA 3ZIZA 3GHUA 4KFNA 1NFPA 2E8YA 2ZUMA 5A6BA 2RHGA 5HXMA 3IGUA 4W5UA 2HJPA 4JNMA 4ZEPA 5DO8A 5HDRA 1FHDA 3LV5A 4C6IA 2XJ7A 1Q45A 3G0XA 3LPOA 3VAVA 4JKMA 2E67A 4Z2LA 2HPMA 3E2RA 3E6EA 4HK6A 1HL9A 2EPOA 5AY7A 2PDFA 5GJMA 2INFA 5A1AA 4PMNA 4MFEA 4DXVA 3N34A 3EDDA 1S2UA 3E74A 3M41A 4ZFMA 1Q7MA 1Q2RA 4XVEA 4IGMA 3N2CA 1N82A 4LYRA 4A4AA 5HJXA 2WMJA 2WK2A 4LB4A 2HPIA 1XG4A 4UZUA 4HZ6A 1Z7AA 4G7EA 5D2TA 4CN1A 1JFXA 3L4WA 2D1ZA 4B16A 2GLKA 2XFYA 3BQ5A 3V16A 1QO2A 4LW7A 1W32A 5BROA 1E0TA 4L1XA 4UNKA 1F74A 3WD3A 1E0UA 4PUEA 3NYDA 2QCMA 2CU0A 3VMOA 3W7NA 1O95A 2FTYA 3K13A 1CXHA 2ZUUA 1OYCA 1ZAIA 1ML1A 3KVMA 1TIMA 4OZOA 4V15A 5I00A 5XINA 1GPWA 3SCSA 1XYCA 3MW7A 5HANA 1GOMA 4O53A 3RU6A 2X1RA 3F5LA 4PRRA 1PWLA 2ICSA 1OJXA 1TWWA 3NSXA 3USZA 4ZTYA 2WNWA 1IXPA 2PDCA 1S2AA 3VOFA 1A53A 4MVAA 5CAHA 4MIMA 4B9ZA 5G4EA 1DQUA 2JGYA 1WO2A 3UA4A 3TW9A 3F4DA 4YN5A 4WSKA 2YBVA 1X8FA 3UG5A 3BLFA 3W37A 3POCA 5I3DA 3M0VA 4J2PA 4J35A 4JYDA 3E0IA 1H7NA 1QJWA 3DBPA 3L4ZA 2NVDA 1OFDA 3L4VA 3VYLA 1E9ZB 3R5EA 2P8BA 3ZT5A 4K8GA 3ABRA 3KHDA 3UPMA 4X61A 4NSBA 1UC5A 3FYYA 1RR2A 5D38A 2J66A 3T0AA 5CKSA 3W1MA 2YXXA 1XCWA 3L68A 4H9UA 1MO0A 2YL6A 3DC0A 2PBGA 3BGAA 1UD2A 2YOCA 3WDIA 4DI8A 4GZJA 3CB3A 2W63A 3GVVA 4ZSTA 4AVFA 4JNYA 1X6UA 3ICJA 2E9LA 3QF0A 2J8GA 4FOUA 1G7VA 3UW6A 1KRAC 1EP1A 3U3HA 3WMCA 4RE2A 1ZCCA 5JQ9A 2OVLA 1GQJA 4DWSA 2F38A 1E1EA 1QATA 3IJ8A 4WUIA 4F0RA 3D0CA 1UKQA 1UYQA 2XVPA 4LC6A 3A3XA 3WX7A 1RXOB 1GCYA 1WAUA 1BWLA 3C0QA 4RW3A 1DTNA 1V8EA 2G0WA 4RDWA 3DFOA 2QCDA 4MTVA 2Y85A 1KR0A 4GI8A 2A3EA 1JQVA 3PZMA 4IPNB 2DT2A 4L56A 4O0ZA 4QEEA 2VFFA 3M46A 3O6AA 3TXZA 3NSNA 2Y62A 4UTKA 5CZKA 3CTTA 2CLLA 3APTA 4DY1A 1NVMA 3B0PA 3KFTA 2YDRA 3W2UA 3HJZA 4M3PA 5FF7A 1C8QA 3QN3A 2YL9A 1EPVA 3TSBA 4YTUA 5I07A 3O7UA 4DJEA 4JX4A 3HBLA 1JFHA 4HNOA 4GZIA 2VTFA 1W54A 1W0MA 4JXCA 1AVAA 3MP4A 4ZBCA 3FV9A 1UW9A 1G4EA 3ECQA 2BTMA 2ZX8A 1VYSX 4PSPA 1PKMA 1OK4A 4CGTA 3T05A 3W7EA 4AEOA 2NVCA 4ICNA 1AQFA 1TPFA 4ZO8A 1WZAA 1PTGA 3F7JA 3I6EA 2TSYA 3DFSA 2NSXA 2PDPA 3T55A 3A6OA 4AYSA 1EDTA 3P0WA 4QDMA 1NARA 4AZBA 3TLLA 3ITYA 4E8DA 3A47A 3ZVIA 1ZS2A 3A4WA 3IWPA 4GMEA 1S5VA 2AQVA 4GY1A 3RUBL 1QHOA 3WEOA 1U33A 2HVMA 3RFAA 4QISA 1C91A 3OZYA 4EXQA 4LNYA 2ZRUA 1OB0A 4LUJA 5DFAA 4H2HA 1ZRQA 2CZ5A 1EQCA 1EZ2A 5CSRA 2X40A 5C7VA 4J27A 5F2GA 4XBSA 3SCPA 1X7FA 4AMCA 3C6CA 4YYFA 1UZDA 1VBGA 1UWUA 2CBVA 3A21A 2Y2WA 1XC6A 4F2TA 5AHIA 1UD5A 5AC5A 3CLMA 4RZ6A 3H2NA 4C7DA 3U2OA 4JQ1A 2DZSA 2J9ZA 3IPWA 2V2CA 3SB0A 4IMGA 5IXEA 1JRCA 3M0LA 4IHCA 3TCEA 2VP8A 1FFRA 4YIWA 3STFA 1ENUA 3I10A 4PBFA 5A95A 3VUPA 1Q4WA 2DPEA 5FJJA 1LBMA 2Q6ZA 1F05A 5EBAA 1KTCA 4FX6M 2X7VA 3VMNA 5JBEA 5G2HA 3GG8A 3UCCA 4Y2WA 1QTWA 2GVGA 4XTIA 1IZKA 3MT1A 4AMAA 2VOTA 5ABHA 2Y6ZA 1XUZA 3T44A 3E5PA 4BF5A 4RX0A 1HJWA 2EXOA 5H8UA 1W1A1 1MUCA 1NFBA 4HOWA 4FX8A 2YCIX 2BX7A 4S38A 1H4PA 1XLFA 4I7VA 3KOFA 3CUHA 4NAFA 1YQ2A 4GCAA 3C5QA 2PTDA 4DRSA 3VKAA 2HQAA 4AZCA 4LUSA 3G2GA 1K7FA 4L9ZA 3TYDA 2QJIA 5CAKA 5EBUA 3RAOA 3CEPA 3G6MA 2OPJA 3TYAA 2Z4GA 4UBPC 1VR6A 3S1UA 4XG1A 2Y7GA 4E4UA 1W2VA 4PR4A 3QQWA 2DQWA 4XAFA 3LRMA 4AB4A 1GKRA 2WMHA 2CESA 3KBMA 3AJ7A 4PEEA 1AZ1A 5ABFA 2V30A 1K9DA 1FWCC 4HQVA 3W9ZA 1W6TA 1IIGA 5EA9A 1GOQA 3PAOA 3U2EA 5KETA 3U4FA 2YIHA 1L9WA 3OEXA 4PB4A 1GTHA 3BARA 4UQ9A 3O8AA 4AF0B 3L4TA 3OYZA 3L2IA 2BBFA 3UERA 3RLUA 2VEMA 2YXOA 3A12A 3IJDA 1P6WA 1UC4A 4H04A 8CGTA 2I7GA 3UG4A 1DQWA 2RDTA 4R7WA 1ECEA 1JDCA 1W9XA 5ECUA 3S6TA 2HROA 5D9MA 3LRLA 7TIMA 1IHIA 2XIJA 1GEHA 1Y5XA 4AY8A 1W1ZA 4DLFA 1DE5A 4AF0A 5LHEA 1I8JA 2ZUNA 2WVSA 2XWEA 4A21A 1I9CB 5CGTA 4F0KA 5BRQA 3GTFA 3P74A 4B5VA 3GXIA 3T1GA 1TV2A 3SSJA 4N2YA 1YDNA 1BYDA 5A69A 2ZZ4A 4JTTA 4D1JA 3ZOAA 1BKSA 4MWAA 3SW6A 2GVYA 2PLKA 2YLLA 4GUJA 1DWIM 3SURA 3GG7A 2FH8A 4DUOA 4DF2A 1YTKA 4FXJA 1W91A 1XLCA 4JTQA 1QW7A 2CLFA 3PTDA 1GKPA 3KCLA 2FHCA 2I9EA 4AZGA 3I4EA 4DWSD 1OHLA 1XLKA 3ZSSA 1WXZA 1E4LA 4RE0A 2WVVA 3L0GA 1KFEA 5C2XA 1MQRA 2PPGA 2DSWA 1YXDA 4TOQA 3RPDA 1KM2A 3L65A 3E3HA 2ATSA 2Z7KA 2OEJA 1PAMA 4AY7A 3GE7A 3G8EA 4J1OA 5CCZA 5I79A 3REQA 2HVNA 3QH2A 2HWGA 3KRZA 4PMZA 4WDWA 2C6QA 4FNUA 1EL3A 4NNAA 4Y8FA 2WYSA 2BOEX 1GWJA 3K30A 3S6DA 2YKKA 1TPWA 2RJGA 2V6AA 4IFKA 4CNPA 3IEBA 3MUCA 3AO0A 1H09A 4CEXC 1D3CA 5BRBA 2XSAA 3WBEA 2Q8LA 4ZTXA 1NY1A 1LWHA 3QY7A 3S83A 4ONVA 4LX4A 2J47A 5FKYA 3SZ8A 1LZOA 2B7QA 3KP1A 1UP2A 2ZX7A 4RDZA 2WAGA 4XAGA 1IXNA 1BG9A 2EPNA 1LOLA 2QUVA 4ZVJA 1VFLA 1HVQA 3W83A 3AFBA 3R8RA 4XO7A 5I23A 4IJBA 3EWDA 1OCNA 2XVKA 3JZEA 4M6QA 1ZAHA 6ALDA 1XRTA 3BQ6A 3KRUA 