4PMJA

Crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 in complex with nadp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
281
structure length
281
Chain Sequence
MHDPIPTIAFPDGRKVPALGQGTWRMGENRAKTADEVRSLQTGLDLGMTLIDTAEMYGDGAAERIVGEAIKGRRDEAFVVSKVLPSNASRAGTVAACERSLRNLGIDCVDLYLLHWRGGYPLAETVAAFEELKKAGKIRAWGVSNFDVDDMEELSAVPDGGNVAANQVLYNLARRGIEFDLLPRCRAQGVPVMAYSPLDEGRLLHDADLIHIAKAHQATPAQVALAFLKTCSGVISIPKTGSPERARENRDAMDIHLTTENLAELDRHFPPPRRKTRLEVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative oxidoreductase
publication title Crystal structure of a putative oxidoreductase from Sinorhizobiummeliloti 1021 in complex with NADP
rcsb
source organism Rhizobium meliloti
molecule tags Oxidoreductase
total genus 102
structure length 281
sequence length 281
ec nomenclature ec 1.1.1.-:
pdb deposition date 2014-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4pmjA00
3MC5A 2BGQA 3LQGA 2PDMA 3CV6A 1Z9AA 4H8NA 4PMJA 1EF3A 4PRTA 4MHBA 1A80A 1EL3A 3R6IA 2PDKA 3M64A 4PUWA 2PDYA 2PDFA 3V36A 1MZRA 3F7JA 3H7UA 1AH0A 2ACSA 1Q5MA 2FGBA 1VP5A 4ZFCA 2PF8A 3UFYA 3G5EA 2WZTA 3R58A 4JQ1A 2PD5A 4YS1A 1K8CA 2PDGA 5LIYX 4LBSA 2IPFA 3UGRA 3CASA 2PDBA 5JH2A 3LNMA 3UP8A 3P2VA 3WBYA 1MRQA 1ZSXA 1RY0A 4WDTA 3VXGA 3UZWA 1YNPA 3O0KA 3RX3A 3DN5A 3U2CA 2PDHA 4Q7BA 3B3DA 3DOPA 3H4GA 2PDQA 3R94A 4XZNX 4JTDA 1SM9A 3ONBA 1YNQA 2ALRA 3FX4A 3ERPA 2INZA 4DZ5A 5AZ1A 3GHTA 2ACUA 4G5DA 2PD9A 4DBSA 4WEVX 3M4HA 2PDLA 4LB4A 2A79A 5LIKX 3LQLA 4JTRA 2PDJA 3EB3A 3GHSA 2FZ9A 3QKZA 2HDJA 5C7HA 1T40A 4GACA 4PRRA 3C3UA 1GVEA 2BGSA 5JH1A 3ONCA 2NVDA 3N6QA 1PZ1A 3LUTA 4YVXA 4GIEA 3FJNA 1YE6A 1AZ1A 2PDIA 4JIIX 3RX4A 1C9WA 4QXIA 5HNTA 1HQTA 4GQ0A 1OG6A 4JIRA 2J8TA 4RPQA 4IJCA 1RALA 4QX4A 1LWIA 1AH4A 2PDUA 1S2CA 4DBWA 3H7RA 3BCJA 1M9HA 3R8HA 1AFSA 4Q3MA 3G1RA 2HE8A 2R24A 4JTCA 2FVLA 2R9RA 4JQ3A 4WDXA 4QBXA 3V0TA 1Q13A 4WDUA 2BP1A 1ZUAX 4XO6A 4GQGA 1LQAA 2FZDA 4HBKA 4IJRA 4WRHA 1QWKA 2PDPA 2FZ8A 4JQ4A 5LIWX 2PDXA 4DBUA 1S1RA 1HW6A 4OTKA 4LAZA 1MI3A 4GCAA 1PZ0A 5M2FX 1EXBA 2VDGA 4LAUA 1S1PA 3O3RA 3Q67A 1IEIA 3UZXA 3UZZA 1XGDA 2F2KA 2WZMA 3UZYA 2F38A 4NKCA 3LN3A 4YU1A 3GHRA 4XAPA 1Z3NA 4H7CA 4EXAA 4LBRA 2CLPA 2HVNA 1JEZA 4JQAA 1X96A 4L1XA 4XZMX 4GABA 3LZ5A 2IPGA 1PWLA 1XJBA 3D3FA 3UWEA 2I16A 4XK2A 3GUGA 3CAVA 3UG8A 3N2TA 1XF0A 3MB9A 3M0IA 3NTYA 3LBOA 2PDNA 4WDWA 4WGHA 2IKIA 1PWMA 4XVDA 3EAUA 4XZLX 2PZNA 4XO7A 4FALA 3BUVA 1YE4A 3T42A 3V0UA 3WCZA 4FA3A 2IQDA 1EKOA 1X98A 1R38A 2INEA 2DUXA 3BURA 2IKJA 2PFHA 4XZHA 2HVOA 3S3GA 4L1WA 2ACQA 2P5NA 1ADSA 1AZ2A 3WBXA 2IPJA 3R43A 3Q65A 2AGTA 2HEJA 3GHUA 3V35A 2NVCA 2IQ0A 3CV7A 3LENA 4YVVA 1Z8AA 1FRBA 2PDWA 4F40A 4JIHA 4JTQA 3CMFA 2PEVA 1X97A 4AUBA 1RY8A 4PR4A 3LD5A 4EXBA 4FZIA 4ICCX 3RX2A 4PUUA 2HV5A 5HA7A 5LIXX 3WG6A 5DANA 3R7MA 1Z89A 3KRBA 2IS7A 4QR6A 2C91A 2DUZA 2ISFA 3WBWA 1IHIA 1QRQA 1VBJA 4ASTA 2ACRA 2QXWA 4R9OA 3COTA 3CAQA 2IPWA 4JTAA 4XZIA 5AZ0A 4I5XA 1AH3A 4LB3A 5LIUX 1ZQ5A 1UR3M 3EB4A 4FAMA 4HMNA 1PYFA 1J96A 4JQ2A 2PDCA 4YVPA 1S2AA 3BV7A 1US0A 3R8GA 3LZ3A 3V0SA 2I17A 5HNUA 2HE5A 4GA8A 2IKHA 4XVEA 3UYIA 2FZBA 1ZGDA 4IGSA 1T41A 3LEPA 2DV0A 5KETA 2IKGA
chains in the Genus database with same CATH superfamily
1TZ7A 3R89A 3WDHA 4Q7NA 1EFZA 2CZDA 1UD6A 1IIGA 1U5HA 3TKFA 1BTCA 4JOMA 1EP3A 1EWDA 1TTQA 1C8QA 4AC7C 2CLKA 5IM51 2G5WA 1EJTC 4PUEA 3T4CA 4H2HA 3K4WA 5REQA 5C6MA 3LRMA 2ISDA 2OXNA 1F6PA 2F84A 5FJRA 3C4UA 3ZJ8A 3IJ9A 5ABGA 1RCQA 2DZSA 3EEZA 2JKAA 4BWLC 1BQGA 2WLYA 3WYZA 4AZBA 1QK0A 3FS2A 4B2DA 2X1TA 4GI9A 2VC6A 3M5XA 5D8WA 4GH1A 1EDTA 5I2UA 1W1YA 1HX0A 4HU0A 4ZOCA 5EFDA 2EG6A 1XYLA 1FWWA 4ZOBA 5IRPA 2P0OA 1UP2A 8XIMA 3HPXA 1JZ7A 3UP8A 4A05A 1O7AA 1JI1A 5HR6A 2DFAA 3L5MA 5FESA 3UA3A 1J10A 2FGZA 1EPVA 1MMFA 1ONXA 3O0KA 3HQPA 4JEQA 3TC6A 1H5VA 1W3LA 3DN5A 3SUUA 4E8DA 1KLZA 4B5TA 3EOOA 4HSOA 4YIWA 3TYCA 4NI3A 2NT1A 2UY4A 1RA5A 4MNKA 3BDKA 2XTKA 5LA2A 4JICA 4X9SA 4REQB 3B8DA 2BVWA 4V15A 5HJYA 4U31A 1KRAC 4BF5A 1L9WA 2LLEA 3GZAA 2PC4A 3AHVA 4HNTA 4QITA 2PCQA 2DZVA 1TREA 2BASA 3PBUA 4ADTA 4CQBA 4I9AA 4V27A 4A6GA 4ZZ9A 3FEMA 1FWJC 1PZ1A 4HB7A 3GQYA 5I03A 3O63A 3CEPA 4Z17A 1KR0A 4BCEA 1JZ8A 4IUGA 2I7GA 1XYBA 1OD0A 4KEMA 2GPTA 3SFWA 1B54A 4AD5A 1LJYA 3GY1A 4DBDA 4L5ZA 3PZTA 2QCDB 4UOJA 5E70A 4QX4A 1DJQA 1JCYA 4EAMA 2QIIA 2PDUA 5BNKA 5HK4A 3OGSA 4LUIA 2BOEX 1E6PA 1ZBVA 1XBXA 4JQ3A 2VR5A 4AX6A 3N9SA 2G0WA 1Q13A 4HPJA 3TIMA 5E09A 4HSNA 3FYOA 1E6NA 3M9YA 2X42A 6ALDA 3QQ0A 3O6AA 4O14A 5BU9A 5H8PA 4KETA 4DI9A 3PPHA 4PCPA 2CLFA 5EPDA 5ABFB 2OLAA 3TYUA 3SZ8A 1IGWA 1GUVA 3V5FA 2YCEA 3HG5A 4AD4A 3WMLA 4UWMA 4ZXLA 5D09A 1PPIA 2DDXA 4PMOA 3S1VA 1EA0A 2E1DA 4Q22A 2ABAA 4K1GA 4JFWA 3FKKA 4PMQA 1Z3NA 1HN1A 4GMEA 5BYWA 4S3AA 4JQAA 1MVYA 3CHVA 3TMQA 3LZ5A 3AXIA 3PC0A 3KBMA 4AF0B 5LNUA 3FHQA 3UXLA 1J6OA 1RXOB 3OG2A 4QNWA 1SPQA 3QKEA 2OX4A 3GUGA 1M1BA 3IV8A 9CGTA 3I10A 4C6EA 3M0IA 2J8FA 1CGYA 4CNUA 2O92A 1D2KA 2VWTA 4LSBA 4F0LA 2ALDA 2WSPA 3PULA 5AECA 3WMCA 3QGVA 4D6GA 3KRUA 1YE4A 2QJJA 1RBLA 3DC0A 1EEXA 3VM5A 3KBSA 4J3UA 4AIBA 5C9RA 3QYQA 1QVBA 4BR1A 3ZLHA 1EKOA 3VNZA 1EIBA 2QDGA 3EKLA 3W6MA 4JIPA 