4PMQA

Crystal structure of the mycobacterium tuberculosis tat-secreted protein rv2525c in complex with l-tartrate (orthorhombic crystal form)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
204
structure length
204
Chain Sequence
SLGTLLDYAAGVIPASQIRAAGAVGAIRYVSDRRPGGAWMLGKPIQLSEARDLSGNGLKIVSCYQYGKGSTADWLGGASAGVQHARRGSELHAAAGGPTSAPIYASIDDNPSYEQYKNQIVPYLRSWESVIGHQRTGVYANSKTIDWAVNDGLGSYFWQHNWGSPKGYTHPAAHLHQVEIDKRKVGGVGVDVNQILKPQFGQWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tat-secreted protein Rv2525c
publication title Structural studies suggest a peptidoglycan hydrolase function for the Mycobacterium tuberculosis Tat-secreted protein Rv2525c.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 78
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08924 DUF1906 Domain of unknown function (DUF1906)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmqA00
2O9TA 4U2ZA 1XRVA 4BS0A 5FKYA 4TUFA 4PMRA 4PUDA 2WWCA 1UR9A 1CXIA 2XWDA 3SCWA 4LPCA 4JFUA 2BHUA 2VQUA 4AZ7A 4GPNA 2XVGA 2OSYA 1BF2A 4UQAA 1CGVA 2WK2A 1VJSA 4R27A 1R86A 1OGBA 3QGVA 2DT2A 1UUQA 4YHGA 1UD3A 4DWSA 2VCAA 3FW6A 4MJ2A 1C8YA 4J3WA 4B15A 1QHZA 3O9NA 2J7FA 4MB4A 3IK2A 5FCZA 3F5JA 1ZL1A 2WZEA 2BXZA 4M82A 3T0BA 3VGFA 3PZ9A 4GI9A 2E4TA 3CUFA 1EIBA 3N18A 1LJYA 3ARZA 3MUAA 4AZBA 2XYLA 1EO7A 3THCA 1N82A 1UQYA 2WSPA 4W88A 4JFVA 1CXHA 1M53A 3AXXA 4UCFA 3NSXA 2BVDA 1KQYA 6CGTA 1IV8A 1LF1A 1CEOA 1GVIA 1JD9A 5TD4A 1NH6A 2WC3A 4CUCA 2WMHA 3VX0A 2FHFA 4NF7A 1W9UA 1W1PA 5LA2A 1UR8A 3M6DA 5HOSA 1KBKA 1K9DA 2YIHA 2VO5A 5BCAA 3MO4A 2UWFA 2ZX8A 1QI2A 1TMQA 4TVUA 3FNDA 1JGIA 4CCEA 5BRPA 2ZIDA 4MNMA 5CSUA 5D9PA 3AFBA 3SCVA 4JCMA 4B3LA 4UQCA 1LL6A 1HVXA 2CITA 1B3VA 5AY7A 4GINA 3ZJ6A 2VX5A 3L4VA 3AOFA 3VUPA 3CHCA 3CHEA 3GNRA 2ZXBA 2DH2A 4DM2A 1YHTA 4HTYA 1H09A 3VNYA 2J7DA 3RDKA 2JE8A 1XYFA 4W8LA 2WPGA 2UY5A 1UKSA 1V3JA 4CN1A 1B90A 1HJWA 3WEOA 4BQ2A 2DT0A 3N12A 1Q6EA 2Y8VA 2VRKA 1JZ4A 1E0WA 1XSKA 3WD2A 2F61A 3WMSA 4Z2LA 3WF2A 4HA1A 1JD7A 1C8QA 3CTTA 2WMIA 1W2PA 1ZS2A 2EPOA 4PMOA 5C71A 3VDAA 2ZXDA 3LPGA 3PTQA 4UR9A 1SMDA 2VCCA 1EDTA 3L4UA 1HN1A 1CNVA 1V0MA 4TXEA 2J62A 1UR4A 1BAGA 1J0JA 4V27A 4E4PA 4R5EA 3DYOA 3QHNA 1J01A 4BQ4A 3ARTA 2VL4A 1GQJA 3WQ5A 5BXTA 1V02A 2BHYA 3VPLA 1HJQA 2DQXA 2PWFA 2J7HA 1E71M 4PCTA 1WZMA 3AHVA 3AZTA 2XTKA 3CGTA 5E6YA 2V3FA 4FLRA 3HU7A 5A6AA 2QF8A 1AQMA 1GQKA 1PBGA 2VZSA 3N04A 4J3UA 1E3XA 3TTYA 4DM1A 1W3KA 4C7FA 1SYTA 2YBTA 2WMKA 5A1AA 4UZUA 1GHRA 3WF4A 4ACYA 1GONA 3B9AA 4B16A 1KB3A 3BAXA 1S46A 3W6MA 4URIA 3NDZA 3RPMA 3SCOA 2WKGA 3WFZA 2PWHA 4GQQA 4ATDA 1CIUA 4AIEA 1K9FA 1V0LA 3ZIZA 3AYRA 3VD5A 2QMJA 1CLXA 1FFQA 3ZMRA 3CUHA 4PRWA 1KGUA 1NWTA 4GO9A 3MSGA 1W3HA 4HMDA 1HVQA 4AMCA 4TTGA 4E8CA 4MNLA 1GVYA 2YLAA 2WMGA 5D9OA 1JFHA 3WMCA 2JEQA 2ZUNA 1VENA 4QLKA 1LG1A 5AYIA 3IJ9A 1CGUA 4X9YA 5CSYA 4D6CA 3OB8A 1U33A 1DWAM 2CETA 1CZ1A 4CD8A 1V0NA 5JBEA 2FH6A 1JYWA 3A4AA 4PEEA 4ACZA 4MDOA 4CKQA 1W3JA 3AICA 1BYAA 2YL5A 4GKLA 1DP0A 2WBKA 3UR8A 4ZEPA 5EMYA 3W29A 3WUBA 3U5YA 1E56A 4Q22A 1UH4A 3E1F1 3VIKA 1WE5A 4TX6A 1H11A 3CO4A 2CERA 4PBGA 1OCQA 1CWYA 2XFFA 1G94A 1MFUA 3WUGA 1NOFA 1UR0A 2D1ZA 3AIUA 2QMKA 2ZE0A 5E0FA 2DH3A 4HU0A 1VJZA 2X05A 3WD4A 1B30A 3WD3A 4KMQA 4D6JA 5EFFA 1C93A 1BYBA 3AHZA 4MNJA 3MUIA 4NRRA 3WIJA 1V6XA 5IHSA 2Y4SA 5CG0A 5I6SA 1NOUA 2JF7A 1C90A 2J79A 3IAQA 1UWIA 2GJXB 2XUCA 1Q4NX 2OWCA 3AHYA 1UWQA 1ZB5A 2VR5A 1JZ7A 3FHQA 1P6WA 4WIWA 3OLDA 2ZX5A 3GTNA 3J7HA 1JZ3A 1KWGA 3PHAA 1UG6A 2WZIA 4NI3A 1HIZA 3AXHA 4MB1A 4OUEA 2BY3A 1G0CA 1TVNA 2V3DA 1PJ9A 3UERA 3RM9A 2G3MA 1OSEA 1NM9A 3WNMA 3ZT5A 1Y7VA 1IZKA 1E5NA 1XSIA 1H4PA 1WDSA 5AC4A 3DYPA 1E6ZA 1W9PA 1E6SM 1UOKA 3VDHA 5A8PA 4KGLA 1AVAA 4KRUA 3W0KA 4LQ1A 3WUEA 1HT6A 2XG9A 3VO0A 5DMYA 1QNQA 2J47A 2W5FA 3SUVA 7A3HA 2A3EA 1H0IA 3FXYA 5A3HA 3EBVA 3O6AA 1CBGA 5DF0A 3ZT6A 3O2LA 2VC9A 1W3LA 3BAJA 3RCNA 3QOKA 4U3AA 1MQRA 4W84A 2GK1A 3APGA 2W91A 3HJEA 4Y7EA 4XUYA 3OZOA 3KL3A 1KWKA 2J7BA 1OWQA 3VMPA 3TTQA 4TX8A 5CGTA 3TOPA 2GJPA 1EO5A 5D9MA 1GOMA 1XH0A 2AOSA 4JKMA 4MPKA 4AD2A 4PCSA 1V3IA 4AY1A 1AQHA 4AEFA 1TFVA 4KRTA 3FY1A 4GXPA 3U7BA 3VNZA 3VDBA 5JIWA 4LYRA 3VD3A 2Z1KA 3WEMA 2GJRA 2CKSA 4RE4A 3BAYA 4HOXA 4XV0A 2EJ1A 4A3HA 1KXQA 4P7LA 1TA3B 2YA2A 4WSKA 4MTVA 1VFOA 3GM8A 1FH8A 1V02E 2X1IA 2VX4A 4UQ9A 4W86A 2CKRA 1J10A 4XZBA 4FLQA 1KGXA 1E73M 1EHAA 2XVPA 1GOWA 3T2OA 3N9KA 2GVYA 3N1AA 2O92A 4PMXA 3ZJKA 2D23A 4EE9A 1WZAA 1ZBWA 1GPFA 4GIAA 5FOOA 5I78A 5A6KA 3PZOA 1XCWA 3OGRA 2QPUA 3MMWA 3WDQA 4ATWA 4WJXA 2JIWA 1BHGA 3PBGA 2CEQA 1B3WA 3U7VA 2PC8A 3ALGA 4QCFA 4W5ZA 2PWEA 1W9VA 2FGLA 1KBBA 3T08A 1VAHA 1UD6A 2EO7A 4N0RA 5BWFA 2XM2A 3UEQA 3MKKA 3NCOA 1ZJBA 4W85A 4CCDA 1JZ5A 5CLWA 3ARUA 2DSWA 3EYPA 2Y8KA 1UQZA 3ARXA 4MB5A 4AIOA 5EBAA 2J77A 5A8QA 1HJUA 4J3TA 3W27A 3JUGA 2Q8XA 1PZ3A 2FHCA 1H2JA 3RO8A 4CD4A 3GH7A 1X6NA 2D20A 1B31A 2OWXA 1TG7A 1NP0A 1ECEA 4BF7A 5FIPA 2WCSA 4RL3A 3SUWA 4AZCB 1JDAA 3K46A 3ZSSA 3OLGA 4JFSA 5LA1A 4PMZA 2CCRA 5IFPA 4FLOA 1HL9A 3TP4A 4AISA 1HL8A 2QHAA 2WVSA 2XFRA 4BA0A 3T0AA 4FF5A 2W4XA 3EMCA 4PSRA 3WQWA 3SCTA 4AYSA 1JZ6A 5A69A 3VVGA 3VDCA 3M07A 