4PMQA

Crystal structure of the mycobacterium tuberculosis tat-secreted protein rv2525c in complex with l-tartrate (orthorhombic crystal form)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
204
structure length
204
Chain Sequence
SLGTLLDYAAGVIPASQIRAAGAVGAIRYVSDRRPGGAWMLGKPIQLSEARDLSGNGLKIVSCYQYGKGSTADWLGGASAGVQHARRGSELHAAAGGPTSAPIYASIDDNPSYEQYKNQIVPYLRSWESVIGHQRTGVYANSKTIDWAVNDGLGSYFWQHNWGSPKGYTHPAAHLHQVEIDKRKVGGVGVDVNQILKPQFGQWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies suggest a peptidoglycan hydrolase function for the Mycobacterium tuberculosis Tat-secreted protein Rv2525c.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords Tat-secreted protein Rv2525c
total genus 78
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08924 DUF1906 Domain of unknown function (DUF1906)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmqA00
4Z2GA 4W89A 3BSHA 1CXEA 3HU7A 3L4VA 4J3UA 5CSYA 1B3XA 4TTGA 3U5UA 3TTSA 2ZX6A 1KXTA 5HBFA 1JZ7A 2XJ7A 1E70M 3KWXA 2JFEX 1G1YA 3N04A 3W38A 1HJUA 1GQJA 3GYCA 2VQUA 1FHLA 1CLXA 3AQUA 1LWJA 5IHSA 3PZQA 2EPMX 1V6VA 3WNOA 4QLLA 1PZ2A 2WVTA 2DT1A 4KGJA 2PB1A 3WQVA 1FP8A 3CH9A 3NSMA 6TAAA 1MW2A 1MFUA 2YBTA 1UQZA 1BYDA 2RGLA 3VDBA 4HA3A 2Y4SA 3U7VA 1IZJA 1Y7VA 3PZNA 3K8MA 2ZIDA 1BAGA 1UG6A 2WVVA 2E4TA 1FHDA 4PMNA 2WMKA 1TG7A 2WBGA 3EMCA 2E9MA 2BY1A 1NWRA 1TCMA 3VNZA 1ZBCA 2X05A 1BG9A 3WF4A 4PMDA 3DECA 3AIQA 1MW0A 4MDPA 2VX6A 2YL9A 4CN1A 1ZB5A 3VM5A 2ZUVA 1GOQA 3TP4A 1HKMA 2BY2A 2E9LA 1M04A 4GO8A 2PC8A 5ABEA 1QVBA 3BAKA 2G3IA 4AD5A 1Q6DA 1H3GA 3L4YA 1LL7A 2WKGA 2CBVA 1K6AA 1E72M 3VMNA 3FN9A 1QW9A 5A1AA 5TD4A 2O9OA 2VZVA 2PF0A 3SCOA 1J11A 3GM8A 2CBUA 1W2PA 3W37A 1PEZA 2CIPA 1HX0A 2ZUMA 1WE5A 5EFFA 4GIAA 4MJ2A 1NH6A 4M80A 4JFUA 2JIWA 1E6RA 4AD2A 4DWSC 2YOCA 4DUXA 1KFWA 3AIBA 3CUJA 2GJXA 1MQPA 5HPOA 2FDMA 2UWFA 4PTWA 2J7HA 1QNPA 5CGTA 1VENA 1OGSA 1HNYA 5E6YA 2TAAA 2J8FA 3AMCA 3VGFA 3HN3A 2X09A 1GOMA 1KXHA 2E9BA 5I6SA 2WHMA 1JAEA 1J10A 1PJ9A 3A3HA 4P8WA 3AIEA 3DYOA 4U5IA 4EAMA 4QP0A 3VIFA 3K4DA 3F4VA 5I78A 2XWEA 4JL1A 3W81A 1B3WA 2EPKX 2GDUA 2WMIA 4C7GA 2J75A 2WLYA 1VBRA 3WH9A 4PEEA 4HA4A 1LF1A 3I3BA 3AOFA 5M03A 1KGUA 5ABGA 5IFPA 4OKDA 1D7FA 1OM0A 2Q8XA 1G94A 2BS9A 5EFDA 2GFTA 1XSJA 1MWOA 3IAQA 3FW6A 1NOUA 1GOKA 3SURA 4KGLA 4E8DA 2QMJA 3DC0A 5A8NA 3MS8A 4NRRA 3F5LA 4OUEA 1K9DA 2BXZA 1W9XA 1WDRA 3M46A 1OGGA 3WDQA 1WDQA 1E6SM 4CCCA 4JIEA 4OJYA 5LA2A 1HKJA 4J3SA 1JD9A 3MKKA 1H0GA 4IPLA 1GZJA 3M6DA 2VX7A 3HJEA 2PWHA 6A3HA 3T2OA 1JZ3A 1KXQA 3VD4A 2VCAA 3G6LA 1ITCA 2GVYA 2VOTA 3FAXA 5ABFA 3L2LA 1E73M 6CGTA 3AIUA 4P7NA 5A6JA 1FFRA 4JHZA 1V3HA 8A3HA 1QNRA 2VRQA 1UR2A 2G8ZA 3PZUA 4AYSA 3KE0A 2DPEA 4HU8A 4FLSA 1EIBA 3QR3A 1W3HA 1VRXA 2W62A 1GOWA 4ACZA 1C8XA 1ZJAA 4DWSD 1WZMA 3AMKA 3IJ9A 1E0WA 3ARVA 3GDBA 3F5KA 1CGXA 1V6XA 3IJ7A 5IFTA 3ZT5A 4AZIA 3THCA 4D6FA 1E15A 1UD5A 5FCZA 1K9TA 3AROA 2D3NA 2CBJA 1TFVA 1KCLA 3GBEA 1WZKA 3GNOA 4FLOA 1OD0A 2XVLA 3MUY1 2ZUUA 3WDHA 1UYQA 1OSEA 4KWUA 2GK1B 3VGDA 2FH8A 1ESWA 4PUEA 2VCBA 4PN2A 3THDA 5A2AA 2V3DA 1JF5A 1NWTA 1PIFA 3AS0A 3OGRA 2D0GA 1JI1A 2DDXA 4TVUA 4UFHA 1EHAA 1W1TA 3W82A 3BAXA 3MUAA 3TONA 3VINA 1UWQA 1C93A 1CYGA 1E4MM 1HXJA 1UWSA 3AS1A 4QCEA 1CIUA 1RP9A 3UR7A 1QNSA 1XV8A 3MANA 4GQQA 1E6ZA 1JZ2A 2OSYA 1U2YA 2ZXBA 2OLHA 1LG1A 3PBGA 3NYDA 1HF6A 1JDDA 1HJSA 4M1RA 4UOZA 3BLKA 3N12A 1MW3A 4S3JA 1UR4A 1VEPA 2J4GA 4UR9A 2ZXDA 4W7VA 3IANA 1QHPA 5GNYA 3BH4A 1JYWA 2WNWA 2YJQA 4CN4A 2O9TA 1G0CA 3CZEA 1J0JA 4J3WA 2CKSA 4PUDA 3GXFA 1GCYA 3PHAA 4FLQA 1VFUA 2G3JA 3KZSA 1JI2A 4F8XA 3A4XA 4L4OA 1MXDA 3MU7A 3FHAA 3L4TA 1CGTA 3POHA 5LA0A 1CXKA 2WHJA 4J3XA 4PMZA 1B9ZA 1KR0A 1JYVA 4LX4A 1SMAA 4J3TA 3WNLA 5A8PA 1GNXA 1JDAA 2W61A 2NT1A 5CPTA 4JFSA 5CGMA 2XVPA 1Q6FA 3GXDA 4RE2A 1TR1A 5CPQA 2GUYA 2CPUA 4PMVA 4UQEA 1KR1A 3VMOA 4E4PA 3OLEA 3IJ8A 1ECEA 2DEPA 2ZX8A 3CMJA 4W93A 4GPNA 2CBIA 3WDRA 1GQKA 2EBNA 4AZCB 4TTUA 3WBEA 2DT0A 1J01A 3UG4A 5AY7A 1W1YA 2BY0A 2QF8A 1WZAA 1V02A 2C7FA 4KRTA 3VIHA 3ALGA 1NARA 4J3VA 3WENA 4ZXLA 1VBUA 1JYNA 2ZE0A 4ZENA 5BXTA 2XHYA 2W91A 4AY1A 1V02E 4PMRA 1MYRA 1UD3A 4MNMA 1RD6A 2Y8VA 4AZ5A 1SR0A 4LGXA 3AZSA 1AQ0A 4PCTA 1MW1A 1HN1A 1G9HA 2YA1A 1LL4A 1PPIA 1UKOA 4P7OA 3WDPP 1KQYA 5C8BB 4R27A 2E3ZA 3WSUA 3MV11 2JALA 5GPRA 4IM4A 1HP5A 1V03A 1XH1A 1PX3A 3LPPA 4AZCA 1CGVA 4LPCA 2OYKA 4WK9A 3QHMA 2CITA 1IZKA 3WFZA 3CBWA 2XVGA 3RILA 3EYPA 4HOWA 3TTYA 4ZXOA 2V3GA 3W28A 1J0YA 4ZE4A 1OB0A 4D6GA 3A4WA 2YKKA 1OT1A 2X0YA 2BHYA 1FH8A 3ARYA 2BFGA 4UZSA 1H0IA 3ZSTA 3PTMA 3ZJ8A 3WKZA 2WCSA 3WF2A 1JZ8A 1WKYA 2F8QA 3GNPA 2BVTA 4PTVA 2YBUA 1E0XA 4HTYA 3NIYA 4HZ8A 1GVIA 4YN5A 2VR5A 1E6PA 1NOWA 3AHZA 2GK1A 1CLVA 5A95A 1FOBA 3WBAA 2ZUTA 4ATWA 1KCKA 2JF7A 3QOMA 4WKHA 4YPJA 2J7EA 2UY3A 2WLZA 1UD6A 3VO0A 1UQYA 4B15A 4UQAA 4B3LA 4CD4A 5HXMA 4D71A 3S2CA 3TA9A 1H11A 1DHKA 4HZ6A 1EA9C 1WNOA 3W26A 3GH7A 1TVNA 1GPFA 4WLCA 3AMDA 5I79A 3T09A 2XSAA 1HP4A 1XCXA 3EDKA 2DQXA 3MV01 3PZIA 4A3HA 2CETA 1EGZA 4YHEA 1CWYA 1WDSA 2WCAA 2BNJA 3ZM8A 1GOIA 1A47A 4JFTA 4OOZA 4C7FA 1XH2A 2J78A 3W24A 1E4IA 1HT6A 2WYSA 3W0KA 4N0RA 4WKFA 4NRSA 4OOUA 1QW8A 