4PMJA

Crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 in complex with nadp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
281
structure length
281
Chain Sequence
MHDPIPTIAFPDGRKVPALGQGTWRMGENRAKTADEVRSLQTGLDLGMTLIDTAEMYGDGAAERIVGEAIKGRRDEAFVVSKVLPSNASRAGTVAACERSLRNLGIDCVDLYLLHWRGGYPLAETVAAFEELKKAGKIRAWGVSNFDVDDMEELSAVPDGGNVAANQVLYNLARRGIEFDLLPRCRAQGVPVMAYSPLDEGRLLHDADLIHIAKAHQATPAQVALAFLKTCSGVISIPKTGSPERARENRDAMDIHLTTENLAELDRHFPPPRRKTRLEVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative oxidoreductase
publication title Crystal structure of a putative oxidoreductase from Sinorhizobiummeliloti 1021 in complex with NADP
rcsb
source organism Rhizobium meliloti
molecule tags Oxidoreductase
total genus 102
structure length 281
sequence length 281
ec nomenclature ec 1.1.1.-:
pdb deposition date 2014-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4pmjA00
3S3GA 3LEPA 4G5DA 1MI3A 1Z9AA 2FGBA 3UG8A 4GA8A 1PWLA 4QX4A 3GHUA 4AUBA 4H7CA 4JTDA 3RX2A 3R8GA 3H4GA 4WDUA 1IEIA 4FZIA 2WZMA 4JTAA 3VXGA 3D3FA 4WDXA 3RX4A 4LB4A 1JEZA 3CV7A 4XZNX 3M64A 4OTKA 5LIXX 4YU1A 4EXAA 3ONBA 4PR4A 4XZHA 1Z3NA 2PDUA 4JQ3A 4JIHA 2PDCA 1M9HA 3WBXA 2PD9A 1PZ0A 1X98A 2PF8A 1RALA 1A80A 2DV0A 3C3UA 2IS7A 1S2AA 3V36A 3WG6A 1RY8A 1Q13A 3UP8A 1EL3A 2IPWA 5JH2A 4ZFCA 3LNMA 5HA7A 4DBSA 3CAQA 3CV6A 4GIEA 3FJNA 4DBUA 1QRQA 2IKIA 3WCZA 2PDQA 3GHSA 1VP5A 3BV7A 2BP1A 4FAMA 4GCAA 4PRRA 1MRQA 4YVXA 4PUWA 3UZYA 3FX4A 2PDFA 3DN5A 3LQLA 2A79A 1XGDA 3G5EA 2PDYA 5HNTA 2PDMA 4NKCA 1OG6A 2HVOA 3M0IA 1AH4A 3V0UA 1VBJA 4YVPA 5AZ0A 3NTYA 3N6QA 5JH1A 2F2KA 1HQTA 2IQDA 4QXIA 1R38A 2HE5A 3O3RA 5AZ1A 1ZSXA 2BGSA 2PDWA 4IGSA 4XVDA 4FA3A 1EXBA 2IPJA 4XZLX 3MC5A 4I5XA 3O0KA 4XZMX 2FZ9A 2PDIA 1UR3M 3ERPA 5HNUA 2DUXA 4JQAA 3GHRA 3WBWA 1XF0A 4YS1A 2R9RA 2IPFA 2INEA 1J96A 2NVCA 5LIWX 3MB9A 4Q7BA 3Q65A 1ZQ5A 1YE4A 4XO6A 2HDJA 2PDNA 4JTRA 3CMFA 3GHTA 2ACUA 2FZBA 2PDPA 4DBWA 3V0TA 3R6IA 2NVDA 1X96A 1HW6A 2PDHA 4WDTA 4ICCX 3F7JA 3GUGA 3CASA 3LENA 4IJCA 4ASTA 3LQGA 2PEVA 2PDBA 4R9OA 1IHIA 4EXBA 4H8NA 4XVEA 2PZNA 2VDGA 4JIIX 3R8HA 1YE6A 2C91A 2WZTA 4GABA 4PMJA 3UZWA 1X97A 3UYIA 1K8CA 3T42A 3M4HA 1AH3A 1Z89A 2INZA 3ONCA 3BURA 4QBXA 4RPQA 2IKGA 1EF3A 2IPGA 1Q5MA 2ACQA 5KETA 5LIKX 3LZ3A 2I16A 2ALRA 4F40A 4WDWA 4XAPA 5LIUX 3CAVA 1YNPA 2IQ0A 2I17A 3LBOA 2DUZA 1ADSA 4L1WA 3LZ5A 3EAUA 1YNQA 1RY0A 4LAZA 2F38A 2R24A 3Q67A 1T41A 3UZZA 3U2CA 3UGRA 1Z8AA 3BCJA 2PD5A 3RX3A 3P2VA 2HV5A 4XK2A 4YVVA 1S1RA 4WEVX 4LB3A 1SM9A 4HBKA 1ZUAX 1AH0A 3V35A 1XJBA 3COTA 4JQ2A 2PDGA 4WGHA 3QKZA 1ZGDA 2IKHA 1S1PA 3UZXA 4WRHA 3B3DA 3R94A 3G1RA 2FVLA 4LBRA 4GQ0A 4LBSA 2HE8A 2PFHA 3R43A 1LQAA 4IJRA 4GQGA 2J8TA 1US0A 1PWMA 2PDJA 5M2FX 2IKJA 1AFSA 2ISFA 3EB4A 4PUUA 3UFYA 3LUTA 1S2CA 3LN3A 3LD5A 4XZIA 2QXWA 1EKOA 3H7RA 3V0SA 3KRBA 1AZ1A 4JQ1A 4L1XA 2FZ8A 1PZ1A 1MZRA 4JTQA 2ACSA 2HEJA 1FRBA 5C7HA 1PYFA 1T40A 3R58A 5DANA 1QWKA 3DOPA 4JQ4A 4HMNA 4MHBA 2P5NA 2FZDA 2BGQA 4JTCA 4LAUA 4PRTA 3BUVA 4XO7A 1LWIA 3WBYA 2PDLA 4GACA 3N2TA 1C9WA 3EB3A 5LIYX 3UWEA 2ACRA 3H7UA 2HVNA 2CLPA 2AGTA 2PDXA 1GVEA 1AZ2A 3R7MA 4DZ5A 2PDKA 4JIRA 4FALA 4Q3MA 4QR6A
chains in the Genus database with same CATH superfamily
5FACA 1DVJA 4NASA 2B4GA 2YXOA 2ZICA 1C93A 3M0VA 1E5NA 3V18A 4GGHA 3MJMA 3EEGA 3WNKA 4S3AA 4QG6A 1YMYA 1T5AA 3WF2A 1YQ2A 2UY2A 1UR2A 4S23A 3BJFA 1ZALA 1OABA 4LPCA 1SO3A 1UZHA 1R8LA 4M6VA 3ITOA 2V2CA 1HKKA 2XH2A 4JYFA 4DUOA 2NWRA 4WDXA 3RX4A 3TZNA 3MMDA 5CBBA 1OX5A 5U7SA 4HNNA 4QSFA 2VENA 2PBGA 4INFA 4L9YA 4B90A 1Z7AA 4AZ7A 3VD7A 3KVLA 4O1CA 5M3WA 1M9HA 5D30A 3WLLA 3HO8A 4FXSA 1BXCA 2OSWA 4RCXA 3O07A 3LCHA 2NXHA 3MJYA 5H8MA 4Q4PA 3JRKA 1W0MA 3UP8A 4IPLA 4Z08A 4A05A 4WOQA 4BA0A 2DZSA 3PBWA 2WNNA 5C9XA 1BTMA 4Z1DA 3V1HA 1QRQA 1SFSA 1OX4A 1E6SM 2YDQA 4RZBA 1VYRA 4YVXA 5I6SA 1ZB5A 4M51A 4CD4A 3RMJA 1M5WA 3EKGA 2EF9A 4AX7A 2WVTA 5AHFA 1OCBA 3GXMA 1NVMA 1K4GA 3VM7A 4GX9A 2G41A 3I6EA 4IMDA 3RPTA 4H04A 2XFFA 4ATLA 1XLLA 1J4EA 2X1SA 4GFIA 1W5QA 3QMSA 3OEXA 1QW9A 1R3VA 1S2VA 4ZE4A 2C13A 4QS6A 2HNHA 3MT1A 4O12A 5LNSA 1ONEA 3C0SA 5A94A 4A21A 4LS1A 5DLCA 4NXKA 4JAWA 2WK2A 4GYKA 1EIXA 4IP4A 1NELA 4JS3A 4OOUA 2E6AA 3UWQA 3T0CA 3ERPA 3I4KA 2DT3A 2KX9A 1OFDA 2PWHA 3TA6A 3KWSA 1NOFA 4R3UA 3CT2A 1VRXA 1KBKA 3PSVA 4FLQA 3TN3A 1WDRA 4E2DA 4PMQA 4ZZ9A 2H9AA 4U28A 4Q6XA 1RCOB 1PHQA 1LUCA 2UWFA 4UBPC 2HS8A 4Q22A 2WQDA 2ZVRA 3CAWA 4CQDA 2FZBA 1FKWA 3DEQA 4JN6A 2VWSA 2X1IA 4GYFA 3L4UA 3DFSA 1EPVA 1WB0A 4UTUA 3LS9A 1WDQA 1PKYA 3S2MA 3I7SA 4O57A 4Q6JA 1BFNA 1G4TA 1WV2A 3B9EA 4RXGA 3SCNA 2G97A 1DWIM 1VENA 3DC8A 3M07A 1RAKA 3EOUA 4K3ZA 2X42A 1E6RA 2GK1A 1THFD 4HA4A 4KETA 4B9YA 1RQEA 1KM6A 3UERA 1AD1A 2YL6A 5BYWA 4QITA 3AHYA 1YW1A 1M41A 2D69A 2OQHA 1ZNNA 3UQNA 2J77A 2YBUA 3ONCA 3GIQA 3PTKA 2Z24A 4PTWA 4JIQA 2O56A 5LIKX 2C19A 4E3TA 1KTNA 3WD2A 5AYIA 2PGRA 2DJLA 3MA8A 2O55A 1ICPA 2I17A 4BZYA 2PPGA 1XLEA 5JBEA 3ATZA 1WOBA 5DF0A 4ZB2A 3IIVA 2DH3A 4HCLA 4Y9AA 4HTBA 1WDDA 1Z8AA 3WQ5A 1XLAA 1VEOA 3BLIA 4JR5A 1X8FA 3H22A 1ZP3A 2X2YA 1KFBA 2OR2A 5EMKA 2EHHA 5U4NA 2E67A 2BOGX 3E02A 1EGMA 1MQQA 2Y6ZA 2I5GA 1SUXA 