4PMVA

Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (xyna) belonging to gh10 family (space group p43212)
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
357
structure length
357
Chain Sequence
GTSLKQAYAQGFLLGTAVNADIVSGKDAASAALVACHFNAVTAENVMKAEVVAPRRGVQDFSAADAFVAYAQRDRQFVVGHTLVWHNQTPEWFFTTADGRPNTPAQQLERMRAHIAAVAGRYTGKVQAWDVVNEIIDEDGSYRSTNWVQRVGDGDTVVRNAFAFAQRYAPDAQLYYNDFNAWRPAKREGIVRMVKMLQQAGVRIDGVGMQGHWGLNYPSLRDIEDAIDAYAALGVKVMITELDIDVLPLTKEGQIIGTGMAHKQFQLPEFKRFLDPYRDGLPADVQAQLRDRYAELFALFWRKRDKIARVSVWGVSDDMSWKNDYPVPGRTNYPLLFDRNHQPKPALDAVVAVPSAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms associated with xylan degradation by xanthomonas plant pathogens.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase A
total genus 137
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmvA00
1C93A 2WC3A 1LJYA 1XSIA 4NRSA 3W6MA 2ZUUA 3W81A 3T2OA 3II1A 4U3AA 3NYDA 1KGWA 4BA0A 4UFJA 1HJXA 1YQ2A 1RH9A 2ESCA 1V3JA 2BHYA 3MUZ1 1OT1A 4KRTA 3JUGA 5HBFA 2CITA 2YL5A 2WSPA 4AISA 4BQ4A 1JYVA 3AS3A 1UWTA 3ZT5A 3OLDA 2PWEA 3OA5A 3ZR5A 3RM8A 4AD4A 5BRQA 1S46A 2ZUTA 5DT5A 4PCSA 2BXZA 5EFDA 1AMYA 2WKLA 2CXGA 2OSWA 5BXSA 1VJSA 4AZ5A 1FOBA 1PJ9A 2CIPA 1A47A 1V6WA 2W5FA 4F66A 1JXJA 4TX6A 1WDQA 1AQMA 4EKJA 1LL6A 3UESA 1I75A 2W91A 5CG0A 1W2VA 2BY1A 1UG6A 1NWTA 4GIAA 3WUFA 3MO4A 3PZ9A 3OZOA 3UG5A 3WMCA 1IZJA 1TG7A 4C7DA 4QFUA 3WUGA 3GYCA 2J7HA 2YL6A 3AHZA 1ZB5A 1CXFA 3AICA 5JBDA 4AZCA 3MUAA 3WKZA 4W7UA 5I5RA 1FFRA 2BFGA 4MJ2A 4GO9A 4XB3A 2TAAA 1MQRA 2VL4A 3RILA 1VFFA 2VX4A 4PN2A 2D23A 4PSPA 5CZKA 2XVNA 3WQ6A 2WVUA 3RDKA 4AD5A 5D8WA 1UR2A 2V5DA 1V6YA 1GQKA 3IJ9A 2OWWA 2CBJA 8CGTA 1UH4A 4QP0A 1MQQA 1CPUA 1JG9A 4FLRA 4J3UA 2DIEA 1QW9A 2J7FA 1JL8A 2Q8XA 4WK9A 4XX6A 2DT2A 3CZEA 3VMPA 4V27A 1J0ZA 5BXRA 1PIFA 1KFWA 1E0WA 3VVGA 1LQ0A 4PBGA 2CBIA 3WDPP 4D72A 1BPLB 3RO8A 4L4OA 2XSBA 3AZTA 4JHOA 1SYTA 1HKKA 4AD0A 5GQBA 2ZX5A 1QNOA 2W67A 4UCFA 2CHNA 4W93A 1V02A 3MU7A 4PUDA 1PBGA 3GDBA 2V3FA 2YA2A 3T08A 4IPLA 4HZ6A 2FGZA 1NARA 3GM8A 1BYAA 2J77A 5AC5A 5BYWA 3IK2A 5EMYA 1UWQA 3W82A 1VF8A 5JBEA 4UOJA 3CMGA 4B3LA 3PHAA 3TP4A 2ZWYA 1E6RA 1BGGA 2D0GA 1WB0A 4EK7A 3BSGA 1CYGA 3OGRA 1XH1A 2BVYA 3L4ZA 1H41A 4D71A 2VRKA 3SCNA 2QPSA 2DH2A 4J3XA 3AIRA 3AZSA 4AZCB 2VR5A 4HA3A 2ZUSA 5A95A 1XSKA 1B1YA 3OLGA 5I24A 1OM0A 2WM0A 5A6LA 2G3NA 3CZJA 3EDJA 4KWUA 1ZU8A 1JNDA 1GQIA 1D3CA 2WMFA 2WW5A 4UZSA 4XUYA 3WQWA 1IV8A 1OD0A 2X1IA 1W9DM 1EIBA 4CU7A 2XFYA 1CXKA 4RL3A 1WDPA 3DYPA 3MSGA 4PRWA 3PZMA 5CSYA 3OLIA 1HP4A 5JIPA 4BQ2A 1TCMA 1B0IA 3TTOA 4XZBA 1PZ2A 4ZE5A 2JIWA 3NSXA 2PC8A 1UD2A 1UWUA 3BC9A 3KL0A 2Z1SA 4UQBA 2GK1A 3GXFA 1E73M 1V3IA 3W24A 1ISWA 2EEXA 4CN4A 1SFSA 1CTNA 5A6SA 5A2CA 5TD4A 1QI3A 2YKKA 1E1FA 1MQPA 5D4YA 4MNMA 1JYWA 2DGAA 2E8YA 4W5ZA 1H5VA 4S3JA 3U7VA 3CZKA 1ZBWA 1WZAA 3MV11 2ZXDA 2WAGA 1EGZA 1MW2A 3LPFA 3M6DA 1FFQA 1E9LA 3OG2A 5A6AA 1KWGA 1VEOA 1GOMA 3FHQA 3AHXA 3HMCA 4BQ5A 3MS8A 3IAQA 1EDTA 2IXVA 2O92A 1UH2A 3VD9A 1HKIA 3VIJA 3SUUA 1HL9A 3N11A 3ARSA 4D6FA 2GDUA 2VZTA 1QHOA 4F79A 