1MW3A 3CQKA 3CS2A 4BQ4A 4GGBA 4C6QA 4HPHA 3UEQA 1JDEA 4HHLA 2X1IA 1PTDA 4RNHA 3RM8A 1PL9A 4HNTA 3OTRA 3I65A 2BVTA 2OX4A 4CD8A 7PTDA 4UFKA 3UPBA 4AD5A 3DFNA 1VAHA 2CLKA 1S5TA 1GOWA 7REQB 5DLCA 2VCBA 4GQBA 3KRSA 1E3XA 4YLWA 2BHZA 3HQNA 4GVHA 4EF8A 3CT7A 1GTEA 3EDEA 3ZQ9A 3EXRA 1RUSA 1SGJA 1DJHA 1KFWA 2FFCA 3W27A 3GRIA 3NQCA 1N8FA 2O9OA 1RQBA 3BG5A 4ERGA 4JCLA 4LEQA 2XIBA 2ZC1A 4TQTA 3QOMA 2WMKA 5FSDC 1K8CA 2JGQA 1U22A 3CHFA 2FVLA 3CUIA 4J3XA 2QF8A 3L67A 3CH0A 1AD1A 3VOIA 1H7OA 3TCSA 3SGZA 4BHYA 3UNDA 4GA8A 3AIQA 1GYLA 2XWDA 3JW7A 5D8ZA 4K7YA 2J24A 3V5CA 3B9NA 4BKNA 2V67A 2WC4A 2BWGA 2CKRA 3M7SA 3KDNA 4X60A 4RUBA 1PVNA 2GJXA 3WFLA 1XX1A 2BXZA 1G4SA 1U5HA 8RUCA 1TUXA 4HD5A 1B2YA 1XDLA 5FAJA 4LTSA 2QCDB 4GACA 4X2RA 5D37A 4Q4KA 2VVSA 4AG0A 3H2CA 5ABTA 4MYAA 1P0DA 2ASHA 1PWMA 4OUEA 2PC8A 1CYGA 4A8LA 4DZIA 4H7CA 3ARXA 3CEUA 2J78A 1ISZA 1Z89A 4R7OA 1BAGA 3NOYA 6REQB 1HQTA 1XRVA 3A9BA 4FOKA 1SZRA 2UY4A 6XIMA 4FHAA 1HN1A 5JVLA 4B3KA 3ZJ6A 3CMFA 3SJ3A 1O68A 1DBTA 4DO7A 1ONXA 3NNTA 5AKQA 3MTWA 4DBEA 1RY8A 2NX1A 2D23A 4LB3A 2ZOXA 1EH9A 1CXIA 2F2HA 4W86A 1HGWA 3RLHA 4L80A 3FKKA 4XVDA 4HA1A 3STGA 2ODOA 4DJEC 3WQEA 3WLRA 1WXYA 4H8NA 2V5CA 4J3SA 4UTWC 1VBJA 4AD4A 5FJUA 3W75A 1QPNA 5HMSA 1PIGA 2C18A 3V75A 3W87A 3M16A 4U2YA 1WKDA 4IFKB 1VHNA 2IQDA 4FIRA 4HBKA 1HO1A 3VUSA 2LLEA 1FCVA 4S1FA 3CK5A 4KKXA 1XSJA 2Z28A 4IMDA 5H91A 4UMAA 3H2EA 1SJBA 3SRFA 4FXFA 1L6GA 5JIWA 3BUVA 3APGA 2SFPA 4WXZA 5BYWA 4ZENA 2P8CA 3I4KA 4JIIX 5D2YA 3VCCA 2ISVA 3CHDA 4O14A 1YDVA 4ML9A 1HJSA 2FZBA 5D2WA 3G0SA 2FFIA 4NU7A 3TYUA 3PFRA 4K6AA 4HU3A 4KEMA 2DZBA 3H2OA 4K36A 4WDUA 1D7FA 3LGDA 4JTLA 3OW1A 1YADA 3SN1A 4E2OA 3MVIA 5E1QA 1VHCA 2X41A 3LM3A 1SZNA 3E2VA 1IGSA 3T8QA 4KEUA 4O1AA 1EF2A 1YRRA 2OLSA 3B8UA 3WLKX 1VH7A 3HM7A 1FX6A 1XLJA 5E6YA 2QVNA 2BHYA 2R1PA 2QAFA 3AAMA 3LTSA 5LSMA 1LOSA 2F8QA 5LNUA 3NDYA 1XIIA 3AXKA 1EJVC 1WB0A 1LQAA 2X2YA 4PL2A 4RE4A 3GU9A 4JS3A 4CNTA 4UTTA 1A47A 4AXKA 3WNMA 2PMQA 1Z69A 1EXPA 4LAKA 2A7RA 1R3SA 4JYFA 3GKFA 4AD3A 4IL2A 2Y7EA 1V7AA 1EC8A 2V5LA 4N9DA 1K77A 4K38A 3ITTA 4BF7A 5REQB 1Q6QA 4JTSA 3GC2A 4KWWA 1H1ZA 1XLEA 1THFD 3LQGA 1TVPA 4IGNA 2GUYA 3DXIA 3OP2A 1C9DA 3TA9A 1D2KA 2VZVA 2YW3A 2REQA 1CX9A 4MLRA 2CIPA 1CLKA 3UGRA 3DG7A 3LK6A 3TAOA 1AW5A 4JQ4A 3RHGA 4IPJA 3JVAA 3VGHA 3KBSA 2QJJA 3R89A 4H9XA 1IEWA 1PZ3A 3T6CA 5LIUX 3EWBX 1MRAA 2XN2A 7TAAA 5REQA 3UY7A 2J62A 3FHAA 4NZCA 2JK2A 4QS5A 4NKCA 1GOXA 1OIMA 1AK5A 1YBQB 4GE8A 3ITGA 2TMDA 3EB3A 1OYBA 3LOTA 2Y5JA 1E0VA 5E6ZA 1F76A 5G4WA 2C14A 1MQQA 2P0OA 5DELA 1ICSA 1TIWA 4UZSA 1F3EA 2J4GA 3SIZA 1W1VA 3I68A 2AQOA 5I2UA 3AHXA 3UG8A 3MI6A 3AZRA 4H9MA 1V3KA 4U5KA 3PY2A 2F6KA 4JTHA 1DORA 3IJQA 5MHBA 3NQFA 3LLFA 3PB0A 1XIJA 4HHMA 3VDCA 1ZHAA 4U3AA 2VL4A 1PS9A 2OO6A 1YE4A 1PX3A 1ZAJA 1HG3A 3CWHA 4GFSA 1QPKA 3DKLA 1E0XA 5C9UA 1OC5A 4ATDA 4DEFA 3SQSA 1J10A 2NWSA 1WQ5A 4GX8A 4S3KA 4JR5A 1WOBA 5FJTA 1QNQA 2ZXQA 3IV3A 2QIWA 4HB7A 2D2OA 5I3GA 4JTRA 2AGKA 3UYCA 2O4QA 5AVHA 3APYA 1R85A 4UQBA 3W86A 4TTGA 1ZB5A 3G1DA 4J40A 2H6RA 1P4CA 4S39A 4X9YA 1LBLA 4PTNA 3QRHA 4J3WA 4QE4A 4ZQOA 3WQ5A 3A4AA 5DMMA 3QY6A 3VNYA 1EOMA 4MJMA 3MQTA 4W84A 1OCJA 4CD7A 3G22A 1MXSA 5FI8A 4O8AA 5ABFB 1DIOA 3FGCA 2BASA 2VX7A 3WDQA 3URAA 1T99A 3EWXA 1C3FA 2Z1WA 4WXYA 3AXHA 3TMLA 3UETA 4FNPA 3CASA 3K4AA 5DF0A 3CZLA 1UROA 3ERPA 4H9VA 4DWSB 3UT0A 3HTWA 1SJAA 2Y63A 4UR7A 2V8ZA 3ANVA 4EPBC 4CN6A 4ZQNA 4GVIA 4KESA 4YCPA 3S2MA 1KM4A 4GZEA 2XGZA 5KZMA 1EA0A 3W0KA 1R6WA 2CLIA 2E09A 3WLLA 1RA0A 3QTGA 5A94A 3BV4A 2VM8A 3SRHA 2WJFA 3N73A 1Q8JA 3UFYA 3NYZA 5CPNA 3LHTA 2I5IA 6REQA 1X39A 1J2BA 3WUEA 4IF2A 5KZ6A 2EG8A 2OSWA 3SFKA 2H8ZA 3FNDA 4GYJA 1FWNA 1PKLA 3LCHA 1XXXA 2WW5A 4W5ZA 4HK5A 4P7NA 4GNJA 3VGBA 1ZFJA 3SY8A 3N1AA 4NZJA 1YDOA 1ZQ5A 1J79A 1PZ2A 4JGDA 3IUHA 1OFEA 1V6TA 1LOQA 1MFVA 3T81A 5I7GA 2Y8VA 1S39A 5A6LA 5CXPA 3V5FA 2FZ8A 2PDHA 2A5HA 1UR3M 1EBHA 3I7RA 2WCGA 4C5YA 2C71A 4E8GA 4B4HA 3GHSA 1JPDX 4KEZA 4HCHA 3VZXA 3GR8A 2HK0A 3HG4A 2HS8A 1Q3NA 4YHGA 4LYKA 4C7GA 2VEIA 1KXVA 2J7BA 1R7OA 4XZHA 3L0KA 3DU0A 4CU7A 1JZ6A 4OJYA 1MRQA 1NDVA 3QZEA 5C2CA 4C6OA 3TYZA 2WQPA 2VEFA 2IKGA 2Z26A 1B1YA 5E0KA 1K4GA 1YKWA 4ZO6A 3TN5A 2A1YA 3GUWA 1TMLA 7REQA 5CLTA 1NM9A 1XBZA 1AD4A 3EX1A 4PODA 4DHGA 3H21A 5B80A 2CXEA 4A3HA 4O4VA 3SQMA 1OG0A 3LG3A 4O1FA 4QXIA 3OZMA 4IT1A 1Y7VA 4EOUA 1JPHA 4I9MA 4K37A 1SO3A 2PU1A 4AWEA 2XM2A 1IZCA 3A4JA 5A8QA 3QSRA 4H00A 1NQ6A 1Z8AA 3KS6A 3WF2A 3PTKA 4O57A 3EKGA 2J7GA 5HMEA 1OX4B 3C52A 1CGXA 3VABA 1FWGC 4RV8A 3VNZA 3BCDA 4Q4OA 2IS7A 1LLWA 