4TUFA 4XZBA 2CXGA 4D6EA 1WP6A 3ARXA 3WY1A 1OBAA 1ZBVA 1OWQA 4MAVA 4BQ4A 3AIWA 2YDRA 2WSKA 1KBBA 4BF7A 1QI0A 3I3EA 1WDPA 1FA2A 1EQCA 5D8WA 1KB3A 5M5DA 1VFMA 1I1XA 4AW7A 3GXMA 3ALFA 1W9BM 1DWGM 1NWSA 4B9YA 4CU8A 4JKKA 1WB0A 2OWXA 3II1A 1UR9A 1UWTA 1ISZA 3ECQA 3WEMA 5A94A 4PCSA 5JUVA 2WMJA 3SUSA 5F7UA 3WNMA 1HJQA 2ZXQA 4HMEA 1XCWA 1B1YA 2WMHA 3POCA 3VGHA 4FLRA 5BWFA 1R8LA 4UZUA 1W9UA 3RM9A 4BQ2A 3DYMA 3D5HA 2XFYA 2UY2A 2WMGA 5EMYA 1VFOA 4UNIA 1V3IA 5E9AA 5D4YA 2D24A 2X2YA 5C70A 3CGTA 1HVXA 5A8MA 2J47A 4JKLA 1KXVA 4LYRA 1M7XA 3UCQA 4AD3A 2VNCA 2YA2A 1BYAA 1XSKA 4URIA 5CLTA 1V6WA 5IXEA 3EMQA 3UG3A 1TA3A 3SCSA 1DWIM 2WWDA 5D9MA 4NSBA 4BCEA 3O6AA 3AICA 3WELA 4UOJA 1IT0A 4GZEA 3RIKA 3NSXA 2DGAA 2X8RA 5AC5A 2DSVA 3WQ6A 4AD4A 2D2OA 3WMSA 3NCOA 3WEZA 1PZ3A 3N1AA 3SUVA 4D72A 2YL5A 2QPUA 1AQHA 1EO5A 2VC9A 3CUGA 3ZJ6A 3A4AA 2D23A 3WEOA 2JEQA 2ZICA 1E6XM 1WZLA 4TVCA 2VRKA 3N11A 3T08A 4AIUA 1JD7A 4DM2A 4ATDA 2FGLA 3ZT7A 1E9LA 4JZ5A 3MMDA 1H41A 1QNOA 3WQWA 3NUKA 3L4ZA 2XGIA 4AZGA 3UEQA 2DSWA 3UERA 2ZX9A 3ARUA 1J12A 3SUWA 2VVNA 1J9YA 2WHKA 1UD2A 4CN6A 5HDRA 1E4NA 2E8YA 3A6OA 3AIVA 4UQCA 5EB8A 4AD1A 3VGBA 5A6SA 4LXFA 3VD9A 2EPOA 2BHZA 4N42A 3CHEA 4TX8A 5JIWA 3RPMA 2YIHA 2WVSA 5A2CA 3SCTA 1DWAM 4FK9A 3WUBA 1MFVA 1W3JA 1BHGA 1HVQA 3ZR5A 5E0FA 3BMWA 4AZHA 2MANA 1N82A 4PMUA 4L4PA 3VIIA 3LPOA 2J7FA 1E3ZA 2GDVA 3MMUA 1RPKA 3AFBA 2QHAA 4PYSA 4HPHA 4D1JA 3WH7A 1E1FA 2ZUNA 4CCEA 3WQ8A 8CGTA 4Z2IA 2HISA 5I24A 4CD5A 1NWUA 5FL0A 3DHUA 1JIBA 1R87A 3SCQA 4Y7EA 2WM0A 3GBDA 4AXNA 1XSIA 3ARTA 1QHZA 2YA0A 2CNCA 2VR4A 2VJXA 4H8HA 1ISXA 1X6LA 2QMKA 5A6KA 2CCRA 2XVNA 3CHDA 1TA3B 2J62A 2IUZA 4UFKA 2WBKA 1G5AA 2XVKA 1UR0A 2D20A 1DTUA 3CZJA 3FHQA 2VCCA 4EANA 1ZU8A 4MB3A 1E3XA 1UR8A 4E2OA 1FH7A 5HPCA 1VAHA 5E09A 3U57A 4U31A 4W86A 5A3HA 3B9AA 1MQRA 2WANA 1H2JA 3CZKA 4MAZA 1CECA 1G01A 5D8ZA 1JZ5A 3EDEA 2J7DA 5CQ1A 3VDHA 4X0NA 2OYMA 4DUVA 3EDFA 2XUCA 4H7VA 3VKKA 1E1EA 1H1NA 1GJUA 3AI0A 4P7RA 4AD0A 3FXYA 1CGYA 2XSBA 4W8LA 2XM2A 1PBGA 3VIGA 3ARPA 1ZBWA 3T2QA 1WPCA 4MB5A 2W66A 1KBKA 3VOCA 3B9EA 1OCQA 1C3FA 2DH2A 1SMDA 4PMYA 3OLDA 5FIPA 1PX8A 2D1ZA 3AHVA 1JL8A 2BVDA 3CHFA 1ZS2A 1E55A 1D2KA 1W1VA 2WZEA 3OG2A 3ARSA 4QLJA 4M81A 3AHTA 1UZ1A 1XD0A 5I77A 2XM1A 4AIEA 2D22A 4A4AA 2W63A 4AZ6A 4GI6A 5IDIA 3GH5A 3BCFA 5BXRA 4U33A 3AJ7A 1CENA 3CZ8A 4KMQA 1CZ1A 4W8AA 3WD1A 4XV0A 1Q6GA 1E71M 2CERA 2Y8KA 4D6JA 4CD8A 4D1IA 1NP0A 4BQ5A 4W87A 2J7BA 1M53A 4JFWA 4AC1X 2VZOA 1XC6A 2BXYA 1JG9A 2J7CA 5JBEA 3TTOA 3BXWA 2DIJA 1V0NA 3QHNA 5DFAA 4C7DA 2WW5A 2JE8A 3KL0A 2VO5A 4M24A 5DT5A 3VD5A 3RJYA 3DYPA 3GH4A 3ARQA 3BMVA 1O7AA 3KEHA 5GQBA 1EOKA 4UTFA 1SFSA 3PZ9A 2O9PA 1V6YA 1ZBKA 2ZX7A 4QCFA 2Y5EA 1RP8A 1CXHA 4ACYA 1ZL1A 4UQDA 1QOXA 3SCWA 1BLIA 2EPLX 4Z2JA 5BXPA 2J77A 4OZOA 4Z2HA 1JYXA 4JAWA 3SCUA 2DSKA 4GINA 3W29A 3LPGA 3PZMA 2ZXAA 2JIEA 1GVYA 3CLWA 5ABFB 2BVYA 2XTKA 1BVNP 2PWDA 1JZ6A 1XRVA 3GTNA 2VZTA 1I1WA 1DP0A 4QLKA 4PSRA 1BG4A 1H4PA 2DSUA 4HMDA 2F2HA 3OLIA 1B2YA 4CVWA 3GXIA 3ZJKA 4U5KA 2GJXB 1B3ZA 2WPGA 1J0IA 3HMCA 4UCFA 4X9YA 1U33A 4U2YA 2RGMA 5CG0A 1CBGA 1B0IA 1UH4A 1UOKA 4H8UA 4WSJA 1Q4NX 3K8LA 1J18A 1X6NA 1EDTA 4PRWA 5FD0A 4Z2LA 1VEOA 1TZ7A 2O92A 1RH9A 1V0KA 4FF5A 2FHCA 2E40A 3SEPA 4GZIA 5FOOA 3VILA 1TMQA 1E40A 4W88A 5BRQA 4V27A 4AEEA 1D3CA 4J27A 3UETA 5DO8A 2D0FA 3ZR6A 5I2UA 4CVUA 1VB9A 1W9DM 3WF0A 1QI4A 1EDGA 4UFJA 3ZOAA 3SCVA 5DT7A 3WH8A 4EE9A 1CXFA 3MMWA 2PWEA 3T0BA 2CEQA 5GNXA 4WSKA 3WD4A 3CUHA 2WKLA 1H5VA 3WMCA 2Z1SA 3MUIA 1S46A 2V3FA 4AZBA 1XHGA 4KRUA 3WNPA 1UWRA 1HJWA 3B9DA 4AZ7A 1MVYA 3VIKA 1W1PA 1C90A 4AEFA 4JL2A 2A3EA 5I0DA 3NDZA 4MADA 4F66A 3N13A 4M82A 3BAWA 5AC4A 4RL3A 2WMFA 4ATLA 9CGTA 2E8ZA 4LYPA 3OGVA 4AISA 4PMXA 2A3HA 1QHOA 1CNVA 3VIPA 1CEOA 2UY4A 5EBAA 3CO4A 1KWKA 1GORA 1EXPA 1R7OA 2Y24A 2IXUA 3VDCA 1QNQA 2UY5A 1L8NA 1CTNA 1C8YA 2VMFA 3D3AA 2G4FA 3W25A 2V5DA 1BYCA 4TOQA 1H09A 2EEXA 3QGVA 4IISA 3QHOA 5DEZA 3G6MA 3WDIA 2OYLA 1BF2A 2EO7A 2WWCA 3T0AA 1BVZA 4ZEPA 1UKTA 2J79A 3KL5A 3N18A 1EOMA 3FY1A 3LPFA 4HU0A 2NW0A 1UKPA 4PBGA 3PZTA 2NSXA 3WH6A 4IPNB 3VD7A 1P6WA 4H8VA 2CYGA 3RDKA 1E6QM 1QI5A 1QBAA 2WVVB 2XIIA 1XD1A 3WH5A 3ARRA 2CESA 1YQ2A 1US2A 2BHUA 3VD3A 2YDSA 4JHOA 4PMQA 4P7QA 1LG2A 3ZQ9A 3WD3A 5C71A 1MQQA 2J7GA 3PTKA 3M7SA 2DIEA 4OBSA 3IK2A 1BTCA 2QPSA 1OT2A 3L4UA 5BYWA 3RM8A 4E8CA 1LQ0A 1HJVA 1W32A 1JGIA 2O9RA 2WB5A 4CD6A 1TUXA 4YHGA 1R7AA 1UR1A 3W53A 1EDQA 1W91A 1VJZA 3BGAA 1F4HA 1UHVA 1ITXA 3WF1A 4CUCA 3CZGA 3BCDA 3K1DA 2V5CA 1I75A 3CUFA 5BCAA 4JCMA 5CLWA 3T0DA 2QLYA 4EK7A 1M01A 1YHTA 4HP5A 3AXHA 2GJRA 2ZWZA 2YLLA 3N17A 1W3KA 3CZLA 7A3HA 4NF7A 3WNKA 1AQMA 1UH2A 3VMPA 2WCGA 4M29A 3WUFA 3MSGA 4AMCA 4MB4A 3FAWA 3L4XA 3EDDA 1QBBA 4W7UA 3AMLA 1WO2A 4H41A 1OGBA 4ML4A 2EPNA 4OBRA 2ZWYA 1XYFA 4MDOA 1NOFA 3VVGA 1GQLA 5A8OA 3AZTA 3SUUA 4MTVA 1M03A 1PX4A 1VJSA 5CZKA 2GJPA 3OZOA 3N9KA 2E0PA 1ODUA 1AMYA 4JCLA 3IAPA 1TE1A 1JF6A 5E70A 2VUYA 1V0LA 1DWHM 3T2PA 3K4AA 1W9VA 3WL0A 4B16A 1MXGA 1C7TA 3K46A 1B90A 1UWUA 3QOKA 1J0HA 2WHLA 1OIMA 4HMCA 3ZT6A 1E43A 2W5FA 3UG5A 1E5NA 3VU2A 2ZUSA 3O9NA 2C0HA 2FH6A 1OIFA 4WKAA 4U3CA 2VT0A 1X1NA 