3H4WA 1FDYA 4RX0A 5CSYA 3SB0A 1ADSA 1XLHA 3W2MA 3EX3A 2AGTA 4PTDA 4PL1A 3U6WA 3CV7A 1HFBA 3S5NA 4O1FA 5I02A 1W1IE 1IIHA 1IEXA 3VINA 4AVNA 3W1AA 2OOFA 4TXEA 1TPVA 1HKMA 3BLEA 4PBGA 1AA1B 3R25A 1TPH1 3MVIA 1OFQA 3H12A 4XZ9A 4CLMA 2YB1A 4XD3A 3WH7A 1A47A 4B16A 1UMLA 1GONA 4RDYA 1WV2A 4PUKA 4NAEA 3KBJA 2ESCA 3UR5A 3W1RA 3SM0A 2VL4A 3W3OA 4EOUA 4UQ9A 4HNNA 4MPKA 2Q8ZA 4MPQA 3WLSA 2V81A 5F2GA 7XIMA 4GY7A 2WYSA 3A3WA 3EKZA 3VO0A 3FV9A 4N9CA 3TK7A 3C0SA 3E5BA 3ABOA 1LM1A 2YKKA 3IEBA 1J96A 2PDCA 1OG0A 3D5HA 4DUOA 3BV7A 3PVFA 1CTNA 1BF2A 3QQ1A 1A5UA 5BOEA 4UTKA 4KT2A 3UWZA 4TX8A 1LRNA 2OWWA 2V2DA 3QN3A 5T26A 4E38A 2VUNA 2A0NA 1KGUA 2PTYA 3CMGA 4P7NA 3UYIA 1MEHA 3L4ZA 2FZBA 3EDDA 3PANA 1GOWA 3GNPA 4YJ5A 4HA1A 3T1GA 4YL2A 3T0BA 4BEUA 1OYBA 4J35A 1HP5A 4H8NA 5JIWA 3L67A 4Q8WA 3G0UA 1OGGA 3UPWA 2QV4A 1XIEA 1CECA 2ZTKA 3O05A 4XIMA 5LNVA 5CC7A 1DHKA 4O19A 3CL7A 3W02A 2QMJA 3MV11 1UR0A 4S3CA 1B3YA 3QMTA 3ZSTA 5DT5A 4D9PA 3TYEA 2E7FA 3ID7A 3KEHA 1JYXA 1DWFM 2YCLB 1EJSC 4DJEA 3F5LA 1GQNA 1NQKA 4UCFA 4ACYA 1G1YA 4QEEA 4Y8FA 1H0GA 1ZB5A 2J78A 2QDDA 5CBJA 2FH8A 1VS1A 3XINA 1OIMA 1ONEA 3TOYA 4AD1A 3NYZA 2GZXA 3BSGA 4N9BA 3CASA 1FP8A 3AMDA 5KMYA 2W3ZA 4PMRA 2R8WA 3ZVHB 2C19A 2WVVB 3QV9A 2OYMA 1F6YA 3EWZA 2ZADA 2ZQ0A 1A49A 3MI6A 4TO8A 3W7IA 3B05A 3M0VA 3CUHA 3DECA 3VD9A 4NZJA 4H8UA 2PDHA 1RCXB 3VOFA 3TN4A 5D02A 4DAFA 2Y4SA 1K4GA 2HS6A 1PVNA 3WJSA 3LBMA 1TJ0A 2VGBA 3PPFA 1TV7A 1IV8A 3FW6A 3PZGA 1P5BA 4DM1A 1LQ2A 3DFYA 1N8IA 1Q66A 4GGHA 3UPMA 2FZ9A 3PM6A 3XISA 4IFOA 3KTCA 4OVXA 3P74A 2R82A 2CXGA 3LHZA 3L0KA 3UBPC 1M5WA 2FHBA 2VGGA 4P7QA 1TCDA 2VZOA 4UTTC 3LUTA 1I4NA 3WJZA 3FJNA 3E3HA 4NI8A 1KA9F 3KWXA 3ZM8A 3GR4A 2BG5A 3KLLA 3PNUA 2WWDA 1A0EA 3S1WA 2YW3A 3HPSA 4KH2A 5D2XA 1RR2A 4BQ5A 1GZJA 2BOGX 1DXFA 4REQA 1OFPA 1TPB1 3KHJA 2UY2A 1Q7QA 1V02A 4HNUA 2RAGA 3N25A 1G4PA 3NL5A 1QI5A 6XIMA 1XLDA 4LGXA 3W7LA 1JPHA 3UJRA 1W2PA 2PP1A 4NJHA 3VPLA 1VFFA 2WNZA 1KKRA 2IUZA 5FSEC 3MKVA 1WKYA 1P0KA 1BKSA 2P88A 4HBKA 4NT0A 3SRKA 3FAXA 4J40A 3G1SA 1S1RA 1CBGA 2VDHA 1EIXA 4GCAA 1J01A 1KFJA 2BV9A 2PE4A 2FLIA 1FXPA 2QCDA 2QUTA 6CGTA 1K70A 1XDMA 3P3BA 1OF8A 1Q6LA 3TA9A 3ZO9A 4A3RA 1J0YA 1B9ZA 2FIQA 3G0SA 6XIAA 3RJXA 3NL6A 5I3FA 5LNWA 5C7VA 2PS2A 4AEEA 4LJ3A 1QI2A 2BTMA 2AKZA 4LBRA 5D8ZA 1UWSA 2J66A 4LU0A 1RP8A 2JKPA 2AAMA 1X96A 1XIDA 2V3FA 5CG7A 1I1XA 3TYAA 1B4KA 1Q8JA 2CLIA 4L56A 1TMQA 1IXQA 3H2OA 1EDGA 3PPCA 4UNKA 2O9OA 4PC8A 2C16A 4PSRA 3NZ1A 3WF2A 5ABFA 3SY1A 3LX9A 5BXPA 4EVZA 4KEVA 1EF2A 4XVDA 3VNJA 1GEHA 4IQDA 3B4UA 3SQLA 1LBFA 3F2BA 4CN6A 4TVUA 3RPTA 5D03A 3ARUA 3M16A 1JXJA 3MHUA 4RPPA 2FB3A 4MIMA 2VELA 1M7JA 3PK7A 5KZ6A 1JZ2A 1BWLA 4L1WA 3TTEA 4XUGA 5DFAA 4BY3A 2OO6A 3ARRA 4U28A 1KCXA 2OPJA 2NVCA 5CZJA 1FWTA 3SGUA 1X38A 4GY1A 3UG3A 5SWUA 3IACA 4FO4A 1L0PA 3IJ7A 1CXEA 1LYXA 2QPSA 5BRPA 2H90A 4KESA 2HVMA 1PX8A 4ADUA 3S2NA 3UWYA 5M03A 3H2CA 1LBLA 5I6SA 3MZ2A 4N9DA 1JF6A 1GOXA 5HXMA 4DJDA 4QLKA 3S47A 2NQLA 5E9AA 4US5A 3T7VA 1P1MA 2P3ZA 3ECQA 1M65A 2P8CA 2CERA 3I65A 4K8EA 5FF3A 4I6VA 3VE7A 3VZYA 1K4HA 2PTWA 3F4DA 4Y9MA 4DQWA 3COTA 2UWFA 2V6AA 2FZNA 3BARA 3IVUA 4QIUA 1EBHA 1OEPA 3P60A 1IEQA 1Q2SA 1ZQ5A 1XDLA 3TN6A 3W25A 4JEJA 3WJWA 4X61A 4WQ6A 1ITUA 3I3BA 1XYFA 1KBIA 1PKNA 2XN1A 3HMJG 3P80A 4DRSA 2Z6IA 1RK5A 2Y5EA 2ZX8A 1ZTVA 3PS7A 5M1TA 4W5ZA 4HHPA 4XVEA 5G5IA 3VTRA 1GVIA 3DHPA 4CVUA 4ZFMA 2NQ5A 4AWEA 1MXSA 3PBVA 4KWUA 3G8RA 5EKYA 1GNXA 1FX6A 4C1NB 3GK0A 2HJPA 2WXDM 4PMJA 4DUVA 4Z2LA 3ME3A 3STGA 4IX2A 3BMWA 4LAKA 1EL3A 1KC7A 1Y5WA 1JCXA 1ZU8A 4PUWA 2E6FA 2PDYA 4RNIA 4Y9NA 3WL0A 3A13A 5FJTA 1W9DM 2GVEA 2O7QA 1CLXA 4FNPA 3UXIA 2NLIA 4JNYA 3R58A 2P1FA 1CI1A 2BMBA 3QY6A 3VM7A 5J04A 3B0UX 1RVGA 5CZSA 1XSIA 3KAOA 3T0CA 1RSCA 4YTQA 2CNCA 5A94A 1BRLA 3NZRA 5DRCA 4OQVA 4RE2A 4GUFA 3UGRA 4NNCA 2EF9A 3VFLA 1DWAM 1KCZA 3NPUA 1OF6A 4JGDA 3WNKA 4MLJA 2X0SA 3WKZA 3W01A 1KBJA 4W4QA 1J6PA 1KGXA 4NF7A 4DY1A 2Z7GA 4GYPA 3EMQA 1IEVA 4HP5A 1Q6CA 3SAZA 5AB3A 3F5JA 1AMYA 2TMDA 4HN8A 4FOUA 3R94A 1LT7A 1I45A 1IF2A 3OZMA 1XYZA 4NJIA 4O0KA 4EANA 3ONBA 3SSJA 1R3SA 5D2WA 5K4ZA 1DV7A 3IV3A 4Z1AA 2YCLA 3DG6A 1XD1A 4HQVA 3PTQA 4D6HA 1H60A 3U48A 3B9EA 1PB0A 2DT1A 3A4JA 3C2EA 1UD5A 2BVDA 3M07A 4O13A 3N2CA 1BAGA 3HGSA 2BWGA 3CQ0A 3H53A 2GDVA 4IIEA 3N3MA 2ZRYA 5D4YA 2OG9A 2HQAA 3GO2A 2Z25A 3ZVHA 1FWEC 1HZYA 5K9DA 1OJXA 4GXPA 1F4AA 1XYCA 4Q6XA 5FEZA 1H0IA 1YKWA 3AHXA 3T78A 3LS9A 3AZTA 3USBA 1I8JA 4XSMA 4IMCA 1HQTA 4XBJA 4GQ0A 1QI0A 4C7FA 3F2DA 4B5XA 2XPKA 5ECUA 7REQA 2VEIA 1UKSA 3LMZA 3GWQA 2WQPA 4IFRA 3R8HA 4AB4A 4GLEA 1E3XA 3OGRA 4YTTA 2EPLX 2HBXA 1IXPA 2BZNA 4WSJA 1Z32X 3TW9A 2Z28A 4IUOA 2YL5A 4CD6A 4AZ7A 2A3AA 4WUIA 2HNEA 4GNJA 1R7OA 1ME7A 1NOFA 2XFFA 1ZAJA 2WVTA 3OJGA 3PR2A 1BFNA 1YX1A 2X7WA 4LBUA 4W84A 1XD0A 4EF8A 2QMKA 3AU6A 1E40A 3ZVIA 3AC0A 1HW6A 1ZPTA 3SCVA 1V6VA 3DERA 5JBFA 3S9YA 1YDNA 4LALA 1GYLA 4PZVA 3T2OA 1NTHA 2Y0FA 4N9EA 3W9ZA 1K3UA 3GVWA 2C3ZA 2RKXA 3A12A 2KX9A 1B3OA 4LQ1A 3NM3A 1NFGA 4I3GA 3LN3A 4YU1A 4XAPA 4HMCA 3N6JA 2CLHA 2QF8A 4ZMGA 2ODOA 1QK2A 1AUSL 3FVDA 4H6RA 1ENUA 3C3NA 2CC0A 2WMKA 4PCSA 3U5YA 2ZRZA 1R8LA 2IPGA 4AD3A 4IIHA 3TX9A 