3WY1A 5KMYA 4OTKA 1P0KA 3C3NA 5I6SA 3W24A 3VCRA 3R94A 1HGYA 3DG3A 1VKFA 5FL1A 2PGRA 3P0XA 3K46A 3WUGA 4O18A 1E71M 5BMXA 1EJSC 3LY0A 2NV1A 4NZFA 2WLZA 2ZQ0A 1HP5A 2G3NA 2PRLA 1POKA 4GVFA 2EQDA 4AWTA 2VR2A 2BHUA 4NY2A 1AJ0A 3LPGA 4ECLA 1NH6A 2FHFA 1V7YA 2HTMA 9XIAA 4H9TA 4DBDA 4D71A 3DHFA 1XFBA 4ZSUA 4W4QA 5KINA 4FB7A 3JU2A 2YA1A 4F66A 5FEWA 3PFMA 1FHUA 4G1NA 1C90A 4DB7A 3UZWA 4HJWA 5FEZA 2DZVA 3WQGA 4WQ6A 3RU8X 4Q8TA 1DXIA 3EZ4A 1RPKA 5BCAA 2OQLA 3GK0A 2BMBA 5LGXA 4KGLA 4GRSA 4PA8A 1SSGA 1WUFA 5I3KA 3STCA 3EPOA 3EOSA 3PNUA 4W7UA 1PSCA 3C2OA 3VNJA 1R86A 3CH9A 3S42A 3FGCB 1XGZA 1R3QA 3NJ3A 3LV6A 2YCJA 3VCNA 2OKTA 4O54A 5KTLA 3FOKA 4V1XA 1WA3A 2WKLA 4ADUA 3HQPA 2G37A 4AHOA 3N9KA 1L6FA 1NP0A 3G3DA 3TIMA 3ATZA 1FDJA 5AC7A 3IJ9A 1QW8A 1QASA 1SO4A 4XX6A 3U5UA 1DEDA 3GLCA 1G94A 4ALDA 4I9AA 1V4YA 1R9YA 2E1DA 3IIPA 2QCLA 1EKOA 4UNIA 3L0NA 4R5EA 3CYJA 4AU0A 1F3XA 1F7BA 4D6EA 5T9CE 1E9YB 3B9EA 2DZUA 2XYLA 3WBXA 1GW1A 5HUPA 5D33A 4YPJA 1EP2A 1EYWA 2ZWYA 3PULA 4GWEA 4BFAA 4DUVA 2XZ9A 4FS9A 2ZKMX 4Z1DA 4HN4A 1O5QA 3AIWA 1TQJA 4ADTA 3DAQA 4I6KA 4CQBA 1AQHA 3FDKA 1JAEA 4V27A 5E09A 3N6HA 1N8WA 2YXGA 5E9AA 1E6ZA 3COTA 1VD6A 3M0IA 3WLIA 5A2CA 1UH4A 1XQLA 2HK1A 4IPPA 3P8JA 1YPXA 3GDRA 3LNMA 4F2BA 4OOZA 3SUSA 2HS6A 2J79A 4E4PA 4OWGA 4YVVA 3VKKA 4LWWA 1TWZA 3IK2A 2A2IA 4YYCA 7A3HA 1SZEA 1CI1A 1XLIA 2OT1A 3NO3A 4NAEB 3FEQA 3SCUA 3MI2A 1TE6A 5M1TA 1GVYA 2V3DA 4GJJA 1F73A 1B4EA 1R2RA 4NNCA 1GOIA 3GNXA 1E15A 3T4CA 3LI1A 3ONBA 1A5BA 2WSYA 3IJIA 1G5AA 3VNKA 3SCOA 1NFGA 5D30A 2XVGA 4QLJA 3AXXA 4MYXA 3ZZ1A 3V1HA 4DBWA 5FJOA 1OX4A 4IISA 3EB4A 5LHFA 4AZIA 3H4WA 1DXEA 2YL8A 1UKSA 2WZIA 4GC4A 5JH2A 1ISWA 1UH2A 5HJLA 5EYWA 5FSEC 2PEVA 2W6RA 3IS4A 7XIMA 2FPYA 3W1LA 2A3LA 1VEOA 3BAIA 1LL7A 3QTPA 4I5RA 3VM7A 5G1TA 3SUUA 3OBKA 4PL1A 1XIFA 2EPLX 4K8HA 1LL6A 3B0VC 3QY8A 2ACUA 3EWZA 1DHPA 3MZNA 5BOOA 3N9SA 1K8XA 3TFCA 3MHFA 2PTWA 4MAVA 2WZMA 1TZZA 4GBDA 2NXGA 1VPQA 3EYPA 3TH6A 2F7FA 4UQDA 3S0CA 5K4XA 1FWBC 4HNNA 3W02A 2GDQA 4UTTC 4CN4A 1ZP4A 2VWTA 1XS2A 4ZO7A 3RR4A 2XN0A 1GVQA 4LVBA 4FA3A 3QV9A 1RCOB 2CC0A 2PZNA 4TMCA 1VEMA 1MNZA 1TWDA 4HP5A 1C8XA 4YS1A 4LANA 4O1DA 1DJIA 3DERA 4PYSA 2W27A 2EO7A 1UOKA 3H22A 4R9OA 3H54A 3FS2A 4Q4MA 1S46A 4JY9A 3WD0A 3THAA 1G01A 3G77A 5GJNA 3B4YA 1SFLA 1A4MA 1NWUA 2J75A 3QOKA 1IZJA 3ZVHA 3GFZA 3GVQA 1MXDA 1XH0A 2WMFA 1TJRA 3UY8A 5A2BA 1CW2A 2QR6A 4LH8A 2OQYA 1QR7A 1QNSA 4XZWA 3W01A 4E0CA 3LXCA 4NIRA 4ZA0A 2PD5A 2O0TA 3Q65A 4ZGYA 5EB8A 3B4UA 3H7VA 1RBAA 1IEQA 1EEXA 2XN1A 3LQLA 1U83A 4KERA 1YPFA 5EPDA 3M0MA 2TRSA 3V5OA 5AOUA 3O6CA 2QMJA 1TTQA 3UCDA 1UWTA 3NXLA 1VS1A 4LUTB 1OGSA 1KC7A 4GISA 2VX5A 4DBUA 3VU2A 4A05A 5FACA 2HRWA 1VYPX 4YU1A 1XYAA 2PTXA 4C6KA 4EK7A 3BLPX 5DN1A 3ZR6A 2DZXA 1A5NC 2ZZ2A 3VGEA 2QCFA 1JI1A 4PRTA 4GXPA 3UWYA 2NQZA 4UWMA 1LYXA 4DO6A 4MB4A 3N19B 4XAZA 1P0NA 2ZA2A 1WBJA 3UZZA 1VYRA 3AALA 4E5TA 4RDVA 2Y1HA 4ZO9A 1H51A 1N2VA 3MO7A 2CLMA 2PWEA 1M01A 2DT0A 3INPA 2OWCA 1KRCC 1NOUA 1KBIA 3A9IA 1X96A 1BTCA 5C0QA 3KE0A 3S5NA 3SN4A 3GH4A 1P43A 1VF8A 1ZY9A 1K6WA 3CHVA 4JIQA 5CBIA 1XBXA 3LSCA 1FDZA 3NZ1A 3W1QA 4EPKA 4WOZA 4IUOA 3O0FA 3E9AA 1H1NA 4GIYA 3VIMA 2OG9A 2JEQA 4YTSA 3EKZA 3VIFA 4H6QA 3WQCA 1BKHA 1QK2A 1UR2A 2WNQA 3LTYA 2WM0A 1AZ2A 4MB3A 4WVXA 2G3MA 1JG9A 3AHTA 1V51A 3NQAA 3QJAA 2Z29A 1CXKA 3TC7A 4AEFA 2C79A 3H4GA 4IP5A 5BXPA 1K9TA 4JL2A 4I7WA 2Z1KA 4JTUA 2G5WA 3UR8A 2YBTA 1R9ZA 2YPIA 4S3FA 1O66A 3V36A 4REQA 4PMQA 2W61A 2V3EA 3UCQA 3M0ZA 1EJ7L 3N04A 1LM1A 3DDMA 3RX2A 2E6DA 3F4WA 4KMQA 3WIJA 1I2NA 1A0DA 3CNYA 4B92A 3VNIA 2KAUC 3UZXA 3USBA 3NPVA 4X9SA 2EGZA 2INEA 1R87A 2J27A 1FY6A 2HISA 1SFJA 5AZ0A 2BG5A 3BSGA 4HSHA 3A5VA 2PCEA 3ARTA 4US5A 3P2VA 3VOGA 4EIVA 5I3JA 2NX9A 4Q3MA 1GJUA 4E3VA 3PWGA 1XRSA 4X0NA 2YW4A 3S9ZA 1O4UA 2CBUA 2W67A 4C1KA 4B5SA 2OKOA 5CC7A 3VPLA 1VCFA 1X8CA 3FN9A 1ZZMA 3A24A 3O15A 1US3A 3MCNA 1Q6CA 4LVGA 1IIHA 1ZJAA 2B7OA 3AMLA 1MZHA 4HMDA 1PX8A 3GFYA 3H53A 4LBRA 5AHMA 3VIPA 2FVKA 4MPKA 1HKJA 2WKJA 5LNSA 3WLTA 3WZ0E 4Y8EA 1GORA 3B8SA 1GNXA 4XAYA 4XZ9A 4L64A 4M56A 3M47A 4Z1YA 1OWQA 1CDGA 4LYQA 3KOXA 1VLIA 4RNJA 4RR4A 2BOGX 1HFBA 5F4XA 2OZTA 1VBHA 4UMCA 5FEXA 4AVNA 4O28A 3K8MA 4OQVA 3A22A 1R47A 4A2RA 2ACRA 2Z00A 4EXAA 3G8RA 2OTDA 4TXEA 3WLQA 3NO1A 3FCPA 3E2QA 4C6DA 1DWJM 1V77A 3W6YA 4HA3A 3HPFA 4UOJA 5DY2A 4Z2IA 1QK0A 2BXYA 2REQB 1Z6KA 4DZAA 3UJRA 4MZ1A 4GUIA 2Y8UA 1ME9A 1OD8A 4D8AA 3AS0A 2VWSA 4RLIA 1DP0A 5FESA 3VDHA 2Z1BA 4Y9PA 1HNYA 1QI2A 5TAOA 4TVDA 3T0BA 5M3WA 3NL3A 3MCOA 1SO6A 4MZ8A 2ZDSA 2BSLA 8TIMA 5XIAA 