4MB1A 4CCDA 1CGWA 1GHRA 1V3LA 4P8VA 1JNDA 4PTXA 1EHNA 1B3VA 1BYBA 1FP9A 4XUYA 2EXOA 3NDYA 1C92A 4MPKA 5I5RA 5FL1A 1GUVA 5AYBA 4BS0A 2ZX5A 1R86A 1JFHA 3M07A 4PTMA 4K68A 1DEDA 1ODZA 1K9EA 3LMYA 1VFFA 2DT2A 1UKSA 2DSZA 3UR8A 4W5UA 3AHYA 4BQ3A 4HOZA 4PSPA 3OGSA 1WCGA 4DWSB 3WD2A 2XFFA 3RM4A 1UD4A 3AXIA 4MNKA 1KQZA 4CGTA 3K8KA 1ZJBA 4GXPA 4CKQA 4W7WA 3CUIA 1KGWA 4W8BA 4NZCA 1CGUA 2WK2A 5M17A 4RE3A 5KEZA 3NJ3A 1FH9A 1C91A 2VL4A 3W6MA 1K9FA 1JDCA 1AVAA 3ARZA 3VNYA 5FKYA 2OSXA 4CU6A 4UQBA 5ABHA 3PZOA 4ZFMA 3AIRA 5M3WA 3S6TA 3OIHA 3CPUA 4R5EA 3CHCA 3WQ5A 2X1IA 3BAJA 2WSPA 2A3AA 1W2VA 3EDJA 3KL3A 7CGTA 4HA1A 2W4XA 2WAGA 1V0MA 1E56A 3SCRA 1CDGA 2ESCA 2J8GA 2G41A 2WZIA 4D6DA 4F9JA 2FHFA 1GW1A 2VTFA 4WF7A 5LYRA 3VGEA 1B31A 3RMEA 3AHXA 1LLOA 1V08A 1ISYA 1R85A 4V2XA 4QDMA 3MUZ1 5JBDA 3VDAA 1O6IA 5BXSA 2WXDM 1BGAA 2WC7A 1J0KA 2VVSA 4W5ZA 4XX6A 4B3KA 2XG9A 3RJXA 1LL6A 4D6IA 1BFNA 1LWHA 4GKLA 2HVMA 5CXPA 2VURA 3TTQA 2D3LA 1KWGA 4IUGA 4M56A 1FFQA 1CXIA 3SCPA 4CU7A 4GZJA 2AMGA 2OSWA 2A3CA 2YDQA 5A6LA 2G3NA 1B3YA 5HNNA 3SUTA 3WUGA 1CXLA 3BAIA 5A2BA 1NM9A 1HJXA 2PWFA 4FMVA 1GHSA 2W92A 1KGXA 4P8UA 3DHPA 3VTRA 1PIGA 2VRJA 4AIOA 1UZ4A 1E6NA 3EMZA 5A8QA 1TVPA 2VI0A 1SYTA 1BSIA 4QFUA 3TOPA 2A3BA 5A69A 1GQIA 2YL8A 3CIVA 1F4AA 1QPKA 3EBVA 4HOXA 1UUQA 2Z1KA 3MSDA 4P7LA 2XYLA 1A3HA 3VX1A 4GO9A 1V3JA 7TAAA 2OWCA 5A6BD 3MO4A 3VUPA 5E6ZA 4D6HA 1GOOA 1L0PA 3U5YA 3WFLA 3VPLA 2EJ1A 1JNEA 1QI2A 3I3DA 4RE4A 3CTTA 3L4WA 3AS2A 4V28A 1U30A 3VGGA 5A6BA 3ZSSA 5CJ5A 5E0CA 1OD8A 1ISVA 2BY3A 4GI9A 1XYZA 3BAYA 2C8NA 3CMGA 4GI8A 4F9DA 2YLAA 2F61A 1H49A 3WNNA 3ZIZA 4TXEA 2V38A 1EQPA 5HOSA 3RCNA 1JXKA 2EQDA 1DWFM 2FHBA 3AISA 2CKRA 2D0HA 4ZE5A 3OB8A 3WUEA 3BLPX 1ISWA 4MJ4A 1LJYA 3AXXA 3AYSA 4DUWA 4BZYA 3GZAA 4Z2KA 4LQ1A 4J28A 3WF3A 4A3YA 1Z32X 2WZHA 4ACZB 1JZ4A 3VX0A 2JF6A 3WDJA 2VZSA 1VF8A 2XGBA 2AOSA 3W4RA 3F5JA 4UQ9A 2XFRA 4Q22A 1C7SA 3ZMRA 2XIBA 5AYIA 2WC3A 4PMOA 2VZUA 2G3MA 3O2LA 1HKKA 5A6AA 1NP2A 2DT3A 4UFLA 5ECUA 4UFMA 3B8SA 2OWWA 3WIJA 3WL1A 3GNRA 5D9NA 3ZJ7A 1UA7A 3WMBA 3VIJA 3RO8A 4WJXA 4U3AA 1HKIA 4F79A 4KH2A 5I3DA 1B30A 3L2MA 2CHNA 4UFIA 4BA0A 4U2ZA 3AYRA 3E1F1 1CPUA 1JXJA 1WAWA 3WN6A 1HL9A 3PZGA 5JIPA 4H2CA 4W84A 4S3KA 3N15A 1OINA 1UD8A 4DM1A 5CSUA 1DWJM 3BC9A 4M8UA 2PI6A 2ZUWA 3VIOA 2J25A 5DF0A 1J0ZA 3VM7A 4DWSA 3AZRA 5DMYA 5CPSA 2YL6A 2W67A 3OZPA 2PWGA 3WQ4A 2WVUA 4HZ7A 1V6UA 2DH3A 2XWDA 2BV9A 1W9PA 1E0VA 2PBGA 3ZO9A 1Q6CA 2FGZA 1BQCA 5I23A 1JAKA 1UA3A 4P8XA 3PZVA 4JKMA 2XPKA 2VX5A 4X0VA 4B9ZA 1E5JA 4CD7A 1V3KA 4D6CA 1W3LA 3A47A 4XZWA 1BGGA 2V3EA 1XH0A 3OLGA 5GNZA 3SIMA 2GSJA 3OBAA 3W27A 4J7RA 4QAWA 1EH9A 1E4LA 4TX6A 5KZ6A 1VEMA 1UH3A 4W85A 4AWEA 5JBFA 1JFXA 4NI3A 1US3A 5A6MA 3PTQA 4GQRA 4H04A 2VX4A 1UWIA 4EKJA 4WIWA 2J74A 4HPGA 2JEPA 3SCNA 5LA1A 1HL8A 5D9PA 2Y2WA 4TVDA 1IV8A 4Q7NA 3PN8A 1NQ6A 3WD0A 1PAMA 3W6LA 2ZOXA 3AS3A 2PBOA 1C8QA 1XGZA 3JUGA 1GONA 4LYQA 4JFVA 3J7HA 2WMIB 2NT0A 1HIZA 4MNJA 2QV4A 2VQTA 1VIWA 3APGA 4MNLA 5D9OA 4UOQA 3NSNA 1Q6EA 3U7BA 1EO7A 5BROA 2AAAA 2B31A 3UESA 5BRPA 3ARWA 3VIMA 1BPLB 5IHRA 1UKQA 2CHOA 2WC4A 3OA5A 4XB3A 3FNDA 3BSGA 2IXVA 2X0HA 3AMGA 1GJWA 1V3MA 4OIFA 1QI3A
chains in the Genus database with same CATH superfamily
3EXTA 3R12A 2J27A 4Z2GA 5LIXX 1PKMA 3BSHA 4W89A 2NUXA 3G8EA 3F03K 1CXEA 3L4VA 5CSYA 4GVFA 4TTGA 4HHMA 3U5UA 3TTSA 4Z1DA 2ZX6A 4DO7A 5HBFA 2XJ7A 2J66A 1E70M 1HW6A 1PKNA 1W8SA 3C52A 2VQUA 3W76A 1R30A 3L12A 3AQUA 5FJUA 2CZVA 4JTKA 4ERIA 4LBUA 1WXZA 2EPMX 3IUHA 4BI5A 2PB1A 3WLOA 1FP8A 3NSMA 5FF3A 4XIMA 1IWAA 2ZYFA 1S2VA 1SFJA 2CLLA 3TLQA 2V5LA 1Y7VA 3ES8A 2OODA 4DRSA 1BAGA 4YVVA 5G5IA 3KFTA 1RVGA 4O10A 1FY6A 2GWNA 2VYOA 3EMCA 2E9MA 2BY1A 1NWRA 1RSCA 1YYAA 3P80A 5K4XA 2X05A 2Z1BA 3C6CA 4CEUC 3TTEA 4PMDA 3DECA 2E6FA 1R9XA 1W1ZA 1MW0A 1X39A 3NQEA 2VX6A 1I2RA 3O0KA 2YL9A 2VWSA 1GVOA 1ICPA 5K9CA 1GOQA 3A12A 2BY2A 3MW7A 1M04A 5ABEA 1AK5A 5AC6A 5CC7A 4AQLA 2G3IA 3T4WA 3EWBX 1RAKA 3MJYA 4E3VA 2I7GA 4FZIA 1K6AA 3GVVA 3CB8A 4DYKA 3VMNA 1QW9A 2QYGA 4RLIA 1KFLA 2O9OA 4QS5A 1J11A 1RBOB 4JICA 4K1GA 2PLMA 3TQVA 1GYMA 1W2PA 2PDJA 1EEPA 3PPCA 3UZ5A 4N7QA 1HX0A 2ZUMA 4Q4KA 4ROPA 4K8HA 1X8CA 1XFCA 3RMJA 4DWSC 2YOCA 2ZZ1A 3AIBA 1F07A 1OFPA 5HPOA 3GR4A 4PTWA 2X2GA 5CGTA 3NEVA 1HFBA 1OGSA 2FKPA 1E1CA 3AMCA 3HN3A 3P5YA 3STPA 4GFSA 4F40A 2PPGA 5I6SA 3XIMA 2ZDRA 4GYJA 1TIWA 1PJ9A 3A3HA 4FALA 4DO4A 4MUPA 3DYOA 4KWOA 2VGBA 3DKJA 1O66A 2QJHA 3S1XA 1IR1A 1GJPA 3P8IA 3WLTA 4DELA 4RNJA 2J75A 1RPXA 3NPXA 2WLYA 2Z27A 4DY1A 3QGKC 2A85A 4YMZA 1KGUA 5ABGA 4C6LA 1PVNA 2PC4A 4XD4A 2BS9A 5EFDA 4NVTA 5T91A 4GZ7A 4HA0A 3W1PA 2I5IA 3FW6A 1NOUA 2OEKA 3AU2A 4D2JA 4HGXA 4Q8OA 1PZ0A 1W1A1 3M46A 4AXKA 3WDQA 4JTJA 4OJYA 1HKJA 4JQ2A 1S5TA 4J3SA 3TSMA 3PVFA 1N7KA 1R46A 1H0GA 4HSNA 4J9JA 1OC5A 4HD5A 3ZZ1A 2VX7A 1FWFC 3R13A 4O53A 6A3HA 2VCAA 3CNYA 4HVXA 2FTWA 1YPFA 5A6JA 1V3HA 1DQWA 3FDGA 8A3HA 3EX4A 4KBXA 5C54A 4HU8A 2BB0A 3FGCB 1W3HA 4F48A 4R85A 1GOWA 4MSSA 1C8XA 4ACZA 4HU4A 3BG9A 1E0WA 3PJXA 3WK0A 1RJRA 1T40A 3RX3A 6TIMA 3F5KA 1GT8A 2JBMA 1DYSA 4AZIA 1A3XA 1A4LA 4AY8A 1E15A 1TRIA 5FCZA 1TFVA 3GBEA 1WZKA 1TMLA 