2VMFA 5A8MA 4UFLA 1DWFM 2J4GA 3GYCA 2ZX7A 1B3XA 3CH9A 3ECQA 1C8XA 2JEPA 1V3KA 3B9EA 3T2PA 1JNEA 1CGTA 1W2VA 1W1TA 1BGGA 2E40A 1W32A 4AD5A 1H0GA 4V2XA 1JYNA 4H8VA 1HX0A 3G6MA 3MU7A 1JI2A 2ZX9A 4U2YA 5E9AA 3L4WA 3WH9A 3AS2A 1J11A 1E40A 1WDPA 1Q6FA 1J9YA 1CLVA 2XVKA 3WQ4A 3NIYA 1XH1A 1BSIA 2CYGA 1HKMA 3L4YA 2WAGA 2ZXQA 1L8NA 1Z32X 5C8BB 3D3AA 3CZJA 1JZ2A 2D2OA 1ZBVA 1CXEA 4YHEA 1UWRA 3RM4A 2DEPA 2XGIA 3K4DA 2WWDA 4M29A 2VX7A 1KCLA 4P8XA 2CIPA 3BSHA 1WDRA 4V28A 2C0HA 1GZJA 3WH7A 5ABFA 2QV4A 1G9HA 5KZ6A 4CVUA 3OLIA 4S3JA 5JIPA 1I1XA 3AROA 3UR7A 3VIPA 2WSKA 1UA7A 4PMNA 3EDEA 4YN5A 2G3NA 1HF6A 1NWRA 1UH3A 4NSBA 2OSXA 1U2YA 1XSJA 4BZYA 5I24A 2EXOA 1E6RA 2ZXAA 4W5UA 5FD0A 4AD0A 2ZUVA 3CZLA 5A6SA 2VZVA 1JZ8A 2VRJA 4P8WA 2WW5A 3NYDA 4AZHA 4UOQA 2PWGA 3K1DA 2J7GA 2ZX6A 3GNOA 1M7XA 2WVVB 3OGVA 4AW7A 1CXLA 2VJXA 3BH4A 1JAKA 1LL7A 1X6LA 4GI6A 1X1NA 3SCUA 3BLKA 2CHOA 2Z1SA 5GNYA 1GUVA 1JAEA 1FH7A 3QHOA 5E0CA 5E6ZA 4NZCA 4H8HA 2EPNA 5I79A 3KL0A 2VVNA 3W37A 3K8LA 3EDKA 3BAIA 1ITXA 3I3DA 4P7RA 2BS9A 2BFGA 4DWSB 1GOKA 3GXIA 1PEZA 3ZJ7A 1ODUA 4XB3A 2ZICA 1UD8A 2J75A 2A3AA 1EOKA 4PUEA 4J7RA 1VEOA 1QI0A 2WHMA 4ZXLA 3GBEA 1MW3A 1A3HA 4P7NA 1UR2A 3MMUA 4MDPA 4Q7NA 4AEEA 1WCGA 1BFNA 1L0PA 2WBGA 1MFVA 1BLIA 5M03A 1BG9A 1D2KA 2DIEA 3AIQA 3CLWA 1V3LA 2IXVA 4H8UA 3VMOA 4W89A 2NW0A 4DUWA 1E4IA 4E2OA 1DWJM 3ZR6A 1RD6A 3POCA 4HPHA 1WPCA 2CBVA 3K4AA 1F4HA 1GCYA 4PMYA 4CCCA 2UY2A 2W67A 4AZGA 4AIUA 4D6HA 3GH5A 1UD4A 3LPFA 4HPGA 1DEDA 5KEZA 3UG5A 4D72A 3VGGA 1G01A 3W25A 1E9LA 1V0KA 1ISXA 3WNOA 2VZUA 5CXPA 3T2QA 3T09A 4LYPA 3ZSTA 3BSGA 2JFEX 2WB5A 3WENA 4Z2IA 3UETA 1XD1A 2YOCA 3VOCA 1GQIA 3MSDA 1CXKA 1DWIM 1GQLA 2BY2A 2YL6A 5A6JA 1LWJA 2GFTA 3OLEA 3AI0A 3GXFA 2WVUA 1WAWA 4GQRA 5HPCA 3WBEA 2OWWA 4OOZA 1V03A 4EK7A 3WSUA 1CECA 1QW9A 1HXJA 4QFUA 1ZU8A 1DTUA 3WF1A 4D6DA 3VIFA 2D3LA 4KWUA 1J0KA 1GOQA 1UD2A 1LG2A 4P8VA 3LPPA 3AHTA 2W62A 4M1RA 2FHBA 1NARA 5A6MA 2G4FA 3AMKA 4GZEA 2ZWYA 4OBSA 1MW0A 3L4XA 3UG3A 2E8ZA 1QNRA 2EPLX 2WHLA 4U33A 3U5UA 3WQ6A 1UWTA 1JDDA 2BNJA 3W82A 1E55A 3PZGA 1E6NA 4J28A 2WANA 3PTMA 4TTUA 1Q6GA 3GBDA 4UFJA 1H41A 4W7VA 3GNPA 1OIFA 4JHZA 3AS1A 1BG4A 1B3ZA 3KEHA 4J27A 3WD1A 4YPJA 2WCAA 4ZENA 1PX3A 2C7FA 3B8SA 5CZKA 3SCRA 3FAWA 4ZE4A 4UOZA 3A6OA 4MAVA 4Z2KA 3WFLA 3DHPA 1KCKA 1WP6A 2ZUWA 3CUJA 4BQ5A 1B0IA 3ALFA 3DHUA 5I77A 2WVTA 1C91A 2V5CA 2E8YA 3ZJ8A 1R85A 4UQEA 3II1A 2YA1A 1EHNA 5CPTA 1WDQA 3WDPP 4QLJA 1R7AA 1QW8A 3OGSA 4QAWA 2V3EA 3VX1A 4WK9A 5CJ5A 1QI3A 1ISVA 1DWGM 4DUVA 3EMQA 3NUKA 2JF6A 1FOBA 5DT5A 1E3ZA 4U5KA 3AIRA 2DSUA 2YL9A 3AIBA 3UESA 5D4YA 1W91A 1AQ0A 3F4VA 2YDQA 4M56A 1ISWA 1V6UA 3PN8A 1BYCA 1H49A 4ATLA 1JDCA 5JUVA 3DYMA 2WCGA 1M04A 3AIWA 1OD8A 4PMDA 1UH2A 2D22A 2V5DA 3CUIA 3WDJA 3OZPA 9CGTA 2J78A 5HNNA 2DPEA 2WHKA 1NP2A 2GUYA 2VZOA 1OB0A 3IANA 2O9PA 4ACZB 1V3MA 1M01A 4WSJA 4HOZA 1CGXA 2OLHA 2RGLA 5FL1A 4M8UA 1JXKA 1MXDA 2FH8A 4D71A 3MMDA 4CD5A 2XM1A 1EH9A 1W9BM 2Y2WA 5BROA 1XD0A 4J3SA 3MANA 3T0DA 4DWSC 4FMVA 2J7CA 2IXUA 5A2AA 4JFWA 2YBUA 4JCLA 1BVNP 3CMJA 3PZUA 1E72M 3CHDA 4CU7A 5CPQA 1QPKA 2ZUUA 4AZIA 4PTXA 1GJWA 1DWHM 1VEPA 2WKLA 1RP8A 3NDYA 1KR1A 1US3A 3WH8A 5M17A 4DUXA 1J0YA 2BVYA 1OM0A 3SCPA 1KXTA 3WL1A 4OBRA 4QCEA 5CLTA 2X8RA 5IFTA 4S3KA 3QOMA 3IJ8A 2GSJA 4GZJA 3PZNA 1PIFA 2CBIA 3GZAA 1MYRA 1W9DM 2D24A 1MQQA 4ML4A 4CD6A 2YLLA 2Y24A 4PTVA 4D6GA 5EFDA 3CZEA 2VNCA 1ZJAA 2EQDA 3AXIA 4QP0A 4OZOA 2G8ZA 1QBAA 1JNDA 4HOWA 4JKLA 2W66A 2ZOXA 3AMCA 3VKKA 4EANA 1E6QM 3MUY1 2VQTA 1VF8A 5A95A 3WBAA 3PZVA 2VT0A 2VURA 2WLZA 2VX6A 1BQCA 4X0VA 2F8QA 5ABGA 5A2CA 4OOUA 4EKJA 1PX8A 4HP5A 2J8FA 1XC6A 1UYQA 1CENA 1JYVA 3ZO9A 3S2CA 4UQBA 1EOMA 3OA5A 5M3WA 4H2CA 1J0IA 3CBWA 1TCMA 3RJYA 4WF7A 1VBUA 3WQ8A 1MW2A 2OYLA 1LWHA 2J8GA 1LLOA 1QI4A 3BC9A 4IISA 3M46A 1OT2A 3RIKA 3SCQA 4U5IA 3WDIA 4MADA 2E0PA 2J25A 2GK1B 2WC7A 2DT3A 1SR0A 1JXJA 2X09A 4PMUA 4JZ5A 2VVSA 2ZUTA 5A6LA 4GO8A 3PZIA 4J3XA 4PYSA 4JL1A 4CU8A 3VGHA 2ESCA 4AC1X 3ARWA 2WYSA 4WKFA 4FK9A 3GXDA 1MW1A 2NSXA 3CHFA 2WVVA 3PZQA 3RJXA 3UCQA 1WZLA 1D3CA 4GZIA 1WB0A 1WO2A 1HJXA 3BXWA 5IXEA 3WNLA 1R7OA 3AZRA 1FP8A 1C7SA 1CPUA 3PTKA 3AHXA 3WDHA 3OG2A 2XHYA 2DDXA 2X2YA 3RILA 3BAKA 1V3HA 3HN3A 1GW1A 3CIVA 2GDUA 1YQ2A 2EEXA 4UFHA 3TA9A 4TVCA 2WNWA 2IUZA 5EB8A 3WNPA 1VEMA 2F2HA 4QLLA 2ZUSA 1EQCA 2XSAA 1CYGA 3F5KA 4K68A 3WN6A 3CZGA 4AD1A 3W53A 3ARPA 5D8WA 1CXFA 4IPLA 2HISA 3VIIA 1I75A 3K8MA 4M80A 1HP4A 3SUSA 2G3IA 4OIFA 1UZ4A 4B9ZA 3VD9A 4JAWA 1HKKA 3WUFA 1EDQA 4LYQA 1V6WA 1C7TA 1E4LA 2RGMA 1FHLA 3CZ8A 3L2MA 4WKHA 4AD3A 3WF0A 3M7SA 6TAAA 1TE1A 2BXYA 4E8DA 2V38A 1XHGA 1B9ZA 4D1JA 1CGYA 1W1YA 4TVDA 1IT0A 3RM8A 1QNSA 1W9XA 1QNOA 3W26A 2V3GA 3WY1A 3K8KA 3VD7A 1E5JA 1JL8A 4UFMA 3A4XA 3W38A 1R87A 1O6IA 1UA3A 3WD0A 4W8AA 1XV8A 4D6IA 3ZM8A 3WKZA 1NQ6A 1GJUA 3BAWA 4W93A 4HU8A 4U31A 4F66A 2NT1A 2FGZA 3EDFA 1E4NA 3AMGA 2EPKX 3WELA 5I5RA 2GDVA 1OBAA 2O9RA 1LL4A 1XH2A 1V08A 2CNCA 2MANA 2CESA 4ZXOA 5AC5A 1K6AA 3GDBA 1ZBKA 4WKAA 1OD0A 1GNXA 1OIMA 5HPOA 1QBBA 3SCNA 4A4AA 2ZWZA 4JKKA 5IHRA 4UQDA 2ZUMA 1EQPA 1WNOA 2DSZA 1ITCA 4KH2A 3W4RA 1B3YA 1HJVA 3BLPX 3CZKA 2Y5EA 5D9NA 