2CWXA 3R1ZA 1AH4A 3OLIA 4HNLA 1JD9A 2XHYA 1FWEC 3VOCA 3LU2A 5LIYX 1IV8A 4FX7A 4DYEA 2WHMA 1TWIA 2Z27A 4KWUA 1KR1A 1WUEA 3E2SA 2WHJA 2GSJA 4HT3A 3DGRA 1T5AA 3VNMA 4HCLA 3KBJA 1TMQA 3FAXA 3UVIA 3T2PA 3GNDA 2ZZ5A 4QG9A 5DT7A 5HR7A 3MO4A 2F2KA 4HA4A 3Q37A 1H5VA 1CLVA 3MJYA 1T8XA 1KFLA 1S5NA 3WEZA 2GDUA 3A3WA 3VC5A 4D6HA 4S23A 5DMNA 5BZAA 1RQEA 4FIQA 2BGQA 2GGJA 3AYTA 1TWSA 5E70A 2QCGA 4AD1A 4PCPA 3C2EA 2P88A 1WX0A 2ZZ7A 3P93A 2W4XA 3F5JA 2GSHA 3VD4A 1WDQA 1SJCA 4NXKA 3ES8A 2VC6A 4JTAA 3E0VA 2NWRA 2DT3A 2HE8A 3AISA 3B9DA 3TTSA 3ARZA 1HKMA 4KFPA 4HU8A 3NQMA 2VR4A 1RJPA 2VELA 4DVOA 1XD0A 4GHRA 1BWVA 2YX0A 1G4TA 1XLMA 3CB8A 4C6NA 2PTYA 3TNOA 3WNKA 3QHNA 4GX9A 3LGEA 4HYWA 3HPZA 2G8ZA 2V3FA 3UBPC 3M7WA 5I77A 3O16A 3CTLA 1FKWA 3BJFA 3W7CA 4ASTA 3EDJA 1GPFA 2D3NA 3P7YA 3S2JA 4IQJA 3WNPA 3TNBA 1W5QA 3MUZ1 4AD2A 4V2XA 4ICCX 4AHQA 2QCNA 4DJDD 4L6HA 4AFYA 3ZVHB 3GS6A 5I06A 4IICA 2Y61A 2J6VA 1WKFA 3T7VA 3EX3A 3W7KA 2WJZA 1HX0A 1RZMA 3QGKC 1SR0A 2DH3A 3GU1A 4R27A 3UYIA 3O6DA 1AODA 2BDQA 3MUIA 2FMNA 3LENA 4RCXA 3PBMA 4GPNA 3MKVA 1Q6DA 5C70A 5EKYA 3GKAA 4C7FA 2I9UA 3BAXA 1QBBA 3BE7A 5HK4A 1AUSL 2YJQA 3AMKA 4EWJA 5C71A 1E70M 1YPIA 1XPGA 4GVGA 4MG4A 4DQWA 4JIHA 2YDAA 1W31A 4RXGA 1B3OA 2UY5A 2VUYA 3QBUA 3R0UA 1UMYA 3CO4A 2WPGA 4MWAB 4H01A 4XTDA 1K03A 5HR6A 3DN5A 5CPTA 4Q8NA 2VXNA 4UUIA 3MS8A 4XBJA 3OB8A 5D9OA 3TAKA 1O60A 3C0JA 1SSDA 1J0KA 1PHQA 4F0LA 3B8TA 3EKLA 2WWCA 4MPQA 4TIMA 5JUVA 3WLPA 4LS1A 4S2CA 3VOJA 3ABXA 4HTYA 2DUXA 5KZDA 3MA8A 1J0HA 2MUCA 2RDWA 5IHRA 1S5WA 3C2RA 4NILA 2V5BA 1IR2A 1LP6A 3NZPA 5DCDA 3CAVA 3TC6A 1H2JA 2V69A 2CBIA 3AIUA 3TJLA 3VD5A 1EX5A 1TQXA 2VEKA 1GG1A 3CC1A 3KOWA 2D2HA 3AYSA 5GNZA 4UFJA 3UWEA 1Z48A 2PDGA 4YTRA 4GJ1A 2CCRA 4Z0JA 3O1NA 1QBAA 4H3DA 1HJVA 2FDSA 1TTJA 1UP0A 4OGZA 2A21A 4UOZA 1BF6A 1W17A 3FAWA 3GHRA 1TJ1A 1WYIA 2W9MA 3V0UA 4JTJA 3M5ZA 3M1ZA 3LLDA 3PG9A 1LWJA 3VDAA 5FCZA 3WLNA 2WVVB 1XBYA 5D05A 5JMUA 2PDKA 5JIPA 4NAEA 3VVGA 4ML4A 2G3IA 2R1LA 3DI1A 3GM8A 1UJQA 3ALFA 1V6YA 2PGEA 4JYEA 1SZGA 1PDYA 5JH1A 1BGAA 2O7SA 3BURA 1VFTA 1EF3A 2POTA 4EPDC 1JYVA 4JAWA 4JFWA 3LXAA 1VENA 2HSAA 3N2BA 1DIKA 4AH7A 4AZ7A 5HOSA 4WDTA 2VZUA 2DW6A 3OYXA 5I5RA 4INFA 4D9PA 4UC5A 5K4ZA 1JRBA 3VFLA 2B31A 2JKEA 3G18A 3GIQA 1M04A 3PR2A 3MSRA 1UKOA 1JEZA 3SJNA 2FZ9A 1FHVA 4GH3A 5CC6A 5E9XA 4JIRA 3WD4A 3LCGA 4AX6A 1Q6LA 4POCA 3VX1A 2IXUA 1V6UA 4IMCA 3RO8A 5B7ZA 2BP1A 4XZBA 3M6YA 1J5TA 3AMDA 2X16A 4S3GA 4F4RA 5CG7A 4Q22A 2IPWA 2WVTA 2NUXA 3GAYA 4EANA 3O06A 2XH4A 3SAZA 3IJ7A 4XZNX 2A3CA 3L4XA 3GYCA 4N9CA 4O1CA 4Y6GA 3NZQA 3B05A 1FVPA 1GVIA 2E6FA 4F0HA 3G1AA 2BNJA 5KITA 4AUBA 5BU9A 5E93A 1YW1A 2YLAA 3S1VA 1F9CA 2I5GA 1EFZA 2WCSA 3VIJA 1TPVA 4LALA 5H8PA 4Z08A 1GVOA 4L5ZA 2VOMA 3WJSA 3TZNA 1TO3A 4DNHA 1F6KA 3F1QA 4MUPA 2ZZ1A 3W2JA 5I78A 3TOPA 1M03A 3DFQA 4XIAA 4FI4A 3EMCA 4NG3A 2ZICA 3BAJA 4G7EB 1OZQA 4N02A 4WY0B 2WV8A 3IUIA 2EHHA 1WDDA 3WJXA 4HZ8A 3WNOA 4GI6A 4MB1A 5DT5A 5U4NA 1KWGA 3FVDA 4E4FA 3ID7A 3VILA 4A8NA 1T40A 3QZAA 5D04C 3WDPP 1GZJA 1FBAA 1EOKA 1FWTA 3BXWA 3VX0A 4O8RA 4MADA 4WIWA 3V35A 3PS7A 3HPAA 2E8ZA 3KOZA 4R53A 4F0MA 2XGIA 3OPSA 1J11A 2OOGA 4MWAC 3TWAA 2VENA 2ZRXA 3M0JA 3SCRA 3BMXA 3ZJ7A 1XUUA 1FP9A 1SQ7A 2YL5A 4G7FA 4JEJA 4M5PA 5GNXA 3GTNA 1SVDA 3URBA 5MKGB 4ES4A 4O12A 4CVWA 4I3GA 3T0TA 2A79A 4F8XA 1UH3A 4I6VA 4Z2GA 1KBJA 3TU9A 3VD3A 4C90A 2AGTA 3UWZA 2WJDA 3TFXA 1VPYA 3ZT6A 4AIBA 5AYZA 4CQDA 3MYPA 5C2GA 4NHVA 1C93A 1TMHA 3HIJA 3PNZA 3K1GA 3M0KA 4PN2A 4WRHA 4QSHA 4BR1A 2DZPA 2XTKA 1LUCB 4H8HA 2QHAA 3EA1A 2GVLA 1OT2A 1ZENA 1K9FA 3C61A 1V02A 4ERIA 4XWUA 1UHVA 1TRDA 4IMAA 1A3XA 1REQB 4G8TA 4FF5A 3D3AA 1FFQA 3ENLA 1OM0A 3MMUA 1IWBA 1POJA 4NAFB 3FX4A 3KZSA 2UWFA 2ZX6A 1CZ1A 2PDQA 1N55A 4LAOA 1RJQA 4XAPA 5HWJA 3BLDA 3UWQA 2JFEX 3ZWSA 4K1WA 2QPSA 5D03A 5D9NA 3FYOA 4C91A 4NZ5A 1XHGA 1KCLA 4Q33A 4L9YA 4NX5A 2QT3A 1FTXA 1CNVA 1ZBKA 4OBTA 1ZBCA 1ZALA 3LMYA 1MDLA 1XLLA 2AL2B 3QMRA 4HA0A 1RD5A 4L65A 1ICQA 1TZ9A 4O52A 1VFOA 3STPA 1XCXA 1EZWA 3UPWA 3QW4B 1J0YA 2GK1B 4KCVA 4UR8A 4UOQA 3CUFA 2IPGA 1GKQA 4CCEA 1EWDA 1H5YA 1XG3A 3WKZA 5RUBA 4LFYA 3TN4A 1VFSA 2NLIA 2OODA 4QIUA 4DXXA 1VLWA 4IXHA 3LHZA 4M82A 2XPKA 2PURA 4IMEA 1J0ZA 2Q01A 3PB2A 1UIPA 1G69A 2F6XA 4FNRA 1H63A 1Q65A 4U33A 4TTUA 3RX4A 4IH3A 3AS3A 4MFDA 4GJIA 1JYWA 4FLRA 3ITXA 4LUIA 3IIXA 3GAKA 4GQQA 1UD6A 3BGGA 4AIUA 2Z2AA 2XZ7A 4QBXA 3NVTA 4RNFA 2D2GA 3QR1A 1HKVA 1W3KA 3BCJA 3EEZA 4TVUA 4BF9A 1OX5A 5DXYA 4JN6A 1QCWA 2GGGA 4LGXA 1DJQA 3ZJ8A 2VURA 2QCCA 2Z24A 4BI5A 1C8YA 2FKPA 3K5XA 1HVXA 