3FLUA 1HZYA 3MUY1 3OODA 2ZUUA 1NEYA 1TJPA 2ACRA 4NAFB 2DQWA 2F84A 3RX2A 3D47A 3KWSA 4PN2A 5A2AA 1JF5A 2Z1VA 3OGRA 3M0MA 3S1WA 1JI1A 4KCVA 2FPYA 4PUUA 3W82A 3BAXA 2PLKA 3VINA 4E0CA 5C9XA 1ZNNA 1HXJA 3AS1A 3CAQA 2HTMA 2YB1A 1XYMA 3UR7A 1QNSA 4UMBA 3MANA 1E6ZA 2WOQA 4RZ6A 1LG1A 1TR9A 1X7IA 1Q6LA 1VBHA 1HJSA 4M1RA 2Z2AA 3N12A 3S5NA 1U1UA 3KRUA 1XCFA 1JJKA 5D2XA 5FJJA 1QHPA 5GNYA 4IGHA 1JYWA 3ITLA 3NQ8A 1M9HA 2WQDA 3CZEA 4JN7A 3VOHA 2Y1HA 5C9WA 1WYIA 4XBSA 4PUDA 4REQB 1AZ1A 1P0NA 1QT1A 3BGGA 3A4XA 4L4OA 3MU7A 2GPTA 4PFHA 5LA0A 2NX9A 1OFOA 1KR0A 4RDYA 2OO0A 4A35A 4AX6A 3WNLA 3E2SA 2ZZ4A 5A8PA 1ZQ5A 2NT1A 4WRHA 1J5SA 3CPRA 1AD4A 4YTQA 4YCOA 2P8CA 3HPFA 2IPGA 1QU4A 4RE2A 1LOLA 1XBYA 4B4FA 3EX6A 3IJ8A 3OLEA 2DEPA 5CZJA 2PDWA 1DQXA 1BTMA 4GPNA 1IHIA 1V7YA 3F2DA 3WDRA 1GQKA 1WDDA 4AZCB 3UG4A 2BY0A 1WZAA 4KRTA 3VIHA 3ALGA 4CQ8A 2VUNA 2NQZA 5EA9A 3DN5A 2ZE0A 5D2TA 3H7VA 4I6VA 3M7WA 1MYRA 5LKYA 4MNMA 1NJJA 3GQYA 1RD6A 2Y8VA 4AZ5A 4X2PA 1H5YA 3AZSA 3MCOA 4P7OA 1KQYA 5C8BB 1TELA 3QLLA 4R27A 4D8LA 3G22A 1UPMB 1XYLA 5GPRA 3A13A 4E8GA 5LSMA 2E68A 1PX3A 3S42A 4AZCA 4ZQOA 1XLLA 4WK9A 2VOMA 1KW1A 4O13A 1EL3A 4C6BA 2QIWA 1W6TA 2XVGA 2Q8LA 3EYPA 3UJSA 3TTYA 3W28A 1OB0A 3H4GA 4D6GA 5I00A 1T99A 1QFEA 4R7WA 5J8LA 3HA1A 1H0IA 3W07A 3ZSTA 3PTMA 4QIUA 3WF2A 1JZ8A 1WKYA 4PTVA 4MY9A 2A6NA 2V2CA 1HGYA 4HTYA 3IVSA 3W84A 3L66A 4RDWA 4HPXA 3RF9A 1TV4A 2NLYA 4Y2WA 4XAPA 3Q58A 3QOMA 2IQ0A 2J7EA 4QQ3A 3UBPC 2NVCA 1M6JA 1RCOB 4N9DA 1RALA 1ZGDA 3TA9A 2Y70A 1JQXA 4HZ6A 2F38A 3SO7A 2PFHA 3GH7A 3QJAA 4C6FA 1GPFA 3M0KA 4WLCA 3AMDA 4HZMA 1HP4A 1AH0A 3EDKA 2HQAA 3RXZA 4HQVA 2DQXA 1EGZA 1FQ0A 2P3ZA 2WCAA 3UWYA 1W54A 2BNJA 3ZM8A 1GOIA 4NL1A 3L9CA 4JFTA 4OOZA 4C7FA 3E2RA 4ZVJA 4L4LA 4KETA 1A5NC 1XINA 3M0ZA 1UC4A 4XZBA 3RYSA 3KCLA 1FWRA 2CXGA 4I9AA 2WQPA 2XFWA 3V4BA 3R94A 3ARXA 1OBAA 3QRHA 4FEZA 4C1NA 3CASA 4KERA 3H2AA 3AIWA 3I10A 2WSKA 2FZ8A 5E5CA 3CB3A 1LBMA 3N9RA 4WGXA 5IRPA 4NJGA 3NZRA 1KB3A 4AW7A 3W7KA 3UWUA 5MHBA 1U5JA 1DWGM 1NWSA 3C3NA 1UR9A 4QJ3B 3IPWA 3SRHA 3T44A 4HHLA 3SDOA 4LBRA 2WMHA 1R8LA 3B4UA 2XFYA 4Y9AA 2YCLB 3BJSA 1XW8A 3VE9A 2WMGA 2WV8A 5EMYA 1VFOA 4V33A 4UNIA 4FX8A 2OZ3A 5D4YA 4Z1AA 1JCNA 4RE0A 3NQ2A 1T41A 3FJLA 1E0TA 2CLIA 3BE7A 1M7XA 3SQSA 3DKLA 1BYAA 4Q4OA 1XSKA 5CLTA 1Q63A 1VZWA 1V6WA 3HPAA 4I5UA 3GK0A 7PTDA 5C0QA 1XIEA 4NSBA 4IMGA 3CWOX 3VZYA 4BF5A 1IXQA 2GQ9A 1IT0A 1WXJA 3RIKA 2X8RA 4GCAA 4AH7A 5AC5A 1XBVA 1BD0A 1AL7A 1N55A 4QJ5B 4CQAA 2PZNA 4JIQA 1XDJA 1PZ3A 2TPSA 4D72A 4OWGA 1JUEA 2A2IA 3RR4A 4J5NA 3ZJ6A 4GACA 1UW9A 3TX9A 3G1FA 4UTUA 3N11A 2IPJA 4LALA 4TX9A 4KT2A 3GR7A 2ZRZA 1EGVA 1E9LA 1Y65A 4GUIA 2QEZA 3LV6A 2ICSA 4WDUA 2E1DA 3N73A 4RV3A 2VEIA 3ARUA 3SUWA 2V2HA 1O5KA 4U28A 1PYFA 5HDRA 1E4NA 4ES4A 4AD1A 4LXFA 4A2RA 2EPOA 2O55A 3PNUA 1GW9A 3CHEA 3P2VA 4B5XA 3IUIA 3RPMA 2WVSA 2QV5A 4IL0A 1DWAM 1W3JA 3BWWA 3ZR5A 4IX0A 2MANA 1N82A 1TZZA 1LLZA 4L4PA 3DG6A 3KBJA 2J7FA 4O28A 3O8AA 1RPKA 1GGOA 3XISA 3BL3A 2Y62A 1EZWA 3WH7A 1E1FA 5I02A 3LCWA 4CCEA 8CGTA 4Z2IA 1AJ2A 3VC6A 1TQJA 2DZUA 6ALDA 2YZ5A 4ML9A 1NWUA 3G2GA 3DHUA 2WM0A 4FNTA 3H6OA 1XSIA 3ARTA 2YA0A 3JZUA 2PU0A 4KF1A 2B7NA 1X6LA 4EXAA 3DENA 5A6KA 5HWJA 2J62A 4ADUA 5K9DA 4UFKA 2WBKA 3FKRA 5G2WA 1UR0A 3FHQA 4EANA 4J35A 1ZU8A 2R1PA 1E3XA 4BEUA 4E2OA 2WKJA 2HE8A 2VR2A 4E2DA 4PTDA 4U31A 3U57A 1JRBA 4W86A 5I3KA 1R3QA 4LUSA 4WUIA 3KOWA 2ZRYA 4LC6A 4GVIA 5D8ZA 1JZ5A 4RZ5A 2J7DA 3SY5A 4X0NA 4LUIA 4GRSA 2V81A 5DN1A 4LWWA 3V18A 4H7VA 5KZDA 3WFAA 1E1EA 2AQWA 5HANA 2VD8A 2FZ9A 3M0LA 3E0VA 1X7FA 1TV2A 4RW3A 5K3VA 2XM2A 4L6OA 3T7VA 1XC4A 4TQTA 3LY0A 4O17A 1W3NA 4E4FA 1C3FA 1X8FA 1SMDA 2EKGA 4PMYA 4IJRA 1PX8A 4PUKA 1NTHA 1E55A 5DCDA 2W0UA 4FSAA 5FEPA 3STEA 4AIEA 2D22A 4AZ6A 3CUXA 3NOEA 2YGYA 3GH5A 3HF3A 3PPFA 4U33A 1O12A 2RDUA 1GVQA 4G7FA 1YDOA 3CZ8A 1CZ1A 4HCHA 3H2CA 3WD1A 2Y8KA 2DVXA 4KIEA 3HURA 4CD8A 3ISIX 4D1IA 1BRLA 1GEHA 2BTMA 1UP2A 4CEXC 2VZOA 3G3MA 3APTA 3V16A 3PSWA 2ZZ6A 1R38A 1JG9A 5JBEA 3PAOA 2DIJA 4IQDA 5FEWA 2V30A 3VKAA 4C7DA 3W2LA 3B0UX 5IBXC 4LVDA 3C2VA 3SRFA 2PDXA 2RDTA 4LV4A 4QM1A 2PZ0A 3UFYA 1ALDA 3RJYA 3GH4A 3A23A 4PCNA 4F0RA 3EWWA 3GZ3A 4UTHA 2PRHA 3PUDA 4QISA 1H62A 4I8DA 3B9OA 4JIRA 3MVIA 2ZX7A 1YLVA 2Y5EA 4ACYA 3WQOA 4X22A 4UQDA 4D8ZA 1QWKA 3QY8A 2EPLX 2G50A 1BQGA 2J77A 3WJZA 1T96A 1WAUA 4G56A 1J79A 3VCRA 2DSKA 4NJHA 2BXVA 4IX2A 1N8FA 2Q71A 1R3VA 4GBDA 2GLKA 2XTKA 1JZ6A 1DJZA 4PSRA 1H4PA 4H9UA 4HMDA 2F2HA 5BU9A 4CVWA 3R5EA 3GXIA 5FAGA 1ZPTA 4HJFA 1B3ZA 2WPGA 4MPQA 4UCFA 4X9YA 4DBEA 2HXUA 2RH9A 4IIGA 1UOKA 4GISA 4GUGA 1Q4NX 1TPVA 3W7DA 3KBVA 3MSRA 3MO7A 4DAFA 4PRWA 1DE6A 2VP8A 1XLEA 5C2CA 3W1NA 1IIGA 4XTIA 3GE7A 1SO6A 1SU5A 4UTLA 2FHCA 3KZPA 3QV7A 6REQB 3SSJA 4IIHA 4XZLX 1K8XA 3MZ2A 4V27A 3VNMA 4J27A 4ZA0A 2D0FA 4CVUA 4QR6A 1TX0A 1VYRA 4ZO9A 1KTBA 3ZOAA 2YCKX 3SCVA 4MFDA 3QR1A 3T4CA 3W1LA 1AW1A 4FB7A 3Q94A 3QR0A 3CUHA 2WKLA 4QJ1A 1S46A 1K8YA 3ZWSA 2J9XA 4LUTA 4ALDA 1MVYA 1M68A 3P82A 2GL5A 3VIKA 1W1PA 2EJAA 4G7EA 3A3XA 2A3EA 5I0DA 3N2MA 4F66A 3CV6A 3T07A 4ATLA 1HQTA 3HFTA 2QT3A 5DXYA 3OGVA 3S83A 3G1AA 2A3HA 2Y7EA 3F4DA 3IARA 2RHGA 2QJIA 2Z26A 