5HDRA 3POHA 1B1YA 3WDRA 3VIMA 3ARQA 1JG9A 1UZ1A 1F4AA 1QHPA 5IDIA 4OJYA 1OINA 3AQUA 3BCFA 4HMCA 3WEZA 5BXRA 3BMVA 3AZSA 2VR4A 1A47A 1I1WA 3FAXA 3VGDA 5CGMA 5JBFA 4UOJA 1OT1A 1GOIA 2J7EA 5GNXA 3VGEA 5C70A 1O7AA 1BGAA 1GORA 1IZJA 2WM0A 2WXDM 5AYBA 2WZHA 3AISA 2YJQA 1V6VA 3UG4A 5BRQA 3VIHA 1B2YA 3KE0A 3I3BA 3AIVA 4IUGA 2TAAA 2PB1A 3THDA 1XYZA 4W87A 2W63A 4MJ4A 2DIJA 1Q6DA 2B31A 4P8UA 5A2BA 3DECA 4L4OA 2XPKA 4H7VA 1M03A 2YA0A 1ISYA 1VFFA 1EGZA 1MVYA 5E09A 1CDGA 4H04A 1KFWA 2GJXA 5BYWA 4W7UA 1HKJA 1DHKA 4W7WA 4LXFA 3PZTA 5ABFB 1XCXA 5JBDA 5HBFA 4A3YA 5HXMA 2XVLA 1JF6A 4WLCA 2VOTA 2CPUA 3EMZA 1E0XA 2A3HA 1BPLB 1H1NA 4MB3A 1W1VA 1AMYA 1Q6CA 2QPSA 5E70A 3WH6A 3TONA 2XGBA 1QI5A 2XFYA 1JIBA 1MQPA 3A3HA 4CU6A 2EPMX 2D0FA 3FN9A 4C7DA 1PZ2A 4F79A 1H5VA 4PN2A 4UNIA 2VRQA 3AS0A 3ARRA 2VCBA 3OBAA 4PSPA 4Z2GA 3W81A 1KXVA 1SFSA 3WF3A 3GXMA 2DGAA 2O9OA 3WNKA 3ZOAA 3ARSA 5M5DA 2XVNA 1EA9C 3BMWA 4HMEA 5DT7A 2EBNA 2A3BA 1FHDA 2BY0A 3SUUA 4F8XA 1JFXA 3W24A 2VUYA 4J3VA 1H3GA 1MWOA 5F7UA 4NRSA 2HVMA 3S6TA 1PAMA 1VBRA 2WMIB 4JL2A 1BYDA 3AS3A 7TAAA 5A8OA 1K9TA 2PI6A 3L4ZA 1BTCA 2A3CA 3AMLA 2JALA 3PZMA 1PX4A 4LX4A 1G1YA 2D3NA 3A4WA 1FH9A 4UZSA 1FFRA 4Z2JA 2WMJA 5DO8A 4KGJA 1FP9A 3DC0A 4CGTA 5A6BD 5ABEA 4JFTA 1NWUA 3MS8A 1EDGA 3TTOA 2C8NA 3NSNA 4L4PA 4XX6A 3NJ3A 4X0NA 2X0YA 5DFAA 1OGGA 3N11A 3KWXA 2WLYA 5LA0A 1JYXA 2G41A 4HA4A 1V6YA 4D1IA 3A47A 5FL0A 1VFMA 2VZTA 2PWDA 5CPSA 1VIWA 1TA3A 5BXPA 1UKPA 2BV9A 1GHSA 2AAAA 2XWEA 4XZWA 2UY3A 1CTNA 4HZ7A 1QHOA 3SIMA 5BXSA 1J12A 1TR1A 4PMQA 4H41A 1PIGA 5I23A 1D7FA 3SEPA 4P7QA 1HP5A 2E3ZA 2E9BA 3HMCA 1G5AA 4PMVA 1E6PA 2W92A 4HZ8A 1OGSA 4HA3A 3BGAA 2DSVA 3FHAA 3I3EA 4JHOA 3VIGA 3VINA 1E0VA 4RE2A 4W8BA 1C92A 1RPKA 5I0DA 1TVPA 1FA2A 3VD4A 4UFIA 3VIOA 3EDDA 3VIJA 3G6LA 4DWSD 2YL8A 1TUXA 1QNPA 5GQBA 1HJSA 1US2A 3EDJA 5LYRA 3GH4A 1HNYA 4IPNB 3L2LA 3MUZ1 1ZBCA 2PF0A 3KZSA 1KXHA 2VTFA 4IM4A 4AWEA 5DEZA 4AZ5A 4D6FA 2XJ7A 2DT1A 1WZKA 4F9JA 4MNKA 1KGWA 2FDMA 5GNZA 3VILA 4OKDA 2YKKA 4CD7A 3LPOA 3ZT7A 8A3HA 4C7GA 3L4TA 1JF5A 4M24A 3MV11 5ECUA 2XIBA 3ZR5A 2E9MA 2CBUA 2BY1A 5GPRA 1QVBA 3WNNA 5A94A 2VI0A 3WL0A 5I3DA 4AZCA 1KQZA 2XSBA 2W61A 3W28A 2BHZA 4AZ6A 4B9YA 3F5LA 8CGTA 1LQ0A 1E43A 3LMYA 1EXPA 2OSWA 2PBOA 4CVWA 4TOQA 1E6XM 1GOOA 4LGXA 4U3CA 2G3JA 4QDMA 4HZ6A 2YDSA 4MAZA 4PTWA 1UHVA 4UFKA 4CN6A 4RE3A 2D0GA 1J0HA 1UWSA 7CGTA 1U30A 1WKYA 2QLYA 3VTRA 1RH9A 5A8NA 1C3FA 6A3HA 3WMBA 2UY4A 4N42A 2WMFA 1PPIA 1UKQA 3VM7A 3N17A 1HKIA 3AMDA 3BCDA 3QR3A 3VM5A 1SMAA 4CN4A 1E1EA 2CBJA 3N15A 1JI1A 2WC4A 1UD5A 1VRXA 2OYMA 3VU2A 4Z2HA 3WQVA 4B3KA 4AXNA 3N13A 5ABHA 4D6EA 4F9DA 1E15A 3RMEA 1VFUA 2NT0A 3OIHA 3TTSA 2CHNA 3NSMA 3MV01 1UR1A 2E9LA 1CGWA 1ODZA 4M81A 2X0HA 3IAPA 1QOXA 4ZFMA 1E1FA 3VMNA 4EAMA 3CPUA 2J74A 2OYKA 1J18A 1MXGA 3KL5A 4FLSA 4ZE5A 3W6LA 5I2UA 1UKOA 1R8LA 2CXGA 4BCEA 3VGBA 3SURA 1UWUA 1K9EA 4UTFA 5A6BA 1UKTA 3ZQ9A 1NOWA 1VB9A 4PTMA 3CMGA 2D0HA 3D5HA 3QHMA 1RP9A 1XGZA 3AYSA 5D8ZA 2PBGA 1TZ7A 2DSKA 2WHJA 2YDRA 4P7OA 1KR0A 3SCSA 1NWSA 2BVTA 3U57A 3IJ7A 3WH5A 3SUTA 4JIEA 2AMGA 1J0ZA 3AJ7A 5CQ1A 2JIEA 3ARYA 2XIIA 4BQ3A 3B9DA 1BVZA 3AIEA 3ARVA 4AD4A 1E4MM 3CUGA 4GI8A 1E70M 1ESWA 1ISZA
chains in the Genus database with same CATH superfamily
3HV8A 4U2ZA 3IK4A 3GDMA 5F2LA 1UR9A 4R9OA 1R3YA 2VFDA 2XWDA 1YTDA 4HHPA 2DFAA 3S4TA 2B81A 3HB9A 2YYUA 1BF2A 1CGVA 2WK2A 2PGEA 1VJSA 2UV8G 1XDMA 4A35A 3QGVA 1UUQA 3KW3A 1YLVA 3ELFA 4MJ2A 4B15A 2H6RA 2I5GA 3BURA 3DHFA 4ZZ9A 3LD5A 4ORIA 2IPGA 1XLCA 2X1TA 2Y70A 3A12A 4IP7A 5C9ZA 3RYSA 3T0BA 1VLWA 4B2DD 4A8IA 3NGFA 4DF1A 3N18A 2E7FA 4QDWA 3ARZA 3MUAA 4AZBA 5M2FX 1KTCA 4A05A 3NL2A 3THCA 2ASHA 1N82A 1UQYA 4JFVA 3ZWTA 5C9UA 4IJBA 3NSXA 2BVDA 4WSHA 1YYAA 5TD4A 5AHEA 3NVTA 1TPDA 1Y65A 4JTUA 5AHMA 1UZDA 3U8GA 1W9UA 3KDNA 1K8YA 5LA2A 5T9CE 4FNRA 2INZA 2ISDA 3SY1A 4QJ4B 5K4ZA 1QPNA 3MO7A 3FYOA 2YIHA 2OJPA 3GRIA 2ZX8A 3W2UA 1TMQA 1U22A 3TYAA 3IEBA 3TUUA 2ZIDA 3ID7A 3DGRA 3AFBA 4MWAD 1B3VA 3Q37A 2HRWA 4KCUA 1XQKA 4XVEA 1LOQA 1TQXA 4GQBA 2DH2A 5BW6A 2PLJA 1BWVA 4HTYA 1K7XA 4LC6A 1H09A 3B05A 4S2BA 3GTFA 2CLHA 1T6MA 3VNYA 3RDKA 4PGLA 3W7IA 1XYFA 1V3JA 1GYLA 5DQPA 3T0CA 4I7UA 4BQ2A 3N12A 2XGZA 1A50A 1E0WA 1NF7A 2VD8A 4HU4A 3WD2A 3U2CA 2Q01A 3LCXA 3CTTA 3VDAA 4C91A 5ABTA 3LPGA 4N6FA 1EPXA 4PL2A 3L4UA 3WLRA 4C6BA 3RRAA 4B5WA 3KS6A 1DJZA 4TXEA 2Z2BA 3MKCA 2VELA 1UR4A 3MJYA 3TH6A 4N6EA 4E4PA 1G7UA 4BQ4A 2NQLA 3QMTA 4FI4A 1M41A 4O12A 4FNUA 4A2SA 4WVXA 3W2LA 1UP2A 1E71M 2PU1A 3SFKA 3GXTA 1XKJA 4Z1BA 8TIMA 3AZTA 4XKMA 1B3OA 1QRQA 5A6AA 1PKNA 1REQA 1AQMA 1GQKA 1V7AA 2GVJA 2ZZ2A 4C7FA 4XD3A 1SYTA 3DEQA 4S3CA 3SN0A 4C6LA 4WDXA 1R3RA 3U48A 2EPHA 1A5MC 4UZUA 4FXSA 4R34A 3B9AA 4XAYA 1LORA 4JGDA 1TWDA 1OHLA 1V8EA 5KSWA 3LSBA 3WFZA 2PWHA 4LSBA 3H23A 3W1UA 2P3ZA 4G7FA 3AYRA 3VD5A 4E4UA 3ZMRA 1VPXA 3ITOA 3GR4A 4JDBA 1VC4A 3BMXA 4XD4A 3ZVHB 2QVNA 2VGIA 3W87A 1GVYA 3F03K 2GGEA 2YLAA 4OECA 1EZ2A 3O0KA 3WMCA 2ZUNA 2PUZA 2DUXA 1UB3A 2IKHA 1SFJA 3IJ9A 1CGUA 1FTXA 3ANVA 4OHQA 1N55A 3STEA 3NPVA 2P3EA 2ZRVA 1U33A 1WDWA 4OFCA 1JYWA 4ICCX 2ZDSA 4GY0A 4CKQA 2ABAA 4QQUA 1UASA 3OHIA 5EY5A 5EL1A 