5AHNA 2WMJA 3W7RA 3L23A 3NQEA 4LANA 5FJIA 4H4IA 2QV5A 5K9CA 3UZXA 2XIQA 3OLIA 4Z2JA 4DJEA 3UCCA 1G6CA 3OA3A 1OY0A 3NDZA 1F5ZA 2G0WA 3W7OA 1A53A 1PWMA 4FOKA 1TJRA 2VX4A 1K8ZA 1IGWA 4PUUA 3LUTA 1O1ZA 5CBIA 1US2A 3ARTA 4JKLA 3VKKA 2DZXA 4MY1A 2G3FA 2OPJA 4ZB5A 4NU7A 4QQ3A 1KBBA 1D3CA 1ITCA 1Q6QA 3LHWA 3VNYA 3PAOA 1ZPTA 3R10A 2FTWA 1GVOA 2FPTA 4YYCA 1RZMA 3TU9A 2B7PA 4GI9A 1W54A 4UR7A 4JTCA 3VD4A 5CJMA 2WSKA 4JXCA 1R2RA 3NL2A 3DGRA 8TIMA 2BASA 2Z1BA 5LIYX 1W1B1 3IAQA 1E0TA 1XIDA 4FNUA 2ANUA 3PPCA 1IGSA 4KQNA 1XV8A 1ADOA 3HJEA 5TNVA 2GZXA 1FXPA 3QW3A 1FHUA 3SY8A 3QV8A 2RFGA 1QOQA 3FVMA 1KCZA 1XM3A 1OGSA 4Q7NA 2R1PA 3ES8A 2YLAA 3PJWA 5DO8A 3VD9A 1W1A1 1VKFA 1LTDA 1W17A 3M5YA 3CEUA 4QLJA 5G2WA 1TTIA 4YTSA 3ITTA 5IFTA 4XQ6A 2I1OA 1F8MA 4V1XA 5FF4A 2NQJA 3DBPA 4EX4A 1CECA 3MUIA 4OE7A 3N6HA 3B8VA 4JHMA 3WUFA 1PBGA 3CV7A 1PKNA 3WEZA 3QKEA 4EXAA 1A5UA 1NOWA 3NYDA 2TAAA 3PWGA 3E2SA 3W26A 1POJA 1E43A 5G2IA 5H6HA 1SR0A 5GVJA 1E3ZA 3PUGA 1YHTA 1V02A 1ADDA 4TR9A 4CKQA 1XICA 4JIHA 2YFNA 1IWPA 2BODX 1NOUA 3WBEA 4OFCA 4CQAA 4GIRA 4B5WA 1C7TA 2R91A 4UC5A 4UQCA 1RALA 3TN6A 3H4XA 4AZGA 3FAWA 3GG7A 1DWHM 4S3BA 3NFUA 2DZWA 2VR2A 3H6OA 3AUJA 1IIHA 3CGTA 3AS2A 3STFA 3P14A 8RUCA 5DMMA 4RKAA 3WJXA 2ZYFA 1CYGA 3BV7A 3RCNA 1XRSA 1KNWA 4WY0F 1WKFA 4GLEA 2QDDA 4I6VA 2QJGA 4IFKB 1HJUA 3VINA 5AHIA 1UIOA 3EZ4A 1W1IE 3LYEA 3DYMA 5BU9A 3VA8A 3PZQA 1ICSA 3N6QA 3SRDA 4PUDA 3QZEA 3VDBA 2DU2A 3UWVA 4IGSA 4FA3A 3VOHA 4R7OA 1HKMA 3FW6A 3QLLA 4UUIA 4CNTA 3MC5A 2UY5A 1XC4A 4LNYA 4A8LA 1E55A 4S3JA 4Y9NA 1XPGA 3UVIA 5HNUA 5HXMA 1WPCA 5A6TC 4AWSA 4PN2A 3WMLA 3WLQA 3M44A 3N11A 8A3HA 3H53A 3UT0A 1GKQA 1E9ZB 1JQVA 1ZJIA 1E0UA 5HPCA 2HCVA 1XBYA 1XR2A 3OO2A 4NF7A 3C4UA 2PWEA 2WCGA 2GL5A 4DBWA 4QJ3B 2WMKA 1OGGA 5CC3A 2QULA 1I1WA 7ODCA 4LW7A 2PRHA 4TX9A 4I9AA 1TE6A 1WKEA 4NZFA 2NQ9A 3SQMA 3PZ9A 2E1DA 1FTXA 1L0PA 3BVJA 1QWGA 3G22A 3KS6A 1ZHAA 4R9OA 4HNVA 3BJSA 2J79A 1WDWA 3QSTA 5A6BA 3LPOA 3DECA 2F2HA 5HK4A 2XIIA 4JTSA 4JY9A 2NT0A 1KM3A 4LYPA 3CTTA 1OGBA 3GZ3A 4KWVA 4OBRA 4IQEA 1Q5MA 2O92A 1MFVA 3V5CA 1QFEA 3PB0A 3OJGA 5F2IA 2QVHA 3QJAA 3A4JA 2ZUMA 3AYVA 4QIUA 2C7FA 2FKPA 1OK6A 3QY6A 4W4QA 1FXQA 2ZBTA 5LIUX 1JXKA 3GR7A 3KOWA 5A6MA 2VGGA 1UH2A 1JI1A 1A5KC 1XIEA 5D04C 1YADA 5FJOA 2PRLA 2V2HA 3VMNA 1K77A 4L7ZA 2P8BA 3BCJA 3OQEA 2YDRA 1R2TA 5GJPA 3RK8A 4NAEA 2HV5A 2VL4A 1FWIC 2NQ5A 3N2CA 3TX9A 2WC3A 3W2NA 1XH0A 2IW0A 3IAPA 2QUMA 3QKZA 4S3DA 1UUMA 3VIJA 2WJDA 1VS1A 3GAYA 1PCWA 3C0LA 2VI0A 2P8CA 3WF4A 1VLWA 4DO5A 2ZUVA 2Q3RA 2OLAA 3IGUA 4I8YA 3OZOA 4BQ5A 3VNDA 5K4XA 2OVLA 3GC4A 2NV2A 2POTA 4AYGA 2GGHA 3CXOA 2PLJA 4ZENA 3GH4A 1DJQA 2VEMA 3FNDA 3T2PA 3ZJKA 4L1XA 1E6QM 2VFGA 5JIPA 4DBDA 1UG6A 1SFJA 3W0KA 4REQA 2V5CA 3GXPA 2ZA3A 3WLKX 3UCDA 3QXBA 2FIQA 4DO6A 5KZMA 3II1A 2PC8A 1SQ7A 1W56A 1S3TC 4K7YA 3FHQA 1SFTA 2FDMA 2C0HA 1W5NA 2VELA 5EMJA 2D0GA 4B3ZA 1TA3A 4RDWA 2VGFA 1KBJA 4Z1BA 2H8ZA 4L6OA 2FJUB 4KIRA 3MWAA 4BWLA 5CPNA 5G5IA 1QR7A 4Q8OA 1H4PA 4V27A 1FFQA 1S39A 1FCVA 4TVCA 4XBSA 5JMUA 1W6TA 1GVEA 3VC5A 4G1KA 3KUMA 2TSYA 4ACZA 4UNIA 2E09A 3Q94A 4JIRA 4DUXA 4FXFA 4QISA 4M3PA 2FGBA 3CB3A 1BKHA 4CNOA 3BH4A 3UWZA 1BLIA 4HPHA 4YMZA 2BNJA 1B90A 1RBOB 3H70A 1OM0A 3E0LA 1J2BA 4O15A 5XINA 4D2JA 5FJTA 2PWVA 4C7GA 1HKWA 1TPC1 2XVGA 4CU8A 1BYCA 6TIMA 5CCZA 4IFOA 1YDVA 3VPLA 3FLUA 4ZA0A 3WEOA 2GWNA 3LSBA 2DIJA 1DQXA 4M82A 4NYUA 5ABTA 1G9HA 3H12A 1IZCA 5TD4A 2Y7GA 3QH2A 2POZA 2XTKA 4P61A 1TRIA 1HT6A 5ENLA 1VBUA 1PTGA 4I5UA 4H19A 4RE4A 5FF0A 1EUAA 1HKVA 4Z0SA 5C9RA 5KZEA 4V28A 4JN7A 4TVUA 1K3UA 3SRHA 3OVQA 2CLIA 4DBSA 4FX6M 2OELA 3IJ6A 4JY8A 4DJFC 3B4YA 2OYKA 2CW6A 1AMYA 1DL3A 1JUEA 5EMUA 2GSHA 3CUGA 4YIWA 4KKXA 3EYPA 2ZX6A 1TVLA 2PP1A 5LXEA 3OGSA 3GO2A 3CUXA 2E7FA 4XSMA 4YL2A 2G95A 2Q3OA 4BS0A 2ODOA 3TCEA 1QJWA 2ABAA 3ZXWA 4OUIA 2PDMA 4P2VA 2O4QA 2DZBA 4NKCA 1J11A 4V1YA 4RZ6A 2R82A 3N2MA 3RPDA 9CGTA 1DJWA 2J6XA 3MPGA 4YVPA 4WSJA 1BYAA 4HMDA 3NZQA 3BL3A 4LAOA 4KEVA 3TP4A 4RNFA 4PTXA 4YTTA 1JYWA 5D9MA 4MWAA 3E96A 2YCLA 2XN0A 1W37A 3S8HA 1XCWA 1MUCA 1FDYA 2NZLA 3WF0A 4O11A 1QASA 3IJLA 3OGRA 5JUVA 1X6UA 3W87A 1IEVA 1M7OA 1VFHA 1RPKA 5K3VA 3UNDA 1E1CA 1CPUA 1LBMA 5TF0A 5ABGA 1EJXC 3TR2A 3T44A 4C6JA 2XGBA 2UY4A 4RPPA 3RCYA 4PTMA 3BSGA 5LZLA 1DTUA 1B3YA 3W2JA 4DELA 1XLBA 3W1RA 1X96A 5HUOA 1A0EA 4CD7A 4DI8A 2EBNA 5CPMA 2VCBA 4D1IA 3VGBA 3L2IA 1Y8BA 1ZBKA 2G5WA 2OGYA 4LVAA 4GXWA 1NDYA 5M5DA 3W02A 5B80A 2HJPA 3SCTA 2AOSA 3ZSTA 1XGZA 4F8XA 3ZJ6A 3CM4A 4JIIX 1WDPA 4JL1A 5XIMA 2AMXA 2EEXA 4AIEA 3B03A 3EOLA 1UJPA 4CCEA 5HR6A 2DSUA 4CQCA 4KEUA 1FWHC 1TTPA 2EJAA 4FNTA 2XISA 2O9RA 1Z69A 1KM5A 4ZXOA 4HD5A 2CLHA 4DRSA 3IVTA 1HL8A 2GUBA 2C1HA 2ZC1A 3T08A 3PFMA 1ME7A 3MW7A 3USZA 4WLCA 2REQB 4RL3A 2ALRA 2NLIA 1BQGA 3CHCA 3NEHA 3LM3A 1B9BA 2F6UA 3UCQA 2CNCA 5A8NA 3KHJA 2C0AA 1EWDA 3RHGA 3GH5A 2O7QA 3BMXA 3KS5A 4NXSA 4JPGA 1UW9A 1TX0A 2WJFA 1RY0A 4WUIA 2CZVA 1Q7ZA 3WNLA 2QPXA 1G7VA 2ZZ6A 3GXFA 5AY7A 1F8IA 1JF5A 2OG9A 3L0GA 5K4ZA 4X63A 3BE7A 1XIMA 4NZJA 1H60A 4IF2A 4N42A 3N3TA 1TX2A 4HCHA 1MXGA 4GYPC 3OZPA 5EMLA 2HISA 2OQYA 3T7VA 3LOTA 3WQEA 2W0UA 2AKMA 3JW7A 4WF7A 1S1RA 3GH7A 