3G1VA 3QYSA 3GFYA 1EXPA 1RD5A 4WEVX 1QNQA 1CTNA 2VMFA 4GMEA 3W25A 1XYCA 3CEPA 4LVGA 1H09A 2EEXA 3T6CA 3N2TA 2YX0A 5FESA 5JQ9A 1OG0A 3BZGA 4LUTB 4ZEPA 1WUFA 1U5VA 4Q4MA 3H4XA 1UKTA 1OC6A 2P3EA 1KLYA 1KKRA 4DJFD 1ELSA 3M16A 2NSXA 3ME3A 3GLCA 4IGSA 3K2GA 1DXIA 4IPNB 2CYGA 1E6QM 2OKOA 2WVVB 4L5ZA 4X3ZA 1US2A 3N29A 1ONEA 4JHOA 1ADDA 2PDBA 3W23A 3OBKA 2ISDA 1DORA 3P84A 4H9ZA 4B90A 1ONWA 3A3WA 1OYBA 5HQLA 2J9ZA 2P1FA 5AVHA 4N9BA 1QK0A 4I5RA 1HJVA 4GJJA 1TUXA 2PTZA 1KFBA 2PMQA 4GIRA 3NURA 4YHGA 3BLOA 3R58A 3KDNA 4AHPA 3ZWTA 1H63A 3TN4A 3BGAA 3FVMA 1F4HA 3RR1A 3WF1A 3CZGA 2FYMA 4JXCA 3TSDA 4Z1BA 3CUFA 4JCMA 5CLWA 3OA3A 3WLRA 3KRBA 2QLYA 4HP5A 3TKFA 2GJRA 4X9SA 3N17A 3CZLA 1MSSA 3TWAA 1UH2A 4AFYA 3SY8A 4OVXA 3L4XA 4M7SA 3W7GA 3ZLFA 4W7UA 3AMLA 4H41A 2HBXA 4OBRA 3E5PA 5ECVA 3VVGA 1L8PA 1ZY9A 1M03A 4L56A 3W7MA 2A7NA 2GJPA 3N9KA 1ODUA 1ECQA 2GJLA 2GYIA 4GXWA 2JGQA 5D2YA 1KRAC 1JF6A 1V0LA 4A8LA 1B90A 3TU9A 3LXAA 3R4IA 3GG0A 1OADA 1LRNA 3WCZA 3PNZA 4S39A 4CCDA 4ZTXA 1GHRA 1TWZA 2R1LA 1ZZMA 4P8VA 5CSSA 3VABA 5T9CE 3E0FA 2CWXA 1B3VA 1BYBA 1FP9A 3NDYA 1C92A 4MPKA 1XIIA 3ABRA 4JQ1A 5FL1A 1ME9A 5CG7A 4BS0A 3QKEA 2BSLA 3U2CA 5K2ZA 3M07A 1O60A 2G96A 1DEDA 1ODZA 1XRTA 3LMYA 2D73A 4K36A 3O6CA 2DSZA 3AHYA 3ES7A 1UZHA 3N3TA 4Z17A 1MXSA 3SW6A 2R1NA 3RM4A 5DCEA 4S3EA 2QQ6A 3AXIA 2FPVA 2G3FA 3DFYA 4CGTA 1ZJBA 1AFSA 3ITOA 4W7WA 4FNRA 2HCVA 3N4FA 1FH9A 2WNNA 3I6RA 1EF2A 4Y90A 3W6MA 3AALA 3VNYA 3S2NA 4MZ8A 1TREA 4GQBA 4CU6A 3HGSA 1VPYA 2BDQA 2KX9A 2QCCA 4QX4A 3GVWA 2WSPA 3W2MA 3EDJA 2BWGA 4HA1A 2QJMA 3CAWA 3IIVA 2WAGA 2ESCA 2WZIA 5E9XA 6XIAA 3NGFA 3L68A 3LHVA 1B31A 2PE4A 1YE6A 3S4TA 3TV8A 1WOBA 3PPGA 5AC7A 3LDVA 3VDAA 3O15A 4EP8C 1O6IA 5BXSA 3TIMA 1J0KA 4HIBA 4B3KA 2ZQ0A 3RJXA 4WR3A 4GX8A 5LXEA 3DERA 1LT7A 4GKLA 2BMBA 3M41A 2VURA 4HK6A 2D3LA 4GJ1A 4M56A 4GZJA 3HGJA 4FNQA 1U1JA 1M5WA 2YDQA 2G3NA 5HNNA 4UTKA 1CCWB 3GDKA 3EOOA 4FMVA 4CQCA 3LX9A 4P8UA 2D69A 4WX2A 2YZRA 1PIGA 2OLAA 2VRJA 4CNNA 3EMZA 1TVPA 4JEQA 1NDZA 2VI0A 1BSIA 1JVNA 3UXKA 2A3BA 3NL5A 3TC3A 1QPKA 4IPIA 5EMMA 3BW2A 3EWYA 2XYLA 5D37A 3UU0A 3GDMA 3HQ1A 3IK4A 3PJTA 3VUPA 3WLMA 4D6HA 5D02A 1UB3A 4GK8A 1DIOA 2QULA 4NUWA 4JDBA 4WZHA 1JNEA 2Z25A 1G4PA 4RE4A 3BLLA 4L61A 3VCCA 4U4MA 3W87A 3UR2A 4LS0A 5CJ5A 3AU6A 3GUWA 5AOUA 4LH8A 1XYZA 3S46A 3BAYA 4GI8A 4F9DA 2YLAA 5AFDA 3NZQA 2F61A 2ZTKA 2O0TA 4TXEA 2V38A 3TAOA 1EQPA 2PGEA 1RQBA 1JXKA 3MHGA 2YR1A 3TN5A 1K8CA 5CZ0A 3WUEA 5CC5A 4IJCA 1ISWA 5E1QA 1CB2A 1QUMA 1LJYA 2QDGA 2QW5A 1IF2A 1XLMA 3FSUA 1IE7C 4POCA 3WX7A 2JF6A 1KM4A 3M5ZA 4ZR8A 2F6KA 3TAKA 1XLIA 1G7VA 3TROA 2AOSA 1QPRA 4XTDA 4IFKB 4Q22A 3ZMRA 5KINA 1CX9A 2XIBA 3JW7A 3DDMA 2P53A 3KP1A 5XINA 4UFLA 2YCLA 5ECUA 3LG3A 3GC5A 2OWWA 3WIJA 2IPFA 4DHGA 3P93A 3RO8A 4NXKA 3Q4DA 1EF3A 4U3AA 1HKIA 4A29A 5I3DA 4NKCA 1AJ0A 1B30A 3EZ4A 4UFIA 4S3DA 1OFBA 4U2ZA 3U8GA 4C91A 4JEJA 1XP3A 1JXJA 2OQYA 5JIPA 1F2JA 3MBFA 2GOUA 3N15A 1OINA 1UD8A 2O7QA 2DZWA 4N2YA 3BC9A 3GXNA 2ZUWA 4GBUA 3VIOA 3WQPA 3MB9A 2J25A 3VOFA 1ICSA 4R9XA 4QG8A 3VM7A 3ZS4A 1XYAA 5CPSA 3DFNA 1YNPA 2YL6A 5IOBA 5H91A 1R47A 1PS9A 2CU0A 5HJXA 1H7XA 1EJXC 3OZPA 2WVUA 3RCYA 2DH3A 1B57A 3BLEA 5CJNA 1A5BA 5I23A 2V63A 1UA3A 1JAKA 1W56A 2FFCA 3W1UA 1R6WA 3PZVA 1AUSL 2LLEA 1XL9A 3LM7A 4O0QA 2VX5A 3FJ6A 4B9ZA 2PDLA 4JTAA 1EJVC 5CJMA 4CD7A 2P50A 4O1FA 4XZWA 1W3LA 3A47A 1YBQA 1A4MA 1XXXA 4QSFA 3UA4A 5HR6A 4C6DA 3W27A 4J7RA 2Y89A 3PUEA 4LV9A 1EH9A 3XINA 5KMYA 5KZ6A 1UJPA 3CHVA 3RO6A 5JBFA 1JFXA 1SJAA 2YFOA 5J5RA 4RKAA 1J8VA 2V82A 1WKDA 1J2BA 2NWSA 4FA3A 4LCQA 1A0EA 1PHQA 2JEPA 4YTTA 9RUBA 3FGCA 5C7HA 3AWNA 3HPSA 2ZOXA 4DZHA 5EBUA 3HQPA 3MDWA 3GY1A 2OZ0A 3JUGA 2I17A 4LYQA 2WMIB 4NU7A 3LLFA 4K38A 3Q37A 2NT0A 1V5XA 4MM1A 1HIZA 4UCGA 2F6UA 4NZJA 1OF8A 4EPDC 3IJIA 1Z7AA 2X7VA 4QNEA 1SZGA 2OG9A 2VGFA 3B8WA 2GSHA 2B31A 3KOXA 3W02A 5BU6A 1UKQA 3S5ZA 2C19A 2VWTA 1OHLA 3BSGA 3AMGA 4MHBA 1V3MA 4C6NA 1GTEA 2HE5A 5F2MA 1CLKA 4QSHA 4TU1A 1AH4A 3P14A 1L6SA 5TNVA 4O1BA 4JNZA 1JZ7A 4JNYA 2JFEX 3LLXA 3HMJG 2WSQA 2VM8A 1S38A 1FHLA 1CLXA 2OOGA 3WLIA 5IHSA 4GC4A 1V6VA 3WNOA 1SSGA 3CO8A 3WQVA 6TAAA 3DFOA 3M5VA 3PSVA 4IHCA 1XUZA 4NJIA 1BYDA 2RGLA 1VYPX 2W27A 2OX1A 4DBDA 1U5HA 3K8MA 4GABA 3CWHA 2WNQA 4E38A 1YXCA 1KNWA 3CYVA 4GOAA 1ONRA 4BFAA 1W17A 1V4YA 1TCMA 3BG3A 3WF4A 4ZL1A 2HSAA 4MDPA 1ZB5A 2ZUVA 2BOGX 1VH7A 1HKMA 4LF2A 1V79A 2E9LA 3U9IA 1ZFJA 1QVBA 3S2LA 3B8VA 1H3GA 4AVNA 2YXOA 1BKSA 3L5AA 1LROA 1TE6A 4S23A 2CLFA 1RY8A 2RDWA 4UTJA 4O14A 5MF5A 2CIPA 2J8TA 5EFFA 1QTWA 4GIAA 1NH6A 2JIWA 4JFUA 3UZYA 1VFTA 4AD2A 3WBYA 3HV8A 2J6VA 5EMJA 3CUJA 3V36A 1QDSA 2V5JA 4NI8A 4LNYA 1QNPA 1VENA 1FDZA 3UPBA 3QC3A 1HNYA 3CM4A 2J8FA 3VGFA 1IT7A 4C5ZA 4JNMA 2BLEA 3BV4A 2E9BA 1DHPA 4O11A 3LBOA 2H8ZA 3E9AA 1JAEA 1J10A 3AIEA 2FTPA 2W6RA 2X7WA 4EAMA 4J2PA 2XWEA 4LUJA 1B3WA 3PTDA 2GDUA 2WMIA 1EBHA 1YRRA 1VBRA 2FZBA 3WH9A 4XKMA 3ANYA 3TJIA 3I3BA 4GQGA 3LB0A 1REQA 1A5CA 2DJXA 1MO0A 5IFPA 3R10A 4OKDA 1D7FA 1G94A 1J93A 4MWAD 2GFTA 2XH0A 1B4KA 1Y5WA 3IAQA 4A8IA 1MDLA 3SURA 4KGLA 3DC0A 5A8NA 4NRRA 1PB0A 4OUEA 2BXZA 2HNEA 4HCLA 5DX7A 1W3TA 4CCCA 3B8UA 1KV8A 3UJEA 4IG2B 