3RMEA 1Q6EA 2YDSA 5DO8A 4PMQA 5FL0A 2EXOA 1Y7VA 2RGLA 1R85A 3AZRA 4U2ZA 2BHZA 1M01A 1J0YA 3VDBA 4JAWA 2FHBA 2YLLA 3UCQA 2VTFA 4PMNA 1KWKA 1UD5A 4CD6A 2V3GA 4J3SA 1JI1A 3VD3A 1BYBA 2DH3A 4R27A 4CN6A 1M7XA 3A3HA 1XH0A 4DUXA 3NSMA 3THCA 1WE5A 4Z2GA 3N9KA 1FHDA 5AYBA 1ISXA 4A3HA 1PAMA 3GXMA 4P8XA 1W1PA 4DWSA 2PI6A 3AIVA 4PTWA 3CZLA 3BAIA 4AZHA 1VEPA 4CCDA 4B16A 1V3HA 1VB9A 2J47A 1V6XA 4GINA 3DECA 1EO7A 5EB8A 5A6BA 3MMDA 1CWYA 1M04A 4ML4A 3WIJA 5ABFA 3GNOA 2O9PA 3WNPA 2W62A 4AW7A 4HU0A 4WJXA 1HX0A 1BGAA 4DUWA 1V3KA 4PCTA 3SCOA 1Q4NX 4TTUA 1B30A 1R86A 4WLCA 2D3LA 3EDEA 1B3XA 4P7NA 1H0IA 3A4AA 4PMXA 4MDOA 2O9RA 1UUQA 3AMGA 1ZBKA 2WZIA 1XD0A 2IUZA 1QNQA 2YA0A 2A3CA 1QBBA 2VO5A 1KR1A 4J27A 4HOXA 3PZQA 1W3LA 3T0BA 4AZIA 1DTUA 3WD1A 3EMCA 2J7CA 1V0NA 4WKAA 1KXTA 4AWEA 3HJEA 4R5EA 2BHUA 1EA9C 2DEPA 1NP2A 2E40A 1XYZA 7A3HA 1TVPA 1W2PA 1E72M 4X9YA 2V38A 3AIBA 5CJ5A 3BCDA 3FXYA 5ABEA 3CUHA 4LYPA 1UD4A 3QGVA 2CYGA 6A3HA 3AS1A 1PX8A 5IHSA 3AXHA 1XRVA 4W86A 2VZSA 3K1DA 3POCA 2CESA 3EDFA 4CU8A 2XYLA 4WSJA 4P7RA 3WDQA 3WSUA 4E2OA 3L4UA 3AHTA 4AXNA 1ECEA 4UR9A 5ABFB 4Z2HA 2WHJA 1UWSA 4TX8A 3IAPA 4U33A 4D6CA 4BZYA 4PMDA 4BCEA 1PZ3A 3MV01 4CU6A 5FKYA 1M53A 3SCVA 1DHKA 2XWEA 4PSRA 4MAVA 2YL9A 1CGTA 4PMUA 5A6KA 4QCEA 3VM5A 1BFNA 2OLHA 2E8ZA 2PB1A 2JF6A 1UWIA 2ZX6A 3AJ7A 4HMDA 1JZ6A 5M03A 2WNWA 1ZJAA 4HP5A 1TE1A 1CGXA 4HA4A 5A6BD 1FP9A 3PN8A 3GH7A 1E55A 5CXPA 3F5JA 4TVUA 1U30A 2O9TA 1R7OA 1UR0A 1UWRA 2Y5EA 4PMYA 3QR3A 3VGBA 4IISA 1NP0A 3T09A 2BV9A 4C7FA 1QW8A 5JUVA 4RE3A 2OSXA 1WKYA 2GJXA 2JEPA 5FL1A 1NM9A 5C71A 4GZJA 2GFTA 3CLWA 1ZS2A 2G3JA 1GOIA 3SURA 2CERA 1IT0A 3ARVA 1JGIA 1J18A 1QI2A 1OCQA 4AYSA 1BQCA 3ARTA 5ABGA 3E1F1 3HU7A 1EHNA 2WMIA 2EPMX 4N0RA 2XM2A 2C8NA 1CDGA 3TTQA 1F4HA 4GKLA 4UQAA 1V3LA 4N42A 3B9DA 1DWAM 5GNYA 4RE4A 2Y8KA 3ZSTA 3EDDA 1ZL1A 5LA1A 1UR4A 3CHDA 4JFVA 7CGTA 2VI0A 1MW3A 1N82A 5IDIA 3ZQ9A 2ZUMA 3MMUA 1ISYA 5CPQA 1OIFA 1CEOA 3AIUA 1W1YA 5HOSA 3U5YA 1HXJA 1GUVA 4W8LA 3ZJ6A 3CZGA 4DWSC 2CBVA 3PZUA 1EXPA 4J3TA 3UR8A 1FP8A 3B9AA 1OWQA 3ARZA 4XV0A 2D1ZA 1SMAA 3WNKA 3WDIA 3L4XA 2BY0A 3CUIA 1E5NA 3WEZA 1UR1A 5LA0A 2CCRA 1H11A 3AYRA 1TMQA 5HPCA 1UKQA 7TAAA 1DWFM 1GVIA 2VURA 1PPIA 3LMYA 1J9YA 3VOCA 1Q6FA 1B3YA 5C70A 4NI3A 1LL4A 2CPUA 3UG3A 5A2BA 3OIHA 1W9VA 1J0JA 4H7VA 3POHA 4MNKA 4DM1A 2ZXAA 4H04A 1UA3A 3RJYA 3CH9A 1KCLA 3ALFA 3KL3A 3ARYA 4LXFA 3WN6A 4MJ4A 3AMLA 2BY3A 1QVBA 4FF5A 2VZVA 1GOKA 3B8SA 1AVAA 2WB5A 4UQ9A 4TVDA 3WUEA 1EQPA 4WKHA 4M82A 2J7EA 1KQYA 2VC9A 4GO8A 2WVVB 3L4WA 1V08A 3CHEA 2YBUA 3VIOA 1HP5A 4Z2JA 1VAHA 1C91A 1E0XA 1KQZA 1MFVA 5A8MA 3M07A 5I2UA 2CKSA 4OKDA 4AZ7A 5HNNA 3FHAA 4LGXA 4M24A 4D6JA 3CMJA 2WCGA 3WDRA 5BXPA 1HIZA 3WH7A 2XVGA 4AC1X 3GBDA 1XCXA 1U33A 1UQYA 5A6JA 2NT0A 4X0NA 1JD9A 4NZCA 2CKRA 1PEZA 4AEFA 2EPLX 2WCSA 3WQ5A 1GOQA 1KR0A 1BG9A 5JIWA 1W3KA 1CZ1A 3PZOA 4LQ1A 3AMKA 3WQVA 3BGAA 4CCEA 3VM7A 2WWCA 3WF3A 1UKSA 2D24A 2A3BA 3TA9A 4HMCA 3SCSA 2AAAA 4QCFA 4BQ3A 2VZUA 3BCFA 4D6DA 2WCAA 3THDA 3ZIZA 3NUKA 4OBRA 1OT2A 1BYCA 4H41A 3N12A 4V28A 