1XPYA 4WEVX 4IM4A 4YCOA 2X41A 4OECA 3UJFA 1TWSA 4IG2B 1V6XA 1KW1A 1K8YA 1XRTA 3IIZA 3LERA 4LYQA 3LCLA 1HG3A 4JQ2A 4WGHA 4DJDD 1M6JA 5F2MA 3AO0A 4OBSA 3HG3A 5BXSA 3P0WA 3G1RA 4GQ0A 4E3VA 3LTSA 2HS6A 3T07A 3WNOA 3FYYA 4NJKA 1QT1A 2I5IA 3CNYA 3IJ9A 1BWLA 3EB4A 5I79A 1XCFA 3WH7A 3PPHA 4PTVA 4YN5A 1CXEA 2VFFA 3GU1A 2CLOA 1E6ZA 2QXWA 3THCA 3V0SA 1EJVC 1VCVA 4AWEA 3W7KA 2PP3A 3QSRA 3I3BA 2R6OA 4J4KA 3ARZA 1R3QA 1US3A 3VDCA 4GY0A 4ZQPA 4JEQA 3GC2A 1B2YA 3RMEA 1DE6A 3DFPA 2NX3A 1VBRA 1Q4WA 3S5YA 2ADAA 3E3HA 1EP3A 3OOQA 3PJTA 3PBVA 1SO6A 1JZ4A 5GQBA 1BSIA 2J75A 4CVUA 3THQA 4AZ5A 1OG0A 5HNRA 4NZ5A 4IIGA 4BQ4A 3BAWA 1U5JA 4QJ5B 4I8DA 4W8AA 5HMFA 2J7GA 2HBVA 2KZHA 1GYNA 2Y2WA 3ARYA 2QDGA 2VP8A 5ECVA 4DWDA 3UG8A 3LTPA 2VEFA 1S2TA 1B3OA 2ZTKA 4QX4A 5HNNA 4IGMA 2AL2A 2QQ6A 4FXRA 3NZGA 3VNMA 1TR9A 2E6DA 1AG1O 1KLYA 2CLFA 4B4HA 1TJ1A 1V7YA 3ZWSA 3CZEA 2GGGA 5FAGA 5AVHA 1Q3NA 4O17A 3DHDA 3FGCA 5E5CA 2G3MA 1U33A 1SSGA 4Q8QA 3SCVA 2XN2A 1S46A 3VD3A 4WY0B 1H5VA 5D37A 2ZWYA 2Y5JA 3W7GA 1H09A 3SJ3A 5CG7A 1V3KA 2O7SA 4PB5A 4XZHA 1L6FA 3E9AA 1TZZA 1YTKA 1YLVA 1KLZA 1ZU8A 2DSKA 5HWNA 2X40A 2VFIA 1MNZA 3QMTA 2NUYA 1I1XA 3MHUA 3V7PA 2PD9A 1K7FA 3AIUA 3RCMA 1HVQA 2HPMA 1NDWA 3NWRA 1EF2A 1ME8A 5A6JA 2VM8A 4Z2KA 4JTKA 4PB3A 1P7TB 2YL8A 4HHLA 3B04A 3OP2A 4ZFCA 3HPZA 1MUWA 3BAIA 2JIEA 4H1ZA 3CL6A 4GIEA 4AMAA 4K8EA 3CMGA 3WQFA 1W91A 4X61A 5C9UA 1TELA 2JKPA 1QNOA 4AF0B 3F1QA 2XZ9A 3ENLA 5F7UA 2BP1A 1X1ZA 3FDKA 1UQYA 1CGWA 2I57A 3MSDA 3Q37A 2O0TA 5HDRA 4EXQA 4P7QA 1A49A 3DFYA 2DORA 5M1TA 4JIPA 4TIMA 4W86A 5LNRA 3CLWA 3KP1A 1ZS2A 3W1XA 3TQPA 3CBWA 3B9NA 5AZ0A 3NIYA 1AJ2A 1HQTA 4IHCA 1V08A 2RGMA 2ZIDA 3GZAA 3DFQA 4LFYA 1JZ6A 2QYGA 1V02E 2G37A 1OZQA 2P3EA 3GR8A 3LHUA 4QSHA 2GJLA 5GJNA 3RU8X 4GZ7A 4I5XA 3DGBA 3F2BA 1QVBA 1XYMA 1YXYA 2WVUA 1QNQA 1NQKA 2FZ9A 1UR3M 4GVIA 2HVMA 1NAL1 1ZCOA 4G1NA 3W88A 4LVGA 4J3SA 3FA5A 1FWAC 1EO7A 2TYSA 3N19B 3L4VA 4HCDA 5LIWX 1PAMA 1DP0A 2RDUA 5EA9A 3S5OA 1M7XA 2E6FA 1EQCA 4F3HA 1P43A 1R3RA 3TC3A 5AFDA 1HW6A 4WDTA 3W07A 1JCNA 1TJ0A 2QUNA 1DXIA 3W7EA 4IJCA 1UOKA 4ASTA 4ZSUA 4DN1A 3KOZA 4AISA 3FEMA 3DI1A 1VFFA 2Y5EA 4H9MA 1P0DA 3QBUA 5CAHA 3IIOA 5A95A 5BXRA 5LKYA 1IHIA 2QIIA 3ZFHA 4HN8A 5CBJA 4PMOA 4HOXA 4AEOA 3S5SA 4X2RA 1KFKA 2X7VA 3PC0A 4D9PA 1TWIA 2X0HA 1HIZA 2Y7FA 2XIOA 4PMVA 4C65A 1M01A 3SDOA 1HP4A 3W7MA 1BF2A 2QUUA 1W31A 4BF5A 2VC6A 4S3FA 4MTVA 4XZBA 3UYCA 3KCOA 3W7JA 4DJED 1UMYA 4A6GA 2FZMA 4O1DA 1OX4B 1CXFA 2ZZ4A 4NY2A 1POKA 1RH9A 3W53A 1MDRA 3NO1A 3SGUA 2HTMA 3P5ZA 1GVRA 1T41A 1R3SA 2AMGA 3ZVIA 1FWEC 4DWSA 4HA1A 3HU7A 4WSHA 5CAKA 3HFTA 1HX0A 1UKSA 3N17A 3W76A 5LNVA 3BOXA 4ES4A 4WJEA 3WD3A 5CZTA 2ZUSA 4LAKA 1GQIA 2PDGA 1L2QA 2E9MA 1S1PA 1TMHA 3CL7A 3AISA 4MB3A 3MZNA 1W1PA 2X0SA 4LEFA 4S2BA 1Q66A 3GTXA 3SN4A 4GINA 4QE5A 3NO3A 3EWUA 4UNLA 4BF7A 1HO1A 3BZGA 2DVTA 2PU1A 3OVRA 3BAYA 2IKJA 4C6DA 3GNDA 1GHSA 3C2YA 2VCAA 2OGJA 1I75A 3MI3A 3BQ6A 4QGCA 1UA7A 4WKFA 3R1ZA 4ECLA 2CBJA 1ZJHA 1VR6A 3VIKA 1QDSA 3OODA 5JQ9A 5BZAA 4Q4MA 5D2WA 2H9AB 1LUCB 3VCRA 3LLDA 1DJNA 1RQHA 2ZX7A 3BAKA 3ZVHB 5SWUA 1VH7A 1E0VA 4PE8A 3LCIA 2ABBA 1SFLA 3QPEA 2BB0A 2JKEA 1WO2A 4N0RA 4XTIA 3AIEA 2YB1A 4O1FA 3KZPA 2EPMX 4ATDA 1EA9C 5D8WA 2Z7KA 3EB3A 2XIJA 3GIYA 3L5LA 3TW7A 1QW8A 4KF1A 1BEUA 3URNA 1KBIA 4FLRA 4RE3A 3SUWA 3I7RA 2CXGA 3I10A 1JFXA 4Y8FA 4Z1AA 3G1AA 3WMBA 1TPUA 3U3HA 3RFAA 1N8WA 4H9TA 4NG3A 4HNOA 1UROA 1WE5A 1UA3A 4JDYA 3U7VA 5A8MA 1EO5A 2WSQA 3BW4A 4ERIA 7CGTA 4OBTA 5IHRA 4F0MA 3FKKA 3HURA 1R5YA 3EX3A 3MDWA 1AD4A 3DDMA 2XIMA 3TJLA 3TSMA 3D0CA 3RLVA 2DT0A 2J62A 4JNYA 2HNEA 4R85A 4LRTA 4MGGA 4IP5A 1X6NA 1T0OA 5CLTA 1PL9A 5IBXC 5FIPA 1WNOA 4Z17A 2J74A 1KGXA 5I7GA 3SUUA 1W3LA 1UYQA 1HO4A 1OEPA 4C6PA 1V6YA 4S3GA 4I9JA 4DNHA 2JEPA 3WNNA 2XVPA 3LCXA 4ZQNA 4CD6A 3F2CA 2J6VA 3W1UA 1Q13A 3WQ4A 5I00A 4NUWA 5LA2A 5D2VA 3CV6A 3KE0A 3P0XA 2CU0A 3M6YA 1Z42A 2PDQA 1FWTA 3RNDA 4CQ8A 4MOZA 3QOKA 2ZRUA 4UFKA 7TAAA 4GCAA 3R5EA 1REQA 3VAVA 4A3UA 4OV4A 1QNPA 1ISWA 4JNMA 1TPVA 4LUSB 2WM1A 1IWAA 2DP3A 3W7CA 4PZVA 1E4NA 5B7YA 2RKXA 2QPUA 3V0UA 4Y2WA 2QCLA 1ALDA 2WCSA 3BV4A 3PY2A 2WOQA 4NI8A 5PTDA 4NJGA 1HKIA 4O19A 2EKCA 1TE1A 5EMMA 4J5NA 4GZJA 1RPXA 3O3RA 2W67A 4WVXA 2WCAA 1WAUA 3QW4B 3VFLA 1EDGA 1XP3A 3QOMA 4XZLX 4A4AA 3T9PA 5LNWA 4R34A 4WJXA 3RITA 2ZXQA 2BY0A 4HPNA 4RR4A 1O94A 4JBRA 2Z2UA 4H6RA 5A2BA 2VWTA 3MUCA 1HL2A 4GCXA 4WQ6A 5H1WA 2NQHA 4N4QA 2QKFA 2WHLA 3VIHA 3ELFA 2E4TA 3NSMA 3QC3A 3DIPA 3W2UA 2R1MA 4PUEA 1JCXA 2INEA 1GGOA 1OYBA 4CN6A 4MIMA 2XVLA 4Q32A 5A6BD 1YDNA 3FJLA 3B0PA 2A85A 3W7PA 1W2PA 3WFLA 2PDPA 4Q8TA 1GORA 3W81A 1QBBA 4H9UA 4A3QA 4GJIA 4LY8A 3GUGA 1PJ9A 3PN8A 3WUGA 4B5UA 5I02A 2OFJA 3I4EA 2QMJA 1BG4A 1TZ7A 4H6QA 4IP7A 2YIHA 3IRSA 5FESA 4HYVA 2YKKA 1MUMA 1OT2A 4PCTA 1NU5A 1RK6A 4QROA 5T26A 2C91A 3WBAA 2WZTA 1MW3A 1IXNA 5FA5A 2A7NA 1JIBA 4O0QA 2Y1HA 5C2CA 3W37A 2OLSA 1KKOA 1OFBA 3VKBA 3ZLGA 3O6CA 4Y9MA 4GXPA 1J93A 2VFDA 3MKCA 4QBXA 3JU2A 3GDKA 1MRAA 3MKVA 3UF9A 5FF3A 1GONA 4F40A 4WDWA 3GXDA 3L9CA 2VUYA 2Q8XA 1XL9A 1WBJA 2VFEA 2NX9A 3UZ5A 1AQFA 2WNZA 4ADSA 3A47A 3F5LA 4NHVA 2Z00A 4BQ3A 4UCFA 3NPWA 1LG1A 