3MU7A 1JYVA 2W0UA 5I78A 4M6PA 2V5DA 2FVMA 2ZRWA 3W07A 1HO1A 2JF7A 3DBNA 3W23A 3SBFA 3ENLA 1KV8A 1XV8A 2JK2A 4PL2A 2Y8VA 4M24A 1EOKA 2VKZG 5LGXA 4L6OA 3G3DA 1VEOA 3XIMA 3DH7A 3B8TA 2FTYA 2V68A 3UERA 2ISSA 3KFTA 2ISWA 2YIHA 4J3TA 5IBXA 1PX4A 4DJDD 4M19A 4MNMA 2XM1A 4US5D 1IGSA 4HPHA 4I6KA 2QCGA 5D38A 3GXPA 3GX9A 3AS0A 4AZGA 1DQXA 1P0BA 2PU0A 4B4FA 5ECVA 4QE1A 4OIFA 3A6OA 3KHDA 1G4SA 4CUCA 3R10A 4IPPA 2X1SA 7TIMA 3R7MA 4C6NA 1Z89A 3FYYA 1JRCA 1TPWA 4Z2KA 2PU1A 2HPMA 3NL3A 1FFRA 3NVTA 1B3XA 4QNEA 3A9BA 3ABRA 3WF0A 4ASTA 3OG3A 1E4LA 2BVTA 1WB0A 3K46A 4C5ZA 2BODX 4IP7A 3IUHA 4XAFA 2BSLA 2GSEA 3STFA 1TR1A 1XIIA 5H8MA 2NT0A 4OWGA 3HZ3A 4JTJA 2Y85A 3N6HA 4M7SA 1AQHA 4O1CA 2EJ1A 4X22A 1J2BA 2HS8A 4KPLA 3IGSA 2F9RA 2W4XA 1BF6A 1US0A 3MTWA 4GINA 4GX8A 5HNNA 3LRKA 3P67A 1XPYA 4U2YA 4GA8A 3QV7A 4AVOA 4C6LA 2PSNA 2JQXA 3TZFA 2OEKA 4PUMA 4NZ3A 2Y70A 4IFKB 5K7JA 3PZ9A 1PKMA 5DCEA 1CXFA 4AWSA 2Y7GA 1VHCA 3BQ6A 3NEHA 3CYJA 2WVUA 3TNBA 4D6JA 4OUIA 1ECQA 1NH6A 2QCHA 4LT9A 2H8XA 3IJ8A 4G6CA 1GOIA 4A29A 3ZZ1A 3PWAA 3BAXA 1D3HA 2YLAA 2Z24A 4LFYA 2DVXA 4IF2A 4TVCA 3IJQA 3PFRA 3RIKA 3MZNA 4L61A 1BXNA 3TONA 3CHEA 1JI2A 2VZUA 4G1KA 1EQPA 3RLHA 1JIBA 1I2PA 4G1NA 1UHVA 3CT7A 3LCFA 4KCUA 2Z1KA 3OP2A 3TWAA 4HNVA 3BAJA 4MJMA 2V2CA 2QJIA 4K2SA 4I90A 3F2CA 1TSIA 3IJ6A 4K36A 3Q4DA 2UY3A 2IPFA 3N2BA 1C8VA 5A8PA 1PZ2A 4UFJA 3LNMA 2XN0A 1JR1A 1AG1O 3IVSA 1QMLA 1L6YA 5HR7A 4C1NA 3Q2DA 3VIGA 2DZXA 4B3LA 1XQKA 3EDEA 5EFFA 3TQ0A 1DIKA 1K9TA 1R9YA 3LRLA 3DFTA 4YHEA 3SO7A 2YYUA 2C15A 3FK4A 4ATWA 1SSGA 4V2XA 3INPA 5FEXA 2WKJA 2INZA 4QDPA 3MYPA 2GVGA 3NQ6A 1W9PA 2PTXA 5CLTA 1L2QA 1CZ1A 4LB4A 1OCQA 1TRIA 5MKGB 1K7EA 1GW1A 1Z6KA 1Z48A 3LDVA 3QLLA 2I5QA 4IIGA 5BW6A 1O12A 4HNCA 4UCGA 3ABSA 3G1VA 3E6EA 1TA3A 1TWSA 1J5TA 4XAYA 4AZ5A 7ODCA 4JTUA 1HKVA 1E6XM 1MZHA 4CD4A 3E0LA 2G8ZA 3ZYZA 1KGWA 3I3DA 4R33A 4IT1A 3FYPA 4FOKA 4S3EA 3C8FA 1XLAA 3C8NA 1BQCA 1Q6GA 3ITCA 3AU2A 3M0YA 3T0AA 1ITXA 4IJCA 2G4JA 2XVPA 4C1KA 4L9YA 3PF3A 3W26A 2QVNA 3LBCA 3GVRA 4EPBC 4WKFA 2OZTA 2VZVA 3SADA 3VU2A 2C1IA 3U7VA 1W1ZA 1CGWA 1EBGA 4RE4A 4QG6A 4LCRA 4Q8VA 3QGKC 1F8MA 4UTJA 3G22A 1E0VA 2GOUA 1EX1A 3AYSA 1B5TA 1HKIA 2YLLA 3P0XA 4IMAA 1NU5A 1GJWA 1HT6A 4ZB0A 1GWJA 3VGEA 2PDPA 3QVQA 4JQ4A 2BXYA 3Q45A 3S6OA 1ZLPA 3CAWA 4OTKA 3NSNA 1D7FA 5BROA 3KL5A 2Z4GA 4RK8A 3PUEA 2DEPA 1SO4A 3CK5A 3PWIA 1XRSA 3M0LA 1B9BA 1IWAA 2PI6A 4H6QA 1JVNA 1PKYA 1XCXA 1UC5A 3M0JA 1Q65A 4JTTA 1U83A 3OGVA 3RPDA 4DNMA 4TV6A 1W9UA 4LXFA 1JEZA 1H41A 4GUJA 3HQNA 3VX0A 3DESA 5TNVA 2YL9A 3W28A 3KE0A 5DCBA 1KWKA 1WXYA 2PGRA 4HMDA 3SUVA 4JIQA 4B4HA 2Q6ZA 1TJRA 3SCSA 1PE1A 2O4MA 5FL0A 3FVMA 2NX9A 4GUIA 1UBSA 3M0ZA 1EH9A 1ISXA 1O60A 2RDWA 2G37A 3R8RA 3NM1A 1YTDA 1MW2A 5CKSA 4ZCWA 4MJZA 8A3HA 2PGFA 3PJUA 2NUWA 2J7GA 3GYCA 1H09A 2I9EA 3WD3A 1V6WA 1LUCB 1M7OA 3GKAA 1KFLA 2QAPA 3LA4A 3N2XA 3B4YA 3N19B 3V35A 5EGRA 3GIPA 2J13A 1GVSA 1K03A 3OZYA 1SUXA 1JFHA 4MNLA 3LGGA 4GWEA 1X6NA 2B7OA 4I5UA 2XVLA 4UNIA 4AUBA 1JCLA 3KOXA 3EDFA 3GD6A 5HBFA 1JXKA 1NP2A 4FLSA 1T0OA 4X0NA 1WDWA 3DXIA 4PTWA 1E3ZA 5JVLA 4H9TA 5T8GA 3E0FA 5FKYA 1PUDA 3WUGA 3MMTA 4KWSA 1VBJA 5LXXA 3DEQA 3ARTA 1JG9A 3BOLA 3W7MA 4MY1A 4CEUC 4JL1A 1HL8A 3A4WA 3DI0A 2DJXA 1A5OC 3RCNA 1JDFA 4L1GA 1ZBCA 2GGEA 5CAKA 2CEQA 5M3WA 1UPPA 2ZOXA 4WXYA 4EF9A 5DX7A 2Y7FA 2V38A 1IQ8A 2NV9A 5HUPA 2C0AA 2JFEX 3LV6A 1E4NA 4CQDA 3THAA 2DP3A 3DG3A 1R3WA 4Q8NA 2AOSA 1VBGA 2IKGA 1ZAIA 8RUCA 4UC5A 2O9TA 2YB4A 5AYZA 1LORA 2C13A 5HPOA 4DVOA 4MHBA 4C6BA 3BG9A 2CKSA 4DJFD 3R6IA 1SZFA 4JHZA 1QOPA 4WOZA 1JYWA 3A23A 3N14A 5D2TA 3QW4B 4OKDA 1UIOA 3T07A 3OEXA 3FJLA 4BQ4A 4UZUA 2ZA3A 2DQXA 3AHZA 1I2OA 4AIUA 3DHDA 1KM1A 4KQNA 5DMLA 1H51A 3VABA 2DW7A 3E49A 1UH2A 2PRLA 4IP5A 5LIYX 2AQVA 1R86A 1UCWA 2RJHA 4B91A 3BICA 2QT3A 5AHNA 4CU6A 4QSHA 5JH2A 3W1LA 2OKOA 5DQPA 4XV0A 2HXUA 3TLQA 1Z41A 1UUOA 1UZDA 3NDYA 3WH9A 4NHVA 1JCJA 3WQOA 5K9CA 4FB7A 3M47A 4OGZA 1XR2A 4L4LA 3ICJA 3PAJA 4E2OA 1RJQA 1LOLA 2H9AB 1XBZA 4FHAA 3WMBA 2XZ7A 2NWRA 3B3DA 3FXYA 3H4GA 3RMEA 3FX4A 3TQPA 3VDGA 2CITA 1LL4A 5T91A 2GL5A 2VYOA 3AS2A 4WEVX 3N4EA 4XQ6A 1XLKA 3CB3A 4LEQA 3W1NA 4KCVA 1VFSA 3WJYA 3DCPA 1O66A 4PFMA 1M68A 2QPXA 1OM0A 3LSCA 2WVSA 4HPGA 4DXXA 1ZHAA 1POKA 2WM0A 2WKGA 1TFVA 1MDRA 2POZA 3HU7A 4RNFA 5FI8A 1C29A 3AYRA 1SZGA 1O1HA 1R30A 1OT2A 2AMGA 5EBUA 1HGWA 3C0JA 3HBLA 4S3JA 3ZLFA 3SGGA 4M1BA 2X41A 4FSAA 2CWNA 4LYRA 5AFDA 3IJIA 3GNNA 1D3GA 1UR1A 3APTA 1GZ1A 4I8DA 4GQBA 4IMDA 1VJSA 1XX1A 2GVJA 3CT2A 4RPQA 4DWSC 4AQLA 2WNNA 1LWIA 4NAFA 5LNSA 3M0MA 1B3VA 1D8CA 5BMWA 4ROPA 2HWGA 1CPUA 2E9BA 2QF7A 4H9YA 5MKGA 2DSZA 4Y96A 4U4MA 1THFD 1W9XA 1J0ZA 3S1XA 2XVGA 3KS5A 2DSWA 1ZY9A 3ITGA 1E1CB 1MYRA 1GVRA 3TJXA 3SY8A 5CPTA 4ICNA 4DX3A 1FH9A 4NXSA 3P0WA 3RM4A 3L5LA 3FNDA 3SRFA 2INFA 3HB9A 4L9ZA 1QNQA 4HOXA 1VIWA 2RFGA 5LIWX 4IMFA 3IJDA 3UZ5A 2QJGA 1R3QA 2ZZ1A 4JTEA 5A1AA 3GG8A 3N29A 3OLIA 1S46A 4IXHA 3UZZA 5A6BD 1PIIA 2A7PA 1XFCA 2WWCA 4V1YA 4WLCA 4R5EA 3GG1A 5D05A 1QW8A 3LERA 3TC7A 2F38A 3VDHA 1GK8A 3GHRA 3U7BA 5EA9A 3BXWA 1ICPA 1HP4A 1QOXA 4KGLA 4HZ8A 4NX0A 1XIJA 3UXKA 1QT1A 1ZBKA 1GG1A 3QRHA 4GABA 1R3VA 