5M17A 4D1JA 1J01A 5GPRA 1EDGA 3WDJA 1EQCA 4CUCA 1MFUA 5I0DA 3VNZA 1W1VA 3VKKA 2DQXA 3WELA 4ATWA 1XSJA 2A3HA 3U57A 1KBBA 1W1TA 3L2MA 1K9DA 4JFSA 3VIPA 1ODZA 2EO7A 1K6AA 4D1IA 5DF0A 3UR7A 2EPOA 2YA1A 1FH9A 2E9MA 5A8NA 3VDAA 1NQ6A 4U5IA 3AIQA 1O6IA 1XV8A 3CBWA 3GNRA 5I23A 3G6MA 4A4AA 5A8QA 5BRPA 1UR9A 2J74A 3T2QA 2FH8A 4EE9A 2DT0A 2QF8A 2C0HA 4PMVA 3WD4A 1F4AA 4QLKA 5I78A 3GNPA 1JIBA 2QMJA 1C7SA 3NDZA 3EMQA 1TFVA 3ARXA 4BF7A 5IFPA 1DWIM 2EPNA 3ZJ8A 1JZ5A 2AOSA 3AS0A 3NCOA 4HPGA 1Q6GA 3GH4A 8A3HA 3CUJA 3BAWA 1V0MA 2J7DA 2JFEX 2VMFA 3K8KA 4MB4A 1KXVA 2GUYA 4DWSD 1UD8A 1R8LA 5FCZA 5KZ6A 3WBEA 4TVCA 3NJ3A 4M29A 3W4RA 1J0HA 1LWJA 4U2YA 1ZBCA 3RM9A 2VQUA 5FOOA 4UOQA 5BXTA 1VBRA 2YL8A 2V3EA 2BY2A 4Q22A 3K8LA 4AIEA 5HPOA 1LL7A 1CGVA 2JF7A 1P6WA 2E9BA 4D6GA 4H2CA 2Y24A 3FAXA 5M3WA 1J12A 3BAYA 2J8GA 1MW0A 1E6NA 1QHZA 2JALA 1H0GA 1WZLA 5A1AA 5LA2A 3WY1A 4F8XA 5I3DA 1H09A 1EOMA 3BLKA 3PZTA 1E3ZA 1W9UA 3KL5A 3PZIA 1KXHA 1UZ4A 1EHAA 4DM2A 1YHTA 2D22A 1E56A 2V5CA 3QHOA 4B9YA 2FGLA 4J28A 1RP8A 1BHGA 1OINA 3WH8A 1TR1A 3ZJ7A 2PWHA 3WH9A 1CECA 1C92A 1LLOA 3TONA 3LPPA 1UKPA 2ZIDA 4FLSA 1E4MM 4AIUA 4ZENA 1JI2A 4H8VA 2JE8A 1NOWA 3FY1A 1CIUA 1LG1A 2WHMA 4JIEA 1GJWA 2VCCA 1UQZA 1CGWA 4URIA 2PWDA 2NW0A 5EFFA 4PTMA 1OSEA 3ZM8A 4MDPA 2YDQA 1H49A 2DSWA 3BAXA 1E4NA 3SEPA 1QI5A 1UOKA 2X09A 2CEQA 3UERA 3DYOA 1PX3A 3NSNA 1MWOA 1JXKA 3AOFA 1X1NA 2PWFA 5D9NA 4LYRA 3PZGA 3N17A 5DEZA 1BSIA 1NOUA 2UWFA 2XIBA 2HVMA 1QBAA 1JF6A 4JL2A 2XVPA 3T2PA 3VUPA 3BMWA 2BVDA 2XPKA 3ARUA 1XGZA 1CXEA 2WMHA 4BS0A 5A6MA 2XGBA 3N15A 4OBSA 2VRJA 3S6TA 2XWDA 1EDQA 1NWUA 2G41A 2B31A 3AXXA 3D5HA 2QPUA 3U7BA 1HJVA 1XC6A 3HN3A 2QV4A 3KWXA 1JAKA 3AYSA 1QPKA 3O9NA 1AQ0A 1GHRA 3VGFA 1W9PA 5CLTA 1KCKA 1XD1A 3WNMA 1G5AA 1CGYA 3W37A 3SCUA 4JFTA 4H8UA 4PUEA 2CNCA 3ZJKA 2EQDA 2VNCA 2GSJA 5GNZA 1Q6DA 2Y4SA 3K46A 1HN1A 3K8MA 3QHMA 3FW6A 1UZ1A 1TA3A 1JZ7A 4X0VA 1Z32X 2G3MA 3F5KA 4W7VA 1US3A 2WLZA 3RM4A 4AZ6A 1R7AA 1TZ7A 4KMQA 4JCMA 1WDRA 2DIJA 3VINA 1MW1A 3A4XA 4ATLA 5E0FA 3AI0A 4YPJA 1G01A 3VIMA 3WQ4A 4GZIA 4M56A 2DDXA 3VPLA 4PMZA 3EDKA 3SCTA 1ODUA 3L2LA 2CETA 3DC0A 1GHSA 1SMDA 1U2YA 1X6NA 1V6VA 4ZFMA 4GXPA 3ECQA 3QHNA 1HJQA 2D20A 4HZ7A 1CGUA 1K9EA 1GOWA 1EOKA 1H2JA 1QNPA 2VCAA 2ZXQA 2JEQA 1UKOA 1MXDA 3MKKA 1E6XM 4W8BA 1JZ3A 1H4PA 1H1NA 1L0PA 4W87A 5CQ1A 1TUXA 1UHVA 4P8WA 3F5LA 1GJUA 4Z2IA 1UKTA 1CXHA 2WVVA 3VMNA 1QHPA 5A94A 3ARQA 1VENA 3SUWA 2CBUA 3SUSA 1WZKA 2ZICA 1HKMA 4GQRA 2NSXA 1G9HA 4PMOA 2WSKA 1JDDA 2VX6A 2VUYA 1RD6A 2VJXA 4JFUA 1TA3B 2ZUWA 4Z2KA 4KGLA 4UQDA 2WMKA 1JZ2A 3WFLA 3WMBA 1GZJA 1BAGA 1DWJM 3ALGA 1JZ4A 1ITXA 1KXQA 2G3IA 4W84A 4JKKA 4W85A 3WL1A 5BWFA 2WZHA 5AYIA 1QNRA 3QOKA 1E0VA 1V0LA 3OLEA 4JKMA 3BMVA 3VGDA 4ATDA 1V02E 3WNNA 2OYKA 1B90A 3W25A 3BXWA 2XUCA 3UETA 3CO4A 3KEHA 2FHFA 3IJ7A 3VD7A 3L4TA 1CNVA 2UY3A 2XVLA 3WEMA 3BH4A 5AY7A 2WHKA 4CGTA 3EBVA 9CGTA 1XCWA 1W9XA 3AXIA 1CXLA 3AIWA 1EH9A 4KH2A 3WQ8A 4JFWA 3ZR6A 5KEZA 4FLQA 3U5UA 1ISZA 1J11A 4HA1A 3UEQA 1JDCA 1QOXA 2G4FA 3DYMA 2XG9A 4OJYA 5IHRA 5F7UA 1JFXA 