1RBOB 1F07A 4GFSA 1LZOA 3UA3A 2X2GA 1ZRQA 4IQEA 4XKYB 4IMFA 1K70A 3VNKA 3QV9A 3E1F1 1OG6A 1WE5A 3B0YA 1XLHA 1H11A 1A4LA 1S38A 1Z9AA 1CWYA 3L21A 3L0NA 1MFUA 3G1RA 5C0QA 1UR0A 3GXNA 3PS7A 2OLSA 3UWZA 1FWEC 1K77A 1BWKA 1E51A 3C2RA 5HINA 3NXFA 5EFFA 4D6JA 2BB0A 1PXGA 3HBLA 4UUIA 3OHMB 1LBMA 4MNJA 1UPMB 5XIMA 1SM9A 3ABXA 2J8TA 3CIXA 3EPNA 4JY8A 4GNVA 4TQTA 2D2HA 1C90A 2J79A 2GJXB 1N8WA 3H24A 4Z17A 3PJXA 2VDHA 1JCXA 2VR5A 4IGSA 4OT7A 4PUMA 1AUSL 3FHQA 3MPGA 1H51A 2ZX5A 1U5HA 4LEQA 4NX5A 3S46A 3GHUA 1JZ3A 1I2QA 2WZIA 1HIZA 1GEQA 3WX7A 4MB1A 3MUCA 4J5NA 2BY3A 1G0CA 1PDYA 2V3DA 3GNXA 2Z2UA 3W1LA 1OSEA 3GW3A 3GUWA 1MI3A 3WNMA 1WDSA 1DQWA 5AHIA 4XK2A 5AKQA 3W1TA 4DJEC 1F8MA 1OC7A 1E6ZA 1FQ0A 3QF0A 1LQ2A 3CIWA 4R7JA 1E6SM 4J40A 1UOKA 3CQKA 5TF0A 3NZQA 3NQ2A 1V79A 3QGKC 5DMYA 2ICSA 4BI7A 3RU8X 3PK7A 1QNQA 3CB3A 1SZNA 1LYXA 1Z44A 5HA7A 3USZA 3NL3A 4X2PA 4YL2A 3O6AA 3WO8A 5DF0A 1WYIA 3ZT6A 3O2LA 4CEXC 1W3LA 1Z69A 1JCJA 2NX1A 4NX0A 3HJEA 1YE6A 4EPDC 3OZOA 2PGRA 4HHMA 3NVDA 4TX8A 2AKZA 4JR5A 2GJPA 1EO5A 4GVFA 3EB4A 4QX4A 5D9MA 2AOSA 3ZR4A 4MPKA 4AD2A 4GRSA 1RJQA 2FFIA 1XLLA 3OODA 3VKAA 3VNZA 3LX9A 2Y5SA 5JIWA 4LYRA 3IIPA 1ZFJA 3WEMA 4FNTA 2HSAA 4KT2A 4XV0A 1AJZA 2FJKA 2PZNA 4QSHA 4GIRA 1KXQA 4P7LA 1IGSA 1V02E 4GNJA 1HKVA 1D8CA 1O95A 1FXPA 3E9AA 1EC8A 4XZBA 3WK0A 3TNOA 3IIOA 3S6OA 1NJJA 1A80A 1LDCA 4H9VA 1EHAA 3I7SA 4PMXA 3ES8A 2VC7A 3BJTA 4GY1A 3L65A 1ZBWA 3WCZA 7ENLA 3KBVA 4YCPA 1E0UA 3OGRA 4ATWA 4WJXA 2JIWA 3PBGA 4PULA 2VFIA 3U7VA 4JTTA 4QCFA 3I10A 1JRCA 2FGLA 2PTWA 1KBBA 3T08A 2C0AA 1NDWA 5BWFA 4H8NA 4ILSA 3MKKA 3MCMA 4GGBA 4W85A 2R91A 4O15A 2DSWA 4C6FA 5HWMA 3JRKA 3ARXA 4MB5A 4AIOA 2G95A 4LANA 3LU2A 3ITYA 4J3TA 5FAJA 3APYA 4UMBA 2Q8XA 4US5D 1Q6QA 3LA4A 2OGYA 4XQ6A 3RO8A 1ZAIA 1X6NA 3MKVA 1XDLA 1NP0A 3DIPA 3E2QA 4UTIA 3SUWA 1IWPA 1JDAA 3K46A 3K2GA 3OLGA 3QQ0A 1R3QA 2QCDB 4D8AA 1F61A 4HPXA 1RSCA 4FLOA 4UIOA 4AISA 3M5VA 3NO5A 5A5WA 3ABSA 1KO0A 2QXWA 3E0WA 1BQGA 4HVXA 5CSSA 5FJUA 2Y85A 3EMCA 3H55A 4RX0A 1UC4A 2R6OA 2OZTA 4AYSA 2YXXA 1JZ6A 5A69A 1ITUA 3AALA 2VM8A 3GYCA 2C15A 3CH9A 1DJGA 5DCEA 4FF7A 1DQUA 1C8XA 4W9TA 1JNEA 3Q45A 1PYFA 1W1TA 1BGGA 3W9ZA 1W32A 1H0GA 4Q3MA 1P0DA 1JUEA 1BWLA 1TE6A 1P48A 1VKFA 4H8VA 3MU7A 3TSDA 1S39A 4LJ3A 1BEUA 1S3TC 5A6TC 4LT9A 5GJPA 2NSOA 1A3XA 3G18A 3L4WA 4AF0B 3AS2A 3I4EA 3R8HA 4A21A 3CU2A 3HFYA 1WDPA 1J9YA 5DANA 1BSIA 1XP3A 3EWUA 3TV8A 2WAGA 2ZXQA 5FESA 3QXBA 3EOEA 3QV7A 3WZ0E 1Z32X 2RJGA 5C8BB 3D3AA 3CZJA 1XLGA 3RM4A 2Y8UA 2XGIA 5E9XA 2CHRA 3IS4A 4P8XA 2IPFA 3NOEA 4V28A 5AVHA 4GH1A 4NVTA 1GZJA 1HFBA 2HMCA 1IEQA 3WBXA 4DF0A 5KZ6A 4CVUA 1H7WA 4KWSA 3WLQA 4RZBA 4R53A 3LM3A 5H91A 2WSKA 4YN5A 3GC2A 3NL5A 5LGXA 3NURA 5FJIA 4R7WA 3BG3A 1XIHA 2EXOA 2V5KA 2ZXAA 3TW9A 4H6QA 1F05A 5FF2A 2VRJA 4JQAA 2WW5A 3NYDA 4AZHA 3L5AA 2PWGA 1FWRA 2BSLA 2VJXA 4NT0A 3B0XA 1X6LA 4GI6A 3FK4A 3OJGA 1SJDA 1KM5A 4MIMA 3GVGA 2IKJA 4J2PA 5MKGA 1FH7A 1IF2A 5DMMA 4QSFA 4H8HA 1SUXA 2VVNA 3W37A 1F9CA 3EDKA 1HUVA 1ITXA 4NZFA 3PBMA 3CNYA 2BS9A 2BFGA 4DWSB 1ODUA 2VDIA 3M6YA 3W71A 2F38A 2J75A 4WRHA 4M6QA 3C8NA 1VEOA 1QI0A 2R8WA 3BG5A 3FX4A 3OW1A 3E96A 3W7RA 3U2EA 3BGJA 3G2GA 2ZDRA 2PDPA 4HD5A 5LXXA 3VNLA 3V35A 1OFAA 1SGJA 4I6VA 1VBHA 2DIEA 3CLWA 2V8ZA 3WJZA 1FWIC 4DAFA 2VYOA 1F4HA 1GCYA 3MWCA 2UY2A 4CCCA 2ZVIA 2W67A 1O1ZA 3URAA 1WXJA 3GH5A 1ICSA 2PP3A 1SO3A 2POZA 3CH0A 3W25A 2I17A 1E9LA 3LCFA 1V0KA 1XLBA 5U4NA 5IOBA 2VZUA 3T2QA 3T09A 5AB3A 3IVTA 2QUUA 4CQ8A 1PCKA 3B9NA 3WENA 2B7PA 2XDFA 2EKCA 5D05A 1ZCCA 2NLYA 1NFGA 2Z1VA 1TV4A 2BY2A 1LWJA 3UXLA 4BWLC 2OG9A 4MKVA 6ENLA 3BW4A 3AI0A 1JRBA 3Q67A 1OABA 4OOZA 4BKNA 3QMSA 3HG2A 4EK7A 3S2NA 1QW9A 4RNIA 3MVTA 1ZU8A 4ZTYA 4FO4A 2WNNA 2BP1A 4KWUA 1LG2A 3LPPA 1F74A 4KEVA 2KX9A 4FALA 1EC7A 1DTNA 4FIRA 4O16A 2V5LA 3U4FA 1E0TA 1UIOA 3G1HA 5C6MA 3RXZA 5EA9A 4J4KA 1EEXA 1MW0A 4LCSA 3W2KA 4U33A 2AL2B 4FOUA 4MGGA 5C7VA 5LNWA 5K9CA 4K39A 1FDYA 3PZGA 4J28A 3PTMA 4FP1A 2FMNA 3SQSA 4JHZA 2PWUA 5D2XA 1XPGA 4NY2A 1KM2A 4DJED 2QYGA 2AQWA 4IMAA 3SCRA 1HO1A 4GISA 1EJUC 3SR7A 1Q6LA 1WP6A 2ZUWA 3ABOA 3DHUA 3M0IA 4FPSA 1LRNA 1LRQA 2WVTA 2P0OA 1MEWA 1X1ZA 2YA1A 1EHNA 2WOQA 4E0CA 1RJRA 1X96A 3URNA 7TIMA 2PAJA 4WK9A 3MP4A 2Y62A 3Q4DA 3G1XA 4ENLA 3DFHA 4UTHA 1W1IE 3EMQA 2IPJA 3NUKA 1FOBA 8XIAA 1J2BA 4U5KA 2DSUA 1SPQA 4WJEA 3BPWA 2YL9A 4PB3A 4O17A 4HN8A 1V6UA 1HW6A 3HPZA 1YDYA 4Y8EA 1G4SA 1GYMA 4JTFA 3VA8A 3DYMA 3W7GA 2WCGA 1M04A 4FR1A 2A5HA 3OZPA 2J78A 3RLHA 1ZCOA 2WHKA 2VZOA 1I0DA 3DOPA 3ITGA 2O9PA 2Q6ZA 4ACZB 4QDPA 2OLHA 4H01A 3SN1A 5HJXA 1YX1A 4D71A 3BARA 3MMDA 3XIMA 4CNPA 3TLLA 1EH9A 3N6QA 2YX0A 5BROA 2CZFA 4MPQA 2E25A 3MANA 2J7CA 3TR2A 4JFWA 1BVNP 4EWJA 1YNQA 1LUCA 1K3UA 3CL8A 3CHDA 4IXXA 1QPKA 4IQLA 3WQOA 4AZIA 4M3PA 1A5NC 4PTXA 1GJWA 5G2HA 1RP8A 2A2IA 3IV8A 1KR1A 3V1HA 3WH8A 1PCWA 3ZWSA 4XAFA 3SI9A 1I4NA 1KFCA 3UG8A 2NVAA 2IMRA 4AXKA 3PBVA 2CLPA 3JS3A 2TPSA 4GZJA 5IDZA 3N2OA 3VABA 3TAOA 4IJCA 1MYRA 1ONWA 4WXZA 2D24A 1MQQA 4ML4A 5DCBA 2C1IA 2Y24A 4NILA 4XUGA 2CZVA 2EG7A 3QTGA 1DIDA 1ZJAA 4QISA 4QP0A 1AW5A 1QBAA 2QEZA 1JNDA 4HOWA 1L6GA 1SO4A 3IJQA 3VKKA 4IFKA 4EANA 1E6QM 3A21A 