2TPSA 4I9TA 2PRMA 5FA5A 2QGHA 1Y0EA 5FJPA 3S46A 1NJJA 1YNQA 2WCAA 4MNLA 1GQLA 2VDGA 1ISXA 6CGTA 4W7VA 3EX6A 1DWAM 4IIEA 4U10A 1HJXA 1FWAC 3QW3A 3CZGA 1HW6A 1RLCL 4CD6A 2FZNA 3GNNA 3BLKA 3WDHA 4HPXA 4XKYB 2PWGA 1JQXA 3D46A 1XBVA 3MMDA 4DYJA 4FNQA 1FH9A 3AI0A 1UA7A 3ARVA 4HYVA 1US0A 3UZ5A 1MUMA 3VM5A 4DO4A 5M5DA 2Y88A 3PJXA 3PBGA 5CEWA 4UTIA 3WENA 4PCTA 4M1BA 4LPCA 1GGOA 3Q94A 5EFDA 3LBCA 3LCWA 1G67A 1QOPA 3WD1A 1A5CA 5IOBA 4CEUC 3BJSA 3BO9A 2DU2A 3LBMA 4ZOBA 3UQNA 1N7KA 4NRRA 2XH0A 5A6SA 2I57A 1KTNA 4PMYA 1EO5A 1KBKA 3W22A 2Y5EA 3MUXA 4EF9A 4EACA 4ZL1A 4JPGA 1AW1A 2GQAA 2A3AA 2Y5SA 2F61A 1EEPA 1ZBVA 5AECA 1BG4A 2BOFX 1QPQA 3SI9A 1R8LA 1KNWA 5H1WA 1FH7A 2DSZA 3TMQA 3Q45A 2D0FA 2O92A 4JFUA 1UR1A 3QZ6A 3CPUA 2OLAA 2CZVA 1H50A 3ATYA 4MWAD 1AJZA 2QYGA 1A3WA 2PWVA 4X22A 5E5CA 3W7PA 4O11A 3H12A 2ISWA 3Q58A 4XV0A 2X7WA 2DVUA 3BZGA 3WF3A 3FA5A 4LOCA 4S2BA 4P8XA 3A64A 3BLIA 2WXDM 4MJ4A 1VBUA 3QQ0A 4DUWA 4GGHA 2VQTA 2V3GA 4PE8A 1JJKA 1ME7A 5LZLA 4M0XA 1JGIA 2GSEA 2VZTA 4MJZA 3FFSA 4Q8MA 2Z7GA 4WR3A 3IAPA 3EXTA 2PDYA 5AZ1A 3LLXA 3WDRA 2H9AB 1XINA 4BZYA 3S3GA 1K8ZA 4HNVA 1WZLA 1XLDA 1IR1A 3TVAA 1TRIA 2HNHA 4YVPA 3AC0A 4ZCWA 3LNPA 1GW9A 3KDOA 3F4VA 4C6MA 4N9BA 1VGAA 3ZR5A 3N2TA 4CNOA 4ZFCA 3W72A 3W1RA 1FWRA 3BW4A 5C9WA 1FDYA 3R12A 3HV8A 2WKGA 3E96A 3K8LA 4WJXA 4XKMA 2GFTA 2VQUA 2PD9A 3OBAA 5K9XA 4KS0A 1OVDA 1PTAA 4FZIA 4AYGA 3N9RA 4ZE5A 4XZMX 4HPJA 1LRNA 1BTMA 1ITCA 3QFWA 5FOOA 1G9HA 4HNUA 3W2LA 3WH6A 4LS0A 2J7DA 3F2DA 3DIPA 3NPUA 4WKAA 3W74A 1NTHA 3W53A 3CHEA 4PFHA 2FPTA 1EC9A 2VGBA 3IIVA 1OGGA 1A5UA 3O0KA 1GEQA 1KGUA 4LCQA 1RSCA 3E0FA 2R1KA 3M0HA 1P1XA 4DAFA 3UJEA 3UP8A 1W1IE 4PH6A 3TLQA 4F40A 1XYFA 1B5TA 3U2CA 3P60A 4HPGA 1NOFA 3FA3A 3D3FA 4HIBA 4PUNA 4Q6JA 1TTPA 3G0UA 3P6LA 3RILA 4LC8A 3UZYA 5B7YA 1P5BA 1XLAA 4IPIA 4NP7A 1QPOA 3GU2A 3ZXWA 4KWSA 2BS9A 2CHOA 2VT0A 2ZBTA 1MVYA 3CIXA 4QHRA 5H8MA 1BRLA 4GKTA 1PPIA 3N12A 4M6PA 2DEPA 3LHWA 5G5IA 3IARA 3N2OA 5IM51 2FGZA 1OSEA 1R5YA 6PTDA 1SMAA 3PG8A 1ZUAX 4MLJA 3WH5A 2OZ0A 4IWWA 5AC6A 3CQHA 1SU5A 3NCOA 3VTRA 4B5WA 4C60A 3MU7A 4TX8A 5A6KA 5A8MA 3XISA 3B0YA 3NURA 4NJHA 4OU1A 2A3BA 3CJPA 3GH7A 3NM3A 3MP3A 3BJTA 1BYBA 1XH1A 4WCJA 1JF5A 4RPQA 4KGJA 2ZE0A 4PBEA 4LRTA 5TF0A 1OGBA 1QHZA 1VRDA 4CQ8A 4XUYA 4A29A 5LGZA 3UXDA 1JCJA 2V9DA 1RV8A 4LVDA 2Z1VA 4ZB0A 3L7RA 4IG2B 1FP8A 5I3FA 4GIRA 4D6DA 2XISA 1H3GA 2Z1SA 2DZAA 2W3ZA 2VZSA 1JR1A 2DIKA 3B8IA 4FP1A 4K1GA 1A3HA 4D8LA 1RPXA 4YXGA 4XUGA 2ZA1A 3OU8A 3S47A 3WH7A 3PF3A 2QF7A 3T78A 4IZGA 4N4QA 4D72A 1XIEA 1OC6A 3KXQA 3L2LA 2F84A 3TN3A 4UFMA 4NJGA 1NWTA 4KBXA 1ELSA 1OFPA 3BAKA 3MYOA 2QJNA 4ZOCA 1XIMA 1CIUA 4M1RA 1FWHC 4W89A 3H55A 1LG1A 4JX5A 2V81A 4V33A 2I14A 3WN6A 4IXXA 5HQEA 1F4AA 4BWLA 1VP5A 4QG8A 2WMIB 4G56A 1VJZA 4UNLA 4MGGA 2WNNA 3GXTA 4FR1A 1IT7A 4UCFA 1R38A 2OO0A 1CGWA 1JZ3A 1CEOA 1RHCA 4LRSA 1P6BA 5IDIA 5CG0A 1DJYA 4GNKB 3IACA 1KCXA 4EX4A 2UV8G 1TVLA 1OZMA 1OFOA 1T7LA 1QNPA 1V0KA 3R2GA 3W7MA 2V5KA 3FY1A 1NAL1 3DENA 3CZJA 4Z2KA 1WDRA 4UQCA 1GG0A 3FVMA 4PCNA 3OVPA 2QQ6A 4J7RA 4P7QA 2HNEA 1TV4A 3PVFA 1YNPA 1PZ1A 2PBOA 2BY0A 3OHMB 2VX4A 3NSMA 3WMSA 2IMRA 2RJHA 1XDJA 1BYCA 1KFBA 3CU2A 4JKLA 3NZRA 4KIEA 3W1PA 1QDSA 1YTDA 5DEZA 2O9PA 3GDMA 5G1YA 3WL1A 4S3BA 1EC7A 1SFTA 1MEHA 4WGHA 3WF4A 1UZ1A 3O3RA 2VC7A 3NPWA 4IGHA 3TW6A 1ALDA 5HNRA 3VKBA 2WPBA 5M2FX 5CZJA 3N2XA 3JRKA 3U48A 4PUKA 2Q71A 2G96A 1K70A 3OBEA 3OIHA 3LI0A 3VGDA 2FZDA 5D8WA 3U9IA 4PCSA 1IXOA 1C7TA 3Q4DA 1J93A 3HGRA 3U7BA 4EP8C 2VO5A 1KM1A 4Q6XA 1TJPA 4Q8QA 1HL8A 2YYUA 4KCUA 4GG9A 5E0FA 2QIIA 4LCSA 4Z1AA 2GJXB 5A6BD 1PBGA 4G6CA 3UESA 3U5YA 1VJSA 3SGGA 3QKZA 2X1TA 1A5OC 1W37A 3GNPA 3B03A 4IIHA 2ADAA 2CXGA 1UCWA 4OBRA 3TROA 2XG9A 1WDSA 2XFRA 4N7QA 3GX9A 1A4LA 1W5MA 4MUZA 1AH0A 1EBGA 1KKRA 2ONEA 4N42A 3UA3A 2MNRA 3DBNA 2PA6A 3C0LA 3PUEA 4LF1A 3KVLA 4NJKA 1BPLB 1QI3A 2QEZA 3W7DA 3UJSA 2D20A 2F9RA 3VFCA 2WOQA 5BRPA 4GCXA 5I0DA 2IPFA 2NSOA 3ME3A 1WDPA 3NQEA 9RUBA 1DE6A 3AYVA 3G1RA 3FJLA 3EB2A 2H90A 2NQLA 3PJTA 3DESA 1MEWA 1GVFA 1W9DM 4PTWA 1Q2SA 3W26A 1EUAA 1MWOA 5BOEA 3GZAA 1E6XM 3AWOA 5PTDA 1BFNA 4JCMA 2VEGA 4UQAA 1XR2A 3LRKA 4G9PA 1EJRC 3BOLA 3KTXA 4WOQA 3SCTA 4QJ4B 5DRCA 3XINA 5C55A 1FQ0A 1VFMA 1CBGA 3HOJA 4F2UA 3WLOA 1H7XA 5BU6A 3VO0A 3OA5A 3RCYA 4GXMA 1SJDA 4HZMA 1E6NA 2VI0A 4M7SA 5F1UA 1KGWA 3PZUA 2PB1A 4YMZA 3T8LA 3DX5A 4IM4A 1G0CA 4JIPA 1WZKA 1MXGA 5EFFA 4ROPA 1W5PA 3RIKA 4WKHA 2Y89A 1WZMA 2ZVIA 3TDFA 4UTFA 1JZ7A 2WJEA 5I03A 5C8BB 2PSNA 3ZWTA 2OYMA 1E9LA 3T07A 4QDPA 3J7HA 1LDCA 2FTPA 4HNCA 3KM8A 