4UQEA 3VGHA 3WNOA 2FH6A 1GQLA 4MB1A 3WEOA 3MANA 1VFUA 5BROA 4B9ZA 4HU8A 2UY4A 3WL0A 3WDHA 4GI8A 4J7RA 2D0FA 5E0CA 5E70A 1JYXA 1KGUA 2XVKA 6CGTA 3FN9A 4M8UA 2ZE0A 3PTMA 5ECUA 1MYRA 3ARRA 4JKLA 2ZX7A 1PIGA 4OOZA 4CCCA 4PMRA 2PWGA 4A3YA 1G1YA 4KGJA 4NRRA 2CHOA 2V3DA 5IXEA 3OZPA 3PTKA 3AMDA 4AY1A 1JFHA 3ZOAA 1GW1A 4MB5A 1OIMA 2WMJA 3UG4A 2VQTA 3WF1A 2DSVA 1HNYA 2G8ZA 1UYQA 2O9OA 2IXUA 4HMEA 1E15A 2A3EA 4S3KA 5E6ZA 3F4VA 1GPFA 2WBGA 3ZT6A 1D7FA 4P7LA 4UFMA 3VX0A 3CHFA 2DT3A 4ACZB 1HF6A 3MUY1 3T0AA 1OGSA 3WMSA 1JAEA 1NH6A 2BNJA 2C7FA 3GH5A 2WK2A 3WD0A 4AZGA 3DHPA 3I3BA 4AMCA 1QI4A 4ZXLA 3A47A 1J10A 3AHYA 3OGVA 4UOZA 3K4AA 1GONA 2YIHA 4UNIA 1OBAA 1W3HA 4E8CA 2YDRA 1WO2A 3NIYA 5I6SA 5D8ZA 2E0PA 1RPKA 5CLWA 1OB0A 4W5UA 3VDCA 4CVWA 2GVYA 4PEEA 4M1RA 1KGXA 1VIWA 3BSHA 3W29A 4CN1A 4E8DA 4IM4A 1JD7A 3W53A 1HJSA 3AS2A 2ZUVA 1LWHA 2GJXB 4QLLA 1DWGM 3PZVA 5LYRA 4UFKA 4Y7EA 3ARPA 1K9TA 1I1XA 3ZT7A 3GTNA 4Z2LA 1FHLA 2GJRA 1D2KA 4NF7A 2J79A 3ARWA 1E6SM 2BVTA 5D9OA 4FMVA 3BAKA 1GORA 4QAWA 3VMOA 3K4DA 3VIIA 3WH6A 1QI0A 4EANA 3BLPX 2ZXBA 3FNDA 2Z1KA 2W66A 4XZWA 1FH8A 1GCYA 2WXDM 1WP6A 2VT0A 1WPCA 1X6LA 4FK9A 4P7OA 2XIIA 1CLVA 2F2HA 1HJUA 2D0HA 2WHLA 3VIKA 2PBOA 3L4YA 2E3ZA 2RGMA 4GPNA 4LX4A 2E9LA 1HL8A 5D9PA 4DWSB 4CKQA 2J25A 4D6IA 3GZAA 4CVUA 2X05A 5DFAA 3W27A 2VVSA 2XSAA 4UTFA 3SIMA 3FAWA 3ZO9A 3AROA 1E1EA 2DSKA 3N18A 3WNLA 2MANA 4WIWA 3RCNA 1E43A 1C8XA 3AQUA 2WMIB 4AD3A 1HVQA 2J7GA 1B3ZA 3VO0A 2VOTA 2ZWZA 3IANA 2QMKA 1I1WA 3KZSA 1C90A 4MADA 1VRXA 4D6EA 2ZOXA 2W92A 3AISA 1GOOA 4UFLA 3EYPA 3A4WA 3T0DA 3VIFA 4GZEA 2VCBA 4OZOA 4AD1A 4F9JA 3SCWA 4U3CA 5CPSA 4MAZA 1CLXA 1E3XA 1PX4A 1NOFA 2WWDA 2XTKA 4J3VA 3O6AA 2OYMA 3W26A 4C7GA 1O7AA 3B9EA 4QLJA 4UQCA 3RPMA 4CD8A 3ZSSA 1MVYA 2WKGA 4GI6A 5D9MA 4HTYA 2GJPA 3WUBA 1CXIA 2VRQA 3QOMA 2PF0A 2BS9A 2GDVA 3PZNA 1B9ZA 5DT7A 1OGBA 2A3AA 2WMGA 1LG2A 4M80A 6TAAA 1E71M 3CHCA 3VD4A 5C8BB 4H8HA 1OGGA 4W7WA 2ZX8A 1C3FA 2GK1B 1K9FA 3SCPA 2EJ1A 4TXEA 2JIEA 2OSYA 5HXMA 4AEEA 2X8RA 2J62A 5A69A 3NDYA 3SCQA 3VGGA 3DHUA 2NT1A 2WYSA 3WF0A 1E40A 1VFMA 1VEMA 4OIFA 4PYSA 1J0IA 2E4TA 2VVNA 3W28A 2WZEA 3WD3A 1WZMA 1JZ8A 1QNSA 4YN5A 2VX5A 1OD8A 3ZMRA 1BVNP 2J4GA 5FIPA 1VFOA 4Q7NA 2OWCA 4IPNB 2F61A 5A8PA 5M5DA 1GVYA 1CBGA 1TVNA 3VIHA 2X2YA 3CUGA 2VX7A 3OBAA 5A3HA 3W0KA 1R87A 2XHYA 1L8NA 1WAWA 3MMWA 1C8QA 4OUEA 4ZE4A 2QLYA 4JL1A 1HT6A 2YOCA 4L4PA 2EPKX 2Y2WA 3M7SA 1C8YA 1C7TA 3KE0A 4D6HA 3WENA 4P8VA 2DPEA 3VD5A 4ZXOA 4MTVA 4P8UA 1V03A 5E6YA 2WPGA 5E09A 3VIGA 5CGTA 4W88A 2X0HA 3VX1A 5CGMA 2W61A 1DWHM 2UY2A 3AFBA 2ZX9A 2J78A 3W6LA 1CENA 4W8AA 5CSUA 2WANA 2OYLA 1HKJA 3CGTA 4GI9A 1G94A 1V3MA 3CPUA 4F9DA 1UR8A 3MUIA 1RP9A 2UY5A 2WC7A 3PBGA 1E70M 3WF2A 3PTQA 3WH5A 1BVZA 3IJ8A 4W89A 4YHGA 3CTTA 4JHZA 5I79A 1B3WA 3TTYA 1FH7A 5JBFA 4B3KA 3GXIA 1BF2A 3SCRA 3VDHA 2X0YA 5IFTA 1G0CA 1WNOA 2WVSA 1ESWA 3M46A 1GQJA 3D3AA 1ZJBA 1ISVA 1E4IA 1B2YA 4WSKA 1UA7A 1BLIA 5DMYA 5FD0A 2ZUNA 3SUVA 1H3GA 4V2XA 2XFRA 5AC4A 1E6PA 3G6LA 4J3WA 4IUGA 2BXYA 4U5KA 4P7QA 3OGSA 1WDSA 1EO5A 2PBGA 