3MUY1 4HSHA 8XIMA 1JUBA 3WBAA 3QQWA 3PZVA 1EJXC 2X1UA 3R89A 5ABGA 1K8ZA 4LTSA 3S83A 4HP5A 3KDOA 2J8FA 2IS7A 1UYQA 1CENA 3NO3A 4UXDA 1PE1A 4NZ5A 5CZ0A 1DJIA 3WLLA 5M3WA 2HJPA 1WKEA 1J0IA 3TQVA 2XN0A 4GBUA 1TREA 4LVBA 4ERIA 3HQNA 5FJTA 1FWTA 1MW2A 1XG3A 3L67A 4IISA 3M46A 3A5VA 1OX4B 2HE5A 1OT2A 3SCQA 3WDIA 1XBXA 4IGNA 5DMLA 3EX3A 5I3FA 1SZFA 4PMUA 3N6HA 2DW7A 3V5OA 1EWDA 2VVSA 4ZB5A 4GO8A 4J3XA 1WA3A 4CU8A 3VGHA 3A22A 3ARWA 1RXOB 3N34A 1XIMA 4Y6GA 4L1GA 1MUWA 3EOLA 1WO2A 2C71A 3LHUA 3PTKA 1QPRA 3UPWA 2X0SA 2RDXA 1M7OA 1GW1A 3DKLA 4PRTA 3O6DA 2BOGX 3RLGA 3HPAA 4TVCA 2CLIA 2ISVA 1SO6A 3W1PA 4NAEB 2ZUSA 1FWJC 1CYGA 1S2UA 3WBWA 3CZGA 4NHVA 3W53A 4IIEA 2HISA 3QJAA 3SUSA 3UVIA 3W1MA 4Q33A 5HATA 4HZMA 4NU7A 3GKFA 3S5SA 4B9ZA 1WQ5A 1XBYA 1HKKA 1YNYA 5CC7A 4IIBA 1I9CB 4R88A 2DY3A 3T0TA 2TODA 4AD3A 4YTUA 3M7SA 2R14A 4TO8A 1UBPC 2G3FA 5AYZA 4KCTA 3QV6A 4E8DA 2V38A 3TN5A 3S1UA 4D1JA 3BICA 4R33A 1JPMA 1CGYA 2CLMA 3AWNA 3REQB 3KFTA 4UFMA 4EIVA 3A4XA 1R87A 3CAVA 1YRRA 5BZAA 3WKZA 1NQ6A 2X7VA 1GJUA 3WK1A 4HHHA 1ZALA 1V77A 3OVRA 3SB0A 4JN8A 1XH2A 4C6CA 2MANA 5AC5A 3L12A 3R0UA 1QBBA 3SM0A 4UQDA 1NELA 1EKOA 3TIMA 4GK8A 2Y5EA 5D9NA 5HDRA 8RUCA 4O1CA 4JHMA 3THAA 3E49A 3VIMA 1EPVA 3AYTA 2E09A 1LRTA 4PL1A 1UZ1A 1AH4A 3PWIA 4N9CA 3BCFA 3MBFA 1U1UA 4IFOA 4IX0A 2Z26A 2POTA 3GG1A 2OCZA 4E3TA 4CQBA 2DVTA 5AHLA 1OT1A 2ALRA 2G96A 4A8LA 5C70A 3NFUA 1IXNA 1GQNA 2WXDM 4L6OA 4NIRA 2ONEA 4Z42C 1Q8JA 1XWYA 2PRLA 5BRQA 1IT8A 1B2YA 3OP2A 4F0MA 4LCRA 5DLCA 2FVKA 2ZFAA 4BFAA 1VYPX 4W87A 2W63A 2DIJA 4P8UA 3QRHA 1DE5A 2C79A 2XPKA 5BOFA 4H7VA 2FZ9A 1JDEA 1ISYA 2DZPA 4YTQA 1KFWA 3VZYA 1UMYA 3CUXA 4W7UA 2WZMA 4W7WA 1EJ7L 4H00A 5ABFB 5HBFA 1RLCL 4DO5A 3RNDA 4PCPA 2IPWA 5HXMA 4YMZA 3KX6A 3CPRA 1JF6A 1OFDA 2VEKA 1I0BA 5CBJA 4LRTA 1BPLB 4MB3A 1Q6CA 2QUTA 3W1AA 4C6MA 3O6YX 4CU6A 3IUDA 1TIMA 1TZ9A 3FN9A 4PN2A 5FEZA 4UNIA 4AYGA 2VRQA 4HA0A 4C6EA 1R3SA 4KFPA 3ARRA 1HG3A 2VCBA 3OBAA 2HK0A 1KXVA 2F6XA 4HN4A 5G1TA 2I7GA 2O9OA 4JN6A 3BMWA 4PMJA 1Z7AA 2A3BA 4CQCA 1YBQB 2VUYA 5F7UA 1H3GA 1MWOA 4B2DA 2HVMA 2DQWA 4UTWA 1K9TA 2PI6A 3L4ZA 3GE7A 3PZMA 1PX4A 2FB2A 3OQEA 1YDOA 4Z2JA 1TPH1 2WMJA 4NJHA 1FP9A 2GPTA 4MY9A 4XBSA 4JFTA 4PRRA 3MZ2A 3VCNA 3MS8A 1TX2A 4AY7A 2QPXA 3UGRA 3NQ8A 3NSNA 4L4PA 3NJ3A 4X0NA 2X0YA 5DFAA 1K7EA 1OFQA 2YDAA 4A29A 2C14A 1JYXA 4HA4A 5HWJA 3V0UA 1GVQA 3A47A 1JCNA 1VFMA 2VZTA 2E5BA 5CPSA 4KEMA 1J8VA 2VP8A 3R8GA 2BV9A 1GHSA 2Q8LA 1CTNA 5I3KA 1TR1A 3TAKA 1VPQA 5I23A 4H83A 1H7PA 3SEPA 1HP5A 2E3ZA 3G1SA 1G5AA 2IKGA 4HZ8A 1OGSA 4HA3A 3VIGA 3FHAA 3I3EA 3MZNA 3O3RA 1E0VA 1SQ7A 1KLZA 4Y9AA 1SJBA 3KVLA 3KOZA 5REQB 5I0DA 5AFDA 1L6SA 2QCNA 1IEXA 4XZHA 4UFIA 2QAFA 1XL9A 3VIJA 2YL8A 4G2DA 1QNPA 1OFPA 3EDJA 5LYRA 3GW0A 1HNYA 4IPNB 1MNSA 4LAUA 2XINA 2Z4GA 3U3HA 1S2VA 3R25A 2ZRXA 3TZNA 2E6FA 2LLEA 2P8CA 3H7VA 5CJNA 2XJ7A 4UB9A 2OX1A 2WSYA 2FDMA 4AB4A 3W1XA 2YKKA 8A3HA 5D2TA 3L4TA 2QVHA 4K38A 2BY1A 3WQCA 3IUIA 3WNNA 4MUPA 3B06A 5A94A 3W28A 3B0VC 3PC0A 2OSWA 1GOOA 4HZ6A 3LGDA 3RCYA 4XBKA 1W5QA 4PTWA 3Q94A 2Z00A 1F8IA 4YWSA 2BXVA 2V30A 3PUEA 4BJHA 4MY1A 4C90A 1C3FA 3WMBA 3NNTA 3VM7A 5I03A 3FVMA 3VC5A 3GZ3A 3UXIA 3M0VA 3RN6A 1WXYA 1SMAA 4CN4A 2CBJA 1RJPA 1TV2A 1TJ1A 4ML9A 4L9XA 1VRXA 3NA8A 3LG3A 4G8TA 2NQHA 4AXNA 5ABHA 2ZVRA 1VHNA 1U83A 4F9DA 2E1WA 1VFUA 2NT0A 3SJ3A 4ZO9A 3O1NA 4PR4A 3CJPA 1CGWA 1ODZA 5RUBA 1IWAA 3WJSA 2X0HA 4XAZA 2BGSA 5F4XA 1NTHA 2VFHA 2B7QA 1JPIA 1AK5A 5AC6A 2CWNA 3DXIA 3KL5A 4ZE5A 1WKDA 3W6LA 3QR0A 3M5ZA 1R8LA 5AHFA 2VC5A 3SURA 5HMSA 4UTFA 2R24A 1XISA 4PTMA 3CMGA 3CC1A 2FTWA 3AYSA 3BQ5A 3L2IA 2VHLA 4KWWA 5D8ZA 1TZ7A 4LNCA 2WHJA 1YDNA 2BVTA 3IJ7A 3WH5A 1T41A 1MUMA 2JIEA 4JN7A 2DVUA 1THFD 3B8TA 4RZ4A 1RQBA 4WY0A 4Q7IA 1DE6A 4JTKA 4K8HA 4CCZA 4AD4A 3CUGA 1HTIA 4GI8A 1ESWA 4FNQA 4DO7A 1QJWA 2O9TA 4GX9A 5HQMA 2GJLA 2ZTKA 4S3EA 4BS0A 1ZJHA 4PUDA 4GIEA 2WWCA 3R0KA 1OFOA 1PSCA 3URBA 2VQUA 1TTPA 3BE7A 3P0WA 4I6KA 2XVGA 4UQAA 3P0XA 3PFRA 4R27A 2NWSA 3DUGA 4IMDA 2DT2A 3KRUA 1IYXA 1P7TB 1XYLA 4C5ZA 4JOMA 4IP5A 1TELA 5CCZA 4J3WA 4GFIA 4IH3A 4JX5A 4MB4A 5CZJA 2CLFA 3IK2A 5FCZA 2GZXA 4HCLA 2SFPA 4EWND 1RA0A 3VGFA 1FWWA 3MYPA 4ICMA 4GI9A 2E4TA 4AC7C 3CUFA 1VCGA 1O68A 2V2CA 4F0RA 2FZMA 3KRSA 2WSRA 2QJMA 1KFKA 5DN1A 3MJMA 4JTDA 3MI3A 4LS0A 2WSPA 4ONVA 3KAOA 4UCFA 3W01A 1LF1A 2F2KA 1GVIA 1JD9A 4Q4KA 1UJQA 3N2TA 1GJPA 1NH6A 3ME3A 3WLPA 5LHFA 2RDTA 2FHFA 4E8GA 2A79A 4NF7A 4Q8OA 4LNYA 4ZODA 1UR8A 3IIZA 3M6DA 5L6UA 1JDFA 2FQIA 1J6PA 1T40A 3UWYA 1KBKA 2ZA2A 1ZP4A 1K9DA 3MO4A 4C60A 2PA6A 1QI2A 1R30A 5J04A 5TBOA 4CCEA 5BRPA 4GUJA 5D9PA 3SCVA 1XRSA 3R1ZA 4B3LA 3DH7A 3LHWA 3BJSA 3L4VA 4ZGYA 3VUPA 3CHCA 3CHEA 1FKXA 3I6TA 1R9YA 3E12A 3H4XA 3FKKA 1UKSA 3LEPA 1HJWA 3WEOA 2HQAA 1KKRA 3OVQA 1Q6EA 1MZHA 4GABA 4FOKA 2QT3A 2F61A 3WMSA 4HA1A 5HANA 1JD7A 2BGNE 3KOFA 2WMIA 1ZS2A 4GLEA 1EWEA 1F76A 4FIQA 1SMDA 4FOJA 6ALDA 3VXGA 2I16A 4JY9A 2J62A 1H61A 4FNPA 1TWSA 3I7RA 3NZ1A 2P10A 4R5EA 1DKWA 3DYOA 1J01A 4Y2WA 5DCDA 3ARTA 3P93A 1WUEA 2GVLA 5BXTA 1V02A 1XC4A 3EA3A 2BHYA 7REQA 3YPIA 2PDBA 2W0UA 1VBGA 2V3FA 4US5A 1KM6A 4QTGA 1J5SA 3HU7A 1WAUA 2QF8A 3FA4A 