2JF7A 3ABSA 3DFTA 5KZEA 1MFUA 3H70A 4MKNA 4Q32A 3DEQA 3VOHA 2PE4A 3UF9A 1IT8A 4AX7A 1DWHM 2UBPC 3R0DA 1BYAA 4NZ4A 4PC8A 4RZ4A 3ARRA 1VCGA 3PUOA 2FGBA 4B9YA 1DTUA 2PWDA 1JI2A 2NV9A 3H7UA 1YHTA 1B54A 1TV5A 1H0GA 2ISDA 3QEZA 3HG2A 1NDWA 1PO9A 4B15A 3R4IA 3T2QA 2VHLA 4HMNA 3TTQA 3SCWA 3EWUA 1K6AA 2GQ3A 4AHPA 5JBFA 3CV6A 3P80A 1E4IA 1E51A 1IF2A 4NX0A 2ZZ3A 3QV8A 2CBJA 1XI3A 4J9JA 2J6XA 3QHOA 1O5KA 2IKIA 3NEHA 4HVXA 4EPEC 1K02A 1ME8A 4UTJA 3CUGA 1E5NA 4FXRA 1BLIA 3M0YA 1M7XA 3EOOA 4M80A 3LN3A 3C0SA 2VRQA 4XISA 3W7IA 4Y90A 1YXCA 1KM0A 2VFIA 1RK5A 3GDKA 1V0LA 2PDXA 1XLHA 3P8IA 4H6EA 3T08A 4IPLA 3E5BA 3OIXA 4W8LA 3R8GA 3TN6A 1FCBA 2EKGA 1QNRA 2E5BA 4QX4A 3FA4A 1UD8A 3IGXA 2NQ5A 2FB2A 2W91A 4GK8A 1AMYA 4AZCB 1CCWB 1XL9A 3HGJA 1W5OA 1UR8A 1F8IA 2VMFA 2VDIA 1B90A 1MSSA 3WMLA 1ZNNA 1MEIA 1OEPA 1UJPA 5M17A 4XB3A 3KBWA 5LIKX 1OYAA 4NZ3A 1JCLA 5JXQA 2Y4SA 4X63A 1KXTA 2P10A 1MI3A 4A6GA 5G1MA 3CHCA 4CU6A 3ISIX 1B4KA 1KLZA 1ZCOA 3H2MA 2JE8A 3TTOA 4HU4A 2OB3A 4MNKA 1UR0A 4H6RA 4D6IA 4L61A 4G2DA 1XIGA 3W70A 4KWVA 1JXKA 1EHNA 1QI0A 1DJGA 3RM9A 3N29A 4ZB2A 1LBFA 1X6LA 1T8QA 2V68A 2X30A 3F4NA 1IEXA 3FXYA 2IXVA 4C6JA 3WQ4A 2ALDA 1XLGA 5IRPA 3EOLA 1M1BA 3LEPA 2ZUVA 1TCMA 3D5HA 3MHUA 3C4UA 5BOFA 1WXJA 3H24A 4E3TA 3W29A 3SUTA 1BQGA 2WANA 1XH2A 3GTHA 2JEPA 3ARWA 4PUJA 5A6AA 1B3ZA 1QU4A 2V82A 4ZQCA 3ZYZA 2EAWA 3RJYA 2J25A 4H41A 2WB5A 4YL2A 3UG3A 3AHZA 4N9EA 4MDOA 1A80A 3TJXA 1MW2A 1U5JA 1CENA 2PDJA 4CQCA 5FF4A 4ZXOA 2C91A 1QNOA 3POHA 5KSWA 3QYSA 3N6QA 4HMCA 4WDXA 3TJ4A 3W1UA 3LCFA 1U5VA 3MSDA 2KX9A 4LY8A 2G3JA 3GVWA 1BQCA 2CFFA 3VK5A 1DIEA 1KTBA 2PDIA 3CAWA 2FQIA 4CNSA 1XQKA 2X42A 1GYMA 3RO6A 4F3HA 4JFTA 3TZFA 3GZ3A 3AUJA 5F4WA 5I3HA 5BMWA 1B3YA 1OADA 3ITOA 4GFIA 5HNNA 4E2VA 3WUBA 4V28A 4PUWA 2L5HA 4M29A 3IVSA 2ZIDA 4H8VA 3BW3A 3EAUA 2QUMA 2C8NA 4CD5A 5D2XA 3HV9A 3NZGA 1W8SA 3CQJA 2DV0A 3WCZA 4IG2A 3A3HA 3A23A 3U57A 3CMGA 5FF2A 1PV8A 2Y0FA 1I0BA 3SBFA 5FL0A 4G1KA 3KOYA 3KLLA 4PB5A 3PJUA 1J0JA 2O4MA 3UD6A 4ACYA 2BVWA 4EAYA 3N4AA 1XYLA 3G6LA 3AIBA 4JBRA 4WLCA 2E68A 3IV8A 1ONEA 5CJMA 5LA2A 2OXNA 1FH8A 3OZOA 3WYZA 4FR6A 2Z0IA 1VFFA 1ECQA 4BQ5A 1LLZA 1XDMA 3W7RA 1NU5A 1M9HA 1E9IA 3W1XA 3WJWA 3NQGA 1HIZA 1J9YA 1WPCA 3QV7A 2EJAA 1TV7A 1TFVA 2DVTA 1P0BA 3CO8A 4W93A 1GVEA 1VCVA 1J12A 1W9BM 1RBLA 4QNEA 1BF2A 4J4KA 3QLDA 2XIQA 4PTMA 3NR0A 2QJMA 4P61A 1DIDA 4I8DA 2ZXDA 5DX7A 1RA5A 1HF6A 5TNVA 3TUUA 2EF9A 4JQ2A 4HHPA 2J8TA 3C8FA 1PYMA 2AL1A 1CGVA 2R82A 3AIEA 3PPGA 1MDRA 3S5SA 1K4HA 2VCAA 5DCBA 4WX2A 1S5MA 1R46A 2OMAA 3LCIA 5CJ5A 1WNOA 4D6GA 4IJRA 3FLUA 4PZVA 4DM2A 1R7AA 4K2SA 1KV8A 3HU7A 3LHVA 4W8AA 1DQXA 1I6NA 8XIAA 4TUFA 1GVRA 4FALA 2WNZA 1GYNA 4UTMA 3NXFA 2GGEA 1W56A 4JTFA 2PDWA 3BVJA 3WK3A 1O5XA 4IQLA 1BRLB 4M8UA 5CBBA 1FWIC 3AMGA 3DFPA 1OD0A 4H83A 3CWOX 2ZTKA 3URQA 5DANA 1JVNA 3VIGA 1UOZA 3FSTA 4MKVA 1RVGA 4F9JA 4JY8A 5DXXA 2QULA 3VDGA 5TD4A 3T40A 3O2LA 1P48A 5TQLA 4GIEA 2AAMA 3B04A 4O4WA 3BLEA 2C1IA 1TYGA 4NL1A 1YTEA 5GQBA 1GZ1A 3P67A 4NXSA 3W7QA 3DG6A 4S3CA 4H7ZA 2C13A 2R1NA 3QGVA 3OQEA 2VYOA 2ZE3A 3VDBA 1WV2A 4EAMA 2BVYA 1YXYA 2GYIA 1M6JA 5C6MA 1UWSA 4C6EA 4PMJA 5DMLA 3GXFA 3BGJA 1W9UA 2D22A 4LV9A 2CW6A 3H26A 5A6MA 2ZRYA 2YA2A 1VRXA 2GWGA 1P0EA 2GOUA 2QS8A 4W8BA 3AWNA 4JEQA 3ANYA 3MPGA 3ES7A 1UWAA 3W6LA 1FWFC 1M3UA 1BXCA 3VD7A 3EWYA 4DM1A 1D3HA 3PZQA 3OA3A 1NEYA 1PCKA 3DFHA 2ZUTA 1ITXA 1PXGA 3LPPA 4O0KA 1UB3A 3LGGA 3G1XA 1TZ7A 3G3MA 1VEPA 3PJWA 5D2VA 2O7QA 3W7LA 3GC4A 2ABBA 3NM1A 5A6JA 3AHYA 3L5LA 4I5UA 4KCWA 1UQZA 5LIWX 4F9DA 1JZ2A 2ALRA 1JDAA 1MNSA 2PDNA 3N11A 2QCEA 2CEQA 3REQB 1I2OA 3KRBA 3ABZA 4XD6A 1ITQA 1EJXC 4ZMGA 5DBTA 1U2YA 3TSMA 3IRSA 2ABAA 2XINA 1U1HA 4PFMA 5GJPA 1A5MC 1JZ4A 4A3QA 4B5UA 1BXBA 2WHLA 3F2CA 4P5UA 2AKMA 4GQRA 1BVWA 3L9CA 2TYSA 4D1IA 3MJMA 2I16A 3H23A 3VZYA 1O1ZA 4AD0A 1ICPA 1KW1A 1YBQA 2ISSA 3WSUA 4KETA 5A3HA 4LUSB 5EGRA 1UMLA 4GYPA 4QDWA 2ZUWA 3KL3A 3TSDA 1A5LC 1WP6A 4LBUA 1MUWA 3WK2A 3PPHA 3KLKA 3P5ZA 4TV5A 2OU4A 1BEUA 1I75A 3E02A 4OFCA 3MP5A 2VUNA 1GQIA 4XSLA 1BGGA 2YSWA 3R0KA 1C29A 1R0MA 3VKJA 5AYIA 3I3DA 1J6PA 1J5SA 5ABGA 3RITA 1V6VA 3UZJA 1OBAA 3SCVA 3RGTA 4JKKA 2EG6A 4ZODA 1TB3A 1G4PA 2WC3A 4KIRA 4M7TA 4JQAA 4JICA 3AS2A 4O16A 3EEGA 4N0RA 3AZSA 1EIXA 1KM5A 1S3TC 2PU0A 2WM1A 3RM4A 1BHGA 3VZZA 4QAIA 1UD3A 3MV11 4E6MA 4H2CA 2YCKX 2ON3A 5K2ZA 4A35A 5GPRA 4RZBA 4GYKA 3NL5A 1ZJIA 2PI6A 1A5KC 4K7VA 3NQ6A 4PTVA 1DPMA 2VFDA 5HQMA 4ROQA 3AYRA 2Z25A 1Z41A 2ZXBA 3ITCA 4I9JA 4W9TA 1R3YA 2F6UA 2IKJA 2OGJA 3PUDA 1W9VA 2UZ9A 1XIDA 3N6JA 5CJNA 3NGFA 