1SZRA 4X22A 1WA3A 1BF6A 3W24A 5CC6A 2QZRA 1L6WA 4ALDA 4FNPA 3G8EA 4JFWA 2YCKX 2X16A 5KEZA 2A6LA 3VDHA 4XWUA 3MI2A 4S3CA 4J2PA 2FFIA 4PMUA 2VRQA 2D0HA 3ID7A 4QFUA 1SO5A 1A0CA 3AZRA 4LUIA 2BV9A 4MY9A 2Q01A 5G1YA 1QI5A 3A4AA 2CBVA 1TIWA 3DFOA 3PTQA 1QPNA 3REQA 2XVKA 1DWGM 4NL1A 1F4HA 4Y7EA 4W7VA 5G4EA 3W1MA 3OLEA 2UBPC 3LY0A 2C8NA 2FMOA 2OXNA 3UR2A 1VF8A 2E6YA 3A9BA 1W3KA 1DOSA 3A13A 4WGXA 1OIMA 5HQMA 2QT3A 7REQA 4AZ6A 4Z1CA 4U3CA 4TOQA 5G2HA 4B4FA 5EFFA 2EAWA 3UPMA 4H41A 3WD1A 2YGYA 1K9FA 1F3XA 1Q6EA 3SFWA 3VOIA 4AMCA 5JU6A 4HMNA 3U9IA 3L2MA 3S42A 2P5NA 3WUBA 1WXZA 4UQ9A 1AK5A 1WKYA 1H1NA 4U2ZA 1UH4A 4O4VA 4HPGA 1OFEA 2CLKA 4GACA 1MXDA 4GVGA 1VFTA 4YWSA 1T96A 1N8FA 2ACRA 5C54A 4LYRA 1M53A 3L7RA 3TAOA 4QDPA 5HWJA 3AMDA 3PANA 1Y5VA 3R0DA 5AHMA 2DSZA 1CLKA 4R7JA 1SMDA 2PTXA 3G1VA 2XFRA 4GUHA 1S2WA 1R6WA 4O1AA 3M0MA 4IX2A 3P84A 2QCDA 3S1UA 2BXZA 1KFJA 3UG5A 2OT0A 1XYZA 6XIAA 1P0BA 1AJZA 3F4WA 4CEUC 1WYIA 2E8ZA 2P0IA 1LQ0A 3MBDA 4JKKA 3VMOA 1KGUA 1UB3A 4UOJA 4WDUA 1K9TA 4AD0A 5I24A 1FX6A 5E93A 3VDGA 3ARRA 2DJXA 1BGAA 3PNUA 3NR0A 1QHPA 4JTAA 1TV4A 4E8GA 4ZXLA 4M7SA 3EOOA 2C1GA 3NQFA 5LIXX 1N82A 1V3MA 3I3DA 1RJRA 1RQBA 2Z6IA 3N9KA 3MKKA 3WQWA 1H1ZA 3ITLA 2FGZA 3ZR4A 3OA5A 3GXTA 3VVGA 2ZXAA 4JQ3A 3TFCA 1DIKA 1O7AA 2QNEA 3WDJA 1LP6A 4OVXA 4E38A 5HANA 2YL9A 1B1YA 4LEQA 6PTDA 2FPYA 4NAEB 3MS8A 4RZ5A 4MUPA 2E0PA 3CWOX 3RLHA 1A80A 4L5ZA 3ZO9A 1LBFA 1AW5A 3W6YA 3CK5A 3KWXA 2FDSA 1EL3A 4NZ1A 2OCZA 3DBNA 2AQOA 1NQ6A 1V51A 4JCLA 1LYXA 4O13A 3K5XA 5AYZA 3W1LA 1OADA 1I2RA 3HQNA 1N55A 1F73A 5EGRA 1XHGA 4MWAD 4JTTA 1SVDA 2L5HA 3AS0A 3B9DA 1I2PA 4GWEA 3O6YX 4HPXA 3IGSA 5FF7A 3BLKA 3VCCA 3IUIA 2GVEA 3W7NA 3KTCA 1JNDA 1GVSA 1FWRA 1SR9A 3WQPA 4H8VA 2HVOA 5LXXA 4F4RA 3NPXA 4H9ZA 3TTEA 4LF2A 5J8LA 5MF5A 4H7VA 1UR1A 2QGHA 4REQB 2WHJA 3EXRA 1G4PA 2XFYA 2ZE3A 1KB3A 2W62A 2VEKA 5CGMA 5BRQA 1EBHA 3W28A 2BHZA 3BXWA 2PGWA 3FJ6A 1BRLA 3PF3A 1TA3B 1PPIA 2YA2A 3LCWA 5EFDA 4BFAA 3P67A 4PSRA 4CNPA 3TMQA 4AD1A 1YDOA 4XD3A 1IR2A 3GHRA 4LBUA 1KA9F 3OG2A 3WH9A 2GVYA 3WJSA 4ACZB 3U7BA 4AHQA 1PKMA 4BF9A 4AVNA 3ZLHA 1W5MA 2D20A 2V5LA 3L0KA 4DYJA 3GHTA 4UTTA 1DQWA 4RV3A 3SEPA 3P6LA 1EJ7L 2BMBA 3O1NA 3PZNA 4FR1A 1C8YA 2VFHA 4AU0A 3E12A 3S9ZA 4OJYA 2NUXA 1JUKA 3RPMA 2Z1WA 2X1RA 3KBNA 3RLGA 1ZLPA 1UD8A 3OBEA 2H90A 1E4LA 1EQPA 4LRSA 4UFLA 3UXDA 1ZAJA 1O6IA 1XYCA 3M0HA 1TPEA 4ICNA 3CPRA 1V3HA 3C8NA 2D73A 1KXQA 4G8TA 4GABA 4PMJA 3BLOA 4Q4KA 1J8VA 1LQ2A 3OVGA 2CWXA 3WLTA 3G3DA 4N4PA 1ONWA 1EC8A 3B0VC 4IH3A 4MYAA 2WWCA 2ZZ7A 2BFGA 3VKCA 3W71A 4GI4A 4A8RA 3B0XA 3GDRA 1F4AA 4W93A 1U2YA 3CUJA 1LLWA 3EA2A 1NWSA 2I16A 4EPBC 2DGAA 3VZZA 4DF2A 5REQB 3U2ZA 1I9CB 2Q71A 4GQRA 3WENA 1TZ9A 2GLKA 5I06A 2HK1A 3NNTA 1LCOA 3BAXA 3RR4A 1R7OA 3LPPA 3K1DA 4M6UA 4ADTA 4W87A 3C86A 4PCPA 3AZTA 5A8QA 3VI2A 1XYFA 3EMZA 3N2OA 3RX3A 1EC9A 3IARA 1ISXA 2AL1A 3W1QA 4WHBA 1XSJA 4HJWA 3RJXA 4LB3A 5E0CA 1B4EA 1UUQA 3M0YA 1ITUA 1Y5WA 6REQA 4JTIA 3CZLA 1I6NA 1LLZA 1XKJA 3R94A 2OWXA 2FVLA 3N29A 1FWFC 4LBSA 1DV7A 4N9EA 4KGJA 5K7JA 1T8QA 3CHDA 2NSXA 1D3HA 2YCLB 4DJDC 1UMLA 4W8LA 2J8TA 1RV8A 1NFBA 2DZTA 1VEPA 4IXHA 1ZRQA 1ODZA 4FB7A 1UWUA 2Q8LA 1QBAA 2RUSA 2J9XA 1E1CB 5AYYA 2NVAA 4JQ1A 3EMQA 1LRNA 2E5BA 5LHFA 1VYPX 4KCWA 3L0NA 1UR9A 2VZSA 1MEWA 4OV9A 4NX0A 4EPDC 1FRBA 1JPDX 2W9MA 3A24A 1OYCA 1BAGA 5GNYA 1TMQA 1AL8A 2XU2A 3VTRA 3NYZA 5BWFA 2F7FA 2FZDA 1R0MA 1R86A 1EBGA 2QCNA 1UBPC 1E6NA 4PMNA 4XUYA 2PLKA 4HGXA 3HPXA 3UWYA 3DESA 3ARWA 3H26A 3EGJA 3PG8A 4TV6A 2E77A 3GFXA 1W9VA 2ICSA 2HVNA 3AAMA 3AHTA 2PDXA 3JUGA 1TUXA 4O1BA 1V3LA 2ZZ3A 3VIOA 3MVTA 1P6CA 4H00A 4QR6A 1D2KA 3PAJA 4WCJA 1ZBWA 4LY4A 1VC4A 3VK5A 1VFUA 3W38A 1B57A 3BSHA 3OTRA 1S5TA 1M04A 1DJZA 1Q6FA 4LALA 3UWUA 4P8XA 1RXOB 1NM9A 1IEIA 1V0MA 5DX7A 2Y63A 1TCMA 3DENA 3R25A 2Z1XA 2D2OA 1KQYA 3M0ZA 3LGDA 3P8JA 2YB4A 5A6KA 2R94A 5HPOA 1GWJA 3WK2A 5F4SA 3WDRA 3AYRA 1N7KA 1YKWA 1IYXA 4Z2GA 5FEZA 2XVNA 3RM4A 1UKQA 3NZ1A 2PDUA 3P62A 4E2VA 2QJMA 4H3DA 2Z1SA 3BO9A 3B4UA 2V63A 4KWUA 4IPJA 1T6MA 1CLXA 2GJPA 3R2GA 3NZPA 4FOUA 3V3WA 5GPRA 2QJHA 3DCPA 4HK6A 4KPLA 4PFMA 3TK7A 1KM4A 1E71M 2B7OA 2F6XA 5D4YA 4C1LA 4Y9OA 3BANA 3RO8A 3LMYA 3MO7A 2BHYA 1PVNA 1XLFA 1Z41A 3CV2A 4DBUA 1V4YA 3M46A 2ZRWA 3LTYA 3PPGA 5I78A 3FIGA 2WO5A 3VIFA 4C6NA 2VQUA 1VLIA 4PRRA 3VOFA 7A3HA 5CJNA 1OB0A 1H7PA 2C3ZA 2CETA 4CCDA 3AMGA 4ERGA 4O1EA 2YZ5A 2JQXA 1RK5A 4DAFA 1QNRA 3H21A 4FK9A 1U83A 2RJHA 2TMDA 3MYOA 1EYWA 3LRLA 3VIMA 3EWBX 2DZUA 2VEPA 4QXIA 1R38A 4NT0A 5J04A 1ISVA 1ZZMA 1ZL1A 1AMKA 4EF9A 4LTSA 1P1XA 2VCCA 4UQAA 3BWWA 1UWAA 1AL7A 4C6LA 1PIIA 3WQ6A 4MZYA 5CGQA 3WLSA 1LT8A 1C91A 4AD5A 1OZMA 3GBEA 3THDA 4C6OA 3SW6A 2V6AA 2ISVA 5A6AA 1DPMA 2Z26A 5I3FA 1DJGA 3WBWA 2R9RA 5I0DA 4LYKA 3GX9A 4MFDA 1IIGA 1GTHA 1J96A 2WBKA 4GC4A 1JQXA 4IFRA 2HDJA 2OEMA 4TVDA 3TNBA 5C6MA 3L12A 2ACUA 2PP0A 4XD4A 3HB9A 4FPSA 4R53A 3AXXA 3QTPA 1S3HA 1JDEA 2PE4A 5BOFA 1EUNA 1W8GA 4BK9A 2Y70A 3DH7A 4DY1A 3N4EA 4JNZA 4MFEA 1B3VA 3T2OA 3MUZ1 4Q33A 1JI2A 4GYJA 3N4FA 3W1PA 2PWFA 3QFEA 3GY1A 4UTJA 3FGCB 1FP9A 4MJ2A 2VC5A 4ZQOA 2DIEA 3CZGA 4Z2LA 5AC8A 5CEWA 4CVWA 1V77A 3I65A 3G24A 1XLIA 