1ZZMA 4G5DA 4LUYA 5D2YA 2VZSA 4J3UA 3LBCA 3TA6A 3TTYA 4AVFA 3FJ4A 4AFYA 2X40A 2XIJA 4CNUA 3WF4A 1X98A 2VEFA 1PTGA 1D9EA 3QLLA 1BXBA 4PZVA 4PE8A 3VOFA 1UPPA 3UZYA 3SCOA 2WKGA 3JR2A 4OU1A 4K36A 4ATDA 2GQ3A 4LAKA 4LS2A 4LVAA 2QMJA 1FFQA 4GIYA 2REQB 3CUHA 1Q45A 1KGUA 1NWTA 4RNFA 3D3FA 1HVQA 1Q85A 1EA0A 3RPTA 3AO0A 3UCDA 2OLAA 3LXCA 5D9OA 4ZL1A 1JFHA 2FJUB 2JEQA 4IHCA 4CNTA 4QLKA 5MKGB 4JX4A 1X39A 5CSYA 2HE8A 4D6CA 2CXEA 4JIHA 1EB3A 3M0JA 1DWAM 4IWWA 4CD8A 1WBHA 1ITQA 1V0NA 4QAIA 2FH6A 1F73A 1AA1B 1NAL1 3AICA 1BYAA 3DFSA 1KFBA 2WBKA 1XUUA 4NUWA 4PA8A 1MSSA 4JEJA 2PU0A 4ZEPA 5EMYA 3WUBA 1YXDA 5CBIA 2H9AA 3IV3A 5T9BG 3P5YA 3UYIA 1CB2A 3BLIA 2DH3A 4I5XA 4S39A 2EG6A 3VK5A 2GL5A 4MZYA 1C93A 3ISIX 4NKCA 2BOFX 2OEKA 2R94A 1D3HA 1FWCC 3OOQA 3LLFA 3GS6A 3MUIA 3I6RA 1V6XA 4WX2A 5I6SA 1T96A 2DJXA 3W1QA 3GTXA 2QJHA 3PG8A 2XUCA 4XZNX 2OWCA 1UWQA 1ZB5A 1UUMA 4XO7A 4LUIA 4JIIX 2PDFA 3EX4A 4AVNA 2VWSA 3QZEA 4KESA 3PVFA 4OUEA 3GIYA 5T91A 1QUMA 3UA4A 1TJRA 3UERA 3KHDA 5AECA 2PDLA 1A5LC 3LCGA 4TR9A 2OQHA 3ZT5A 1E5NA 2TMDA 1P6CA 1H4PA 5AC4A 4HJFA 4ICNA 4XAPA 2PLCA 3OVGA 4N9BA 2ON3A 4G7EB 5TNVA 1W9PA 2FZNA 3QPYA 3S2LA 3VDHA 5A8PA 1WX0A 4KGLA 3W0KA 4LQ1A 5BWAA 3WUEA 5F2IA 4IG2A 4HKPA 2QGYA 4PC8A 2W5FA 3SUVA 1ZGDA 4R85A 3R5EA 4IF2A 5GJMA 3IUHA 3QY6A 1XXXA 4I5RA 5DY3A 2ZADA 3MT1A 4H9ZA 4EPEC 1G4PA 1ZY9A 3M1ZA 4REQA 2A85A 4FSAA 3BAJA 3S0CA 4OWGA 4NZ3A 4W84A 3APGA 4Y7EA 4XUYA 3C3NA 2E5DA 3HOJA 2NXIA 5FF3A 3H2FA 3TTQA 3LMZA 3TOPA 3T8LA 1MNZA 2GGJA 1TO3A 3H26A 3OYXA 1PV8A 1XH0A 3SN4A 3TYDA 4PCSA 2XZ7A 2V69A 5BRBA 1AQHA 2PZ0A 4GXPA 3U7BA 2ACUA 3NQDA 2YXOA 3HG3A 2TRSA 4IIFA 3VD3A 4S2CA 2GJRA 1EF3A 1KRBC 4PH6A 3ZXWA 1TA3B 4O50A 3CT2A 2YA2A 4KEUA 1RR2A 3GM8A 3OEXA 2B7OA 1JCLA 2FLIA 4FLQA 3RR1A 4NZJA 4Q8MA 3SADA 2DU2A 2F6KA 1GOWA 1RALA 2O92A 3ZJKA 2GQ9A 3SO7A 1VD6A 4TMCA 4S38A 5FAGA 4ZTXA 4GIAA 5FOOA 5I78A 4C1KA 5A6KA 3F2BA 2CEQA 3A3WA 3G22A 2PC8A 3PFMA 4INFA 1FUYA 3BZGA 1EP2A 3UPBA 3CWNA 2XM2A 3UEQA 1ZJBA 1AZ2A 2ZC8A 4DIAA 5XIAA 4AY8A 1UQZA 2C91A 5EBAA 2J77A 5A8QA 2Y88A 2DV0A 4DELA 3R11A 4IT1A 1Q7QA 2E77A 3IPWA 1H2JA 4GD0A 4ZQMA 3ES7A 5AYYA 1TG7A 2PDGA 4DJEA 4Q4OA 4AZCB 1Q2RA 3SZ8A 1GVOA 1TRIA 5IFPA 3E38A 4F0KA 3TP4A 3F2CA 1HL8A 2WVSA 1PL9A 2XFRA 3LTYA 3T0AA 3N4FA 2V82A 4O0QA 5K2ZA 1IIGA 5H8PA 2W4XA 3RGTA 2RDUA 1S1PA 2YZRA 2XISA 1OFBA 4ZOEA 4F4RA 2YCEA 3VDCA 5I00A 1FWDC 1UMLA 1AZ1A 4UFLA 5A8MA 3CQJA 4NZ4A 4ROQA 4H9XA 9XIAA 3BLLA 4NJGA 3LHZA 1DV7A 1B3XA 1RHCA 2RHGA 4DBEA 4GUHA 1XLAA 3GUGA 3ICJA 3B0UX 3FJLA 2VEGA 1CGTA 1W2VA 3VNMA 2ZZ7A 3V7PA 4AD5A 1QMLA 2CLKA 2Y7FA 2VDGA 2HZGA 5I09A 4ZA0A 3DG6A 2ZC1A 4HIBA 4HNLA 5E9AA 2E28A 1R0MA 3WH9A 1V5XA 2QKFA 1E40A 1Q6FA 3WQ4A 3NIYA 5DXXA 2CYGA 1LTDA 5K9DA 3L4YA 4Y9OA 4GJ1A 1L8NA 2HVOA 4UTTA 2F9RA 4RXGA 1JZ2A 1UWRA 1RBLA 2DEPA 3M0KA 2WWDA 1M5WA 2VX7A 1P1MA 3EXTA 2Z7GA 1O12A 5A8GA 1WDRA 4EX4A 4O1AA 3NEVA 3BLFA 2QV4A 1G9HA 2GGGA 4S3JA 5JIPA 1EP1A 3IRDA 1DJWA 3BK0A 3NPWA 3KWSA 3VIPA 3FGCA 3EDEA 3QZAA 4C1LA 2E1DA 2BODX 3VKCA 1UH3A 3ABQA 1QFEA 4NSBA 2OSXA 1U2YA 4BZYA 5HUPA 1QCWA 3O06A 5I24A 1OYAA 1E6RA 1V4YA 3HFTA 4W5UA 5FD0A 4AD0A 2ZUVA 1KFJA 3N4AA 4UTWC 1JZ8A 2J6XA 1ME7A 1FWHC 4UOQA 2J7GA 3LTPA 1TRDA 4UC5A 3GNOA 3OGVA 1CXLA 1JAKA 3FEMA 2YGYA 3BLKA 5FA5A 5HQEA 2OKTA 1HZYA 2Z1SA 3NYZA 1JAEA 3CEUA 1M7JA 1YMYA 4JICA 3QHOA 5E6ZA 1DVJA 2EPNA 5CPOA 5I79A 4Q4SA 5DRCA 3BAIA 1B9BA 3I3DA 1RQHA 1W8GA 3BW3A 4P7RA 3O0FA 1GOKA 3GXIA 1PEZA 3ZJ7A 2ZICA 1YTKA 3EXSA 5B80A 1QOPA 1EOKA 1FRBA 4PUEA 3BLOA 4J7RA 2G50A 1RK5A 4P7NA 4L80A 4MDPA 4DX3A 3FYYA 4AEEA 1A5CA 4B5VA 1MFVA 5M03A 3AIQA 1V3LA 2IXVA 2VEPA 4H8UA 1DWJM 4F3HA 1W3NA 4HPHA 5MF5A 4MYAA 2YPIA 3PANA 1PUDA 4M0XA 4HGXA 5AC8A 2CBVA 3K4AA 3DESA 2OODA 4Q4RA 1L6FA 1AL7A 4Q8UA 4P61A 2HS6A 3B4YA 2YBVA 4AIUA 1RCOB 3UG5A 4L6DA 3W7QA 1CX9A 2GUUA 4I9TA 3WNOA 1ISXA 1Y5XA 3T4CA 4LYPA 3LHVA 2QCHA 2JFEX 2WB5A 4K37A 3U6WA 3U4AA 4NYUA 5CC6A 1XD1A 2YOCA 1GQIA 3OYZA 4PTDA 4RK8A 1FY6A 3GTIA 3LQLA 4GYPC 4NAFA 4BF9A 3S8HA 3TEVA 2JGQA 2GFTA 3GXFA 1WAWA 2OR2A 4O19A 1QO5A 2PCEA 5AC7A 1V03A 2V5JA 3WSUA 1KTBA 3R12A 1CECA 4QFUA 4UR7A 1DTUA 4H6RA 2YCLA 2D3LA 1G69A 4P8VA 4N7QA 3MDWA 1B5TA 4M1RA 2F6UA 3VOIA 3T4WA 1SZEA 1O5QA 5A6MA 3T40A 3PPGA 4MYXA 3UG3A 4B4FA 2E8ZA 3WLIA 3G8RA 2WHLA 2INFA 1DIEA 6XIMA 2DUAA 1ADSA 1PHQA 1UWTA 3PUGA 1E55A 4GHRA 3B3DA 2WANA 2OU4A 4TTUA 4AG0A 4UFJA 1UIPA 4MZ8A 4W7VA 3HG5A 2IKIA 1Q6RA 3KEHA 4MFDA 1KBLA 3BGGA 1M65A 1EUNA 4ZE4A 4FXFA 4DI9A 4Z2KA 2HXUA 2QCGA 1IWBA 3QR1A 3KOXA 4AHQA 3OU8A 3ALFA 3SRFA 3EOUA 1C91A 1SW7A 1W0MA 4UQEA 3II1A 2W9MA 1WDQA 3WDPP 2P88A 1K02A 3DI1A 1Y5WA 3OGSA 2OOFA 4PUNA 3VX1A 2AMXA 5B7ZA 2P53A 1XLMA 4DYJA 1QI3A 1ICPA 1C8VA 3N3MA 1LOSA 3LV6A 3R7MA 4DUVA 3IVUA 2JF6A 5DT5A 1XFBA 1F2JA 3GNNA 4NNAA 5DXYA 3AIBA 3ZLFA 2AQOA 5D4YA 3WG6A 4X61A 3H21A 1H7XA 4PTNA 2YDQA 3OQ8A 1TSIA 1YPFA 3XINA 1BYCA 5FJRA 3DAQA 1H49A 1AG1O 2IQ0A 4MY8A 1YIXA 1JDCA 1B4KA 2PMQA 2VOMA 4IOTA 4PMDA 3AIWA 2EF9A 1KNWA 2D22A 5IM51 3GHSA 3CUIA 1L6WA 4Q4QA 1H7RA 1A5KC 2DPEA 3IANA 2VFEA 1HKWA 5JH2A 4WSJA 1UBSA 3PJTA 4FS9A 2NXHA 3PM6A 1HGYA 5G1MA 4M8UA 4K6AA 