1A5UA 3KS6A 5FI8A 3L5MA 3R7MA 4HN4A 3M6DA 4EOUA 3ATZA 3B8IA 3OYXA 3LNMA 4ERGA 3Q45A 5ABFA 2VOTA 5I3GA 1E51A 1Q85A 3JU2A 1G67A 1FFRA 2VRQA 1UR2A 3LCLA 1UUOA 2QDDA 5F4SA 4AYSA 3KE0A 2DPEA 5HJYA 4FLSA 5ABTA 1EIBA 1VRXA 2W62A 1ZJAA 3AMKA 3IJ9A 3GDBA 3B03A 1CB7B 1ZALA 1CGXA 3PFMA 3IJ6A 4XBKA 1L2UA 1V6XA 2WJEA 3IJ7A 4MWAE 1QW7A 4C6IA 1GK8A 1UD5A 3WLQA 5EGRA 3G18A 2CBJA 1GOXA 4FLOA 2PODA 1OD0A 1OYAA 3UQNA 1UYQA 3H53A 1UCWA 2FH8A 1ESWA 4PUEA 3THDA 2AAMA 1J6PA 1NWTA 2PS2A 3AS0A 3W7IA 2D0GA 4O1AA 2Y7DA 1L9WA 1ZRQA 3GNXA 1EHAA 1W1TA 1XG3A 1UWQA 3C0LA 3LUTA 3TW6A 3URAA 4QCEA 1GKPA 1RP9A 3NAVA 3TZNA 1JZ2A 4M6UA 1U2YA 2OLHA 4WDWA 1KRMA 3DH7A 3PBGA 1XIFA 4XG1A 2I9UA 4L64A 3NYDA 3DFSA 1HF6A 4UOZA 3BLKA 1MW3A 2O4MA 2J4GA 1SJBA 2C1IA 4W7VA 3NXFA 3H2NA 4FR6A 2NUWA 3H2FA 2ISVA 3GS6A 1V51A 1F6PA 4GXMA 1IWPA 2FZNA 4PBFA 2O9TA 4PMJA 4DN1A 2CKSA 3G1XA 5FAJA 1S5MA 3PHAA 2BZNA 4XWUA 1JI2A 4F8XA 3M9YA 4EPEC 1MXDA 3L4TA 2CFFA 2EG8A 1JPDX 2WHJA 1H51A 1B9ZA 4Q8UA 3SBFA 4LX4A 1SMAA 4IUOA 1JDAA 2W61A 2FPTA 4F3HA 3W1AA 3KTXA 1P48A 3F4CA 1Q6FA 3GXDA 4C90A 4B5TA 3UGRA 3W88A 5CPQA 1TR1A 2CPUA 3SR7A 4PMVA 1NVMA 4K2SA 2ZX8A 1L6GA 4HSHA 2EBNA 3G0XA 4TTUA 1K1DA 3KRSA 2DT0A 3U2ZA 2QF8A 4L6DA 1V02A 4GNJA 3H2OA 3E96A 3PG9A 1XICA 5BXTA 2HV5A 2W91A 4E6MA 3M5XA 3KUMA 1SR0A 4LGXA 3GW3A 1HUVA 3KXQA 3EKLA 3HIJA 2VFGA 3PB2A 3W74A 1EX1A 3HG3A 4ZSUA 3T40A 1XDLA 3LD5A 1LRQA 2YA1A 1LL4A 1PPIA 1UKOA 1EP2A 3LGEA 3WSUA 1R2RA 1TIMA 4YCPA 1R9YA 2C1HA 5ENLA 1P4CA 2RFGA 5LNWA 3IJDA 5AHMA 4LPCA 2OYKA 4PULA 2P76A 4UIOA 3NOYA 2ODOA 3WFZA 3CBWA 1T0OA 2F7FA 4HOWA 3R11A 2V3GA 4MIMA 1J0YA 1LLWA 3LCGA 3OG3A 1FH8A 4JIIX 2PP1A 4RDZA 3T78A 4CNTA 3DG7A 3RLUA 1MZRA 1N2VA 2YB4A 3WKZA 3SN4A 1EZ2A 1TZ9A 1E0XA 1NFGA 1PKYA 4R7JA 1PDYA 2Z2UA 5DELA 4YN5A 1E6PA 1G6CA 1K8ZA 2HDJA 4KQNA 4GWEA 3SI9A 1JDFA 2H9AA 3Q2DA 2A5HA 3VO0A 4US6A 3BQ5A 4UQAA 4CD4A 4K1WA 1H11A 1DHKA 3BCJA 4ZB5A 1TVNA 1QO2A 4R9OA 2QJNA 5I79A 3HZ3A 4LJ3A 1A5LC 4A3HA 1YDYA 5BMXA 3A5VA 2CETA 3VE7A 4PRRA 4OV9A 1H1YA 1A47A 1XH2A 1A5MC 3W0KA 3G24A 4NRSA 4OOUA 4TUFA 8XIAA 3WY1A 3EA2A 2E28A 2YDRA 1KBBA 4LEFA 1VR6A 4FXFA 3I3EA 1WDPA 5I07A 1I0BA 2XGZA 1EQCA 4LVBA 5M5DA 3ALFA 3GDRA 3QV6A 1W9BM 2I57A 4JKKA 3P67A 3E02A 2OWXA 1ISZA 1US0A 2DU2A 2JGYA 4KWWA 3WEMA 1IEQA 4PCSA 4YYCA 3T9PA 4XD3A 3OVRA 4DYEA 5F7UA 3JRKA 3WNMA 1HJQA 4HMEA 3ZR4A 1XCWA 1TQXA 2X1SA 3POCA 3VGHA 3WO8A 3ZVHB 4BQ2A 1Q5MA 3D5HA 1D7KA 4MLJA 5KTLA 2ACQA 2UY2A 3IEBA 4JQ3A 4AX7A 4ZODA 1H61A 3W1MA 5J04A 3CGTA 4FX7A 2QGHA 3KVMA 4LYRA 1UROA 2DUAA 4AD3A 3QFWA 1GG0A 4H6RA 2VNCA 4LY4A 4O19A 5IXEA 1TA3A 3NVDA 3H55A 2WWDA 3THUA 3W3OA 3DUGA 3LSCA 5D9MA 3TVAA 2Y88A 3D3FA 4BCEA 3WELA 1GZ1A 1NFBA 2EAWA 2DUZA 5CBJA 2DSVA 1F8IA 1WA3A 3RLGA 4JTLA 3MP5A 4QG9A 1AQHA 2I56A 3UWZA 3ITCA 1EO5A 2IQDA 2VC9A 4EWND 2H9AB 1IIHA 3A4AA 3PWGA 2JEQA 1GKRA 4TVCA 2Z6JA 3FA5A 4DM2A 4ATDA 4DWDA 3ZT7A 2O56A 1H50A 7TIMA 3MMDA 1QNOA 3WQWA 3LMZA 3NUKA 3GTFA 2XGIA 5HNRA 3UEQA 2B81A 5GVJA 2DSWA 4S3AA 1J9YA 2ZA2A 3GVQA 3GIQA 2E8YA 5A6SA 5EB8A 3C2RA 3VGBA 2A0NA 1S1PA 1S3HA 2DORA 3URBA 3B0PA 4N42A 1TPEA 3LV5A 4JTSA 2YPIA 1IXNA 3CC1A 5JIWA 1DV7A 2YIHA 3SCTA 1SFLA 4AY7A 3N9SA 5E0FA 4EPBC 3VIIA 4N4PA 4XAZA 4UNKA 1E3ZA 3MMUA 4OQVA 4RZBA 3TFCA 3GDLA 5K4ZA 4HPHA 1SPQA 3ZFHA 1T5AA 5I24A 1V6TA 1MMFA 4LTSA 2X1UA 5C5YA 4PE8A 1I2NA 1ZJIA 1R87A 4Y7EA 1MUCA 4H1ZA 1YDVA 3EA1A 2DZTA 3TSBA 4H8HA 1G69A 4B5UA 1QPNA 2DJLA 2TODA 2XVNA 3CHDA 1TA3B 5G2IA 3OVGA 3CV7A 4M6VA 4AIBA 2D20A 1DTUA 3CZJA 2VCCA 4DPQA 4Q7IA 3I7RA 1VYSX 4PB3A 5HPCA 4PB5A 2AL2B 3BURA 1F3TA 1W0MA 1H2JA 1CECA 1G01A 3IGXA 4A6GA 3EDEA 5CQ1A 3VDHA 3N14A 3UWQA 2CC0A 3O6YX 3TJ4A 3S1UA 1T8QA 5I3FA 1GJUA 1ZAHA 4NJJA 3AI0A 4P7RA 3GG8A 2POTA 2D2HA 1KTNA 1ZBWA 4XZIA 1WPCA 2W66A 1KBKA 3VOCA 2GGJA 2IQTA 2DH2A 4GYFA 4K7YA 3EPMA 5FIPA 3PJWA 5REQB 2D1ZA 3EB4A 4C6PA 5FA5A 2BVDA 4IGNA 3DFQA 2DW6A 4XZHA 4AVFA 1RA0A 3NQVA 3ARSA 4QLJA 4M81A 1HTIA 1UZ1A 3K13A 3VOGA 2XM1A 5I77A 5IDIA 3S9YA 3FIGA 6PTDA 1A3WA 3IIZA 1CENA 3ELFA 5D09A 3RITA 3LNPA 4D8AA 3MC5A 4YWSA 4IL2A 4KMQA 4AF0A 1E71M 1S1RA 2JKEA 3LM3A 5DBTA 1NSJA 5D03A 1NP0A 1F3EA 3VKDA 4W87A 5XIMA 3G1YA 1IWBA 1TJRA 4AC1X 2BXYA 2J7CA 3N6HA 3UY8A 3TTOA 4LAKA 3BXWA 4DXVA 3RN6A 2OO6A 1F6YA 4UR8A 2PTWA 3URQA 3KL0A 2OR2A 5DT5A 3EX2A 3FJ4A 3GR8A 1LZOA 1E0UA 4AC7C 4LY8A 1UBSA 1OF6A 3BMVA 5AHLA 1O7AA 3GFZA 1DVJA 5CZTA 3KEHA 2XSXA 1V6YA 4LS1A 4DJFC 3WQDA 4QCFA 2CZEA 1CXHA 1ZL1A 5DQPA 4Z2JA 3UG8A 5I06A 4NYYA 1FBAA 3V7PA 3SRKA 1JYXA 4OTKA 4MWAA 4M5PA 2ZXAA 2VFIA 1GVYA 4QRNA 3P0XA 5ABFB 2BVYA 3D6NA 1KRBC 2PWDA 1I1WA 1BG4A 3GHSA 3RRAA 3ZJKA 1DJHA 1S2UA 4XZ9A 2QIIA 2INEA 2GJXB 2QXWA 1J0IA 4UTIA 4YWIA 3W73A 1U33A 4U2YA 2RGMA 1XQKA 4HMNA 5CG0A 5CPOA 4L1WA 3TA6A 1UOZA 2W3ZA 4AWUA 3MUXA 1M7OA 4KCUA 4WDXA 3W72A 1J18A 1X6NA 5FD0A 3ITYA 1YMYA 4Q3MA 5FACA 2J88A 2O92A 5FJOA 2OB3A 2INZA 4FF5A 5HQEA 4RPPA 2DFAA 2XN1A 1DBTA 5FOOA 3VILA 4O18A 4W88A 5HULA 5BRQA 5J5DA 4AEEA 1D3CA 3TZFA 1MUMA 3TYDA 3LGGA 4E2VA 4GNVA 3BJTA 2EPHA 3LTPA 3WF0A 4UFJA 3CH0A 3WH8A 4J3ZA 4EE9A 1CXFA 3K30A 2PWEA 3MMWA 3H23A 2CEQA 1R3TA 5G1MA 3BUVA 3WJYA 