2XH0A 2WANA 3L4YA 1GNXA 3L5MA 2Y85A 4HZMA 1XLCA 3M5VA 1D8CA 2WKJA 3RRAA 5BROA 1AH3A 5DQPA 4DWSD 4LC6A 1Z89A 4C6CA 4Z2HA 4PCNA 1C8XA 4GZEA 3W86A 1QHZA 2NXIA 5HQEA 5KETA 1E1EA 2FB3A 1CNVA 1E1FA 5IHSA 1EJTC 3PTMA 1YX1A 3BW2A 3MUAA 3LBOA 3ABQA 4AIBA 3ECQA 4B16A 3T55A 2GOUA 5D05A 3HGJA 1EIBA 4L1WA 1YNQA 1F61A 2RDTA 4MAVA 2WXDM 4GO9A 4MDOA 3UESA 6ENLA 4LAZA 4H9VA 3IS4A 1O4UA 3WQCA 3Q67A 3UZZA 2NUWA 4DJEC 2XSBA 5H8PA 1WZMA 1VEMA 3WLHA 1Y0EA 1Q4NX 1TIMA 3P2VA 4HJFA 5HINA 4D8AA 4BEQA 1FKXA 5KSWA 1H7NA 4YVVA 3BLLA 1SM9A 3LG3A 1UKPA 1XDLA 2GSEA 3ATYA 5E0KA 3IJDA 3BLDA 1AH0A 4QTGA 1XSIA 4AAJA 3H2NA 1ICQA 4HNCA 5CSUA 2EPHA 2IKHA 4FSAA 1JNEA 1XGEA 2CKSA 4FMVA 4M1BA 1V03A 3CH9A 3K46A 3WFZA 4V2XA 3RUBL 4O10A 4V33A 5JIWA 1EB3A 1ZBVA 3TMLA 1OFRA 1QI3A 2JBMA 3EX4A 1R3YA 3PULA 1LM1A 3N2BA 2VXNA 2W5FA 4M29A 3TC7A 4MY8A 2BY3A 3G0XA 1B3XA 1X1OA 3R79A 3LN3A 3SFKA 3APGA 1H62A 3LD5A 4ILSA 4C91A 4RDVA 4N02A 5DMYA 1K9DA 1DXFA 1NSJA 5T91A 3LHTA 1MNSA 1SMAA 2FH6A 4K36A 3ES7A 1VZWA 5JXQA 4YPJA 3U2OA 3B8DA 3VOGA 4ZVJA 1QPKA 5CPQA 2E9BA 3VKJA 2CBIA 2G3NA 4JYEA 5I23A 4DX3A 2WJZA 4Q8MA 3BUVA 2QDEA 1KR0A 3CZJA 1JAEA 5I3HA 6ALDA 2PRMA 4D6FA 3VO0A 5DT5A 5EYWA 4TMBA 3VUSA 1NWUA 3H7UA 1RLCL 3HA1A 4PTDA 3ALGA 3QFWA 4ONVA 4PH6A 1VGAA 5ECUA 4XUGA 4EK7A 3NQ2A 4QAIA 5A69A 1M1BA 4TUFA 1X7IA 4DI9A 5FD0A 1PDZA 1DHKA 4AHPA 3STCA 1EHNA 1PWLA 1Y7VA 3TVAA 4O14A 4D6EA 3J7HA 3ZSSA 1XC6A 1EHAA 3GNPA 1W3HA 4X3ZA 4ERAA 1A5SA 1M7JA 3O05A 2NXGA 4F48A 3WO8A 3RXZA 5JBDA 4OUEA 3PB2A 5LA0A 1U1HA 4WX2A 5TIMA 4IMFA 3BDKA 8XIAA 4OTKA 5HJLA 1RJQA 2CZFA 4RW5A 2DT1A 4HVXA 3O8AA 4HU3A 3U5UA 1R47A 3B97A 4DXKA 3S6DA 2RDWA 3AXKA 2C71A 2CC0A 1TUFA 3C61A 2XHYA 2A3AA 2VTFA 1WZLA 4GNVA 4DWSB 3A12A 3VE7A 5D9OA 5CSRA 4BQ2A 2BWGA 4GUGA 2C15A 1J6PA 3W75A 2EGZA 2OYMA 4N9CA 4H8UA 3WD0A 3AYTA 3EA3A 3FJNA 4JFVA 3ZT5A 2V0TA 4KCVA 1TFVA 3DAQA 3WCZA 4R33A 4M56A 2YDSA 4EVZA 1Y5XA 4AXKA 3AXIA 1V8EA 2V68A 3ITCA 4MB4A 4AY7A 3D5HA 3CZ8A 1HGWA 3D46A 4U3AA 3WY1A 4GBDA 2GJRA 2A3BA 1A4LA 2BVYA 3ICJA 1XIJA 3AMLA 4AY8A 1UH3A 4LC8A 4PA8A 1UKOA 3T8LA 2PTWA 4QE1A 3NTYA 1YBQA 5A8GA 3AOFA 1UD4A 3SCPA 1H49A 1EZ2A 1RBLA 2Z7GA 5AZ1A 3HPSA 1H2JA 4C7DA 4HOWA 1XLDA 3WF3A 3DX5A 1K7XA 1EXBA 3UVAA 3E6EA 3E74A 4GD0A 3DHUA 4XZMX 3P81A 4QRNA 1DIDA 3PZMA 4UZUA 4AB4A 2VX7A 2DUXA 4QEEA 2BS9A 2QCCA 4YS1A 1F3WA 2XM2A 3PUOA 4UTHA 4RE2A 3AS1A 4Q7IA 3ZM8A 3GG8A 4ZODA 4P8VA 4R27A 1GYLA 3CQ0A 3QN3A 1AW1A 3CPUA 3SBFA 4XO6A 1E15A 3TYBA 1CIUA 4U31A 4QLKA 2PBOA 5F4XA 5CZKA 3KVMA 2WAGA 3ZT6A 3VNKA 2WBGA 1ZCCA 4JX4A 4ZSTA 1H7RA 3BICA 1E3XA 4KFNA 2DEPA 4S3EA 3GXNA 2EO7A 3T0BA 3FS2A 3QLDA 3QV9A 1BHGA 2PDBA 4HA0A 3W85A 4H8HA 4MVAA 4CN1A 4IPIA 2XIBA 5BXPA 3R13A 1YE6A 2J88A 3TWAA 2EXOA 2FVMA 1LROA 2FLIA 1IZKA 3W70A 1UD6A 1MMFA 2A21A 3T42A 1ZTVA 2OEJA 4AYSA 4HP5A 1GK8A 3VE9A 3BURA 3P80A 1OC5A 4DQWA 2OSYA 4AXNA 3RIKA 2UZ9A 3M0KA 1YNYA 1QO5A 2FQIA 3V5FA 3B9OA 4IZGA 1OWQA 1EX5A 1GVFA 4DXVA 3GVQA 5MKGA 1UQZA 2R1LA 4HTYA 4HHHA 1Q65A 4MYXA 1IR1A 4HIBA 2E25A 3QEZA 4CD8A 2X2GA 4OQVA 2A3EA 3LGGA 1AUSL 1REQB 1R30A 3GXIA 3W74A 5I3GA 2RGLA 4GRSA 4D6DA 5D09A 4IX0A 3VOJA 1LORA 4EPKA 2QW5A 2UV8G 4QQUA 2H3DA 2H3BA 3S2CA 4NJHA 6XIMA 2ZUUA 2YBVA 4LU0A 3S9YA 1FWWA 1ZUAX 3VKDA 1XJBA 3W84A 2J7DA 1QK2A 3TXZA 4F2TA 1OFPA 1KRMA 3QV6A 4UMBA 4AD3A 4YLWA 2HE8A 3B9AA 1UCWA 4C6KA 2TODA 1Q2RA 4H2CA 1V6UA 4WJ8A 1W9BM 1X1NA 3M41A 1XINA 2BXVA 1LRQA 2WSRA 1BXNA 3H7RA 5CXPA 3CO4A 3UJEA 4E5TA 4QNEA 3QHOA 4BWLC 2Y5SA 2PTDA 1NP2A 4J27A 4P7LA 5C7HA 1PYFA 3HPFA 3FHAA 1RSCA 3H8AA 2DZAA 4HA3A 1X8CA 4MHBA 2MANA 1WUEA 1IE7C 1RD6A 3NOEA 3N04A 1LWIA 2J7EA 5FEPA 1W9UA 5EU9A 3LDVA 1LBLA 4LJ3A 2GJNA 5LGZA 1O68A 2CLMA 3E2RA 4EWJA 2Y24A 1IEXA 4PUNA 4M8UA 3U57A 4GKLA 4ZO7A 5I09A 3BJTA 4XB3A 1BWVA 1GYMA 1GW1A 1UWIA 3H2FA 3LEPA 2P76A 1Z9AA 1U5HA 1XW8A 3BGGA 4TX6A 1FH8A 2VZUA 2XJ7A 3Q2DA 5A5WA 1VPXA 4U10A 2WNWA 4HK5A 1RA5A 5HBFA 3DKJA 1JPHA 1A3WA 4IL0A 3LI1A 4ZO6A 3R8GA 1V5XA 5K9XA 2Y4SA 4C6BA 1GVYA 3TJXA 2E40A 3A4XA 4TTGA 2BVDA 1JEZA 4E8CA 4XZNX 4PBEA 2QCGA 2GPTA 4GQQA 3KOXA 4N9DA 2OMAA 4LF1A 4CNUA 4D8LA 1GG1A 3EXSA 1O95A 3ABRA 4Z2IA 4O16A 1Z3NA 3TA9A 2Y8UA 1SGJA 1FP8A 1JCLA 4TMCA 4W88A 3U4FA 2XG9A 3BLPX 1JXJA 4M7TA 2J66A 1EDQA 3LB0A 2D3LA 3M5XA 1ISZA 1MEHA 3BZJA 3EKZA 4KWWA 1OVDA 4QP0A 4J40A 1BPLB 3S1XA 3SY5A 4XG1A 4B92A 3SY1A 2FHFA 3TTSA 4O0KA 2UY3A 2ZZ5A 1TJPA 2VGBA 4HSHA 4QM1A 1TR1A 3NPVA 1EFZA 1UPPA 4NSBA 1VP5A 4GNKB 3H2OA 1OFQA 1BQCA 4HHPA 4WD0A 4ZB0A 3REQB 1HP5A 4LVDA 1BVNP 3OYXA 2QF8A 3N34A 4IOTA 3ZJ8A 4PUWA 3NJ3A 2CESA 1D7KA 2A79A 4ORMA 1GOMA 1RA0A 2INFA 1QOXA 3MTWA 4MWAC 3WELA 3O63A 4W85A 3L4WA 1KWGA 4XV0A 4I7UA 3NL3A 1F3EA 1CI1A 1DHPA 5BXTA 5CZ0A 1AH4A 1PSCA 4MMWA 4ZE5A 4HK7A 4XD6A 1I45A 4MG4A 3U5YA 4O4WA 5M03A 1OCJA 1ME9A 2BGSA 3HGRA 1RCXB 1JCJA 3LV6A 4JEJA 3SECA 3VZYA 1R9XA 3ZJ7A 1E0WA 3G6LA 3IIXA 4TTUA 3C0JA 1W3NA 5FJUA 4LVBA 1R3WA 1JDDA 3GU9A 5E70A 3AIVA 3UA4A 3RM9A 2DPEA 3FK4A 4JQAA 4UXDA 3EA1A 4B2DA 3NSXA 3FDGA 2ZKMX 4HZ7A 9XIMA 2HXUA 4KS0A 1KM1A 4GC3A 2NQZA 4M0XA 3MB9A 4IXXA 1ZQ5A 3EKLA 5AC7A 4JX6A 2QCDB 4EP8C 2GSJA 5DELA 5BMWA 3N1AA 1FVPA 