1JXKA 2FH8A 4GVIA 2PTZA 1W9BM 1W1A1 1XD0A 2XH7A 3T0DA 3SGUA 4DRSA 3NTYA 3OZYA 1H1YA 4CNSA 1RVKA 5A2AA 2YBUA 3RHGA 2FZ8A 3LXAA 3MQTA 3MBDA 2ZUUA 5CPQA 3M16A 4LB4A 1SFTA 1TKKA 1M1BA 1KKOA 5ECVA 3RMJA 3RLVA 1OM0A 3BJFA 1KXTA 3G24A 4OBRA 4QCEA 5F4WA 4RCXA 3QOMA 4MWAB 1L6YA 3PZNA 1PIFA 2CBIA 1S2AA 3N2MA 2D2GA 1L2QA 4GC3A 5BU9A 3WJXA 1W9DM 3GB6A 3NM3A 5KTLA 3NDOA 2VNCA 3S1WA 3AXIA 4N4PA 2G8ZA 4IQDA 4OZOA 3UZ5A 3DENA 5C2XA 3GWQA 2ZOXA 2X1SA 1EJSC 4MLJA 5A95A 2VT0A 2VURA 4IL2A 5D04C 4Z08A 4X0VA 4R3UA 4AX6A 3DDMA 5K4XA 4B5UA 3GNDA 4GX8A 3F1QA 3UW6A 1OC5A 2YCJA 3NQ7A 3QY7A 3G0XA 4E6MA 3UWEA 4UQBA 5LIXX 3RAOA 1TWIA 4WF7A 3PSVA 2JGYA 4FXJA 3WQ8A 2ZZ4A 5JXQA 1TUFA 1LLOA 1DL3A 2C19A 1GTEA 2E0PA 2GK1B 3MHGA 2DT3A 1SR0A 1JXJA 2BX7A 1VR6A 5A6LA 4MFEA 4PYSA 3STPA 3FDGA 2ESCA 1EJWC 2WYSA 3V1PA 3CHFA 2WVVA 3PZQA 3DFQA 1L9WA 1VPYA 1X8FA 3W23A 1OK6A 1SVDA 3WNLA 4EOUA 2QZRA 1C7SA 1CPUA 3AHXA 4RXFA 3U9IA 4JNYA 4KBXA 4O57A 4JTCA 3CIVA 2GDUA 2OO6A 1YQ2A 4QRNA 2EEXA 4UFHA 2IUZA 1CT5A 4GWEA 5FSEC 5DRIA 1EQCA 3R58A 3F5KA 4N9EA 4K68A 4AD1A 2ZRYA 3ARPA 5D8WA 1X6UA 1CXFA 3E0LA 1HP4A 3DKJA 4O52A 3VD9A 5I06A 3D47A 1EDQA 2XH4A 1TIWA 4LYQA 4QJ1A 1TJ2A 3A23A 1CCWB 4D8ZA 2RGMA 4RNHA 2VC6A 1LQAA 1NQKA 4JTRA 1R3WA 4LOCA 1J93A 2BLEA 4LU0A 1TE1A 4X60A 2BTMA 2UBPC 3LGGA 4LY8A 4WR3A 1W1YA 4F2UA 3L0GA 4TVDA 3C6CA 3TR9A 1QNSA 1W9XA 4R9XA 3WY1A 2PDUA 1AL8A 1VBJA 3KLLA 4YIWA 1UA3A 1XV8A 3FXGA 4IMEA 3CXOA 4MOZA 3BAWA 1E9IA 3SJNA 1P0BA 1E4NA 4O8RA 2GDVA 1PTAA 4WY0B 1WV2A 2FVLA 4A8NA 4E3VA 1N8FA 2CESA 2A4AA 3OVPA 5LIWX 3ZVHA 2PPGA 3GDBA 1W1B1 3OBKA 3QFEA 1OIMA 3SCNA 1NFPA 3T55A 4WEVX 3W7PA 1YPXA 4HCHA 3CK5A 1ITCA 3K4WA 4KH2A 5I7GA 2Z2AA 1KA9F 3CS2A 4OV4A 1HJVA 3CZKA 2JKPA 4IGHA 3POHA 3L23A 2YSWA 2FPVA 1FCUA 1GWJA 3TROA 3A5FA 4LV4A 1TMHA 4WXYA 1XRTA 3EKZA 3AAMA 1OYBA 3OBEA 4CQDA 4F2TA 1BD0A 3BMVA 3AZSA 4RNJA 1GTHA 4XKYA 4KPLA 3B8VA 3VGDA 5FEPA 4UOJA 2J7EA 3SQMA 3INPA 4RPPA 3NG3A 1BGAA 5FEXA 5AYBA 4LUSA 3MWAA 1V6VA 4TMBA 3UG4A 4I90A 3VIHA 3VAVA 3I3BA 3V0TA 5HNTA 3PG9A 4GXMA 2TAAA 1A5UA 3THDA 3EB3A 4MJ4A 2B31A 3C2OA 3DECA 3RLUA 1WKFA 2XIOA 3IJLA 4PFMA 4QXIA 4ES4A 4S23A 1H7OA 2I5QA 1CDGA 1G6CA 1T8QA 4QIUA 1XUZA 3CUZA 2GJXA 4LAMA 1IGWA 4DPPA 1DHKA 4XD5A 4LXFA 3PZTA 5KMYA 1FCBA 4I3GA 1Z6KA 5JBDA 3ITVA 3EKLA 1YDVA 3U0HA 3C3UA 5FF0A 1UP0A 3CYJA 2XVLA 4WLCA 4EP8C 2HVNA 2VOTA 2CPUA 4LEFA 2KAUC 1EX1A 4YCOA 3G0UA 1W1VA 5E70A 3BTNA 4QS6A 3LUTA 1L8PA 5LGZA 3A3HA 4ZVJA 4HK6A 4LRSA 2EPMX 1TB3A 2GDQA 1R5YA 4F79A 4JTQA 3IARA 2G4JA 2DJLA 3M5YA 3K13A 4Z2GA 1F3TA 5EMLA 2G5WA 3WF3A 4QBXA 2A0NA 2DGAA 5I3IA 3QZ6A 3QSTA 4K8EA 7XIMA 1XIFA 4HMEA 1FHDA 4GJJA 4F8XA 2HDJA 1JFXA 3W24A 2V68A 4J3VA 2Z27A 4JTAA 4NRSA 2C13A 1PAMA 3S6TA 4G1NA 2WMIB 4JL2A 1BYDA 3HO8A 3KP0A 3CQ0A 1Z3NA 2A3CA 2JALA 3C2VA 1JJKA 1LROA 3Q65A 2H90A 1VYSX 1OX6A 3A4WA 4UWMA 3ZLHA 3B03A 3TYEA 2PDIA 4XIMA 1NWUA 1XF0A 4Z1AA 4E2VA 4RJEA 2C8NA 4XX6A 5DY2A 3LN3A 2WLYA 4HT3A 2GSEA 1V6YA 1JQXA 3H4WA 5C2CA 3WQGA 2DVXA 2QV5A 4HJWA 1UKPA 4R7OA 1XIEA 2AAAA 1RCXB 3KOWA 4XZWA 3S3GA 2ZRUA 1EBHA 1J12A 3PULA 1GKRA 2PGWA 3PR2A 4PMQA 4H41A 2O7QA 1PIGA 1OADA 2GWNA 3KZPA 4UCGA 2E9BA 4PMVA 4B3ZA 1E6PA 2W92A 3VKDA 3LRKA 2OPJA 2DSVA 1LBFA 3NQ6A 4FXRA 3ITTA 3DHDA 3I68A 4EXQA 3PBYA 4L7ZA 1NF0A 1E1CB 1K4GA 5GQBA 4I7VA 1HJSA 4GY7A 3GH4A 4EAYA 1WOBA 3GXPA 3LENA 3KZSA 4QEHA 3H2EA 1KXHA 4XD6A 1PS9A 3D6NA 4D6FA 3MI2A 1A49A 4F9JA 1KGWA 3VILA 4GVGA 4CD7A 3WLMA 4M24A 1JF5A 3M41A 5I3JA 1DJNA 1AW2A 3KTSA 2CBUA 1ADDA 5T26A 1X8CA 1QVBA 1OF6A 1VFSA 5I3DA 2XSBA 3UJSA 1R9ZA 3F5LA 1WDDA 8CGTA 1ELSA 4X22A 2X1RA 4LUTB 4TOQA 4IFRA 2HS8A 2YDSA 3SSJA 2Y5JA 4UFKA 3M0XA 6TIMA 1TWWA 1JPKA 5M1TA 2D0GA 3A3XA 1J0HA 4O1DA 2Y0FA 1ECQA 3JZUA 1UWSA 1RZMA 4JNZA 1I45A 1MRAA 3G0SA 3WJYA 1QO2A 3VTRA 4L9ZA 5AZ0A 4KFNA 4MKSA 6A3HA 2WMFA 4J9JA 1NFBA 3N17A 3H53A 3DBNA 1MXSA 4KS0A 3PPHA 1JULA 3QR3A 4KERA 3EGJA 2EKGA 4FB7A 4CQAA 1E1EA 3N15A 1JI1A 1ZUAX 3LERA 3VU2A 4XBJA 4A6GA 4Z2HA 4UTTC 4B3KA 3B8UA 4B5NA 3N13A 3QKEA 4D6EA 1ENUA 1E15A 4RDVA 5LNVA 2CHNA 3NSMA 5JMUA 1RA5A 2E9LA 4DBWA 1ONRA 3TSMA 4AF0A 3SY5A 4PUJA 2O56A 1XGEA 4Q8QA 3GAKA 1TPVA 3UD6A 4GVHA 2OYKA 4QNEA 1MXGA 1XINA 3UNTA 4D2JA 3O15A 5I2UA 1UKOA 1GK8A 9RUBA 4IG2B 4HBKA 3I65A 3KBSA 4N02A 3QSRA 5A6BA 3ZQ9A 3KBWA 3LY0A 4S1FA 4WCJA 4FR6A 4LW7A 5CZSA 1RP9A 2CC0A 4QROA 3PF3A 2DSKA 4YYFA 4P7OA 1ZJIA 3ITCA 1SSGA 5D2VA 4KFOA 3SCSA 1NWSA 2EJAA 3SUTA 4JIEA 2AMGA 1J0ZA 5CQ1A 3F2DA 2ZZ6A 1BKSA 4MLRA 3B9DA 3HGSA 2QQ6A 1SW0A 3R10A 1E4MM 4I5UA 1R47A 4V15A 3MCOA 3NQEA 1ZLPA 4QITA 4TUFA 4PMRA 3B4UA 4C6DA 2Y7DA 1CXIA 1TV5A 3SCWA 4LPCA 3W7MA 4ADTA 2CZ5A 4GPNA 2W27A 2OSYA 1S5NA 3M43A 1AW1A 1OX5A 1R86A 4YHGA 1UD3A 4JIPA 4DWSA 3NOYA 1CLKA 3W07A 2PWVA 1TZZA 4UNKA 2WZTA 3WFAA 2WJFA 3O9NA 1NDVA 2J7FA 1V7YA 1J79A 2I9EA 1XIBA 2BXZA 4M82A 3PJUA 2VD9A 3PZ9A 5HR6A 2FIQA 5ENLA 3L66A 1KM1A 1LJYA 1DORA 2XYLA 3VKJA 1EO7A 1P6BA 1EF2A 1QDSA 1CXHA 5KITA 1M53A 3AXXA 4JTSA 6CGTA 1CEOA 1W5NA 4Q8NA 2BWGA 4AH7A 3C2EA 2PGFA 2WMHA 3VX0A 5H2ZA 1XQLA 1OVDA 3UJ2A 3V18A 1JVNA 4JIRA 1JPHA 4Z1DA 2Z28A 1M7PA 2VO5A 2UWFA 1H63A 5FSDC 2O4QA 5HR7A 