3GXNA 1WPCA 1KM5A 1MNZA 2FPTA 2QEZA 3B8WA 3ARQA 3ELFA 3GH4A 3WD4A 1QR7A 1PL9A 1A5BA 1OK4A 3UR7A 4ZXOA 1GVQA 3N2TA 1TMLA 3NTYA 3LBOA 3AXXA 2PWGA 4JYDA 2JBMA 4C7DA 4DYKA 4JTIA 1A3WA 1RV8A 2QUVA 5D9MA 1H1NA 2WW5A 2ZDRA 3WUFA 4AY1A 3OTRA 3A24A 4B92A 4RJEA 3V0UA 3WCZA 5EMKA 1S3TC 5DF0A 3H21A 1XLFA 3CZ8A 2WJDA 7PTDA 1VC4A 1MW1A 3LV5A 4IOTA 4JXCA 3GDTA 1FKXA 4QDMA 1V0LA 4ADSA 1FWNA 4GOAA 2IQTA 2CHRA 1V79A 4PN2A 3C52A 3CJPA 2IQ0A 3ES8A 4Q7IA 1ELSA 3KVKA 1AMKA 3NQ2A 3PZVA 1CIUA 4YMZA 3PP7A 1DQWA 1E51A 1EJ7L 2WCGA 4C5YA 1YQ2A 5H8UA 4JTQA 5BZAA 1MO0A 3PN8A 4D6FA 2J7CA 2WZHA 1UH4A 4F0RA 2W66A 4CNPA 3RO8A 4LANA 4ZO6A 1F73A 4CU8A 2EG8A 1SR0A 4HOZA 4PBEA 5HATA 1BYDA 1PBGA 3KXQA 5HWNA 1LT8A 1UYQA 3G1DA 4O57A 4O1DA 2Z1SA 1A0DA 1JAKA 5DY2A 4XD5A 2I14A 4MB4A 1LUCA 3LCWA 1Q6FA 2Q3RA 3BCFA 3RHGA 2G3FA 3GU1A 5AYXA 3CAQA 4ZSUA 1HVQA 3E2VA 3QGAC 1K02A 1XLBA 1L8PA 3TN3A 4HK7A 1W0MA 2X2YA 3CM4A 3WF4A 1VFUA 1NWTA 1H7WA 1E9IA 3N13A 5LIUX 1UZHA 3C2YA 2FDMA 4F66A 2ZZ4A 3TAOA 1PYFA 4QQ3A 3T4WA 1CGTA 1JPMA 3IARA 1RQEA 3GTHA 1SFJA 2J74A 3H6OA 4DZIA 1J4EA 1HKKA 2D69A 1HGYA 4XBKA 4YTUA 4Y6GA 1RBOB 4HGXA 1UP3A 1CXKA 2ZE0A 4PMNA 4D8AA 2BOFX 4A8NA 4EAYA 3W7JA 3TC3A 1T41A 3ZMRA 1KQZA 1TE6A 4B5NA 2GDUA 1Y5XA 4QE5A 4YWSA 5BCAA 3GS6A 1KXHA 1V3HA 3WLNA 2FDSA 1EF3A 3LPPA 1YIXA 3R79A 1Y5VA 2RGMA 3SY5A 4UQEA 4HA4A 3HURA 1H63A 4X9YA 1V6TA 2OELA 3PZNA 1V3KA 5C55A 2CLOA 4JAWA 5BU6A 1FWHC 4DO7A 3BMVA 3M6DA 1FDJA 3NOYA 3WEZA 2NW0A 4A2RA 1AH0A 1Q4WA 3BGAA 2FGBA 1TELA 3UA4A 1Z7AA 1JQVA 1A5NC 1TCMA 1JD7A 3ARXA 1E0TA 3CWNA 2YBTA 4PEEA 4AC1X 7ENLA 4FNQA 2FFCA 3NZGA 3H22A 2A21A 1GPWA 1P0NA 4MUZA 3ZT5A 4I9MA 4C7GA 1E73M 4JTGA 3NSXA 2OX1A 1QO2A 2Y6ZA 4I9TA 3NO3A 2OZ0A 2Y5JA 2OO0A 1OCBA 4MYXA 3K4AA 2XU2A 2PURA 4LW7A 3UJSA 3M7WA 3GNRA 2G50A 2ZWZA 3UT0A 3PY2A 4RUBA 4MWAB 4Q4SA 3NQVA 1X39A 1JZ3A 3EA1A 3QOMA 3B8VA 2E6YA 1Q4NX 1KD0A 4GG9A 4M1RA 4ZR8A 5I00A 2EJAA 1ZCOA 4GI4A 4AIEA 3QC3A 3UY7A 1KR1A 1QOQA 2ACUA 3GVVA 2OSWA 2D20A 4LX4A 5EMUA 1QHOA 4IG2B 3G8EA 4HCLA 3M4HA 1RK6A 3RR1A 2DZPA 2FPVA 3CB8A 3A5FA 1BVWA 3WN6A 3EB3A 3S46A 4CU7A 1PAMA 4BWLA 5I09A 3GNXA 1V4YA 5HQEA 4HCDA 1OY0A 5TQLA 2ON3A 2VRJA 4ZQRA 3ONCA 5B80A 1NSJA 2Y88A 4QJ3B 4QLJA 3CC1A 4DO6A 1FH7A 4GIEA 5GNXA 4UBPC 1VCFA 5LGZA 3LXCA 3C61A 2ZBTA 4O0QA 2H9AA 3W1XA 4PMYA 2PDIA 1WAWA 3N2MA 2R91A 2C14A 2RGLA 4GIRA 1OX6A 1X7FA 1RALA 3UG5A 1TV5A 1V3LA 4NZFA 1D9EA 1KRMA 2FTWA 3GIYA 3TTSA 1FWAC 1J9YA 4MB3A 3UJ2A 2B0MA 3VNYA 4ML4A 1L2UA 2QJNA 2HE8A 5EMJA 4OUEA 4JCMA 3BG5A 4JTCA 2J8GA 2GVLA 1DWGM 2ONEA 3PZIA 3QJAA 1OCNA 3PTMA 4PB3A 1IWPA 4LVFA 4QRNA 4GE8A 1XI3A 4X2PA 3MJMA 5ABHA 4QAWA 2XH4A 3NQ7A 2VDIA 1EA9C 2OYKA 1U5JA 1XICA 4NSBA 1ZP4A 4DBUA 4QG9A 4WX2A 2BHUA 3UVIA 1QUMA 3AALA 3NQAA 1W8SA 4ZSTA 4GYFA 4HA0A 2YL8A 2R1PA 3VIIA 3MT1A 1IEIA 4JX6A 3RILA 4LYKA 4AHOA 3B0XA 5A95A 1TIWA 2B7QA 5FA5A 4UQCA 3TXZA 2CLMA 2CPUA 4L80A 4EXAA 2DZTA 2REQA 4UZSA 1E71M 1E1CA 3ITXA 1JYNA 4H7VA 3ZQ9A 2NXHA 4KFNA 4N42A 3WQWA 1TTIA 3ABXA 4DPQA 1GHRA 2WOQA 4FR1A 5H1WA 4JY9A 1QASA 4RE3A 3B03A 2I16A 4JL2A 4L65A 1QNSA 3MB9A 1FWFC 2ZA1A 1DJYA 3IIVA 2P76A 1PSCA 1PWMA 2GVYA 1REQA 3EAUA 2YDRA 4MY9A 1K8XA 4XZLX 4PTVA 4CNNA 3RR4A 4FALA 2Q09A 1W1B1 4FK9A 3V16A 3VNMA 4Q33A 1R0MA 4PMUA 3URNA 1AD1A 1ADDA 1X98A 3AIVA 1W3TA 4YYCA 4US6A 1HIZA 4LAMA 5DXYA 1GOOA 2CCRA 1VF8A 3W83A 2HEJA 1PDYA 5G1YA 3NPVA 5K9XA 1DE5A 2BY1A 1N82A 2OODA 1BPLB 2V67A 5FCZA 4RZ5A 1YBQB 3KW3A 3O6DA 2WKLA 3RK8A 2DU2A 4GX9A 4Q4QA 1RJPA 1SFTA 4BKNA 1TWDA 3KRSA 2CWXA 3LD5A 5G1TA 4FZIA 1ISZA 3GRIA 3VNDA 4IPIA 1H49A 1RCOB 5BXSA 2JEQA 2A3HA 1LQ0A 5EBAA 2YL6A 1WAUA 4QR6A 3RO6A 3EXTA 3FGCA 5D2YA 2J6XA 1OB0A 1UMYA 1C8XA 3WK2A 2ACRA 3K8MA 5A8MA 4YCOA 4RDWA 2XFYA 3O6CA 3P93A 2QUUA 1VAHA 3CO8A 5CGTA 4X0VA 1HNYA 1Q6EA 3T08A 2WBGA 1W1A1 4A8LA 1JGIA 1YPXA 3OZOA 3E9AA 4AZ6A 1VCVA 3WH5A 2EHHA 4M6UA 1IXOA 5CH9A 3S8HA 4N6FA 4RDZA 3VCNA 1J12A 2NV2A 2NSXA 4HSHA 3OBKA 5KITA 3CH0A 1Y8BA 1ZBWA 1TYGA 3PZMA 3FA3A 1CCWB 3AXHA 3M7SA 4ZQMA 1XXXA 4Q8PA 8XIAA 1HL2A 3AIRA 4NVTA 4CQ8A 1HXJA 2ZC8A 3SCNA 1QW7A 3QR0A 3SI9A 4ZQCA 3WUEA 3N15A 4AWUA 4BI5A 4BI6A 1DJIA 1KKOA 2GDQA 1RD5A 1MUCA 1MUWA 5K4XA 4ENLA 2X1IA 2CESA 3PWGA 3TH6A 4UFMA 3G5EA 1GOKA 4ACZB 1MFUA 4FPSA 4JCLA 5I0DA 3WZ0E 3E0VA 1RHCA 3ZFHA 1PEZA 3GDBA 4YXGA 4NZ4A 1UW9A 2FFIA 5DO8A 4LF1A 3G1HA 3LXAA 3TROA 2PDBA 3WBYA 3RCYA 3VC6A 1CXIA 2VD9A 2ADAA 3G1YA 4N7QA 3L0NA 4NY2A 1XLLA 1FCQA 3TOPA 4GXMA 1PV8A 3MP4A 2HROA 2FHFA 1UR2A 3VI2A 4MZ1A 2CBJA 3FEQA 1SM9A 2ALRA 3B06A 4NJJA 5JBEA 1W6TA 4WJXA 2VZSA 5A8OA 3LY0A 4G5DA 3MUY1 2PD9A 2OWXA 1XBYA 4M51A 1G6CA 1YPIA 1XCWA 2A79A 4XZWA 3MI3A 1LL7A 3VDAA 6ENLA 2ZZ2A 4U5KA 1DPMA 4M80A 3OODA 4Q8QA 3EWYA 5GJNA 4AIOA 1VR6A 1UR4A 2E67A 4CGTA 1K6WA 1H7OA 3MSYA 2WHJA 2NVDA 3UQNA 4GYPC 5CPSA 3FFSA 3KS6A 4PUDA 5CXPA 3O06A 3UU0A 2PGEA 1R9ZA 3RF9A 4L9XA 1UP0A 5HNTA 4J3SA 3FIGA 4NJKA 1OG6A 1QHPA 2DH3A 2VOMA 4K8GA 1IR1A 1CDGA 5F2IA 4LNYA 2OWCA 2VX4A 4GIYA 2YBUA 4K1WA 3W70A 3G6LA 3RXZA 4W89A 2Y24A 5E9XA 1PJ9A 4H9UA 4Q3MA 1N55A 3WBEA 1OADA 2XIMA 2WMIB 1UWTA 1XLJA 3AXMA 2QCCA 1UQYA 2FVLA 1XC4A 1PCWA 4HOWA 1XBVA 3U9IA 