3WD4A 1H5VA 1XBZA 2GOKA 3DBNA 1XHGA 5HUOA 4C6EA 1N8IA 4AZ7A 3REQB 5FF2A 1W5QA 1IZCA 3TH6A 5G4HC 3TQKA 1X97A 4C6KA 4AEFA 1PWLA 3M0JA 4JL2A 3WQFA 3NDZA 3B40A 4MADA 3N13A 4M82A 1MEHA 3NM1A 4RL3A 1YPIA 1PTDA 5HR7A 4NT0A 9CGTA 2E8ZA 3EWCA 3VXGA 2XH4A 2CWNA 4LYPA 1UZDA 2Y63A 4N6EA 3RFAA 3VIPA 3NNTA 3KTSA 4B5WA 2VGGA 1C9WA 3WBWA 3N19B 5H2ZA 1WOAA 5EBAA 5BWAA 5DY2A 1TB3A 5EPDA 5B7ZA 1Q2SA 2G5WA 1R7OA 4FIQA 2NQ5A 2UY5A 4AWTA 4EVZA 1AMKA 2GQ3A 2V5DA 1LWIA 4TOQA 3QHOA 1RBLA 5BZAA 5DEZA 1GQNA 3SFWA 4YL2A 3G6MA 4FOUA 1XGEA 4YVPA 1I45A 2EO7A 3UWEA 2PDQA 3RPTA 5LGZA 3FY1A 3LPFA 1UKPA 1FWDC 3PZTA 2YCJA 5HAOA 2YSWA 2X1TA 3OHMB 9XIAA 3IS4A 4IFOA 4PB4A 4PCPA 4H8VA 2CW6A 2H90A 3RDKA 5GJMA 2POZA 3EOLA 2XIIA 3QTPA 1BWKA 3EB3A 2ZZ7A 1Q2RA 4DF1A 2Y7FA 2CESA 1YQ2A 3REQA 3PS7A 5DMMA 1RJQA 1JCJA 4PC8A 2ZRXA 3H12A 4PMQA 4P7QA 4DJED 2AQVA 1OK4A 3SECA 1MQQA 3S6DA 3GVGA 3PTKA 3M7SA 3W86A 3IGSA 1BTCA 2PLCA 2VENA 3PP7A 2PDPA 4JTEA 3FEMA 4FNSA 4IXXA 3P74A 4AHQA 4CD6A 2V5KA 2XISA 4PRTA 1R7AA 4P5UA 4WGHA 3BCDA 1I75A 2FIQA 1TJ1A 3MYPA 2NVDA 4BR1A 1TX2A 3OVQA 4YNGA 1M01A 1YHTA 4EK7A 3AXHA 2YLLA 3C8FA 7A3HA 3G1DA 3WNKA 1L6YA 3OU8A 2WCGA 3DX5A 3MSGA 2HEJA 1BRLB 1GTHA 1QBBA 1SFTA 4XSLA 2ZZ5A 2QCNA 3I7SA 3K1GA 3NQBA 1F9CA 3QLDA 4MDOA 1NOFA 3AZTA 2GWGA 3O6DA 1VJSA 2FVMA 1VQTA 4Q8MA 3R8RA 3IAPA 5BOFA 4GQ0A 2V8ZA 4E4UA 3W7JA 3M5YA 4DZAA 2VUYA 1DWHM 3E2VA 3TYCA 4MWAB 3W7CA 1ZCOA 3K46A 4ZGYA 1J0HA 2C13A 1UIPA 4NQ1A 3E49A 1PDZA 1UBPC 1BXNA 3ZT6A 1E43A 3T81A 3N2BA 3VU2A 5FEXA 3O9NA 3TE9A 5CC3A 4IFRA 4KEVA 4Y8EA 1X1NA 5I3IA 4MB1A 4JQ4A 2IW0A 5DLCA 1DKWA 1EFZA 3UP8A 3N3MA 1EHNA 2EXOA 4F0SA 2OTDA 4UTWC 5HMSA 2QCLA 5AYBA 4ORMA 2P88A 1R86A 1JFHA 4PTMA 4K68A 4LEQA 1ZUAX 3NQAA 1K9EA 2PCQA 4GLEA 1SR9A 1I9CB 3MI2A 2DT2A 4Q6JA 3TOYA 4BQ3A 4PSPA 1XISA 3OVPA 1XFBA 1KQZA 3K8KA 4GXPA 4BKNA 4US5A 4ICNA 2IPWA 1ZJHA 4H9YA 4E5TA 4W8BA 1CGUA 4RE3A 4DUOA 1W5OA 1C91A 4HNOA 2HPMA 1Y5XA 2NWRA 1EJTC 1SW3A 1Z44A 3QPYA 3TR2A 3PZOA 3AIRA 5LHFA 3WK3A 5EKYA 3CPUA 3CQJA 1P0DA 2A3AA 1Z41A 5F2LA 1G7UA 9XIMA 3RPDA 1E56A 2J8GA 5HNUA 2ALDA 5HK4A 2Z24A 2FHFA 2J6XA 1GW1A 1P6BA 1R0MA 2VTFA 4WF7A 3TJLA 3R43A 5LYRA 2VGIA 4JYDA 4XUGA 1V08A 2I1OA 1KM1A 5JBDA 4JOMA 4O54A 3SN0A 2VVSA 4W5ZA 3LI1A 2XG9A 4IT1A 1LL6A 1TPC1 4M1BA 4KWVA 2HVMA 2ABAA 1Z48A 4IUGA 2ADAA 3SCPA 1S2AA 3CQHA 3QPZA 2AMGA 2OSWA 1B3YA 2HNHA 4MWAC 3R8GA 2PWFA 1FWNA 4WXYA 2CLOA 4JYEA 1KGXA 3DHPA 2QJGA 3EEGA 7REQA 3O0FA 2PGFA 1XX1A 3WLLA 1UZ4A 1E6NA 1EB3A 1VS1A 4NIRA 3UZJA 4QFUA 5LIKX 1P1MA 3VAVA 1F4AA 1E9ZB 3HBLA 1DOSA 3EBVA 3UWWA 1UUQA 2Z1KA 1TV8A 1A3HA 2SFPA 2HMCA 1V3JA 4GO9A 5A6BD 1Z3NA 2KZHA 1KC7A 5LNVA 5JH2A 5LIYX 3WFLA 2EJ1A 2WSRA 3I3DA 3KOYA 4DAIA 3S8HA 1MZHA 1KBIA 3KVLA 5TBOA 4V28A 1U30A 2XZ7A 3ZSSA 4XD5A 5E0CA 1ISVA 4AAJA 4K37A 4ROQA 3KP0A 4Z1YA 1YX1A 4FXRA 1KBJA 3D0CA 3MWCA 2Y5SA 4L6HA 1H49A 4WY0B 3ZIZA 3WK2A 1DWFM 1FHUA 4V1YA 3AISA 3GAKA 1ZP4A 2D0HA 3LTYA 3WG6A 3BLPX 3IRSA 1UMYA 4LCSA 3AXXA 4FIRA 3AYSA 3QC0A 3GZAA 5CKSA 4Z2KA 2V0TA 5I09A 3S3GA 5GJPA 1NAL1 4MKNA 3VFLA 2FZMA 3CUZA 3WDJA 2AMXA 1RV8A 3ITXA 1VF8A 3BLFA 3EEZA 3MQTA 1O5XA 4IQJA 4FP1A 1D8CA 5AYIA 5C7VA 3S47A 1K7XA 3TYUA 4H8NA 4CNOA 2Y8UA 2ZRVA 2CHRA 3WQGA 1NP2A 2DT3A 2Q01A 3H7RA 4EF8A 1F76A 3B8SA 1KKOA 1W5PA 3WL1A 4YLWA 4M3PA 2ZKMX 3VIJA 4WJXA 3MCMA 4DJDD 2C3ZA 1FWTA 1TPWA 4KH2A 2Z0IA 4MLRA 4UWMA 4BA0A 1NDWA 3E1F1 4LSBA 1YE4A 1WAWA 4AG0A 3R1ZA 3WN6A 1WQ5A 1AA1B 5T8GA 4S3KA 1FCQA 4QXIA 2G37A 2YXXA 3PK7A 3ZVHA 1KO0A 3SY1A 5KITA 3MJMA 1K77A 5I03A 3Q65A 1KFCA 2HXTA 4C6MA 1OX4B 3C3UA 3KBMA 1ME8A 2PWGA 3H8AA 5LHEA 5HMEA 4HZ7A 4K6AA 2QNEA 2XWDA 4ZB2A 1W9PA 1OFDA 2PBGA 5F2IA 3PWIA 4S3BA 1Q6CA 4LNCA 2QPXA 4H9MA 1LTDA 2BASA 3DU0A 5FEZA 4A05A 4GKTA 1W5MA 4JKMA 3FV9A 4H6QA 4X0VA 3ZVIA 4KS0A 1RY0A 4HCDA 1EYWA 4D6CA 4GD0A 1QOPA 1C29A 3OLGA 5GNZA 3OBAA 4QAWA 3OJGA 2GVJA 4C5YA 1UPPA 4TX6A 1VEMA 8RUCA 3SSZA 1PO9A 4NI3A 1M65A 3IIXA 2OFJA 1QATA 5AHEA 3SCNA 3WQCA 3EKZA 4NXSA 4IOTA 1GKQA 5AYYA 1IV8A 4Q7NA 3CXOA 3W6LA 3DBPA 3AS3A 1PXGA 2PBOA 3CV1A 4UUIA 3KRZA 3DI0A 2Z2BA 2RDXA 2W79A 4WOZA 2VQTA 3LTSA 1OK6A 1VIWA 2I16A 4MNLA 3L65A 3INPA 4GA8A 3L5LA 4X2RA 2UBPC 3NSNA 3HG4A 1A5KC 4B5SA 4ERAA 1EO7A 2P0OA 3W1RA 2AAAA 4HYRA 3UESA 1Z8AA 3TMLA 1E9IA 1S2CA 1BVWA 1GVEA 3W1QA 3NQDA 3OA5A 4XB3A 1UC5A 3B3DA 1YNYA 1VC4A 4OIFA 1KM0A 2RKXA 3SJ3A 4HPJA 3HU7A 4J3UA 1THFD 1DIEA 4OV4A 2G0WA 3KWXA 1G1YA 1GQJA 3GDTA 1LP6A 3FYOA 4ZOBA 4GY1A 2QKFA 4HYVA 4DXXA 3PZQA 1BWVA 1YXDA 1JCXA 1SZFA 1EJ7L 2WVTA 3PFRA 2DT1A 3V0UA 5AECA 1MW2A 1TTIA 1UQZA 1W5NA 3PG8A 4HA3A 2Y4SA 4FO4A 4NAEA 1IZJA 3O07A 4Y9OA 3LSBA 3PZNA 2OCZA 2FTYA 2ZIDA 2PTYA 4DI9A 1Z69A 1UG6A 5LGXA 2WVVA 5HQMA 4PMNA 2WMKA 1TG7A 2GUBA 2RUSA 2PP3A 4HKPA 2ZBTA 2QCFA 3VNZA 3KBWA 3V1HA 2ZCGA 1BG9A 1H7RA 2Y0FA 4Q4SA 3F2BA 3H70A 3NO5A 1JDEA 2PDIA 3W7RA 3PR2A 4LB4A 4CQDA 4FXSA 4CN1A 3VM5A 2E7FA 3TP4A 4LB3A 3MUCA 4ZBCA 4GO8A 2PC8A 3BAKA 3LRLA 3WLJA 3SJNA 4K8EA 3C2YA 3L4YA 5T26A 3I7QA 2WKGA 1E72M 5TQLA 3ZLHA 5A1AA 3V5CA 1DJGA 1A53A 2VZVA 4GJIA 2PF0A 3SCOA 1I6NA 3TYAA 3GM8A 2CBUA 2XN0A 3E3HA 3W7LA 4DJEA 1PEZA 4R3UA 3TNOA 1WE5A 