3WD2A 3N04A 4JZ5A 2YJQA 3AIEA 2Y8VA 1DEDA 3AHVA 1FA2A 2D3NA 2W63A 3VU2A 2DT1A 4CD5A 4JCLA 1A3HA 1KB3A 2QHAA 1W91A 2WVTA 1BG4A 4K68A 3A6OA 1V0KA 2FDMA 2XFFA 1V6UA 2YBTA 2DSZA 3MSDA 2YLAA 3GBEA 4LPCA 4ACZA 4HOWA 4EAMA 1AQHA 3LPOA 3I3DA 2WC4A 1UD6A 4GQQA 4E4PA 3J7HA 3CZ8A 5E9AA 4HOZA 3WFZA 4MNJA 3VGEA 3W38A 1US2A 4CD7A 4U31A 3TTSA 4DUVA 1JF5A 1JYNA 3EMZA 3TOPA 2W4XA 2AMGA 5ABHA 4KRUA 1E6ZA 5EBAA 1E6QM 1HVXA 4ZEPA 1JDAA 4TOQA 4ACYA 2WBKA 3CIVA 3BAJA 1Q6CA 1KBKA 1XHGA 4B15A 5GNXA 3N1AA 3GXDA 4YHEA 1UD3A 1E4LA 3RIKA 2D2OA 1MXGA 2XGIA 2VR4A 1ZBVA 4MB3A 5HDRA 3N13A 3WBAA 4PTXA 3AMCA 5A8OA 4FLOA 4TTGA 4NSBA 3VNYA 2EBNA 2F8QA 1DP0A 2OWXA 4M81A 1BYDA 1GNXA 3L4VA 4WKFA 1BTCA 2FHCA 1B31A 3OB8A 4LYQA 3RJXA 1HJWA 1ITCA 3O2LA 1W3JA 3VILA 4MPKA 3APGA 4UFIA 4WF7A 1E5JA 2XJ7A 5I77A 1NWSA 1B3VA 2J7BA 1M03A 5A2AA 1WCGA 2WLYA 4QDMA 2DSUA 1W9BM 2J8FA 3LPGA 1J0KA 1XH2A 4AZBA 2VZOA 3SUTA 1UH3A 3CUFA 2J75A 4AD2A 1VJZA 4CD4A 4AIOA 5CPTA 4HZ8A 4UZUA 1SR0A 3WF4A 1LF1A 4HPHA 4TUFA 1XYFA 1VBUA 1W32A 4MNLA 3VTRA 1JNEA 4UFHA 3S2CA 4PTVA 5BCAA 1NWRA 2XM1A 1IZKA 4OOUA 4RE2A 3I3EA 2HISA
chains in the Genus database with same CATH superfamily
1C93A 4RPPA 1SUXA 4HN4A 1VCGA 4NRSA 3W6MA 2ZUUA 3W81A 3CLMA 3T2OA 3RHGA 1WDWA 4U3AA 4K8EA 1KRMA 4BA0A 1M6JA 4XUGA 2C1IA 3W7MA 1V3JA 3GK0A 2F6XA 3JUGA 3JW7A 4KESA 2QNEA 3V5FA 4C6EA 4BQ4A 1JYVA 3OLDA 1NF7A 1NELA 1PHWA 3OA5A 3PJWA 4QJ1A 4AD4A 5BRQA 4HD5A 2P76A 5EA9A 3QFEA 2NX9A 1J2BA 1SFTA 1AMYA 3BTNA 3UWQA 1ZRQA 2OPJA 4FOKA 1VJSA 4AZ5A 4Y9MA 2CIPA 1A47A 4Y9OA 1MDRA 3IUDA 1ZP3A 3SN4A 3CEUA 4HJFA 2P88A 1ZLPA 2ZQ0A 2W91A 1X1ZA 1W2VA 2BOEX 1NWTA 4G56A 3WUFA 3IJDA 3MO4A 4BI7A 3OZOA 4DO4A 3UG5A 4BFAA 4UTUA 2DZPA 1Z89A 2DJLA 3TC7A 3R0KA 1E0UA 1XYMA 4H4IA 4H9TA 3DENA 5K3VA 5BWAA 1J5SA 3PBMA 5JBDA 1EZ2A 3MUAA 4G2DA 4W7UA 1FFRA 4N02A 1X8CA 2DP3A 3M44A 4UTLA 2I7GA 1EZWA 1VFFA 4YNGA 4PSPA 5CZKA 2Y70A 4DXVA 5MF5A 5LIWX 2WVUA 1UR2A 3RCYA 1V6YA 1MUMA 3IJ9A 8CGTA 4FLRA 3MJYA 2H3BA 3WQDA 2C16A 1XIFA 2F2KA 4V27A 1J0ZA 5BXRA 1PIFA 1KFWA 3W1AA 3LK6A 3VVGA 1V4YA 3WDPP 2BG5A 5FSEC 3S47A 2RJHA 3FA3A 4WR3A 3AZTA 2G50A 3LOTA 4JHOA 4IGSA 1XDMA 3R0DA 5GQBA 4POCA 2PSNA 2FB3A 5H1WA 2W67A 3ABXA 2CHNA 1IQ8A 5D2YA 1JULA 4AY8A 1V02A 3MU7A 2Z1BA 3T42A 1NARA 5AC5A 3UBPC 2O0TA 3PJUA 4UOJA 3TP4A 1G4EA 1WB0A 5D2WA 1OVDA 1CYGA 4KIEA 4O1BA 1YDOA 1WUFA 3SCNA 1XYAA 3LI0A 1N55A 3W7JA 1XWYA 4BWLA 7TIMA 1KRAC 1EC9A 1DJHA 1XSKA 1IT8A 3B0VC 1U5JA 2RDTA 4NJGA 4NZFA 2DIKA 1ZTVA 2PTDA 3KTCA 3G3DA 1D3CA 4UZSA 4Q8WA 4H19A 4Q4PA 4AMAA 2C79A 1PO9A 3IS4A 2IQ0A 1HQTA 1WDPA 2P10A 1S2CA 3MSGA 3V1PA 5CSYA 4BQ2A 4H9UA 1K8XA 4O17A 3TXZA 4DJFC 2VEPA 3V16A 4GYPA 1GK8A 1Z42A 1BXCA 2PDKA 4JNMA 4ZE5A 2OO6A 3P67A 2PC8A 1IIGA 3S3GA 3BC9A 3VUSA 3KL0A 2Z1SA 3GXFA 3BANA 4CN4A 5HANA 4HIBA 2H9AB 5TD4A 3FV9A 2REQB 1QI3A 1E1FA 4PB3A 1JYWA 1RUSA 4W5ZA 4M5PA 3U7VA 1FWAC 3UA3A 2WAGA 2E09A 3M64A 2ZZ5A 3M6DA 2PRLA 5A6AA 1Q7MA 1KWGA 1VEOA 3FHQA 4C6FA 3B06A 2G97A 4IICA 3STFA 2CLPA 3IAQA 3LXBA 4ES4A 1HL9A 1RA5A 3ONCA 4D6FA 2ALDA 