3BJTA 4WDUA 4JDBA 2I56A 3DFOA 1W54A 3HF3A 3AIUA 3GW0A 1S38A 3WLMA 4JN7A 3P14A 1M7PA 4KMQA 3EMZA 1LQAA 2OR2A 3GXDA 3QR3A 4FF7A 4PB5A 3CQIA 1G67A 3S5YA 1H1YA 4LAZA 1KQYA 3KBVA 1MI3A 4K39A 3RGTA 2QJMA 3H7VA 2PF0A 2GJNA 3TYBA 4UTTA 1P7TB 3MO7A 1FDZA 4QROA 2OEJA 2VURA 1IZJA 4HPXA 2V5LA 2QUMA 3RG6A 2CZEA 4JPGA 4UMAA 1UR9A 3GU2A 3GUWA 3LHTA 4K8HA 2W27A 1SZNA 4H7CA 2EPOA 3MP3A 3S9ZA 3QFWA 3F1QA 4L1XA 2XIBA 4DUWA 3W38A 5A2AA 2BGNE 3W53A 5AYBA 4HTYA 3OYXA 4C6OA 1CXHA 2V30A 1R3TA 4L64A 2VGIA 1DTNA 4Z1CA 4QJ4B 2PDNA 4WDWA 4JN6A 4EK7A 4MADA 3HJEA 3WNLA 3G77A 5D9NA 3LNPA 5KTLA 4UFKA 5E6ZA 1QNOA 2Z26A 4YCPA 2PBOA 4KGJA 3TTQA 4UTHA 4K7YA 3G3MA 3PZQA 4DUXA 1XP3A 4GI8A 3WDIA 2INEA 1W1PA 1IWBA 3BURA 3WQCA 4X3ZA 3NA8A 3RN6A 2D73A 3T9PA 4KFOA 1NDZA 4TTUA 1H7PA 1EC9A 1G0CA 3S6DA 3U2ZA 3R43A 4G9PA 5AHMA 1JL8A 9XIMA 2GJRA 4ZE5A 4YVVA 4NU7A 1YEYA 4U3AA 3E38A 2J7BA 1RJRA 1ECEA 3K1GA 3W6YA 3HG2A 1J0IA 1Y65A 4QGCA 1NWSA 2D1ZA 1W37A 5C8BB 3SRDA 5HQMA 3FY1A 1GYMA 3UWWA 4EXQA 3UW6A 3QMSA 2HCVA 4UTWC 1S5WA 2E6AA 4A2SA 2IS7A 3WLJA 3KZSA 3UWQA 1BVNP 3QZ6A 1MDLA 5EMYA 2DUZA 1SYTA 2FTPA 3EZ4A 1F3TA 3L4TA 1AK5A 1B90A 3V1HA 1F7BA 1O68A 2FQIA 3QQWA 3ES7A 3FSTA 3W73A 4Z0JA 4QCFA 1SW3A 3ARPA 1YBQA 3WDPP 3BAWA 4CNTA 2XSBA 3W84A 2CIPA 3POHA 5CG0A 3CV2A 3LI1A 2NQ9A 4BEQA 2QKFA 3GTNA 4GFSA 5KZMA 5IXEA 3DU0A 3WQVA 3KOYA 3MHGA 4W8AA 2XYLA 1CLVA 4H6KA 4PFHA 1TPFA 4HN4A 4RE0A 2HMCA 1JNEA 2WQDA 3AMGA 3U3HA 1WZMA 1H5YA 3CV6A 4C6PA 1TPEA 3TFXA 3ANVA 4FNTA 1UUQA 2E9MA 1KTBA 4F4RA 1A80A 4ZO8A 3M64A 1V6XA 5FOOA 1Q63A 5E5CA 1MZRA 4JS3A 3TE9A 3TCSA 5CJNA 2H6RA 1Q5MA 2FJKA 3UNDA 1C7TA 4ZFCA 2QIWA 5L9FA 4UB9A 4XIAA 1JGMA 1XIHA 3U2OA 1F6KA 2VFIA 4O12A 5T9CE 3LSBA 3SGZA 2VCBA 3EWBX 4J27A 4MMWA 4H01A 4DXVA 3N12A 2Y7EA 2QS8A 1EDQA 2PGWA 2VHLA 2E5DA 2PPGA 3GVQA 3P2VA 1MRQA 1X8CA 4K6AA 1B2YA 4GJ1A 3EA3A 2JGQA 2Z1BA 4ZO7A 4U2ZA 4C65A 2H8ZA 3DDMA 1YLVA 4BQ3A 3AXKA 1DJZA 4Q7BA 1OFEA 3BSHA 4CQAA 4N6EA 4JTDA 4CN4A 3O15A 1XC6A 3CLWA 3PG9A 2DSKA 4MWAD 1J0HA 4JDYA 1EPXA 4DJFC 4ACZA 2BVYA 3CQJA 2RJGA 4BF9A 1JDDA 2C1GA 3C2VA 3NQMA 1JJKA 1JUBA 1WQ5A 3QKZA 4C6IA 1B31A 1NQ6A 1QI4A 3L9CA 3QBUA 2V0TA 3CUJA 3H70A 1VZWA 4UUIA 3HM7A 1CLKA 3PUOA 2WLZA 2V69A 2CLLA 3KVJA 3CIVA 1E6QM 2V82A 3ATZA 3DUGA 4AHPA 1E70M 2V63A 2WC7A 1FWCC 3RX4A 1C9WA 5DY3A 5KINA 2DT2A 1VPXA 3OW1A 4R34A 1S2UA 4TR9A 2G96A 1HKJA 1WP6A 4O52A 3RUBL 4ZOAA 2GQ3A 4DBWA 1PIGA 3PNZA 4LTSA 1AJ2A 4GGBA 3P5YA 3NIYA 1OFDA 2WB5A 2O55A 4FXRA 4UOQA 4RV3A 5E1QA 2J27A 3VDBA 1MW3A 2BDQA 2ICSA 4PRWA 3VOGA 4RNHA 4P7OA 1GCYA 2ZZ6A 4Q4OA 4UOZA 3BOFA 1HF6A 3EOEA 1FWRA 4HCHA 4Z2HA 2E9LA 2ATSA 5A5WA 1LTDA 5C2XA 3WLKX 2AQOA 4W7VA 4O1AA 3S2JA 2B7NA 2WM1A 5I79A 1L6GA 3MSRA 1F76A 2DH2A 2DZBA 1PZ0A 5I3JA 1DIDA 3WH6A 3C2RA 3GKFA 3O3RA 3OA5A 1DORA 2ZX6A 4Y8EA 3KOFA 3EMCA 2YZ5A 1GZGA 4M8UA 5RUBA 1VRDA 1FVPA 5F2MA 3TW6A 1NF0A 4TX9A 4S39A 1BG9A 1JAEA 2AL1A 2WMIA 3KX6A 3V7PA 2CLPA 4OJYA 1SZRA 4HMEA 4HKPA 1VD6A 1DXEA 1XLIA 3AO0A 4LS0A 1V93A 3CAVA 3LGDA 5BRBA 3TYZA 3BAKA 3V3WA 3WQ6A 2D2OA 5AKQA 4ZTYA 3GR8A 1KCLA 4IMEA 1ICSA 3CLMA 1BRLB 1DWJM 4G7EB 5EMLA 4PTMA 1P7TA 1F8IA 4V33A 1GORA 3Q94A 3W82A 5A69A 3T42A 2O7SA 3GBDA 3URBA 3NQEA 2HRWA 1JD9A 1I1WA 4NIRA 3TV8A 4DELA 4B2DD 3WDRA 1SFSA 4E3TA 4G56A 1NARA 4Z2IA 3BJSA 1UWIA 1OZMA 3CL8A 3G1AA 3S3GA 3VKBA 3LHYA 2ACQA 4W86A 3WBXA 2C6QA 3CPRA 5JIPA 4BS0A 2E28A 3C6CA 1NY1A 4J3ZA 4O28A 2CXEA 3VKKA 3IK4A 5GNZA 1NEYA 2PEVA 4MKVA 1W3NA 5CGQA 3I4EA 1FUYA 1JRBA 4J9JA 1I0BA 2GJPA 4JFSA 4B5SA 3SEPA 3RX2A 2B7PA 1O5RA 2EPMX 1R7AA 4WY0B 3RU6A 5HQLA 3KRBA 3C0LA 3HIJA 4XBSA 3MYOA 2EPHA 4GC4A 3VOIA 3PJWA 1G7UA 2BHYA 2PP0A 1XISA 3LCHA 3T6CA 3MUXA 1IT0A 4GVHA 2VEFA 1GGOA 4YLWA 1XFBA 1F3EA 4Y2WA 3ITTA 3MWAA 3AMKA 1GYNA 3WO8A 7REQB 3JZUA 4QFUA 3B9AA 3NWRA 1ODZA 1MUMA 3RRAA 4M7TA 3ABZA 4AY8A 4MYAA 3HQOA 3TVAA 3HTWA 2OLSA 3KBWA 2WC4A 4PMDA 3CGTA 2NUXA 2FPYA 3W7NA 3N2OA 1EO5A 2XVKA 3JZEA 2E8YA 5JUVA 3MMWA 3KDOA 1LLWA 3KRZA 3VE9A 4DB7A 1ZFJA 3TW7A 3UR2A 4ICMA 3R0UA 3KLKA 1XDJA 2VC9A 4GNVA 3MC5A 4AFYA 4DXKA 2YA1A 1EGVA 1MWOA 3GW3A 3T40A 1LRTA 3URQA 4ML9A 3TXVA 3R13A 1F07A 2EAWA 3S9IA 1O5KA 5MF5A 4Y9PA 4E6MA 2IW0A 3MJYA 1E9LA 2VUYA 2J4GA 4ZE4A 1E55A 2E5CA 3KZPA 3WLOA 2C71A 3NPWA 4NXKA 1EGMA 2YCJA 4P8UA 5DN1A 1VP5A 1KM2A 4JQ1A 1D8WA 3LYEA 4ERAA 4C6JA 1QPQA 3B8SA 2O56A 3L4WA 3MHFA 1K8CA 2JIWA 3NXLA 1W9VA 5HWJA 3VGFA 1P0DA 2PDGA 1FXQA 4MB1A 1TVLA 3WFZA 4C6CA 3DFNA 3EX2A 3RCMA 4B9YA 1FCBA 3K13A 2H3BA 1ZSXA 2XFWA 4O4WA 4JX5A 3F03K 3BLDA 1ZS2A 4R27A 1DHPA 2VFEA 1DWIM 4XD4A 3ZR6A 2ZVRA 5K3VA 3GXFA 1VPQA 4PGLA 2I1OA 4FNRA 3LXBA 3AI0A 2OU4A 3D0CA 1XYAA 2XGZA 4CNOA 1WKDA 3Q37A 2PWEA 2OTDA 1TJPA 3W72A 3VIMA 4JKKA 3GE7A 2ZZ7A 4JTRA 1CW2A 1GVOA 1PDZA 4GK8A 3N4AA 1EGZA 2W5FA 1T40A 1XLCA 4FXSA 4O1EA 2TPSA 5JH1A 2VX5A 3AQUA 3EPMA 4A8RA 2BBFA 2VVNA 1C8YA 1XG4A 3ZJ6A 3FOKA 3QPEA 3NR0A 1J8VA 1S5MA 1XIFA 4BZYA 1XQLA 1WDRA 5E0FA 3VGDA 1R3RA 5DMNA 1ONWA 5CSSA 1P4CA 3BLFA 4NG3A 1SVDA 2FVKA 4BJHA 3U4AA 5I3HA 1GTHA 2VM8A 3EOLA 2J8TA 2GWNA 1A5AA 2ZRXA 3OHIA 3DX5A 1MFVA 1WO2A 1AH4A 4HJFA 1BVZA 3OQEA 2VTFA 3IRSA 3ATYA 2FZMA 2XN2A 