1F07A 2NUWA 3KL5A 1Q66A 4KH2A 1RK6A 2ZVRA 3LBOA 3I6TA 4BEQA 3DHPA 2P1FA 2D69A 1XRFA 2VCCA 2NXIA 3PSVA 5IHSA 3ARSA 2VKZG 2HXTA 4RL3A 3LTPA 3HURA 1TPC1 1QAPA 3WFZA 4ZOEA 4H6KA 1XGEA 4S3AA 1HKIA 1KM6A 1H7WA 2QV4A 5HPOA 1S2VA 4L1WA 5AYYA 3S1XA 4X2PA 2WSQA 4GY0A 4MM1A 4L4OA 3IJ6A 3DYPA 2DIEA 2YB4A 1CB2A 2E25A 1X98A 1Q6FA 1CWYA 1UKPA 4PMVA 3V4BA 3TQKA 4R88A 3MBFA 4M6UA 4A3YA 3G1HA 3O07A 3RNDA 1SFSA 2J7HA 4WKFA 1TTIA 4S3JA 2DUAA 4E38A 4JX6A 3L66A 5K9DA 3T4WA 4MMWA 5A5WA 4URIA 1CT5A 1X97A 4AVOA 3CL7A 2HMCA 1O1HA 3P82A 1OFBA 3VD9A 3R10A 3W1NA 5EMUA 1UIOA 1KFCA 4UTWA 3N4FA 3AXMA 1WKEA 3L12A 3QYQA 1A0CA 3JS3A 1TVNA 2WZEA 4DWDA 3CAQA 4Y9AA 2R24A 4YJ5A 5IBXC 1LLOA 1VJIA 2ZTJA 4GLEA 2CWNA 3KVJA 4LAZA 4GQGA 1UG6A 1W3JA 4CCZA 3TXVA 1EUNA 4MNMA 4C6CA 1AQMA 1BSIA 3W85A 2VD8A 4JFSA 2PGWA 2OQHA 1V03A 1T0OA 1FHLA 1E1FA 3EPNA 4OECA 1M7PA 4U3CA 1TG7A 2DJXA 2YYTA 1OX6A 2B7NA 3KCJA 2DQXA 1FCQA 1KWKA 3PZNA 2PZ0A 1QMLA 4DJFD 4XD4A 3B8DA 2W5FA 4GUFA 2PTZA 1GT8A 2DSUA 1PIIA 3E12A 1HP4A 2WLYA 1EWEA 1V3IA 3W2MA 3OG3A 3ZO9A 4YTTA 1UR4A 3E0WA 3WMBA 3V7PA 1HZYA 4GABA 2PLMA 1H7PA 3GUGA 3LS9A 1RQHA 1ONWA 3VINA 3CUXA 1ZLPA 2B0MA 1FWJC 3KWSA 1S3HA 2X2GA 1NDZA 1Q13A 4QE1A 3WBYA 3LERA 1Y65A 2BGSA 2G4JA 3VI2A 4DF0A 3NTYA 3U4AA 3AICA 4JTGA 1I60A 2OJPA 5JU6A 3C86A 3EWWA 2Y24A 2Y7FA 4WGXA 3MCMA 2I17A 2WWDA 1ADSA 3BH4A 3HJEA 3OJGA 5J8LA 1YX1A 2XM1A 1TX0A 1QWKA 3N13A 3VA8A 1W1PA 2W79A 2YDQA 4AY1A 3WEMA 3NDZA 4J3TA 2GQ9A 2JALA 3NPXA 1QXLA 3DOPA 1Q4NX 4PRWA 2QLYA 2VX6A 3DUGA 1BSLA 2P76A 3C2VA 3U7VA 4FPSA 1L6WA 3MUAA 1YYAA 3VIOA 4GQ0A 2J8FA 1V0NA 4Q8OA 3NQ2A 1VIZA 3UJFA 3QR0A 4TU1A 1VPXA 1OQFA 5BXSA 1FWWA 4UFHA 4O17A 1GHRA 2G41A 1KKOA 2O56A 4I7UA 1W1TA 3GNOA 3I6RA 1E6RA 3W25A 2Q09A 2BY2A 3ZFHA 1UWQA 2CNCA 1KFKA 3GC5A 4CD4A 1JUEA 4ZB5A 4LY4A 3WLHA 1RP8A 6TIMA 5L6UA 2PLCA 5LA0A 2OZ3A 4OT7A 1J2WA 3HN3A 4DJDC 3KP0A 3URNA 3K4DA 3RRXA 3TTYA 3WK0A 5CZTA 3O05A 3UXKA 4A22A 3WF1A 1ITUA 2NQJA 4HK7A 2YFNA 1R2SA 4UIOA 1AQ0A 3PM6A 4JHZA 1M7OA 3GDTA 2A85A 1JULA 3PPCA 2BV9A 3PUGA 5LXEA 1FRBA 3SRKA 4UXDA 2V38A 1I45A 2NXHA 2RDXA 1PHWA 4BY3A 6XIAA 3RDKA 1UA3A 2RUSA 2X09A 5HMFA 3ZJKA 4R3UA 3SQLA 4QFUA 3BZJA 1DL3A 1ZTVA 1XM3A 1RBOB 3GWQA 2GGIA 1LT8A 4EWND 2I5QA 3TKFA 2FVMA 3TX9A 2ZUSA 2DT1A 1JCYA 1EGVA 1R3VA 4AC7C 4ZOAA 4LAUA 1H41A 4Q4QA 3BV7A 1X1NA 2WO5A 1NOWA 1UUQA 3THUA 1EX1A 4JZ5A 1XICA 3EBVA 2J77A 1DJZA 3TYBA 2QZRA 3BLLA 4MY8A 4C1NB 4XQ6A 2WSRA 1A5AA 4K68A 3TW7A 2A6LA 3AHVA 1V6WA 4MY9A 3JR2A 3UGVA 4AZ5A 1B3WA 2FPVA 4FF7A 3MDUA 4XO6A 1HO4A 4NNBA 2OOFA 1WAWA 5G4HC 4QGCA 5HJYA 5HUOA 1KGXA 3PBUA 1Q6OA 2EPMX 3W7HA 3TC3A 1W3TA 4OIFA 2H3DA 4EXBA 2AMGA 2PUZA 1GK8A 1KB3A 1LCOA 5F1VA 3UXLA 4WSJA 4NT0A 1PKYA 3SO7A 4PMRA 1W8GA 3WQDA 4QEHA 3PTMA 1F6YA 4Y96A 4ADSA 3GXMA 3KEHA 2D0HA 1QHPA 4HN8A 4TX9A 4HYRA 3QQ1A 1L6SA 3D47A 4YTQA 3NL2A 2QXWA 1ZGDA 3G1SA 1KO0A 1PZ0A 2BVDA 2OZ8A 2WMGA 2ZDRA 5K7JA 3FEMA 3EMQA 4MB5A 3QM3A 4LSBA 4CNNA 1QOQA 3AOFA 3HFTA 2XIIA 3UWWA 1CXFA 4NF7A 3RMJA 3QMSA 1JDFA 4QRNA 2QDEA 5BW6A 1HKWA 2GJNA 1HJUA 1UPMB 3JZUA 2INZA 4IX2A 4AZHA 2HBVA 1RD6A 2JKAA 5EMMA 1DKWA 2GGHA 3MSGA 4O1EA 4P7OA 1LTDA 3HO8A 4U4MA 4ENLA 3GW3A 2VC9A 1RJRA 1CTNA 2NQ9A 2GJRA 3TEVA 1P1MA 5DY3A 1ADOA 3CGTA 5ABEA 1YE6A 5A8PA 3FDGA 1R3RA 4QROA 2XSXA 4C6LA 1NP2A 4LT9A 3S1WA 3GG0A 3CXOA 4B5TA 1JCNA 1EA9C 1NWRA 4C65A 4V1YA 3S5YA 2PP3A 4IIBA 4CUCA 3NA8A 1C9WA 2OWWA 2VJXA 3UXIA 4KRUA 1W3HA 4H7VA 2X0YA 2AAAA 3GTIA 4B90A 1EO7A 2R8WA 1W5NA 1E72M 1XW8A 1TR9A 1JUBA 1EGMA 2RFGA 1CGTA 1EJUC 4TVCA 5F2LA 1OG6A 2DSVA 3GFXA 2X05A 2VGGA 3NQVA 1TPDA 1KLYA 3EXSA 3FHQA 1O5RA 2R14A 3B8WA 4Z2HA 1IEVA 1TA3A 2RKXA 1FOBA 4RXFA 4Q8VA 4OUIA 3GBEA 2XIOA 4G5DA 4FLSA 3KX6A 3AIRA 1L8PA 4HZ7A 5BXTA 1V02E 1H1YA 4BQ2A 3EA2A 4EE9A 2ZWZA 4AEEA 2QUTA 2G4FA 1Q63A 1D3GA 5AVNA 3ABQA 2OGYA 4O15A 2ACQA 2PF8A 2GJPA 1D9EA 2G50A 2NT1A 1AW2A 1TPEA 3EA3A 3KAOA 3MMTA 4MJ2A 2A7NA 1D8CA 3V0TA 3II1A 4LBSA 3CL8A 2ISFA 3I7SA 4QCEA 2OLHA 2GL5A 2G3FA 3MHGA 1EDGA 3ARQA 2BZNA 1HUVA 3W7GA 1TUFA 3QPZA 1PJ9A 1TSIA 2DVXA 4IGSA 1UPPA 3TK7A 3M5YA 1PDZA 4ACZB 3FJ6A 2AQWA 4XD3A 3W38A 4DLMA 1SYTA 2XH2A 1ODZA 1R3TA 4EKJA 2O55A 4HTBA 1JD7A 3C56A 3W73A 3QKEA 1Q5MA 3P14A 4JFVA 4L4PA 5CC3A 2R9RA 2XVLA 4L6DA 1KFJA 1KXQA 2AKZA 2J88A 1TV3A 5C54A 2FB3A 4X0VA 3AS1A 1UBSA 4H1ZA 1WBHA 2PS2A 3MKCA 1L8NA 1V3MA 5F2MA 3CPRA 3ABOA 1XFCA 1TV8A 2KZHA 3G1FA 2W66A 2PDBA 1IT0A 3YPIA 2MANA 4D8ZA 3W76A 2CZFA 2H8XA 3DHUA 2R1MA 2PFHA 5LKYA 2EPHA 4MF4A 4Z0SA 1ADDA 3XIMA 1IEIA 4P7RA 1TA3B 3GHTA 3THDA 1EXBA 