1QHOA 3CJPA 3F2BA 3RMEA 1NDWA 4PMQA 3HJZA 4CEXC 4G8TA 3PBYA 2DZXA 1LUCB 4PUKA 3GQYA 2RGLA 4JIQA 1M01A 2R8WA 1OFAA 4UUIA 3UCQA 3GU1A 3V0UA 5HMSA 1UD5A 3GG0A 2V3GA 3RO6A 3IV3A 4CD6A 1NF0A 4GLEA 4IL2A 1BYBA 4L1GA 4KCUA 1M7XA 3A3HA 2NV1A 4JTLA 1WE5A 2XH2A 3N9KA 1QO2A 1FHDA 4WZHA 2BSLA 2DZUA 3BV4A 4XAGA 2QS8A 3AU6A 2ZADA 2PAJA 4Z42C 1VEPA 3FXGA 1V3HA 1VB9A 4GINA 5EB8A 5KZDA 3W7KA 3GU2A 3S1WA 3WIJA 3A21A 3K13A 2EGZA 2NVAA 3S5NA 4BWLC 5CZTA 1FCUA 3K4WA 2PCEA 3N3MA 2C15A 5HQLA 4PCTA 3H2AA 2GWNA 1R86A 1B3XA 3A4AA 4PMXA 1FXQA 2BODX 3RR4A 3AMGA 3TYBA 3FJLA 2WZIA 2YA0A 2A3CA 2VO5A 4IMFA 4J27A 2AKMA 1RCQA 2A6LA 3PZQA 1MRAA 1W3LA 2VGFA 3T0BA 4AZIA 1DTUA 4HHPA 3E12A 2A79A 3HJEA 4CQ9A 3S8HA 3CYVA 2MNRA 4FALA 1W2PA 5FACA 2CZ5A 5CJ5A 4S2CA 5ABEA 4J2MA 5EPDA 5DX7A 3UZ5A 3CUHA 6A3HA 1XF0A 2PDGA 1PX8A 1PB0A 4RV8A 4W86A 2VZSA 4M51A 4GY7A 3EDFA 3VYLA 2FLIA 4NXSA 4US5A 4AXNA 4FXFA 5ABFB 2WHJA 1UWSA 1XIIA 4U33A 2Z2BA 1FHUA 5AC7A 3VOIA 4PMDA 3RPTA 1PZ3A 2Z2UA 4BCEA 4FB7A 1G67A 4L4MA 2YFNA 5EY5A 3PPFA 5F4SA 1XBZA 4PSRA 2YPIA 3KRUA 1CGTA 5AHFA 3VXGA 2P53A 3STCA 5A6KA 5FSDC 1M68A 2PFHA 3VM5A 1XS2A 4PTDA 3LLXA 4GC3A 2E8ZA 8RUCA 2XSXA 4HZMA 4GJJA 3AJ7A 1XIHA 1PWLA 1JZ6A 2G37A 2WNWA 1TE1A 1CGXA 1HZYA 1OABA 4IQDA 4FXSA 5AHLA 2QAPA 4L65A 1Q65A 3GH7A 4ZQNA 5CXPA 4MGGA 2NUYA 4TVUA 1EJXC 5D38A 4PMYA 4C6QA 1UWAA 3GB6A 4JD4A 5E93A 2PA6A 4LUYA 2YXOA 4ZSUA 4H01A 3M0VA 2HS8A 5JUVA 4RE3A 1WKYA 2HXTA 3PUOA 4IZGA 2GJXA 5BMWA 5BU9A 1ZS2A 4IUOA 2TRSA 3SURA 2BXVA 2CERA 2H3DA 1I2RA 4Q4OA 3FVDA 1QRQA 4JQ1A 2AGKA 4NAFA 4JHMA 1JCNA 3E1F1 3HU7A 1EHNA 2WMIA 2C8NA 3RLVA 1F4HA 1V3LA 4N42A 3H6OA 3IACA 1W3TA 3UW6A 3EDDA 1W0MA 4A22A 1NEYA 3W9ZA 2Y7GA 2FJUB 5IDIA 4FR6A 3ZQ9A 1FQ0A 1QASA 3MMUA 3HQ1A 1N2VA 1PTAA 5CPQA 1EPVA 5HOSA 3U5YA 3OJGA 4EF9A 2P5NA 3BE7A 1KRBC 3G2GA 4DWSC 1DIEA 1FP8A 1EBHA 1LT8A 3A64A 3ARZA 1KBJA 2D1ZA 1YXDA 4KT2A 3WNKA 3L4XA 4US5D 3WEZA 1S5VA 3QZEA 1UR1A 5LA0A 2CCRA 1H11A 1QJWA 3GRIA 1UKQA 1DWFM 1GVIA 1WX0A 1PPIA 3LMYA 3P8IA 2QQ6A 4OECA 3T40A 5C70A 1VJIA 3SRKA 3UG3A 5A2BA 1UMLA 2I17A 2Z7KA 1J0JA 2FTPA 4H7VA 3VZXA 3POHA 2I16A 1JRBA 5AKQA 3HFTA 4LSBA 3U2OA 3ALFA 1S5WA 4ORMA 3UZXA 5F1VA 3ARYA 4LXFA 3WN6A 1KM2A 3H7UA 4LC6A 1QVBA 3ZWTA 4A3QA 5D05A 2TSYA 5M2FX 3B8SA 1AVAA 1QOPA 4M3PA 4UQ9A 4TVDA 3DXIA 2P3EA 1PDYA 3E6EA 4C90A 1TJ2A 4K39A 2LLEA 4GO8A 2P1FA 3L4WA 3PUDA 4W9TA 3CHEA 1FWHC 2YBUA 5JVLA 3EOUA 5J8LA 3OW1A 5CC3A 1KQZA 3TJXA 3M07A 2CKSA 5HNNA 3PC0A 2WCGA 1HIZA 3WH7A 3NGJA 5D37A 2XIOA 2V8ZA 4AC1X 3GBDA 2YCJA 5A6JA 1X7IA 3EKLA 1AJ0A 4AEFA 3EXSA 2EPLX 4XD5A 3WQ5A 4FXRA 1QXLA 3TQPA 1IF2A 5H8MA 3BVJA 1BG9A 2Y85A 1CZ1A 5JMUA 3GW0A 1RR2A 3V75A 1UJPA 3WF3A 3TA9A 2HE5A 4N2YA 2NVDA 2IKGA 4GH3A 3BCFA 4F0RA 2WCAA 5HINA 3KRBA 1TWWA 4OBRA 2ISFA 4LEQA 1WA3A 2AL1A 2JBMA 4HTBA 4GI4A 5M17A 1EQCA 1UBSA 2DQXA 1R2SA 1J79A 3G0XA 2A3HA 3ICJA 5AZ1A 1KBBA 1QATA 1P0KA 4NNCA 4D1IA 4J9JA 1NU5A 3W2LA 2ZRZA 4I90A 3TYEA 1FH9A 1K1DA 1XLGA 1M1BA 3C6CA 2P50A 4MJMA 1O6IA 1XV8A 5I23A 3G6MA 5BRPA 5K4XA 1UR9A 2X2GA 2HBXA 1X39A 