3FKRA 5CSUA 4JYFA 2GYIA 3ORWA 1YW1A 5AY7A 4GINA 1XYMA 2E68A 2H8ZA 4EVZA 1R9XA 3ZJ6A 2VX5A 4B91A 3K1GA 2YFOA 4K8GA 2B4GA 2ZXBA 4IPIA 1KCZA 4DM2A 3P82A 2R1NA 4C1NA 2X42A 6REQB 2HNEA 4NJJA 1JCYA 2Z1BA 3EKGA 1VYRA 4W8LA 1PO9A 2A7RA 4O1EA 4DWDA 3THQA 4CN1A 2PP0A 4D8LA 1B90A 3SQLA 4AHOA 3LCLA 5CC5A 3VI2A 3TNBA 2VRKA 2FPTA 3TWAA 1IXPA 3DFNA 1JZ4A 1XSKA 3W73A 3WF2A 4JD4A 1C8QA 1A0DA 1W2PA 2EPOA 4PMOA 4FNSA 1H60A 4WDWA 1I6NA 2ZXDA 3W7KA 3GG0A 4UR9A 2VCCA 2ACQA 1V0MA 4ZO6A 4RUBA 2OB3A 1BAGA 3DI0A 4GOAA 4NL1A 4V27A 4J2MA 3WJWA 1ZTVA 1ZHAA 3DFYA 2VL4A 1GQJA 2ZQ0A 2ABBA 3C5QA 3HM7A 5CC3A 3O16A 1HJQA 2DQXA 5E0KA 3TYUA 1V51A 4PCTA 3ZYZA 1WZMA 4QNWA 3AHVA 3W74A 3CGTA 1VCFA 5E6YA 2C18A 3GK0A 1FWFC 1AD4A 3N04A 4DM1A 1W3KA 2YBTA 2WMKA 1JQVA 3FS2A 3FVDA 3S5YA 1UR3M 4HYRA 4B16A 3TWBA 4RE0A 3EZ4A 3BAXA 3UCCA 1S46A 3W6MA 4ZQPA 3NDZA 3NZRA 5HJLA 4E2BA 2RFGA 3RPMA 1K7FA 3FYPA 1MEHA 3N19B 3QFWA 4AIEA 3MVIA 3C61A 1Q8AA 3GLCA 1CLXA 4QQ3A 2WQPA 3SDOA 2ZE3A 3UP8A 3T81A 4GO9A 1W3HA 4AMCA 4TTGA 2WQDA 4E8CA 4ZCWA 4I9AA 4O1BA 2NV2A 3LYEA 4Z1YA 1F7BA 3S9YA 1VENA 3M0ZA 4ZQCA 1TYGA 3TJ4A 4O4WA 3GDKA 1LG1A 5AYIA 3TC6A 1GVEA 5D37A 3F4NA 1X1OA 4DLFA 4C6IA 2CETA 1CZ1A 4HMNA 1EYWA 3LS9A 3A4AA 3GFXA 4PEEA 3M7WA 4ACZA 4MDOA 1XYBA 4RLIA 4DJDA 4GKLA 1DP0A 3UR8A 1POJA 2D2JA 3W29A 3U5YA 3L7RA 2C3ZA 3N14A 4Q22A 3VIKA 4TX6A 2QUNA 2CERA 4OUIA 3LI1A 1OCQA 3PBWA 1W1ZA 4JQ3A 2PC4A 1G94A 4RDWA 1NOFA 2D1ZA 3WD4A 1O66A 5I3HA 3WD3A 4KMQA 2PTXA 2J13A 2BDQA 2WJDA 1BYBA 3AHZA 1GOXA 4NRRA 3FFSA 4Q6JA 1UOZA 3ATZA 2XIQA 2JF7A 4O10A 1WUFA 5E1QA 1UWIA 3IJIA 4J1OA 5G2WA 2GOKA 1Q4NX 1KM0A 4L6HA 5TQLA 1JZ7A 3QVQA 4OV9A 3UWVA 4AMAA 1P6WA 3ANUA 4WIWA 3GTNA 3J7HA 3FSUA 1KWGA 3TCEA 3PHAA 1UG6A 4NI3A 3AXHA 2FPYA 4Y8FA 1TVNA 3GQYA 5CGQA 4CNNA 1QK2A 4PUKA 3RM9A 2G3MA 2FMOA 1FWSA 3M5XA 4XVDA 1Y7VA 3VCRA 5LNUA 1XSIA 4TV6A 3IACA 3B0PA 4EF9A 5CBBA 1R2TA 1O4UA 1QR7A 5BNKA 3CV2A 1H50A 1SR9A 3KCLA 4A22A 4GBDA 4FA3A 1EFZA 4KRUA 1GEHA 2OQLA 4NXSA 2J9ZA 3VNIA 4UMCA 2J47A 4LV9A 3CTLA 1AQFA 4DEFA 2A3EA 1TPWA 5LIUX 5FJJA 3GDRA 1O5KA 5A3HA 3EBVA 3DG3A 1CBGA 1XLKA 1OX4A 2C16A 4KEZA 5D38A 1H5YA 2QR6A 4U3AA 1MQRA 1IIHA 3LCWA 3KL3A 3UWWA 4DY1A 1KWKA 3VMPA 5CGTA 3LCHA 3V75A 3EWYA 3KLKA 1F3XA 3HV9A 3LOTA 3STCA 4AEFA 3FY1A 4HK7A 2OZ8A 2RKXA 1PWLA 3MCNA 2Z1KA 3N29A 1DXEA 2CKSA 1T8XA 3IGUA 2E67A 3BAYA 4HOXA 4GKTA 2EJ1A 1LBLA 1W3IA 4WSKA 4MTVA 1VFOA 1FH8A 4M7TA 2VX4A 3DC8A 4DBDA 4HK5A 4KCVA 4W86A 2CKRA 1KGXA 1E73M 3MSYA 3VOGA 1AJ2A 4FEZA 4DO4A 1V6TA 3QC0A 3T2OA 3FA3A 1QK0A 2GVYA 3MB9A 3N1AA 3IGHX 4EE9A 1WZAA 3TYCA 2FVMA 4WOQA 5U7SA 1GPFA 1VCVA 4L5ZA 4M6PA 3G1FA 3L68A 1H1ZA 1XCWA 2QPUA 2J66A 3MMWA 3EPOA 2Y6ZA 1B3WA 2QUMA 2OFJA 2PWEA 1KRAC 1UD6A 4N0RA 4X63A 1E9ZB 4NXKA 5CLWA 3ARUA 4JTHA 3EYPA 1LM1A 2Y8KA 3REQA 2HPMA 1SO5A 3O6CA 1CW2A 4HNUA 3E02A 3TXVA 3EOSA 1TCDA 4NNBA 1PKLA 2NXGA 1HJUA 3W27A 3JUGA 5K3VA 4C6JA 1OY0A 1PZ3A 2FHCA 3CQHA 3R4IA 4CD4A 3GH7A 3TQPA 2D20A 5KETA 4PUWA 4BF7A 1ECEA 2Y61A 3GY1A 5HUOA 3COTA 2WCSA 1DJYA 3ATYA 3ZSSA 3HA1A 3VKBA 3U2ZA 4F0HA 5LA1A 4PMZA 2CCRA 1HL9A 1I8JA 1T0OA 3N2BA 5DBTA 1W37A 1KC7A 4RW3A 4FF5A 3H8AA 3WQWA 3SCTA 3VVGA 3KCJA 2Z25A 1EGVA 1S5MA 3W00A 5IBXA 1TVLA 3H2OA 2OXNA 2A7NA 4KWOA 4O8AA 3ECQA 1W6TA 1ML1A 4H6EA 2I1OA 1V3KA 3B9EA 3T2PA 2A21A 2OGJA 3Q2DA 2E40A 5KZMA 3NWRA 3TXZA 1F6PA 2FZDA 4ADSA 2YB4A 1HX0A 4MWAE 4U2YA 3UZXA 2QCLA 1KM3A 2R1KA 3DBPA 1VJIA 1ICQA 3EB2A 5C54A 1XH1A 1SZRA 1HKMA 2GUBA 3HZ3A 1P4CA 3BOLA 2D2OA 4YHEA 2OKOA 5LNRA 4H9TA 1KCLA 1IEWA 2CIPA 1N8IA 3STFA 3BSHA 2B7NA 3N3TA 4LFYA 3GO2A 2C0HA 4JYEA 4B5SA 4RZ5A 3WH7A 4WY0F 5ABFA 4HNCA 2Z6JA 3OLIA 3GAYA 1I1XA 3AROA 3T05A 4GE8A 4PMNA 1SJCA 3KTCA 1TV7A 1HF6A 5CJMA 1H7NA 3EWDA 3TN3A 1NWRA 1Z8AA 1P0EA 1XSJA 3GVQA 4OBTA 3W7DA 5DBUA 5GVJA 2FB3A 3RX2A 2VZVA 4JTGA 4P8WA 2MUCA 2OEMA 3KP1A 4MM1A 3AYVA 1M7XA 2WVVB 4QE1A 4AW7A 1UW9A 5HWNA 1X1NA 3SCUA 3W72A 2CHOA 3CB8A 3UXAA 4YS1A 1I2NA 1GUVA 1KV8A 3Q58A 1S5VA 1YPIA 3UT0A 1YBQA 4KETA 3KL0A 3K8LA 1TPFA 1SJAA 2GJNA 4RDYA 4KIEA 1RQEA 3CLMA 5G4EA 4GZ7A 3KOYA 4JEQA 1XFCA 3P6LA 2A3AA 3G77A 5AVNA 2PTDA 3N6JA 2J6VA 3PBUA 4Q8TA 1A3HA 3QQ1A 1UR2A 4M6VA 3CQIA 1FWNA 3MMUA 3OO2A 2OELA 1W5PA 3R79A 1XDJA 1GZ1A 4Q7NA 4BR1A 1WCGA 3TVAA 4GC4A 5FJOA 4LF1A 1BLIA 1BG9A 1GKPA 5I07A 5AZ1A 1Q7MA 4W89A 3RCMA 4E2OA 1RD6A 3WK3A 2DZSA 3HGJA 1Y5VA 4HU3A 1Z42A 3VNDA 2HPIA 3DGBA 3GDLA 3BOXA 4PMYA 4RR4A 4H7CA 1R46A 4Q4PA 4AZGA 4D6HA 4GNKB 1UD4A 3I4KA 4HPGA 1DEDA 2G37A 5KEZA 1G01A 3FSTA 1XJBA 4TV5A 4G9PA 5CXPA 3EOOA 3OPSA 2QDDA 1N2VA 3TMQA 5REQA 4L4MA 3E2VA 3NXLA 3MSDA 4PCFA 3LGEA 1DWIM 5A6JA 1NSJA 2P0IA 2PDHA 2ANUA 2ZKMX 1QU4A 3OLEA 2WVUA 2Q09A 3NQMA 4OVXA 3WBEA 4HPJA 2C1HA 1FHUA 3MP3A 3UGVA 1NIUA 2CLEA 5G5IA 4H19A 1HXJA 1ME9A 3WF1A 1W17A 3VIFA 4OE7A 4XZLX 1J0KA 3APTA 1NDZA 1U5VA 2FHBA 1NARA 1ZAHA 1DJQA 2V2HA 3AMKA 4GZEA 4OBSA 2NQ9A 3L4XA 2A7PA 3A4JA 1QNRA 4LUSB 4IIHA 3WQ6A 2L5HA 1S1RA 3H22A 1C9WA 2YYTA 3TFCA 4RPQA 2GGIA 1FX6A 2W79A 1E6NA 1Q6GA 1OIFA 3AS1A 4ZFCA 1QPQA 1XM3A 3AWOA 2DZXA 2XU2A 2VWTA 3TK7A 4YPJA 4ZENA 2J88A 4MVAA 5CZKA 1UUOA 3FAWA 3KRBA 3LLXA 4UOZA 4AVOA