1YEYA 1Q6RA 5FF3A 4DJFA 1XGDA 3LSBA 4DWSC 1M65A 5K9CA 3GBDA 1ONRA 4GKLA 3MBDA 5CSUA 1MYRA 2RGMA 3W84A 1Z42A 1RLDA 3M5XA 2ZZ6A 2FHBA 3N25A 3VKDA 3GIPA 5LIXX 2ZFAA 1Y5WA 1X38A 6TAAA 4JHMA 1K7EA 2PP1A 5I09A 5CC5A 5FJIA 1TX2A 2BY1A 3RK8A 2E0PA 1QRQA 3K4WA 3LHUA 5FAGA 3W2NA 3GNRA 3TE9A 1GQNA 2CETA 3MSYA 1E73M 2AMXA 3OQ8A 4ORIA 1D8WA 3AU6A 4YVXA 5EMJA 3A5FA 1Q85A 1E55A 4JOMA 1VZWA 4LJ3A 3W7OA 2OSYA 4AWSA 4OE7A 1XYMA 2V0TA 1OFRA 1M68A 4K3ZA 7ENLA 3R7MA 1H11A 4LAMA 1E1CB 4QQ3A 1JPKA 3LDVA 4GOAA 4LEFA 5HWMA 4AISA 3GR4A 4BI7A 3RF9A 3FKRA 4P8VA 1OF8A 2DZWA 1DVJA 3TOYA 2Q3OA 3LUTA 4NJIA 2Y7DA 3QR3A 2I56A 4O19A 3UR5A 3DHDA 1R3WA 1PUDA 4GY7A 3MV01 3S9YA 4LV4A 1K9EA 4LS2A 3RPMA 4YWSA 3SN0A 2WVUA 1PB0A 3WDJA 3B97A 1QW9A 2X0SA 3ANUA 3O6YX 1T41A 3BPWA 2OSXA 2Q3RA 1W2PA 3OHIA 1JGMA 1OF6A 2XU2A 2D24A 1A0EA 4KWOA 1E6SM 2FDMA 3SCNA 1XWYA 5JBDA 3KW3A 1LWIA 5FEPA 4B5XA 4UTHA 3R25A 1XKJA 2YBUA 1QPRA 1X7IA 4QLLA 4LVAA 5D4YA 3TWBA 3PWIA 4GD0A 2GZXA 1NIUA 3SR7A 4L9XA 2AOSA 4P7LA 2YDSA 4Y9OA 4C6FA 5AC8A 2OCZA 2RH9A 3BCFA 3WQOA 2WQDA 3QXBA 3CYVA 5CH9A 2XFWA 1C7SA 4RDYA 1K7XA 1IYXA 1JNEA 4RKAA 1RVKA 3RXZA 4L4MA 1F3WA 5HNTA 2Z2BA 3S5OA 3I3BA 5GVJA 2HVOA 5G2WA 3RR1A 2EBNA 4HOXA 3QPEA 3P62A 1E4NA 5CPSA 4WHBA 4LXFA 4AQLA 3CIWA 3R43A 5AHEA 3W82A 1S2WA 1RCQA 2CPUA 2NV2A 5SWUA 8A3HA 3W7JA 4NI3A 1JPIA 3SUVA 1YDYA 3PAJA 4ZXLA 2Z6JA 1F2JA 3KBNA 4KFOA 1UZ4A 3N3MA 1XP3A 3H4XA 1B3VA 2J13A 3EOUA 4NRSA 4FOJA 1UASA 4MHBA 2BFGA 1XCFA 1AL8A 4Q7NA 3IJLA 4PMDA 3FIGA 4CNUA 3N14A 2P5NA 2VRJA 2VR5A 4A8RA 1ZL1A 2QJGA 1PCWA 1KBBA 1TE1A 4KT2A 1P7TA 5CPQA 1KQYA 3LXBA 4KPLA 4O10A 1RAKA 4HCDA 1NWSA 2CLEA 3QV6A 2XDFA 3GH5A 4IFRA 3WF0A 4RW5A 3O63A 2QDDA 1XC4A 1XYBA 3GW0A 5D02A 4QAWA 2PDUA 3PZ9A 4EVZA 1H60A 1VC4A 2PRHA 4YWIA 1I2PA 5HINA 4OOUA 2FH6A 3ZLFA 3F2BA 5HATA 4C6PA 2QW5A 4U5IA 4XD5A 2X1SA 3SIMA 3T42A 1JYNA 3HQOA 4DPPA 3SEPA 2BY3A 3HFYA 4NQ1A 4JD4A 1W9PA 4A3RA 3R58A 3GR7A 3BANA 4ACZA 1CECA 4CVUA 3H8AA 3SADA 2PAJA 4TMBA 2D73A 5LNVA 1SM9A 4NYYA 3NQ7A 2YZ5A 4HKPA 2ZRVA 3GDBA 3RRAA 2ACSA 3WH8A 1V3JA 4PCFA 4AXNA 5CGMA 3RJXA 3HB9A 1MW0A 1LF1A 1GOOA 2JKPA 1KRBC 4JDYA 1GOKA 3CL6A 4MKSA 5EMKA 2NQHA 1V3HA 4HSOA 4C6BA 4QNWA 3T0DA 2ZA3A 5CZ0A 3I7QA 1XSIA 4RV3A 1MZRA 4GH1A 1CXEA 3AIVA 3C2YA 3ZMRA 1R2TA 4OV4A 2X0HA 3VIIA 4IX0A 3QLLA 3W88A 3UJ2A 1GJWA 3PZOA 1UUMA 3U8GA 2CITA 3UU0A 3W28A 1RALA 1RP9A 5A8NA 4ZR8A 5CGQA 4MAZA 3EDKA 2E77A 3KBVA 4KRTA 2A6NA 3PN8A 3IVTA 5DQPA 3LA4A 4H4IA 3MANA 3PZTA 2E5DA 1BVNP 3LPFA 4AZ6A 2Q02A 3PC0A 2DZTA 3W23A 5T8GA 4R33A 5I3IA 4LQ1A 3OGVA 3DYMA 2ZX5A 4WEVX 2YCLB 4XBKA 1XV8A 3IIOA 1ESWA 3DFYA 4U2ZA 2V5DA 3WLSA 2YGYA 3S1GA 4CU8A 5G2IA 2OT0A 1LG2A 3BWWA 4UB9A 5KEZA 3DC8A 1T96A 2EKCA 2QJHA 3FSUA 1JL8A 2IW0A 4US5D 4AC1X 2XFFA 2V2HA 3AZTA 4MNJA 2HBXA 3CZKA 1CLXA 2QUNA 1X1ZA 1E56A 4A3UA 1IGWA 4O1BA 2PP0A 5D9PA 3L21A 4GI9A 3BOFA 5AC4A 3R8HA 5J5RA 4HHHA 1TCDA 4QJ3B 1DOSA 5AHLA 1XD1A 3HPSA 4TR9A 1OCBA 1OIFA 2PDLA 3N3TA 3VNDA 2JF6A 5EY5A 1TPUA 2YCLA 3B8VA 3K1DA 3CQ0A 3TYEA 5EU9A 4CQ9A 3HMCA 3W07A 1OFAA 3EGJA 4JL1A 3THQA 5LYRA 4KQNA 2FMOA 2E6AA 1EJWC 4FLOA 2PWHA 4FLQA 4LU0A 2TODA 5J04A 1EDQA 1SO5A 5T9BG 3PANA 1L6YA 1U30A 4QCFA 5AHFA 1V93A 3THCA 3ZSTA 3C3UA 2FJUB 3CIVA 1Q6EA 2YZRA 3NO5A 4J3VA 3UR2A 6A3HA 3VIKA 3S2CA 4IP4A 5CZSA 5MKGA 4YHEA 3M9YA 3LZ3A 3W1AA 5ECVA 2FIQA 1NF7A 3BAWA 4Y9NA 4FXSA 1I0DA 2NT0A 4PULA 3NEVA 4LUYA 1XIBA 3VMPA 2WSPA 2G97A 4Z17A 2WZTA 3DKJA 3VKCA 1VFHA 1BWKA 2OEKA 3IRDA 1Z32X 5C5YA 7CGTA 5DCEA 3SY5A 1CGUA 7ODCA 1SR9A 3UVAA 3V0SA 4J3UA 1SZFA 1E4MM 1XISA 3BSHA 1DWFM 4FNSA 3IGSA 5XIMA 1FXPA 2WC7A 4Q8WA 1GONA 1QNVA 2Q8ZA 3IIZA 4JDBA 3HF3A 3ONCA 3FJ4A 3R6IA 4ZQMA 4PMXA 3CQIA 5M03A 3OODA 5BNKA 4DJDA 3VC6A 3E38A 1M41A 1SUXA 3GXNA 5CBJA 2R6OA 3WBWA 3SGUA 4WD0A 3PHAA 2X8RA 1H62A 2VRKA 5FIPA 1T6MA 2XUCA 4JIEA 2V5JA 2J9XA 1X1OA 3TQVA 1J8VA 4PTDA 1CGYA 2FZMA 4MDPA 1JNDA 3CM4A 5HMDA 1XJBA 3IK4A 4W88A 2CHRA 1MW1A 4IIFA 5BWFA 5DMYA 3SRDA 3BTNA 1VIWA 2PLJA 1QUMA 2HXUA 2C16A 4OKDA 4AAJA 1NQKA 1K3UA 1CPUA 2E4TA 2QUUA 3CBWA 2JIWA 3WD2A 4DXKA 1JCXA 2ZRWA 4IFOA 2D3LA 4J28A 1ISVA 1G6CA 5CPLA 4QE5A 4P8WA 1OABA 4DUXA 1F4HA 3HGOA 1U1UA 2E9MA 1UQYA 3L5AA 4QJ1A 4FEZA 4GNVA 3S2LA 2C19A 3B06A 3PPFA 5K3VA 4I90A 1PIFA 1AA1B 1S1RA 3CV1A 3WUFA 3EDFA 4IIGA 1J96A 3ITLA 1F6PA 2IQTA 5FF0A 4GIAA 3NQ8A 3LX9A 2CERA 1V79A 4L4LA 3TONA 1WDWA 2BGNE 3B0XA 4UCGA 1H7RA 3SY1A 3RYSA 1VB9A 3BLOA 1B0IA 1DJNA 4IMFA 3WELA 4Q4SA 1U1JA 4PUMA 4XIMA 4LUTA 3ALGA 3W4RA 3B9AA 3L23A 4PBGA 4OHQA 3EOEA 4PSRA 1OINA 3KHJA