4DVOA 2FH8A 2C0HA 1UBPC 3APTA 3TYUA 3MT1A 1KFJA 3GNPA 2QMJA 3OO2A 2XZ9A 2V68A 4BF7A 3N2CA 3KBNA 3LSCA 1EP3A 2EPNA 3TMQA 1JZ5A 2AOSA 3AS0A 3OYZA 3GG7A 2QYGA 3WFAA 1AH0A 4OV4A 3CUJA 3BAWA 2VMFA 3FYPA 1S39A 3IGXA 4MIMA 1R8LA 3RX3A 3L67A 1QUMA 1VFHA 4U2YA 3NFUA 1XDLA 2O4QA 1VBRA 3LGGA 2YL8A 5GJPA 4AIEA 2XISA 2YCLA 1LL7A 1CGVA 2JF7A 1GKRA 3WBXA 2E9BA 4D6GA 4H2CA 1DL3A 1MUWA 1ONEA 1R9XA 3QC3A 4UR8A 3BAYA 2V5LA 4B90A 1MW0A 1U22A 2PTWA 4F2TA 1RQHA 3W7HA 1WZLA 3ANUA 1S1RA 1QNVA 4QDWA 5EL1A 5I3DA 3I10A 1XUUA 1VLWA 3HF3A 1L8PA 3R43A 1FWTA 4K36A 4XBSA 1PUDA 4QJ5B 1A5SA 2XINA 3KOXA 2PP0A 1S2WA 4PCPA 3GHRA 2Y89A 1OG0A 3ZJ7A 3W1QA 3LTYA 2I5GA 2B7QA 1CECA 2WJZA 1EYEA 3IARA 7ODCA 4HSHA 4AIUA 4H8VA 1KBIA 2BGQA 2VCCA 3P84A 1CGWA 2NW0A 4NZ3A 1LTDA 2DV0A 5DY2A 4ICNA 1A3XA 5LGXA 3N6QA 2YDQA 4UC5A 3UERA 2OZ3A 4F0HA 4Q4QA 1MWOA 3W7LA 5D09A 1X1NA 3HM7A 3CC1A 3F2DA 4PZVA 3RR1A 4LAMA 2V5BA 3H70A 1WKDA 1XYBA 2OG9A 3EOLA 4RNHA 5FEWA 3PZGA 5HJLA 3VE9A 5DEZA 2UWFA 1CX9A 1QR7A 1JF6A 3CXOA 3EX3A 4H7ZA 4FA3A 1XGZA 4DB7A 1OYAA 5A6MA 2H8XA 4G9PA 3MPGA 1EDQA 3R13A 4HCHA 3U7BA 1ELSA 4PCNA 2QV4A 1U1HA 1UMYA 1JAKA 3W1RA 3O9NA 2PDIA 4PTNA 4ALDA 1SGJA 5CLTA 1XD1A 1CGYA 3NYZA 4KWOA 3GKFA 2CNCA 1AMKA 2GSJA 2KAUC 5GNZA 3K46A 1SJAA 3CMFA 1IEQA 2WLZA 3TC3A 1TZ7A 1OG6A 4JCMA 4KQNA 1RXOB 1AUSL 1MW1A 3A4XA 5D03A 5E0FA 4BEQA 1G01A 2R9RA 1GVFA 4GZIA 4YWSA 2DDXA 4IT1A 3EDKA 4G1NA 3SCTA 1WQ5A 2TMDA 1U2YA 3UJFA 1D8WA 4XQ6A 4AH7A 3QZ6A 3IGSA 4JEJA 1GOWA 2VCAA 5IBXA 2JEQA 1UKOA 4W8BA 3G8EA 1H4PA 5LXXA 4WVXA 1H1NA 4W87A 5CQ1A 1TUXA 1R6WA 1UHVA 2FZMA 4P8WA 2PP1A 3ERPA 3F5LA 3UJEA 4DZ5A 1GJUA 3LGEA 5FF0A 1XR2A 3KAOA 2WVVA 1WKEA 4NKCA 1SO4A 3UVIA 1CI1A 3H2CA 1G9HA 4NZJA 2WSKA 2VX6A 1RD6A 4RZ5A 3IIOA 2BP1A 2VJXA 3GIQA 5KSWA 4NAEB 3KP0A 5G4WA 4NXKA 4O4WA 4HK6A 3T55A 1GZJA 4MF4A 3ALGA 4MZYA 3G3MA 2G3IA 1PS9A 3WL1A 2WZHA 4C1LA 3QOKA 3NL2A 4F0SA 3BMVA 3VGDA 3ME3A 1V02E 3M5VA 2OYKA 3UETA 3U4FA 3MCMA 3KEHA 4RNIA 4QEEA 2Z00A 1ZALA 2CZFA 3IVTA 3SN0A 3PB0A 3A23A 4FS9A 1O66A 3KWSA 3PFMA 5FF3A 4GD0A 1XLKA 2X16A 1BQGA 4MJZA 4QHRA 2WHKA 4B5VA 3IIPA 1CXLA 1LP6A 3ZR6A 2FQIA 4XVEA 5I3GA 5KEZA 4FLQA 3U5UA 1ISZA 1J11A 4HSOA 1JCYA 3H2EA 2G4FA 6TIMA 3CASA 4OJYA 2INEA 4LCSA 2FH6A 1WBHA 2X42A 3MANA 4H1ZA 4CNPA 3BLOA 4B9ZA 3KVJA 3BICA 3EKZA 2QJJA 4L61A 1IXNA 2ZDRA 5A6TC 4Q8VA 3UA4A 3FDKA 2H6RA 1VYPX 1N7KA 1KGUA 2R1MA 2XVKA 4LBRA 3LM7A 4R3UA 1VS1A 1XW8A 2ZE0A 3SDOA 4REQB 3H54A 4JKLA 2VC5A 4OOZA 4CCCA 1A5NC 1G1YA 2A4AA 2CHOA 1T99A 2V3DA 3OZPA 3PTKA 3LHZA 4HYWA 1JFHA 4IF2A 2WMJA 3R79A 2VQTA 3WF1A 1UYQA 2IXUA 3FGCA 2R1NA 2Q02A 2A3EA 4Z0JA 3F4VA 3AALA 3E96A 3N25A 3ZT6A 4HSNA 2WPBA 3VX0A 3IRDA 4ACZB 1S3HA 3T0AA 3WMSA 2ZC1A 2PTXA 4JXCA 3BJSA 5GJNA 4QEHA 4N9DA 4KWSA 4UOZA 3I7QA 2YIHA 4A3UA 3UG8A 1WO2A 3ITYA 3TN5A 2Z1XA 4LUJA 1RPKA 5CLWA 1P0NA 3VDCA 3LENA 2Y61A 1I2PA 1PKMA 1N8IA 5BNKA 1F76A 4GNJA 3N9SA 5LKYA 2QUVA 2Y0FA 3ARPA 3GTNA 2Z6JA 1FHLA 3LCLA 1D2KA 4K1WA 2J79A 1R5YA 3ARWA 5FJJA 2BVTA 5T9BG 3BAKA 3NXLA 2Z1KA 3MB9A 4ZQPA 1G4TA 1T5AA 1FH8A 