4RE0A 3N13A 3CUHA 4M6QA 4MLJA 3P8IA 5F1UA 5J5RA 1TG7A 1QW7A 2X8RA 2DW7A 5C2GA 3G1DA 2PEVA 2REQA 4IPNB 5C0QA 1DIOA 3BGAA 4D1JA 3IVSA 3OBAA 1CB7B 4CQBA 1HNYA 1RVGA 2BHUA 3U2EA 4XVEA 4UR9A 4HPJA 2Y8KA 1EEPA 1OBAA 3QZ6A 3PBYA 3PP7A 2IXVA 1VPQA 3AUOA 4WKHA 1ZP4A 3AJ7A 1OCNA 3C6CA 5BOOA 3UYIA 4US5D 3NG3A 3LU2A 1UWSA 1HF6A 1UR4A 2QCMA 4RPQA 2QJIA 3EOSA 4BI7A 2ACQA 4F0SA 3QQ0A 4RNJA 3RU6A 3PUEA 4PC8A 4IG2A 1GJPA 1F05A 5DCDA 3PFRA 5HAOA 4GH3A 4IWWA 2QCHA 2QCEA 5EMYA 5JBFA 3CAVA 3TW9A 1PKLA 3DI0A 2DUZA 2D3NA 2D22A 1DKWA 2E68A 2VYOA 1PX3A 4ROQA 1O66A 2CYGA 3GIPA 3TOPA 3VIPA 1V93A 3G77A 3U2CA 2XGIA 4YCPA 4RNHA 1YPIA 3G1YA 1CT5A 3KVJA 2GUUA 1GKPA 3UXKA 3PBGA 3DHFA 1CLVA 4CNSA 3HFYA 2GQ8A 3B0YA 1WXJA 4HZ6A 3IGXA 5C7VA 2IQTA 2VQTA 1HZYA 1M3UA 1I8JA 2YCJA 1IXOA 2F9RA 2QV4A 3POCA 2W27A 3IVUA 5E6ZA 1B3ZA 1ZGDA 2PCQA 4QCEA 1LJYA 3OLGA 1PTAA 4AZBA 3UR5A 3TYZA 2V82A 1M68A 4LBRA 1QU4A 4JYDA 1DQUA 4C6IA 4TU1A 3NQGA 3MANA 4CLMA 3SUVA 1BRLB 4ZTXA 1US0A 1RJPA 1JCMP 3GQYA 2I5QA 3UFYA 5D33A 3MSGA 4M80A 3AC0A 4ACYA 3PJUA 2WMFA 2WWDA 3CQHA 3P74A 4AD2A 2V69A 4PEEA 5CKSA 2BX7A 5DY3A 3QYSA 4IMGA 2FZ8A 1MZRA 1RR2A 3NXFA 3WH6A 1O5XA 1VBGA 2X30A 5BMXA 1MZHA 4KCTA 4JTFA 4GHRA 3BG3A 2E1WA 5DANA 3SCQA 4C90A 1QWKA 3DOPA 2A2IA 3KL0A 1XYAA 3GFZA 1A5MC 2QJNA 5LNUA 3O6DA 2YX0A 4AZHA 1CGUA 4XO7A 2FVKA 2CXEA 3ZWTA 3LMZA 4R88A 3AIBA 1QMLA 4ZOAA 4DNMA 4HSNA 1PV8A 4PL2A 1AJ0A 1FWGC 5CC5A 4LH8A 5AC6A 2OOGA 5LHEA 3LV5A 3PZTA 3WLJA 3E38A 1DBTA 3W27A 2OT1A 3L21A 2A3CA 2FHBA 4G5DA 4L4OA 2LLEA 1E9LA 2VEGA 1SW3A 4IQDA 3RM8A 1OD8A 1JCTA 2OZ3A 1Q2SA 3S4TA 1JF6A 1TQJA 3A5VA 5XIAA 1SW0A 4H7CA 3S5NA 4OT7A 3T1GA 3QY8A 5G4WA 4S39A 3CYJA 2A6NA 2ZVIA 6A3HA 3IPWA 2GVJA 1C7SA 1P7TA 2OO6A 2ZXDA 2WZMA 4UCGA 1PE1A 1V7AA 3OB8A 1GHRA 1ONXA 2WB5A 3D3FA 1ZFJA 3GDTA 1KCXA 3T09A 2VZVA 3DG7A 4MNLA 4JZ5A 4ZGYA 3ONBA 3IUDA 3B05A 3T4WA 1IXPA 2JE8A 2GFTA 3OHIA 4G7EA 1TWZA 2V5DA 3P61A 3OYZA 4LCRA 1FCUA 5D2TA 3WQDA 8CGTA 5CC7A 3DG6A 2YPIA 2DSVA 4R9XA 3SN1A 3BARA 5AKQA 1ZAHA 1L9WA 3EWYA 2CHOA 1D7FA 3W00A 5HA7A 2WMIA 2QPSA 4IMAA 4PUKA 5I03A 1B0IA 3KP0A 3S1WA 3IK2A 1CZ1A 3SO7A 4JFTA 3G0UA 3PWAA 1XYLA 5I3IA 4GKTA 1SZNA 1KM0A 1XFBA 4A3HA 3PG9A 3BCDA 1EGVA 1HL9A 3SM0A 1I60A 3NQ7A 1PDYA 1FHLA 2PDYA 4XKMA 4OHQA 1SPQA 4RZ4A 3M16A 1DTNA 3PVFA 2G3JA 3LHYA 3TAKA 8XIMA 2IXUA 1TVPA 4K2SA 3WL0A 2E3ZA 1L6SA 2YYTA 1VCGA 4LS2A 3UY8A 3PWIA 1TV7A 1UR8A 5EB8A 3VMPA 3EWZA 4KEMA 2ZUWA 1UPMB 4FIRA 4Y6GA 1GJUA 4RDYA 2PDWA 1Q85A 3OZYA 4EAYA 2Z2AA 1JZ2A 3W73A 2GGEA 5C55A 4RDZA 5DRIA 2IPJA 1OFAA 1TPDA 2WKLA 2ZRZA 3M43A 2BBFA 4PUMA 1EDTA 1S5MA 3GE7A 2GWGA 1UHVA 3VNLA 4L4MA 1QCWA 1DWAM 4MKNA 3K4DA 1DYSA 2ZTJA 5CPOA 2I7GA 3BCFA 3W82A 2NVCA 2Y62A 3A3WA 4EWND 2DVUA 4DUWA 2O4MA 1YE4A 4M81A 3FSTA 3M0LA 3CL8A 2RAGA 3QHNA 3GAKA 3M5ZA 2CLEA 2D0FA 3MMUA 3JZEA 2PTZA 3W29A 1VCFA 2PWDA 4EE9A 3KEHA 2HWGA 3N9RA 5CPLA 3WJWA 3H23A 3CASA 1J0IA 3R12A 3VM5A 3WD4A 2DW6A 1QTWA 1V3IA 1TCDA 3QPZA 2Y61A 4RV8A 3GFYA 3G2GA 1KXVA 2P0OA 1H7XA 4NRSA 1WDSA 1SZEA 4H8NA 3INPA 3N25A 2VEIA 3WYZA 3KW3A 3W3OA 1A4MA 1P5BA 2PZNA 3TONA 2YFOA 3BLFA 2VDGA 3LHVA 2V9DA 5FCZA 4GUIA 2PAJA 1EWEA 3T0TA 2QIWA 1O5RA 3CMJA 4ZO8A 1OIFA 4X2PA 2WKGA 3SRKA 4ZTYA 1F07A 5D38A 7ENLA 4MB1A 3IUHA 3M4HA 3A21A 3N6JA 1PHWA 1LL7A 5E09A 1PYMA 4Y96A 3R8RA 3S5ZA 2IKGA 3E0WA 1D3GA 1UJQA 2ZOXA 1LG2A 4ZO9A 3CV1A 1GOIA 3QZAA 4B5XA 3CYVA 3LZ3A 4NNCA 1JDFA 4LUTB 4DWSC 1GOQA 4KW2A 4N9BA 4XAPA 1YDYA 4U2YA 2GJXA 5BCAA 5T9CE 4IL2A 2OSXA 4AVFA 5BNKA 4S1FA 5DBUA 4ZR8A 4HN4A 1OD0A 2W6RA 2F38A 2VVSA 2C18A 2Y8VA 2QGYA 1UUOA 1H3GA 1XBVA 5AECA 2OEKA 2V5JA 3GLCA 2FTYA 3TYEA 4Y8EA 3KZSA 2ZZ1A 1J5SA 2AGKA 2ZC8A 4B5TA 3E0VA 4M5PA 1LL6A 3NQMA 4JHZA 5CZJA 3O16A 4Q4OA 3AFBA 1BG9A 4GUFA 4J3TA 2PC4A 4LSBA 1A47A 1KWKA 1SW7A 3ZVHA 3CUZA 3TYUA 5FL0A 4LV4A 4H7ZA 3L67A 1CGYA 4XAFA 1G01A 4IJRA 4AVOA 3FA4A 1O60A 1Q8JA 4GQGA 4DXXA 3TN5A 1V79A 2FJKA 4P8UA 2FTPA 1AFSA 2XUCA 1TKKA 3HMCA 4CN4A 4D8ZA 1KBLA 5HQLA 2GGIA 1TWWA 4H6EA 1NEYA 1VIWA 3VUPA 3IWPA 4DVOA 3RLUA 4PODA 1XQKA 2WZIA 3EWCA 4RK8A 1AZ1A 4W7UA 4XKYB 1ZJBA 2YL5A 3ZIZA 1LDCA 3WLIA 1EJSC 3CT7A 4C5YA 1J79A 3FSUA 1WBHA 2Y7DA 1HJVA 3GG1A 4C5ZA 3LXBA 2QUTA 3TDFA 4JQ4A 4C1NA 1XKYA 3HGSA 3POHA 4N6FA 5H2ZA 1G4EA 3NL6A 1O5QA 3PZGA 2RJGA 2C14A 2C6QA 5CSYA 2G96A 1A0DA 5FL1A 1HVXA 4K8GA 2BZNA 2VD8A 2AGTA 3OW1A 1AZ2A 3VYLA 4DZ5A 1JRBA 4Q3MA 1YPXA 2WW5A 2XH7A 1W1VA 4IIDA 2WLYA 3P60A 1I4NA 4D6GA 1S5VA 3MCMA 4M6PA 3ARVA 5CQ1A 3AZSA 3VX1A 2A5HA 1EJRC 4FP1A 2VDIA 1KFWA 2ISWA 5L6UA 1AODA 4LQ1A 1I0DA 3ITGA 2GDQA 1GCYA 3H4GA 4F9DA 3S6TA 4UTMA 2B0MA 1VJIA 4AEFA 1VHCA 4FNSA 1CX9A 4LB4A 3VOCA 3WMSA 3TEVA 4YU1A 4CQ9A 2XWDA 1GUVA 4NZCA 1IQ8A 3IIPA 4FEZA 4MM1A 4KT2A 4OIFA 1W5PA 1A5CA 4A35A 1LF1A 4LOCA 2QUVA 1YPFA 2GQAA 2FHCA 3VFCA 3WZ0E 4GUJA 2YLLA 4EF8A 4LUSA 4O54A 3LCFA 1ODUA 3FV9A 1V6TA 3A9IA 3BLEA 2ATMA 3NM1A 4PCSA 4U33A 2DV0A 1FQ0A 3WDPP 3C3UA 3A22A 2JEQA 3WG6A 2ISDA 1JAKA 3NQ8A 3UG4A 4HNLA 3Q58A 3ABOA 4G2DA 2I9EA 2DQWA 1HUVA 2NW0A 4MNJA 2YA0A 5DXYA 4B5SA 2ZWZA 1E9YB 1Q6LA 3C0QA 4TX8A 5A6LA 4DAIA 3QGAC 3MSYA 1IT7A 4MJMA 3HBLA 1HKJA 3U8GA 3S83A 3MP3A 