3GXMA 1AQ0A 4PODA 4TX6A 1DKWA 3L4VA 4DWSB 3BQ5A 5B7YA 2OQLA 2J9YA 4WF7A 3W87A 1X6LA 5U7SA 1C9DA 2A3CA 2FZDA 1NOWA 3P5ZA 3STPA 1QWKA 1QHZA 1Q85A 4UFIA 7A3HA 1PYMA 1GQLA 1XGEA 3NL2A 1XSJA 5M17A 3NZPA 3S0CA 4ZO9A 3OVGA 5H2ZA 3UZXA 3KCJA 1DJHA 4GYKA 4Z2GA 2VMFA 1RBAA 1AODA 2F2KA 5IDZA 2WZMA 2P0IA 2DZWA 1P0EA 4UMBA 3RM8A 3HJZA 1S39A 1A0CA 3GFZA 3L2IA 2E0PA 3O8AA 3MP5A 1EZ2A 4XWUA 5FL1A 2YA0A 3VZZA 2GSJA 1TG7A 2X2GA 3M5YA 3ITOA 5TF0A 2D24A 2CBUA 2R6OA 5A6KA 3GU9A 3QYSA 2OYLA 4LWWA 4E4PA 3SN4A 1PZ3A 3QHOA 3EPOA 4Q8UA 4JTSA 1RLCL 2QVHA 1JFXA 2POTA 1A4MA 3HV8A 4GUHA 2XFRA 4JIEA 1OX4B 4LY4A 2HK1A 2QUNA 4D71A 1H11A 4DJED 2XGIA 4AYSA 2JEPA 4FA3A 3OU8A 3VGBA 4D72A 3LTSA 1NF7A 2E1WA 1W31A 2DUXA 2UV8G 3ITVA 3U5UA 1V3MA 5AN7A 2Y63A 3FAWA 1NDVA 4C6FA 4ZQOA 5EB8A 1AZ2A 3AWNA 1NELA 3EX1A 1EC7A 1OGSA 3NQGA 4CCDA 1NWRA 4M6QA 4ERGA 3DYMA 4GZ7A 2OQYA 5FJIA 3N4FA 3PZUA 4G7EA 4GO8A 2W62A 3T09A 5DANA 4YWIA 2YYTA 1TA3B 1XCFA 2Y5SA 3PBMA 5A6JA 1BD0A 1QI3A 1RPKA 3VOJA 2X05A 4QEHA 3AHTA 2WJFA 4IXXA 3GG7A 3WEOA 5TBOA 4UTFA 2JE8A 5CPNA 3BG3A 4BHYA 1TJ2A 2RUSA 4R9OA 1OYCA 3GFYA 3K8LA 2C0HA 3ANUA 1P6BA 4GKTA 3S2LA 3KVLA 1H50A 4AD0A 2YOCA 1QXLA 1HJVA 1VYSX 5A8GA 3NAVA 5A6TC 3OO2A 3CV1A 3BZJA 3EWDA 3FA5A 1WKEA 1AJ0A 4IZGA 1EHNA 4XD6A 1A50A 2PA6A 2DSVA 2I17A 4D1IA 1IE7C 2RDUA 3QR1A 4NX5A 4WY0A 1K7XA 1X1OA 2O9RA 4R3UA 1P6WA 4L6DA 1F61A 3MANA 4FP1A 3FXGA 2DV0A 3KCOA 2PWDA 2OJPA 3LTYA 1G9HA 1U1HA 2D0GA 3M1ZA 3TQVA 4U5IA 3WLTA 1A4LA 3GC2A 3NDOA 4A21A 1XS2A 4MKNA 3FHAA 4FR6A 2TYSA 1KFEA 2NXIA 4AG0A 4DM2A 4AZCB 2CLEA 3W37A 3GC4A 4GQQA 1U2YA 5DMMA 2VOTA 2VZTA 3AJ7A 2DORA 2PDFA 3V36A 2VCAA 2FGLA 2KZHA 4OZOA 2BXVA 1W5QA 1PIFA 3QHMA 2ACSA 2DT0A 3TA6A 2XM2A 5FF7A 1JDAA 3EBVA 4EIVA 1F05A 3RLVA 1TV8A 4J1OA 1TV2A 3FJ6A 4RW5A 4DLFA 5LA1A 3WD0A 1R85A 3EGJA 4CVWA 1MXDA 1J18A 2Y61A 4S3FA 5CLWA 1YPFA 3ZJ7A 1O94A 1DL3A 1GKRA 2W6RA 2EO7A 4MUPA 4HT3A 4D8LA 5LNRA 4ZQPA 1BWKA 1O1ZA 3VNLA 1WBHA 1XWYA 3E2RA 3MUZ1 4LUYA 2YDQA 2X7VA 3AAMA 3AMLA 1KBLA 3TJIA 3JRKA 7TAAA 3EB2A 1H7XA 1YMYA 4W8LA 2DIJA 4PUJA 5AZ1A 5IHRA 1RH9A 4GZEA 2NVAA 2A7RA 4MAZA 3V1PA 4MJ2A 1XLEA 1KO0A 1VEMA 1YXYA 4WR3A 4S3GA 4OT7A 3LLDA 1TX0A 6REQB 4WJEA 5DRIA 4FOJA 3UXDA 4DZHA 2BGSA 2ZX5A 2PWFA 1BLIA 1QCWA 5FF4A 5FF0A 5I7GA 4EX4A 3JW7A 3M0KA 2WCSA 3SRHA 1E9ZB 1I2RA 4BFAA 1JUEA 3UCCA 2WMJA 4Q4KA 1DWHM 2PZ0A 1CYGA 3SECA 4JIIX 4DZAA 1I6NA 2E25A 4QXIA 2WPBA 4P2VA 5GNYA 1CB7B 4FEZA 1H7NA 3CEUA 5E0CA 1J11A 1B57A 3EEGA 1UR8A 2JALA 1QAPA 2OKTA 3URAA 1U1JA 3W7PA 2X0YA 2R24A 2AAAA 4AXNA 1R6WA 3MMDA 1LWJA 3HA1A 1AW2A 4HU8A 3PSWA 1GJUA 4O15A 4LAOA 3V5CA 3ITLA 4AWTA 4UR7A 3AOFA 4RL3A 3BWWA 1ZUAX 4GQGA 3DYOA 1LZOA 3VVGA 3WF1A 4K3ZA 4O17A 3L12A 4C6QA 3L66A 2W91A 2X8RA 4PMXA 2D2JA 3KL0A 2DJLA 2PDXA 4WXZA 1LBMA 3VIOA 1TUFA 3POCA 3VMNA 1KV5A 5E6YA 1C92A 5I3GA 2ISVA 2HSAA 1D3CA 3DFHA 1VB9A 2BX7A 1Q6OA 4GUGA 5AC5A 1XGDA 2RH9A 1NP0A 2PLMA 4W7UA 1F9CA 3LCGA 5FIPA 5GJPA 1UQZA 1Z42A 2VXNA 2GK1B 1ME8A 3LM7A 3NQFA 1UD4A 3BO9A 4R7JA 4DWSA 3OOQA 1YRRA 1F4HA 4QE4A 2VGFA 4S38A 1G01A 3VUSA 2TAAA 3IRDA 1TPC1 3GH5A 4HHHA 1ZALA 2A3LA 3S5OA 1W2VA 3S4TA 2E68A 5JU6A 3K8KA 1QW9A 3TLLA 3WQ8A 2GUBA 1QDSA 4LUSB 3I7QA 2IKIA 4W5UA 3BLKA 2X16A 4JHMA 5AVHA 5LZLA 1FWIC 3PBGA 5M5DA 4PEKA 3IGHX 3KTXA 3N73A 4NQ1A 3W1MA 2J25A 4JYEA 2W63A 3QV6A 2BS9A 4HZMA 6PTDA 3RJYA 4GZIA 1SU5A 2X0HA 4CQ9A 2OGYA 2PUZA 3B9OA 3BGGA 3QPZA 4XX6A 2QDHA 3VIPA 1W1VA 3VUPA 3VKAA 1TPUA 5DELA 4Z1YA 3MKKA 3HQ1A 3ZS4A 4U10A 5KZEA 1XRTA 1RAKA 2Z0IA 1Z8AA 3IAQA 2VP8A 3NO1A 3W7OA 4ZA0A 2A1YA 1L6WA 4RXGA 5DLCA 1G4TA 2J7FA 1JQXA 3ARSA 4LS1A 4WK9A 4FIRA 3APGA 4FXJA 4F9DA 3WLIA 5C5YA 2HV5A 2PLJA 1OX4A 4FLOA 1KRBC 3HPAA 1AQFA 2VX7A 3RFAA 1NWUA 1ZJHA 4W93A 1TR9A 3WBWA 3CU2A 3E1F1 1V7YA 3MSGA 4N4PA 4JTKA 3H24A 5G4HC 5XINA 2O0TA 2VFGA 4JTAA 4I5XA 3TEVA 2Z2BA 4XKYB 4L7ZA 1K9DA 1M7XA 4FAMA 3T2PA 1E6ZA 4NAFB 2WCAA 3VGHA 3UPBA 4JX4A 5C71A 3UXAA 1Z44A 4XTDA 1DOSA 1A5KC 2VEKA 1GW9A 1K9EA 3TCEA 2Y7DA 4WCJA 3QEZA 3MBDA 3ZJKA 3WQ4A 1JCTA 2R14A 3QLDA 5AC6A 1FCUA 1VYPX 2R1MA 1ZGDA 1P43A 3S1UA 3AUJA 2A6NA 1C91A 1TO3A 4UMCA 4UTUA 4TIMA 3B0PA 2WSKA 1TQXA 2G3IA 2VFFA 3LG3A 4PRTA 1KFCA 5H91A 3MUCA 3OHMB 1US2A 3FKRA 5AVNA 2DIKA 3GC5A 5FF2A 1C7SA 3R11A 4EPKA 2DGAA 3E96A 1NDYA 5TIMA 1VPYA 2EKGA 2V3GA 3S5ZA 3WIJA 3MO4A 4JNMA 4F0SA 4MFEA 1FOBA 1YDYA 4O0ZA 4I7UA 2PF8A 4C91A 2CYGA 3CQKA 4ATLA 1DTUA 1E1EA 2Y1HA 1XM3A 3EPNA 2YGYA 1OFAA 2F6XA 5CQ1A 2J9XA 2DSUA 3UYCA 4TMCA 4F79A 4J2PA 4IIFA 1OC5A 3T8QA 3E0WA 4MLRA 3FCPA 3IPWA 2F7FA 3WNNA 4HD5A 1SO3A 3R1ZA 3PJTA 1BTMA 4Q4PA 4WDTA 4XB3A 4JHOA 3TAKA 1YNPA 1XRVA 2DIEA 3CUIA 4EKJA 3B9NA 4AZCA 2UZ9A 3NYDA 3I6EA 4YPJA 3F4WA 2H3DA 4XZNX 5XIAA 2OZ3A 3VX1A 5LSMA 2I9UA 2P10A 1LG2A 4MFDA 1S2TA 1BYAA 1UG6A 3M41A 4EE9A 4DBSA 1VEPA 2BFGA 3I7RA 3WLHA 1T8XA 2V8ZA 3NG3A 4LVBA 4I7VA 5LIKX 1B4EA 4K7VA 4L4MA 1H61A 2HDJA 4FXFA 4GACA 4QG8A 3W7EA 3C3UA 1SJCA 4QS6A 1W3HA 3LI0A 3ZR5A 2OMAA 3EDJA 1OT1A 3SSZA 3MCOA 1U30A 5LHEA 1X1ZA 3LHUA 3O9NA 2VC7A 1BYBA 2ZXBA 2WSRA 4K38A 1ME9A 5HJLA 2I5IA 3VCCA 1U1UA 4O8RA 4ZQNA 4M81A 1XUUA 2J62A 1AZ1A 2QR6A 2ANUA 2ZUUA 4PMVA 