2I14A 3R2GA 3V3WA 4JN8A 1HL2A 4M80A 1E6RA 3F1QA 4LFYA 5G2HA 3G0SA 2FDMA 3W1XA 1CW2A 3FVDA 1I60A 5AHNA 4S1FA 3B8DA 4DF0A 4O0KA 4F0MA 1LRTA 2OT1A 4O8RA 2X09A 1LDCA 2FQIA 1TPFA 3TR9A 2Q3RA 4JTCA 2NUYA 4J2MA 5EMLA 4RNHA 4QP0A 3VIFA 3HQOA 5I78A 4JL1A 3W81A 1VP5A 2EPKX 3UJ2A 4C7GA 3CIXA 3WLNA 1XLDA 3R0KA 4PEEA 3BK0A 3T0CA 1LF1A 3AOFA 5M03A 1TTPA 1PE1A 3EWZA 1OM0A 2Q8XA 2WO5A 3LI0A 4LRTA 3STGA 4M19A 1J2WA 1ZHAA 3SRDA 4G8TA 4QJ4B 5JXQA 1GOKA 2EG7A 4DB7A 1K9DA 1W9XA 1WDRA 3BGJA 1OGGA 1WDQA 5HJLA 4JIEA 5LA2A 1XLCA 3IJLA 4KKXA 1EWEA 1K02A 2YW3A 1IR2A 4ZTYA 4IPLA 1GZJA 1YKWA 2WM1A 1VFSA 2PWHA 1JZ3A 1KXQA 3G6LA 5TIMA 1ITCA 2J13A 3FAXA 1E73M 1K4GA 1MEIA 4GH3A 1QNRA 3VNDA 4R34A 1RCQA 3PZUA 4GIEA 1RR2A 1DXEA 1WZMA 3TFXA 1IYXA 2FMOA 4BWLC 3M0HA 1ZP3A 4IG2A 1XWYA 3WYZA 3ENLA 1NFPA 3DGBA 1FWBC 3QQ1A 3MT1A 2NSOA 3AYTA 4D6FA 3WMLA 3RAOA 1EJWC 1K9TA 3AROA 3GX9A 3FX4A 2R14A 2D3NA 1KCLA 1Q65A 3H21A 2E5BA 4KWUA 2A3LA 3LHZA 1R9ZA 2VCBA 3VYLA 1P0KA 3GU2A 1REQB 1PIFA 1VBGA 1XUUA 3ONBA 1GYLA 1OZMA 3UPWA 2DDXA 2YDAA 4N02A 1JCYA 3H2MA 3TONA 3SFKA 3HJZA 2ALRA 1C93A 3MDUA 4NJKA 1E4MM 1YEYA 1TYGA 4GQQA 3QH2A 4KFPA 5CEWA 4GGBA 3KAOA 4JIHA 4UBPC 3S9ZA 1JDDA 4Q8TA 3TYEA 3VKBA 4S3JA 1VEPA 3NYZA 5BRBA 3GHTA 1DPMA 3EWDA 1TV3A 3OZYA 2ZXDA 4GVHA 4TV5A 4KWSA 3IANA 3FSTA 3IIPA 3SM0A 1LBFA 2BODX 3VNKA 2WNWA 2YJQA 1G0CA 4IMCA 1J0JA 3NQ7A 2TRSA 3C0JA 4L9YA 4J3WA 4NZFA 3QSTA 1JUBA 4DBUA 4FLQA 4BI7A 1VFUA 2G3JA 2MUCA 3KZSA 1YXYA 3AO0A 3ABXA 4Y9NA 3W1TA 3FHAA 3DESA 3YPIA 1CGTA 1XIDA 3POHA 4LANA 1CXKA 1FWSA 5A5WA 4PMZA 3W7EA 4H19A 2GQAA 3IIOA 4DNHA 1GNXA 1OC7A 3S5SA 3ZYZA 4GUFA 4JFSA 4Y8FA 2BGQA 5CGMA 1H60A 1FWCC 2R24A 3U4FA 2XVPA 3NPVA 1SO3A 2VC5A 2GUYA 2CLMA 2PTXA 4UQEA 1KR1A 2QS8A 2VDIA 4O16A 2QR6A 2ZTJA 4YTSA 4IXHA 5F4XA 3OW1A 3CMJA 4W93A 3V35A 3HG2A 2HK1A 3QYQA 1A0CA 4LOCA 3WBEA 2QUUA 3QW3A 1SZRA 3QVQA 1S39A 1J01A 1IXOA 4ZO7A 5BNKA 3L0GA 3WENA 2E6DA 4ZXLA 3UY7A 2D2JA 5XIAA 4Z08A 4ZENA 4B5VA 2XHYA 4AY1A 3QSRA 1V02E 1KD0A 1SO4A 4PMRA 4Q7BA 1IXPA 1UD3A 3DI1A 4Z0JA 5KZMA 4O50A 3P0WA 1MW1A 2OEJA 1PL9A 3WDPP 2PDKA 2AKZA 3MI6A 2DUXA 5JVLA 2E3ZA 3NO1A 1ADSA 4NX5A 3MV11 2JALA 1HP5A 5CGQA 1V03A 3GC4A 2CZ5A 5KSWA 1C9DA 3HTWA 3LPPA 3PBYA 2CZDA 1CGVA 2C1GA 1ML1A 3L23A 3QHMA 1ME7A 1Z42A 3RILA 4EWJA 2H3DA 3ABQA 5CH9A 3A4WA 1OT1A 2HWGA 2X0YA 2C18A 2V68A 3ARYA 3CWNA 4O52A 4UZSA 1P6CA 7ODCA 3QY6A 1EC7A 2BVTA 1XGDA 4X61A 3V1PA 2TSYA 1KBLA 5IDZA 1Q7QA 1GVIA 3B06A 1NOWA 3KHJA 3AHZA 1MNSA 2GK1A 1CLVA 4Y9PA 3WBAA 2ZUTA 3GB6A 4WKHA 2WLZA 1UD6A 3HOJA 4B15A 1O4UA 3CL7A 4AEOA 4XQ6A 3GG7A 1I2OA 3EPNA 2PDYA 1EA9C 5CAKA 2OZTA 2IKIA 1XF0A 2PLJA 3T09A 2XSAA 3KTCA 2ON3A 2QCGA 3MV01 3PZIA 4FF7A 5U4NA 4KFNA 4YHEA 3GWQA 2OKTA 1TV7A 1WDSA 3N4AA 2J78A 3W24A 5IM51 4XIAA 3KCOA 4WKFA 3IVTA 1QW8A 1M7JA 3VI2A 4Y96A 1Y0EA 3M0IA 4MZYA 1PIIA 4S3CA 4QHRA 2PD9A 3BG5A 1QI0A 1ZAJA 4BEQA 3RLHA 1XR2A 4IH3A 2PWUA 1KM6A 1VFMA 3HM7A 5DRIA 1KCXA 2DZVA 1P43A 4AB4A 4B9YA 1WB0A 3II1A 1UWTA 2E6YA 3QY7A 1HKVA 4DI8A 5A94A 5JUVA 2WMJA 3E0IA 1Q13A 1Q6RA 2ZRWA 2VDGA 1N8WA 3W7QA 2R6OA 3BO9A 1EJRC 2J9YA 2H6RA 2ZXQA 1OQFA 1B1YA 3C5QA 2PDHA 3CT2A 4FLRA 1VKFA 4UZUA 1W9UA 3RM9A 1PSCA 1V3IA 2WJDA 1JULA 2D24A 1FRBA 1HVXA 1SO5A 3H54A 4PUWA 1OCBA 5A8MA 3WLHA 2J47A 4JKLA 1KXVA 3MCNA 3KX6A 4JTGA 3FXGA 3A22A 4UR7A 2YA2A 3MVTA 4URIA 3AXMA 3UXDA 4CNPA 3SCSA 3LBMA 1EPXA 4NNBA 2A4AA 1UWAA 3IACA 4HT3A 3O1NA 2X30A 4IPJA 3AICA 3KCJA 4GZEA 1X96A 3MMTA 3NSXA 2DGAA 4S2BA 4AD4A 2D2OA 3DOPA 3WMSA 2PURA 2C71A 3CU2A 4KEUA 3N1AA 3SUVA 3UXLA 1P0EA 4OT7A 1Y8BA 3CUGA 1WKFA 3VA8A 3WEOA 2D23A 2OMAA 2X41A 1E6XM 4I7UA 1AH3A 1YNQA 2NV9A 1RA5A 2B4GA 1TWIA 1BXCA 4AIUA 3PUGA 4B5NA 2GGGA 1R3WA 3OQ8A 1R3RA 4JZ5A 1YADA 1H41A 3WJSA 3NZ1A 4AHOA 4AZGA 3UERA 4CQ9A 4FOKA 1UD2A 4GIYA 5D04C 4CN6A 3AIVA 4UQCA 3W6YA 3VD9A 3TN6A 3NQMA 1UP3A 2XN2A 4TX8A 3EXRA 3QMTA 4HNCA 5A2CA 2VKZG 1VRDA 4FK9A 4G9PA 3WUBA 1MFVA 3NM3A 4AZHA 3LPOA 3S6OA 3KW3A 2NQLA 3W7HA 3AXKA 1EJUC 5AHIA 2ISFA 3LHTA 1S5NA 5LZLA 5GJNA 1FKXA 5C9RA 2R91A 5FL0A 3S1GA 1YW1A 1F73A 3GFXA 5I3JA 3SCQA 1MI3A 4Q8PA 4AXNA 1QHZA 2FDSA 2CNCA 2VR4A 2VJXA 3MHFA 1D8WA 3P81A 2NX3A 2IUZA 1G5AA 1XLHA 2XVKA 4LYKA 2WSYA 1FH7A 2OEMA 2OLSA 5SWUA 5A3HA 4DF2A 2WANA 3LOTA 4MAZA 5EY5A 5JU6A 3CK5A 3BW4A 3VZZA 2OYMA 1U22A 3EDFA 3H4WA 2EGZA 1XLKA 1H1NA 4AD0A 2F2KA 4W8LA 2A21A 4JQAA 4R53A 3T2QA 1R2TA 3FYPA 4HBKA 2QUNA 1ZLPA 3B9EA 3GYEA 1OCQA 3B0VC 4DJDC 3OLDA 2FZDA 4LT9A 5LIUX 3AHVA 3CHFA 1D2KA 3QZ6A 3C0QA 2ASHA 3PULA 4O4WA 4DQWA 4M6PA 4Q4PA 4A4AA 2W63A 2PA6A 4GI6A 4WJ8A 1J6OA 4EF9A 3VOIA 3BCFA 4XVEA 1XLJA 3EAUA 1LUCB 3KBNA 1VHNA 1NU5A 3LS9A 4XV0A 4D6JA 4ICCX 2R1KA 1C8VA 3OPSA 4BQ5A 2J7BA 3IJQA 4JFWA 1X6UA 4H00A 2D2GA 3VNIA 2E77A 3VCNA 3TDFA 3AJXA 4RUBA 1V0NA 4XKYB 5DFAA 1ITQA 4YYFA 3BQ6A 2WW5A 1GVSA 3KLKA 2VO5A 4M24A 5K7JA 2OZ8A 3KS5A 4IPPA 3DYPA 1AW2A 3GG1A 3NFUA 2OT0A 1FWAC 4E3TA 4FI4A 1RZMA 1D3HA 4L9XA 4PFMA 1EOKA 4UTFA 4FOJA 1SFSA 3PZ9A 3LK6A 3NWRA 1P7TA 3RRXA 3UA3A 1XRSA 4JX6A 4OFCA 3G8RA 1U83A 1SQ7A 1RP8A 4ZCWA 1EGMA 3UVAA 2GJNA 1FTXA 1QOXA 3KBSA 1KFEA 1Z89A 2PRMA 3W71A 4Z2HA 5CPLA 2Y6ZA