3TKFA 5HNTA 4L9XA 4DM1A 5DXXA 4OGZA 3LSCA 2B81A 2CPUA 1S38A 2NSOA 3U0HA 4F0HA 1VBJA 3W6LA 3N4AA 2F2KA 2G4FA 1F2JA 2X1TA 4X9YA 2HE5A 1K4HA 5K9DA 3ZYZA 1ZSXA 3AJXA 1TJ2A 2OU4A 3G1XA 4NZ4A 3HN3A 4LT9A 3G3MA 3NDOA 3KBMA 2QDHA 2X05A 2J4GA 3CLMA 3TROA 4BI6A 2V3GA 1XG4A 3EPOA 3BG9A 1E51A 4HB7A 4POCA 3AI0A 3MWCA 1E73M 3N3MA 3STPA 4UFJA 1TB3A 4UOQA 4QAWA 3GK0A 5HUPA 3RGTA 3GDBA 1LT7A 4JFUA 4Q8VA 1KXHA 3TW6A 1TVNA 4B15A 5AC5A 2PF0A 3VNIA 4AHOA 3S1GA 4U5IA 1A3HA 4P7NA 3EDJA 3ANUA 1JJKA 3UY7A 1C90A 1DJHA 3UJ2A 3WJYA 3R6IA 3KM8A 2NWSA 2NVDA 2QAFA 4AIOA 5DN1A 1EA0A 3KRUA 3CQIA 3NQAA 1A50A 1U22A 3IV8A 4TXEA 1E5JA 3CUIA 4MAZA 5LSMA 3QF0A 1QI2A 1VHNA 1GT8A 4MNMA 5A8PA 1K6AA 1W3IA 3A3XA 1VPYA 1EGZA 4RXFA 3ZQ9A 4DLFA 2QVNA 2CBUA 1IWBA 4XTDA 1JGMA 3WMCA 1X38A 1C29A 2GOKA 3AIWA 4ZOCA 1FFRA 1NFPA 1XBZA 4GX8A 4KEZA 1FWBC 3W4RA 1FDJA 1EF3A 2JIWA 1H51A 3SURA 1BKSA 4UMCA 1ELSA 4QS5A 4UIOA 1F76A 1XD1A 4PL1A 3PUDA 4O0ZA 3WKZA 2Z25A 2HZGA 3NQDA 1E40A 1W1YA 4NQ1A 1YYAA 3W7LA 4IMCA 4LAMA 2OB3A 4E4FA 2A4AA 3O2LA 3NSNA 2ZZ2A 2VVNA 3O7UA 2PTYA 3WUEA 2C1IA 4H83A 1ADSA 3G8RA 3RDKA 3R0UA 4MB5A 3BK0A 1XRFA 4H6KA 2GK1B 4CU6A 3FXYA 1MSSA 1EYEA 1HJQA 2OYLA 2DUAA 4PMXA 1SU5A 1QPQA 3K4AA 5A6SA 1C92A 3NUKA 1GZ1A 5E1QA 3V16A 4PUJA 2VC7A 1R2SA 2WSYA 5BU6A 4DYKA 4XK2A 3TSDA 3RRXA 2OX1A 2O9PA 1YBQB 4NAFA 2VGIA 3QRHA 3H24A 1JRCA 1SO4A 1MW0A 1IT0A 3GVVA 1E72M 1FCBA 4WRHA 5D8ZA 3RO6A 4LWWA 3EB2A 3T0DA 4B91A 3QHMA 3I7QA 1W32A 1BVWA 3MI6A 4IJBA 1BSLA 4KH2A 1J12A 3GTNA 2PDJA 4UQEA 3CUFA 1CENA 5T9BG 1ZENA 5CSSA 3C56A 2AQVA 1BXBA 3SQLA 1GQKA 3E0FA 3F4DA 4XZIA 1RP9A 2VO5A 1S5NA 3GTFA 2Z28A 3IJ8A 2PUZA 3SZ8A 2ZXBA 1ZBCA 3OU8A 2X1UA 2O9TA 2XYLA 5IXEA 4JTQA 3VDAA 4IICA 2EPLX 1T40A 3SGZA 1TSIA 2V8ZA 3R58A 1W1ZA 4MPQA 5C5YA 2CZEA 2V5KA 2G8ZA 3F5KA 3DG3A 4B3KA 3A5FA 3LPGA 3N2TA 2OKTA 5C9WA 4J1OA 2QJJA 2OQLA 3W1NA 4O52A 1VRDA 5KINA 2BG5A 2CLPA 3WQOA 4BR1A 4UTWC 1G94A 7XIMA 4UWMA 4ZBCA 5B7ZA 5BWAA 3H54A 3S3GA 4S38A 3S2JA 1MI3A 3AMCA 4YJ5A 4C6FA 3CHEA 3PPFA 2P50A 2Y7EA 3ORWA 1UWRA 3W25A 4UQDA 4A3YA 4HOZA 3HJZA 4P7RA 5HMDA 1CXIA 1DWJM 5F2GA 1J5TA 4FF5A 3K4WA 1KV5A 3MCNA 5AOUA 3ALFA 1K70A 3VXGA 3LGEA 5I77A 2YJQA 3CIXA 3AWNA 1F6KA 4GGBA 1VYSX 3C3NA 3M64A 5MKGB 3W83A 1P0NA 1NH6A 1WXYA 5FI8A 1UZ4A 3U4AA 3AALA 1OSEA 4L6DA 1CTNA 1VFLA 1MW2A 1BWKA 1E56A 1OT1A 2B7NA 3S2NA 4FLOA 2QF7A 3GDMA 2PLCA 3UPWA 1SJDA 3T0AA 2BSLA 3P3BA 1GJWA 1XG3A 5I07A 3QC0A 2G4JA 2PF8A 1UASA 5CZSA 3UETA 2KAUC 3B0UX 4PBFA 2IPWA 3LNMA 1R46A 3CAQA 4HU8A 1B4KA 3GTHA 1H63A 3GC5A 2EG6A 3XIMA 5MHBA 5BRBA 4FHAA 3W01A 3R89A 1H50A 1HXJA 2AAAA 3LHZA 1RHCA 1XISA 2HROA 4XZ9A 4MDPA 1CB2A 1P6WA 5I5RA 1XLHA 1QI4A 3T8QA 1HJWA 2WMHA 2P10A 1E70M 1OG6A 4GIAA 4B2DD 2JF7A 3UPBA 1PCKA 3NXLA 3GG0A 1XLKA 3URQA 1FWJC 1JD9A 5L9FA 3HTWA 3FN9A 4Y9PA 2Q8ZA 4UMAA 4X0VA 3VCNA 1SJAA 3EMCA 3NGFA 3B8SA 2DY3A 4KRZA 5GJMA 4CNNA 1JYVA 2PCEA 3GR4A 3TNOA 5K2ZA 4UTTC 2WPGA 4AQLA 3K2GA 3H4WA 1AVAA 3E0IA 3OZMA 3M6DA 4DB7A 5DBTA 2BDQA 4WIWA 2VX5A 2E28A 1DJYA 1AQ0A 1R7AA 1EC7A 2ZRVA 4GJJA 1UR0A 2QHAA 1CWYA 3NURA 4GNJA 1XS2A 5E9XA 1JZ5A 1J0ZA 2VDHA 2VOTA 4DLMA 1MEIA 3FEQA 1EZWA 2I56A 4ENLA 3HF3A 4QLLA 3W7IA 2CKRA 2PS2A 3MV11 1VFMA 3WK1A 1XIIA 4C6QA 2PDHA 3W7QA 1E0XA 3OGVA 3L4XA 3LENA 3AHVA 1W3TA 4NZ3A 2OZ8A 1OQFA 2NX1A 5D9NA 5REQA 3WH5A 5HMSA 4JL2A 2QLYA 1A5BA 4LGXA 4N2YA 3MVIA 3KX6A 3ZZ1A 2H6RA 3F4NA 3I3EA 3NM3A 2WM0A 4MPKA 3KDOA 1CXKA 2Z4GA 3F4CA 4UFHA 4GFSA 4HMCA 4BKNA 1FDZA 1Q7MA 3CQJA 2D24A 4UTKA 3C2EA 3O06A 2TRSA 3IK4A 2OTDA 1K1DA 3MHFA 2W92A 5A3HA 2ZQ0A 3TTYA 3RF9A 3MSRA 3PK7A 3QR3A 3GNOA 3W2KA 3WLNA 1OF6A 2JKAA 2XN1A 1Q8AA 4YNGA 2OO0A 1KXTA 4I9TA 3TOYA 4MZ1A 2EPKX 1W8SA 3GKAA 1ECQA 3EEZA 3VC6A 1GZGA 3B8WA 3K8KA 3GSMA 1NWRA 3VGDA 5AHEA 1XI3A 4P8WA 2EQDA 1BTCA 2Z6JA 1F7BA 3E5PA 2VNCA 3GM8A 1W9XA 2DT2A 4GK8A 1YXDA 1NIUA 4UTWA 4HBKA 2V3EA 4L6HA 5CH9A 3STGA 4JN8A 4RJEA 3EDFA 3DUGA 3SIMA 2B7QA 3LLXA 3SN0A 3OIXA 4NJJA 3MV01 7PTDA 3SQSA 2C16A 3B3DA 5E6YA 2J27A 3MP4A 4J35A 3FYOA 4C1KA 1FOBA 1GQJA 2W79A 3Q4DA 3ZR6A 4K6AA 3IGHX 5KZDA 3QVQA 5BOEA 1JZ3A 2W63A 3A3HA 5EKYA 4F0LA 2V30A 4B3LA 1GOXA 3W7DA 1KFCA 4Z1YA 4DPQA 3AIRA 3TSBA 1OC6A 3RG6A 5GNZA 2A3HA 4L65A 3PSWA 1PEZA 4F79A 3VU2A 5AC4A 1VJSA 3SCRA 4IIFA 3W2LA 2E5CA 1XH1A 2HEJA 5A2CA 2YCEA 4QCFA 4O18A 4PEKA 1K02A 2VD9A 1U30A 4PCFA 2FB2A 3U6WA 3AS3A 3FVDA 3TE9A 1MWOA 3RN6A 3PZIA 1RD5A 1O5KA 3PZOA 4EANA 2XZ7A 3DXIA 4K1WA 2F6KA 3JVAA 2WQPA 3N15A 2PA6A 4HU0A 3L2LA 5IDIA 3IEBA 3UWEA 1NF7A 4RLIA 1TPFA 1F6YA 1PS9A 2YXGA 3CPGA 1OHLA 4X60A 4QJ1A 4O53A 2PDKA 1UWQA 3ARUA 3VX0A 3TQ0A 3AU6A 1XDJA 4AIUA 1E6XM 2WV8A 1T99A 5A8OA 3NZRA 4ZMGA 3ARSA 1VJZA 3ZLFA 5HJYA 2A7RA 3RILA 2Z0IA 1B3WA 3AXMA 2PB1A 3TQKA 1XD0A 2GQ9A 3QQWA 3G1HA 3KBSA 3L5AA 3B8TA 4LS0A 4Q8WA 3H55A 3UJSA 1RBAA 3EPNA 1QATA 3WQGA 4UTIA 2CFFA 3WFAA 1R85A 1WP6A 1XIHA 1F74A 3GUWA 4F0RA 4YYFA 3DFHA 2PMQA 3HMJG 2RDXA 1I2NA 3LBCA 4AZCA 2OODA 3S46A 2BY2A 4PR4A 2CZ5A 1FCQA 1ML1A 4MJ4A 1S2UA 4BI5A 4KWOA 3KTXA 1XIBA 1KO0A 9RUBA 1DE5A 3VIIA 3PHAA 1PO9A 1MYRA 1X98A 3W22A 4E0CA 3V4BA 4DM2A 4I9MA 1J18A 5KTLA 4AW7A 2D2HA 4HNTA 3GYCA 3GWQA 