1P48A 1T7LA 1SFLA 2D23A 1C3FA 4D1JA 4F2TA 2Z6JA 3VIKA 3OVQA 4M5PA 2CW6A 4AEOA 4JIRA 3WNOA 2V9DA 4Z1DA 1OC6A 3W1UA 3W2NA 4FI4A 4M56A 4GZJA 3N11A 5HJXA 1VBHA 4B90A 4MY8A 3G1RA 3KVMA 3SUTA 4O18A 2OCZA 1ISVA 2F2HA 4DYEA 6REQA 3DZ1A 4POCA 1VCGA 2R9RA 2OSYA 4WDXA 4D6DA 2GUUA 4MWAC 3V0TA 3K30A 3BZGA 2AMXA 4B5UA 3VOHA 1JULA 1NJJA 3BOXA 4O10A 3NNTA 4A3QA 1CNVA 4UTIA 1LP6A 3II1A 2VX6A 5U4NA 4U3CA 3WH8A 4S3KA 1GEQA 4DWSD 3DGRA 5I77A 1W3IA 1KM3A 1DE6A 3W2UA 2VO5A 2FHCA 5FAGA 4DF2A 2RDTA 1BSLA 4EACA 1M6JA 5B7ZA 4RCXA 1PTDA 1WCGA 3H2AA 5M2FX 1PHQA 4OU1A 3WF3A 4H19A 4BI7A 4AYGA 3T55A 2VRQA 1B30A 1TTJA 3LPGA 4GBDA 2VEGA 3VIJA 3PTDA 2E4TA 1WXZA 3S1GA 3THQA 4B3KA 2GQAA 1E6SM 3HGOA 5HNRA 3Q58A 4KRTA 2ZUVA 2G97A 2B81A 2EPNA 1YXDA 2A2IA 5C2CA 1UD3A 3W88A 1AW5A 4GFIA 4Z2JA 1N2VA 4MVAA 3L2MA 3H2NA 3UGVA 5XIMA 4I8YA 3CBWA 1XJBA 4P7LA 1V0NA 2YJQA 3UG8A 5F4WA 5C70A 3A3XA 2X30A 2GJLA 2VEMA 1GG0A 3H2FA 4WGHA 1KXVA 2PRHA 1MEIA 1TQJA 1UJQA 4H9XA 2VWSA 1JZ5A 1EUAA 5CPOA 3PB0A 1VBUA 5A6MA 2YR1A 3DC8A 3LLFA 3L23A 4CN1A 3W75A 1FQ0A 1R2RA 2I57A 2IQDA 2GK1A 3DHFA 1WOAA 4E5TA 4KCTA 4OOZA 1KBBA 3WDQA 2PFHA 2VEPA 1V77A 2ZX9A 3OIXA 4ZTXA 3H55A 3U4FA 4ZB5A 3G6MA 3S42A 3HG3A 1HTIA 1V6UA 3M46A 4KERA 1WKFA 3CIWA 4L6HA 3UZJA 1SMAA 4GVIA 1FWGC 1W17A 3SCPA 3CO4A 4HYRA 3ALFA 3VMOA 4AZIA 3B9DA 1RQBA 4LUSA 4PR4A 4GNKB 4EP8C 1E72M 1ZJBA 1YW1A 5IDIA 4PUUA 2P50A 1F5ZA 3ZXWA 1VYRA 1XKJA 4JFTA 1FWBC 5GVJA 2ZE3A 4DPPA 3CZKA 1KXQA 4AAJA 5BMXA 2XZ9A 4RZ4A 2R1LA 1QNVA 1V8EA 3MDUA 1EJRC 1ALDA 1W8GA 3TZNA 4IH3A 3IIXA 4OBSA 1SMDA 4RKAA 2ZRVA 3LLXA 4NILA 1B1YA 2DVTA 3MI2A 4DN1A 2PLKA 3BV4A 1Q7ZA 4JKLA 1GPFA 2QZRA 2YX0A 3W2JA 3EB4A 1EUNA 2X1RA 2WZIA 6A3HA 1ML1A 4MTVA 4H8HA 4YYFA 3PSVA 1M41A 1QO5A 4X63A 3VK5A 3WQGA 3GTXA 4HYVA 1UOZA 3GNOA 3W4RA 5HNUA 1XW8A 2HE5A 3K1DA 1WYIA 4M3PA 1Q45A 4HHMA 3A4XA 2QW5A 3L4UA 2EG7A 2Z27A 2ZIDA 2JKEA 2QCNA 4UQDA 3ZIZA 5FEPA 1YDOA 2PC8A 2PDMA 3NEVA 5JMUA 5I5RA 3BW2A 3WENA 3UNTA 1HO4A 2W79A 4M6VA 3O16A 3H4XA 4P8VA 3TTOA 4XKYA 3S2CA 4H2CA 4CKQA 2ZUMA 3H7UA 1TWWA 1T8QA 4AF0A 1FHUA 4AEFA 3P61A 2OVLA 3FN9A 4GO9A 2GGHA 2XIJA 1S5VA 3UFYA 3SN1A 3M5ZA 4BQ2A 5CJ5A 4H9VA 2REQB 3MQTA 4S3BA 5C9WA 3BE7A 4O1BA 2R1KA 1JPIA 3PFMA 1Y7VA 5K2ZA 1AQMA 2E77A 1L6SA 3MPGA 3P84A 1UBPC 3N18A 2QCEA 5C9ZA 3WUBA 1XL9A 2WV8A 1K6AA 2ZWYA 3N04A 5D33A 4YTSA 4LV4A 4QP0A 2G3MA 2A3BA 1H1ZA 1WXJA 1EZWA 5ENLA 3BANA 4JYFA 3V5OA 2JGYA 1OFOA 3U2CA 3HFYA 1Q3NA 4RDVA 5I23A 3IUDA 1REQB 1WZKA 2QGHA 4J4KA 3O07A 3DOPA 4FX7A 5CCZA 5HWMA 2FYMA 4TVDA 3TP4A 2J88A 4M29A 4FF5A 4IGMA 1DP0A 1S5TA 5FAJA 3PPGA 4J7RA 3FSUA 3F4VA 3NJ3A 4XTIA 3WL1A 1SR9A 3PBYA 2O4QA 1IT7A 1EYEA 5CAHA 2QAFA 1OBAA 3W7CA 3RLUA 3GDMA 4LV9A 5LA0A 3SQSA 3A21A 4F0MA 4Q4RA 2V5CA 4IL2A 1DJNA 2J47A 2A4AA 2CHOA 3EX6A 1UA7A 3W1QA 2OFJA 3TNOA 3KM8A 1P6CA 4XAGA 1EJUC 1W5PA 3EWWA 1PO9A 2EBNA 1KWGA 1SJAA 3BVJA 1S5NA 2B4GA 3QY7A 2NXGA 3DBPA 1YE6A 2OT0A 4HNLA 4R85A 1KB3A 4KKXA 1VBRA 5LXEA 5CZKA 3IGUA 3K4DA 4MNJA 4UTLA 1PTGA 3LCLA 3FGCB 3PB2A 1V7AA 4UFLA 3QF0A 4L4PA 3GNDA 1G7VA 3H7RA 5DCDA 1ZCCA 4NZ5A 3BCJA 5I24A 2GQ9A 1LLOA 1FTXA 1BEUA 3W1TA 1FWSA 2RHGA 5G1MA 3LPOA 2XHYA 2Z2AA 4CD8A 2C79A 4FMVA 4Y9OA 4HJWA 2V5JA 5G4EA 1GKPA 2BP1A 1GQIA 3SIMA 4QJ1A 5CC5A 4XO6A 4ZVJA 3M0XA 4JZ5A 4TV5A 4WRHA 3NSMA 3WK0A 3NZQA 4BF7A 3VNIA 3THDA 4E4UA 3HMCA 4D6EA 1X6UA 4R9XA 1TX2A 5KEZA 2DY3A 1BYCA 1FH8A 4GHRA 4GIAA 5A6SA 1OFRA 2QHAA 1RD6A 3AUOA 1FBAA 1SSDA 5HMDA 2V5BA 5LYRA 1F74A 3AROA 4Q6JA 2XWEA 4WKAA 1YTKA 1V51A 2E40A 5L6UA 3U2EA 3W1PA 1E56A 1MXGA 1WUFA 2KAUC 3ARVA 4XZMX 4DO4A 1CGVA 1ISWA 4GY0A 2XDFA 3MV01 1I0DA 5C2GA 3UG4A 4A3UA 5CC3A 3DIPA 3D3FA 1KW1A 4Q4MA 4XK2A 2WVVA 3HG4A 3KCLA 4MB5A 4LC6A 4HYWA 2F6UA 3WFAA 4LF2A 3TR2A 4CD7A 4RZBA 2X1UA 4XO7A 4PCTA 3BUVA 4MWAE 5I3IA 4IISA 3H23A 1TWZA 5J8LA 2QJHA 3BW4A 3THUA 3QTPA 2FJUB 2GUYA 4MJ4A 1BG4A 5AC7A 4AD2A 4JTHA 3GDRA 1T5AA 1CWYA 3IIOA 3OB8A 3QSRA 4HU3A 2HVOA 3C2FA 3N17A 3BLIA 1IXNA 4FIQA 1MNSA 2YCKX 3Q65A 1GHSA 2V3EA 3GAYA 4FNSA 1OINA 3SQMA 2ZA2A 4UTMA 2YCIX 4IWWA 1OFBA 4F40A 4UR8A 1VFHA 4RR4A 5EU9A 4F2BA 5CC6A 2NQJA 3CZGA 1QPRA 2Y8UA 1YXCA 2XG9A 3JU2A 3HGRA 5I3DA 1XUZA 5DEZA 1U5VA 2GWGA 4WSHA 4NJGA 5AHEA 3QW3A 5GJMA 1G94A 5HA7A 2O9PA 1HG3A 5CPLA 4OFCA 1WX0A 3N34A 2C91A 3MUIA 4CCZA 4E3VA 1UPMB 2A6LA 4LYQA 2XIIA 3PUGA 1O4UA 4OV4A 1VRXA 2PODA 1QWGA 4Z42C 5C0QA 1BXCA 2BHZA 2G41A 2ATMA 5IFPA 3LCXA 3BTNA 4DJEC 3S2MA 5AYIA 2Y2WA 4H1ZA 1EEPA 3P8JA 1RA0A 2PBGA 3I4KA 4Q32A 4QJ5B 4MG4A 1TRDA 1CX9A 1OC7A 4UIOA 3USZA 3SR7A 1PCKA 2ZXAA 4WY0F 3NDZA 1IR2A 3OIHA 3BL3A 3V0SA 4WZHA 1M53A 1YYAA 2OOGA 5I06A 2AQWA 5C9UA 5A6LA 3FJ4A 4IIDA 4LVAA 1R2SA 2OZ8A 3NQDA 3M6YA 3AIEA 5TAOA 4IM4A 2YXGA 2Q71A 2NSOA 1ZP3A 4UTWA 4HU4A 1V03A 2P8BA 4NASA 3EYPA 2DQWA 1SO6A 3EDKA 4PBFA 3U57A 3KBNA 2PDKA 4OHQA 4KCWA 3G24A 3F7JA 4H00A 3J7HA 4D6CA 3WQ5A 1LWHA 3K2GA 4WHBA 5CJMA 4FS9A 2YXXA 1ESWA 4E2BA 4A4AA 4YS1A 3W7KA 1QPNA 1W9BM 5G4WA 3W22A 4F0HA 5LKYA 4IP4A 4TU1A 1GVYA 1M3UA 4N02A 1UWRA 1C93A 3P7YA 3BAIA 2D0HA 3RMJA 2DVUA 1XSKA 3ARWA 4ORMA 4Q8MA 2EKCA 3SURA 3VILA 3UCDA 4GJIA 2QCLA 2XIQA 3AS3A 1YNYA 3SUWA 3E0IA 3DENA 1RUSA 2ZZ5A 4MAVA 4GD0A 3RYSA 4DZ5A 4WGXA 3VZXA 4E8CA 2NUYA 4CCEA 1E0UA 5FJJA 1W91A 1WDDA 1H62A 3C56A 1FP9A 4H04A 4KFPA 4DWDA 1W3KA 1WE5A 1TVPA 2DPEA 3WD1A 5AOUA 2ZKMX 4F9JA 2WBKA 2GQ8A 2PMQA 3E02A 4HNOA 3REQB 3NVDA 5HPCA 3STCA 3RLGA 2D2HA 1FWDC 3T05A 3DG7A 3O1NA 1S2VA 3GFXA 1GKQA 2TODA 2CHNA 4C6DA 3SCTA 2XUCA 2FMOA 3AYVA 1XPGA 4QSFA 5HMSA 3HGJA 3ANYA 1ICQA 2VJXA 4D2JA 8TIMA 4UXDA 3IS4A 3VYLA 3GIQA 2WHMA 3CAKA 4IX0A 3CHDA 2YFNA 3ISIX 3RNDA 4QTGA 5CBBA 1VLWA 1B3WA 4GI6A 3OVPA 3WQFA 3VC5A 1LOSA 4DJFA 4PE8A 1ZZMA 2BY0A 1EWEA 9RUBA 3AIWA 4W87A 4LVGA 4RXFA 2Z1WA 3VD4A 2A85A 1SO5A 4PA8A 2D3LA 4ERIA 4W85A 2OSXA 3GAKA 1TV4A 1TIMA 3ZOAA 3T44A 1XLGA 4JKMA 5C54A 1A5LC 4QDWA 5FJUA 5HANA 2IXVA 1K8ZA 2OB3A 3GM8A 1Y0EA 1S1PA 4LRSA 3R4IA 3MMUA 4YN5A 1WZAA 3KP1A 3NGJA 4ALDA 1HVXA 1KNWA 5PTDA 1E9YB 2NQZA 2F6KA 4LC8A 4IL0A 1CXLA 3AJXA 1W32A 5A2BA 1TV3A 3WK3A 1LG1A 2CFFA 3LPFA 5BOOA 3RDKA 3KP0A 2CZVA 1UASA 3VGGA 3DHUA 5GPRA 4UQBA 1QJWA 4D8ZA 1PWLA 1FCVA 4DJDC 4JR5A 4H9ZA 2NX1A 4UFHA 5FSDC 4EPDC 3WK1A 2IXUA 3BAYA 4JNZA 1OYAA 3SDOA 1UZ4A 1IYXA 3N1AA 3PTKA 5DBTA 2PZNA 1RQHA 4DYJA 3W7GA 2DT3A 5ABTA 1UD8A 1GQJA 1GVFA 1V0MA 3BLLA 4LRTA 3W7RA 4Q8TA 3AYTA 2VFDA 1R38A 1NFPA 2ZXDA 2IKJA 1RPXA 1DIEA 1M01A 1V6YA 2WK2A 4XZHA 1J0KA 2VQTA 3E74A 3OLEA 2SFPA 3TWBA 3UJEA 2QV5A 4JY8A 2E8ZA 5BRQA 2P5NA 2IPJA 4I7WA 3QSTA 3GHUA 1FY6A 1XINA 1SQ7A 1EX5A 3LENA 4KEUA 5EY5A 5BOFA 3W6LA 2QGYA 5D04C 4XUYA 4FX6M 3R12A 3ARZA 3CMFA 2YDSA 4KRZA 1X97A 3DI1A 4PTNA 3G1FA 1EJVC 1TB3A 2WNWA 4HTBA 3QC0A 3UR8A 1E43A 4LUTB 4H7ZA 1OABA 1S2WA 4EPEC 1Q2RA 5F4SA 2Z7KA 3QM3A 1UB3A 2CZ5A 3N9KA 1L6FA 1R3YA 5I3KA 1H7RA 4GVGA 2WJEA 2J79A 1QRQA 2W67A 5BXTA 4MM1A 3KDNA 4OV9A 2Z1VA 3AWOA 4KW2A 1A5SA 1WZLA 2NLYA 5A8QA 2QXWA 1W5OA 3TSBA 3EX4A 2VFHA 5AZ0A 2MNRA 4URIA 3LM3A 2AGKA 3IUIA 5DMYA 3M43A 4HA3A 1UROA 1V08A 2J9ZA 4YTRA 2UY5A 2TRSA 4JQ2A 5A6BA 4QQUA 4YVPA 1S2AA 3W29A 2WMFA 1HJQA 1E0XA 4PULA 3R8GA 1E1FA 1R9XA 4F0KA 1MQQA 1VFOA 4N4QA 1SJDA 3WEMA 5CGMA 3E2SA 5D37A 1KFKA 1O5QA 4B5VA 3TN5A 3VIFA 1Q7MA 3MA8A 4ZB2A 3N3TA 4GISA 1PXGA 2BLEA 4IICA 3LQGA 2IMRA 5CPMA 4B15A 3L4YA 1Z9AA 6TAAA 2NQHA 3W7QA 3CH9A 4L4OA 3FLUA 4YHGA 3V4BA 2EGZA 1XRFA 3WD2A 2RDXA 4O4VA 2DW6A 3QOKA 4JN8A 2I5GA 3NPXA 1BSIA 2PAJA 4J28A 3SIZA 3L4XA 1VLIA 4PB4A 2WZTA 2ZC1A 1UZ1A 2YPIA 4NYYA 1VFLA 4LCSA 3GDLA 3B40A 1W5NA 4GCXA 5HMFA 5F7UA 4EWJA 2PWUA 4LBSA 1J5SA 3L0GA 4A35A 3T0DA 2WNQA 3EWCA 2PB1A 3NQBA 2C18A 1Q6DA 4WIWA 3SCOA 1KTCA 1MSSA 1VENA 1QNPA 2A3EA 1F3WA 3DAQA 3NURA 2E6DA 3H26A 3RX3A 3BW3A 2BXZA 1KTNA 3MVTA 1J0JA 2PDQA 1BGAA 1VHNA 1YNQA 3P8IA 1Q8AA 1NFBA 1TZ9A 1JCMP 3MKCA 3R5EA 4WD0A 1ZRQA 2EPKX 4IHCA 1O6IA 3THCA 1CGUA 1EO7A 3MBFA 3C0QA 3GTFA 3QMRA 4QLLA 3LQLA 2PDJA 4G7FA 3GHSA 1RVKA 4IGHA 2ZDSA 3V75A 3MSDA 4EWND 3CUFA 4DIAA 4RLIA 4O11A 3TDFA 2GLKA 3N6QA 3WNMA 2GJXB 4ROQA 5G2HA 4JD4A 2MUCA 1PKLA 1T96A 5DBUA 4BK9A 3RITA 4U33A 3IAPA 4NNAA 5CPQA 3WLLA 2XWDA 4MZ8A 4AHQA 4C60A 1H2JA 4DAIA 3R0KA 4LCQA 4NNBA 3MCNA 5KZDA 1T6MA 3BC9A 3MW7A 2XSAA 3A47A 3TMLA 2AL2B 3QH2A 2HISA 4K68A 1S2CA 2X40A 3STEA 2ZUSA 1FHDA 1LF1A 1E5NA 3APYA 5JBDA 2V3DA 4OE7A 3D46A 3W2LA 1XKYA 4E2VA 4J5NA 4QBXA 2NX3A 4IFKA 2YSWA 1V02E 1VQTA 3FDGA 5AHIA 2WO5A 4W7WA 3REQA 1SW0A 4KWWA 3W86A 2HPIA 4ECLA 3CPGA 4F3HA 4GJJA 4R53A 5CBIA 1OIFA 3CUGA 1OK6A 2FZ8A 1I9CB 4QCEA 1J79A 4B9ZA 6TIMA 1FA2A 2OT1A 1EXPA 1VKFA 1ZAHA 2VDGA 1UUMA 1PHWA 4PCNA 4F48A 5IBXC 4KWVA 3DKJA 1XGZA 2QCFA 5EMMA 3GDKA 1DBTA 3NQCA 4OOUA 1JNDA 5D32A 4LPCA 3TSMA 4AVFA 4JTLA 3SFKA 1BKHA 2C7FA 2Q3OA 2NWSA 4MOZA 5BXRA 3UEQA 3SJ3A 1PS9A 3PJXA 3CYVA 4Y7EA 4X60A 1TMHA 2ZICA 5ABEA 1Z69A 3RAOA 1IZKA 4G2DA 4DF0A 2VR4A 5DT7A 1I2NA 1UIPA 4XZBA 2YA2A 3AISA 5FD0A 4O16A 4ZEPA 2XVNA 1A53A 1XF0A 1OVDA 1UKQA 2J7HA 1CEOA 4IIBA 4NZCA 5AHFA 3OPSA 4B5WA 3O7UA 1A3HA 3VKCA 4IPLA 5AY7A 3LOTA 3BGJA 1RLDA 4NRRA 4RNJA 3BLPX 3VA8A 3UF9A 1W1TA 4E4FA 4HK6A 1QATA 4NYUA 1XIBA 1R5YA 3TUUA 1TJ1A 3YPIA 1K9FA 3A22A 2F61A 3W71A 4S1FA 2DZAA 3ALGA 5IFTA 1FKWA 1V5XA 1XG3A 3JR2A 2FKPA 4S2BA 2XJ7A 3CPUA 4XKMA 4ZOEA 5E0KA 5F1UA 1FRBA 4KWOA 4NZ1A 1R87A 4MZYA 3L2LA 4J3XA 1Q6QA 3NFUA 1WOBA 3VCRA 2HTMA 2VQUA 4NP7A 4PCFA 1NM9A 2ZYFA 3WG6A 4R88A 1JDEA 3GZ3A 3OQ8A 1PTAA 3LGEA 3WNPA 2R94A 3WLQA 2QYGA 2WHLA 3HPFA 1LLZA 4IQEA 3L21A 3R2GA 3KUMA 3AMCA 2BY2A 5J5RA 3IGXA 1QPKA 4DEFA 1AJZA 1JZ4A 3MDWA 3A9IA 1ITQA 1F2JA 1K8YA 4TOQA 4GVFA 4XZIA 3JVAA 4HPNA 2PTZA 4IGNA 3LHVA 3S6TA 1XIGA 5CSUA 4RW3A 1LCOA 4LEFA 3B8IA 2VI0A 1K7FA 4DF1A 1SGJA 3PUDA 4HZ7A 3VDCA 1V3JA 3ZT7A 2J24A 3UESA 4ATDA 1MW0A 2JIEA 3B0VC 2J7EA 4A3HA 1GT8A 2IKHA 1UH3A 1DJGA 1AL8A 2NV1A 4LUTA 1G4EA 7CGTA 2QLYA 4IGSA 2WMGA 4PSPA 1N8WA 3PG8A 2VNCA 1HJWA 1NIUA 4W9TA 2D2GA 2BGQA 4QM1A 3VD5A 1JDCA 1A5MC 3SUSA 1XYMA 3SCRA 2CU0A 3CUXA 5HINA 2ZUWA 3UJFA 1J2WA 4HVXA 2E5BA 4P7RA 1WDQA 2ASHA 4KF1A 1CB2A 3SCWA 3HPZA 3EOUA 1OGBA 5HUOA 1N7KA 1F3XA 3CTTA 2OLHA 3WQPA 1VIZA 3TYDA 5BWAA 2GSHA 3CZLA 3WX7A 4YNGA 2BNJA 2PD5A 3GG0A 3F5KA 1UKOA 3B04A 5D9PA 3QZAA 1JUKA 3BLOA 5TD4A 1ZJAA 3W00A 3W85A 3RM9A 4R7OA 1G69A 1U22A 4QISA 5A6AA 5IOBA 1QBBA 1M03A 3HOJA 3T2QA <