1R3TA 3NCOA 2WVVA 1E4MM 4ML9A 3TYDA 3P7YA 4AH7A 3AQUA 2DZVA 5EPDA 4ZCWA 4ZQRA 4JHOA 4GY1A 3GVWA 5LYRA 1VBHA 3JS3A 1HN1A 4QEHA 1V3JA 5EBAA 1HGYA 5EBUA 4K38A 4D6IA 3WSUA 1I2QA 3MP5A 1J9YA 1MRQA 1SZFA 1WOAA 2X7WA 4I6KA 3FX4A 2PDFA 1XYBA 3DN5A 1H7WA 3DC0A 4A8NA 1XGDA 3HV9A 2DFAA 4DJFA 5DEZA 5CG0A 4TQTA 3PBUA 4E6MA 1XCXA 5E9AA 2J8FA 2ZX8A 3CEPA 3B06A 1GQLA 1K6WA 3EX6A 1CXHA 2YSWA 5C70A 4DHGA 5ABFA 2O9OA 4IPPA 4QDWA 1JYNA 1PZ2A 3MY9A 1CEOA 3BTNA 1RLDA 4FS9A 3E2VA 4MF4A 5F4WA 4XISA 2VRJA 1AQHA 4J2MA 3ITYA 3FY1A 1UD5A 3GNNA 2XWEA 1XXXA 3BQ5A 3B40A 4PMZA 4D6JA 1AW2A 5A2AA 2PDIA 2JF6A 3PM6A 4EACA 2BOFX 1K9EA 3THUA 1QAPA 4XBKA 1CGXA 1WKDA 5FAJA 3EXTA 3Q65A 1R9ZA 2G3IA 2CWNA 4JTRA 3GDLA 4P5UA 2OX4A 3VNJA 4K37A 5IDZA 4GO8A 1IT8A 1MVYA 3KOYA 3WL1A 4HQVA 2P1FA 2A1YA 4MWAB 4ZEPA 1XQLA 4IQJA 1H7OA 3IANA 1DXEA 3UR7A 4I3GA 4ML4A 1JUBA 2ISSA 3QM3A 3E49A 1EP1A 2W66A 1MFUA 2IUZA 1KV8A 1ITQA 4Z0JA 4UNKA 3JZUA 3TLQA 2EG8A 2ZRYA 4C7FA 1QUMA 1Q6CA 3MQTA 1B5TA 1UP3A 2NV1A 2CHRA 5IM51 4G7EB 3K30A 3E5BA 2PZ0A 3L68A 4IISA 4K1GA 3SI9A 4QNWA 3SUSA 1W9DM 2QCFA 3UGVA 2FYMA 3SCWA 4O28A 1U1JA 2ONEA 1MO0A 4E2BA 4JKMA 1JFHA 2VC9A 2WMIB 2R14A 3T2QA 4MLRA 2NT1A 3R4IA 5IRPA 2AAMA 4MADA 1KKRA 5FJPA 3QV7A 3UU0A 2Q09A 2XDFA 4CCZA 3OVPA 3WLOA 3KOFA 1KRCC 2DH2A 3EWDA 4KWSA 3MYPA 3GS6A 5AHLA 3F2DA 4L61A 2W91A 3GBDA 3EPMA 3WNPA 1BD0A 2BGNE 4ZQMA 3UEQA 3Q45A 4KFPA 1UIPA 2PODA 4D6HA 4FOJA 1P6BA 2E5DA 2XINA 5T8GA 3KHDA 4JGDA 4GIYA 4FO4A 2HQAA 4H9XA 4BJHA 3DKLA 5BW6A 3MBFA 5FEXA 2H8XA 4F2BA 1V6VA 2QMKA 2CHNA 1E6PA 3N12A 4NI3A 4E2OA 1KRBC 1PXGA 4GYPA 3ZMRA 1LQAA 4KRUA 2PLMA 4G56A 2OWWA 3YPIA 4B9ZA 1G0CA 1E4IA 3W7HA 2ESCA 4ROPA 3WF1A 2OKOA 2EJ1A 5TQLA 1CBGA 1S2CA 3LLFA 4UB9A 3LI0A 1Q63A 1EKOA 2FFCA 3W2MA 2ASHA 2P88A 2JALA 1IEWA 1QNVA 3OG3A 4G9PA 3C8FA 1EPXA 2J7BA 3RYSA 3PJXA 3IV3A 1H0GA 3FCPA 1KCKA 1DIEA 4PBGA 5DMNA 4DF1A 3A64A 3IRDA 4KERA 4JTEA 1OX6A 2DVXA 4FR6A 3TTQA 1AA1B 2VZTA 1TO3A 5HWMA 3OPSA 1F6PA 4HU4A 4EIVA 2OOFA 3KLLA 1FHVA 5J5DA 4P7OA 1EH9A 2D1ZA 2TPSA 3KCJA 1EP2A 4G7FA 3MZ2A 4JD4A 5BRPA 3KVKA 1PUDA 2PGFA 5AVNA 1KQZA 4IQLA 4S3KA 1KTCA 4JOMA 1ENUA 2CCRA 5JVLA 2JK2A 3LK6A 4M19A 1WX0A 5C71A 3FJ4A 1UC5A 1K7EA 5D2XA 4L64A 3GHUA 1H61A 1JPMA 2WNQA 1CGTA 1JR1A 1UKTA 3RX2A 3HG5A 2Z29A 2YCIX 1LWJA 4NRRA 1VQTA 4QHRA 1D8WA 1FY6A 1UP2A 3BPWA 3PS7A 2VT0A 2GJXB 1LOQA 3CWNA 3M0JA 3I68A 3FXGA 4CGTA 2WSPA 1NF0A 3ZT7A 1X6LA 3M47A 2WLZA 4QG9A 3TZFA 1JZ8A 4QJ4B 4MZ8A 2V5BA 4CUCA 1ESWA 4L4LA 3WDIA 3KBWA 1TV3A 3G0SA 1LZOA 1SZGA 1YRRA 5CGTA 1H41A 1DORA 4PYSA 4PULA 3SB0A 3S2LA 2AL2B 1M7PA 4MKSA 3SSZA 3MMWA 2IMRA 3NQVA 2IS7A 1XSKA 1Q6OA 3EX2A 3K8MA 5JH2A 2I14A 4RUBA 3TQVA 3VGFA 3WH8A 4FX8A 4YXGA 2J9YA 2IKIA 3V75A 4GJ1A 2OZ0A 4GI6A 1ITXA 3GKFA 4EPEC 4FAMA 3H7VA 4YTQA 5RUBA 1TPH1 3PZUA 1HJXA 2D23A 3UZYA 1LLOA 1EEXA 4J3UA 2BVTA 2ZX9A 3TJ4A 3DHPA 2EG7A 5CPSA 1B9ZA 3N9SA 3AYSA 3UJRA 1NP0A 3B8UA 3W9ZA 2W61A 2FH8A 4YTRA 4W9TA 1RVKA 3KBVA 2VOMA 5FJJA 4I7WA 4WKAA 4EOUA 2BOEX 1AQMA 3NQCA 3URAA 2Y89A 5DMLA 4LUJA 2D2JA 3AHZA 1NDVA 1GOWA 3AIQA 4Q4QA 1P4CA 4C1NB 4NNBA 1F9CA 2ZA2A 5C8BB 4GE8A 3C2OA 3HG4A 1QOPA 3KAOA 1LOLA 1SYTA 2BLEA 3I6RA 4DPPA 3TH6A 2VR4A 2WYSA 1GPFA 3H2AA 2R1NA 4J9JA 3HV8A 4JIEA 1R9YA 2WHKA 4BHYA 4S2CA 1GEQA 2V81A 4QE4A 1W2VA 2PU0A 1P1MA 5DCBA 1KTBA 4F9JA 5ABEA 3W6MA 1FH9A 2JFEX 4RW3A 3CMFA 4NX5A 1TWDA 3L66A 2J78A 3TV8A 1L6GA 2PWGA 1KD0A 4A2SA 4IUOA 1XIFA 4PSPA 1QI0A 4GH1A 4ICCX 4ZOBA 4WSKA 1PX8A 1UD3A 3WJZA 4OOZA 2XSXA 3PZVA 3FFSA 4XBJA 1GZJA 5I2UA 1XX1A 3CH0A 3NVDA 3BMVA 3RR1A 4WR3A 1EX1A 3VZXA 4Q4SA 2DSWA 3R8HA 5LGXA 4NIRA 3FYPA 3AROA 1W5OA 3THAA 4DO4A 3TN4A 1G69A 2OZTA 1X97A 4U5KA 1L2UA 1UD2A 3T6CA 1EOKA 4PMRA 4CU7A 3L4TA 3VIGA 4GBUA 4HSOA 5KMYA 2J7HA 3SAZA 3EX1A 1YTEA 4NVTA 3AICA 1KR1A 1BYBA 1FWDC 4C60A 4O8RA 2V2DA 2WHMA 1WZKA 5DFAA 1XLJA 1G67A 1OCQA 2SFPA 4NP7A 3O6AA 3QR0A 5I3KA 1LRTA 1U1UA 1YNPA 2IQ0A 4LXFA 1J0YA 3CHFA 4XZWA 1NDZA 1MQRA 3K1GA 3EAUA 5AN7A 3XISA 1JL8A 4GZIA 1NY1A 1GVQA 3APTA 1SJCA 1KRAC 1TTQA 4KGLA 4PRWA 2Z2BA 4GVHA 2R1KA 3ARPA 5CJ5A 3UD6A 1MDLA 2D2GA 3AU2A 3KL3A 3GU2A 4XAZA 1SJBA 4HKPA 4PMDA 2JGYA 1SSDA 1JVNA 3CU2A 2Q02A 5HJXA 2ZRXA 4MJZA 4AFYA 1IEQA 3LCGA 2XGZA 4XD5A 3CAKA 1UP0A 3GTIA 3FKRA 2ZADA 3R43A 3C2VA 3WNMA 3CJPA 1TPWA 4FNQA 2EPOA 5GNXA 4V15A 3EDDA 2GGJA 4KESA 1VB9A 4F66A 4FLSA 2Z1VA 3E1F1 4IFKA 4OZOA 1T8XA 4YHGA 3VD5A 2VUNA 1PB0A 2PGEA 3WDHA 3NAVA 3ZR5A 3C2FA 1U5VA 3S6OA 3KRBA 1PZ3A 5FSDC 4J3ZA 3V1PA 1M65A 4AEEA 3TYAA 4MWAE 2DZPA 3LRMA 4UFIA 4W84A 1A5LC 4URIA 1JYXA 1JULA 1QO2A 1FWSA 4GMEA 3FOKA 2GUYA 3F5JA 3KBJA 4E8DA 5E0FA 1NWTA 4OWGA 3BG5A 4JTJA 2BTMA 4ICMA 2QEZA 3D3AA 1TMLA 1QHOA 3LNPA 4NYYA 3G1FA 2YR1A 3SSJA 1C8VA 3NPUA 4LX4A 1QK0A 1K03A 3CQKA 5FF2A 3K8LA 1KGWA 3W1TA 3TTOA 2WPBA 3CO8A 4AZIA 4WZHA 1Y65A 4L56A 3D6NA 4DIAA 3S0CA 5G1MA 4XIAA 4J3VA 4GA8A 2VX6A 1FUYA 2ZUTA 1CDGA 1Q6RA 3IJ7A 1FHDA 5H8UA 1Z32X 2VRKA 4JTDA 1YXCA 4FIQA 4UFMA 1JDCA 1BYDA 4FXJA 1H5YA 4FZIA 4KFOA 1TTJA 1GKRA 3KFTA 1WZAA 2X0YA 5DCEA 1I0BA 1OC7A 4ZOEA 5LA1A 1OJXA 1B31A 1LL4A 4JCMA 1WUFA 3T40A 4EAMA 1JG9A 1RCQA 2VZOA 2VJXA 3VGGA <