3CWOX 4XAZA 2ZTJA 1XCFA 3CWNA 1WPCA 1X6LA 4P7OA 1KM0A 2F2HA 3QW4B 4DF2A 1YDNA 2D0HA 2R1PA 3L4YA 3ORWA 2E3ZA 4LX4A 4AX7A 1H7XA 3EWUA 3UWUA 4D6IA 3W27A 3TE9A 4WRHA 4O12A 1KM3A 4MOZA 4R9OA 1E1EA 3CO8A 1UPMB 2BB0A 4GXMA 4ORIA 1A5BA 4WIWA 3LB0A 4DZIA 1B3ZA 2VOTA 3PTDA 3GNXA 1XISA 4H9YA 3TEVA 3WQCA 2G4JA 1VRXA 3PPHA 3AISA 5AB3A 1GOOA 2EHHA 5KZMA 3A4WA 3T0DA 3VIFA 4OZOA 3EPNA 4AD1A 4F9JA 3H12A 4IOTA 2V63A 1E3XA 3UU0A 2WWDA 5CBIA 3EWCA 4NJKA 3NGFA 1SO5A 4C7GA 1LM1A 3B9EA 4UQCA 1TZZA 4IHCA 2GVLA 4HTYA 1GWJA 3QN3A 3DN5A 5H91A 3TROA 3DI1A 3JRKA 4BF5A 2GDVA 3PZNA 1OGBA 2WMGA 6TAAA 3Q65A 5FJTA 3CHCA 5FF7A 3VD4A 3OIXA 5HNUA 3S2NA 3UXLA 1H7OA 4AWSA 3W1TA 2PDJA 3TUUA 3G1XA 2Y5JA 2QCCA 3E3HA 1L2UA 4U4MA 4HBKA 2GK1B 1MNSA 4I9TA 2Y6ZA 4FZIA 1G69A 4AEEA 2A6NA 3GXPA 4C6PA 1YNYA 3NA8A 4DO7A 3DHUA 2A3LA 1W3IA 5LNUA 3BGJA 1I0BA 3W28A 6REQA 3MKCA 1Q66A 4R33A 4EXAA 5AZ0A 3VOFA 3NVTA 3B8UA 2VX5A 2CZDA 1TCDA 3OBKA 4GCXA 3DHDA 5CZJA 2Z1WA 3OA3A 1OQFA 5M5DA 4GIRA 1ZFJA 3M0JA 3GUWA 3TSDA 1T8QA 5A3HA 5C9ZA 4RX0A 3FOKA 1UW9A 5K9CA 2PDFA 3WLOA 1L8NA 1TPC1 5DANA 4YVXA 2OZ0A 1DQWA 3GHSA 2F38A 4JL1A 2YOCA 3NQBA 3QW3A 2GL5A 2EPKX 1C7TA 3KE0A 4D6HA 2RJGA 5LNSA 3KHDA 5E09A 4MWAB 4ZOCA 3DC8A 1KA9F 3VX1A 4MLRA 2W61A 4JN8A 1SZEA 3NQDA 2ZZ4A 1H7WA 3AFBA 3W7NA 3PM6A 5HATA 3P14A 1CT5A 3CGTA 4K38A 2OYLA 2AMXA 4GI9A 1XLMA 5D2VA 4JQ4A 5T26A 3EXRA 2UY5A 4MG4A 3HQOA 3URQA 2YXGA 5D02A 1ZCOA 5T8GA 3PTQA 3WH5A 3GY1A 3IEBA 2FMNA 3IJ8A 4S3AA 2BMBA 2RDWA 3E02A 2VR2A 1DORA 3LHYA 4QNEA 4B3KA 3VDHA 2WSQA 4B5NA 1ESWA 8XIMA 3NL3A 1KTCA 1TRIA 1MEHA 1GQJA 4YTRA 3D3AA 2ALRA 2JKPA 3UWZA 3W1NA 3FYYA 4WSKA 3LN3A 4IUGA 4MM1A 2QEZA 2GGJA 3CHVA 2Q09A 3UXDA 4JZ5A 4O1DA 3H8AA 1DJQA 2HQAA 3N6JA 1FA2A 4C5ZA 2W0UA 3VU2A 5DXYA 2Y7DA 3VKAA 4LF2A 4DX3A 3O6DA 4Q8TA 5HMEA 5U4NA 3M41A 1DJWA 1PE1A 1IXPA 3KRSA 2FDMA 2V2DA 2YBTA 1MMFA 1H7NA 1XGDA 1AQHA 3GUGA 3I3DA 1XLHA 4E4PA 4CQAA 1R47A 3VNMA 1JCMP 2J27A 1OZQA 3W38A 1XLJA 2HSAA 4LUSB 2DQWA 4GHRA 4OT7A 4KRUA 1E6ZA 3O8AA 4HK5A 3CV7A 3KOFA 1OC7A 1J4EA 4ZO9A 3N1AA 1OCNA 3RRAA 1V5XA 5HQMA 1KBLA 2AAMA 1UD3A 2C14A 1WDDA 1E4LA 1W1A1 2D2OA 3WCZA 3C2EA 4XKMA 3SRDA 4IPIA 4WOZA 4FAMA 1SU5A 5HDRA 2Z25A 4TTGA 4O16A 4L6OA 4NSBA 3HURA 3VNYA 4LAKA 2OWXA 1GNXA 4KETA 1BTCA 4LYQA 1H60A 3B0UX 4U10A 5IM51 1X96A 4MPKA 3APGA 4X2PA 1PZ1A 1E5JA 5I77A 1NWSA 3JS3A 3UJSA 4GCAA 1M03A 3IWPA 3IIVA 1FY6A 1ITUA 3GXNA 2WLYA 4QDMA 3KLKA 4B92A 2VZOA 5IOBA 4XK2A 3LCIA 1FDJA 1UH3A 4A29A 5T91A 4AIOA 4TU1A 3GX9A 4R9XA 3UWWA 2ZC8A 4QITA 1W32A 4UFHA 3QYQA 4PTVA 5CG7A 4DJDA 1NWRA 3MY9A 4OOUA 3MUXA 4XIMA 1LJYA 1N8FA 1XSIA 3LDVA 5HUOA 4LS0A 3OEXA 4LJ3A 2B81A 1VFSA 3NYDA 1RAKA 1YQ2A 3C2RA 2HTMA 3WMLA 2NV9A 4KRTA 4C1NA 3LHWA 3M0ZA 3P7YA 2PRHA 4XSLA 3AS3A 1UWTA 3N4FA 4ILSA 1IGSA 2KX9A 1G4PA 4P5UA 4LCQA 3RM8A 1EJRC 1JR1A 4Q4MA 2CLKA 2B0MA 2V5KA 3W6YA 1S1PA 5DT5A 4PCSA 3H7RA 2PLCA 4EP8C 4L56A 3NR0A 2WKLA 2CXGA 2E5DA 2PCQA 1PHQA 4HKPA 1PJ9A 2XZ7A 2QCMA 2ISWA 1XP3A 4GNVA 4TX6A 3A13A 1WDQA 1PCKA 3OVRA 4EKJA 1LL6A 1I75A 5C9XA 3TYAA 4L64A 1NTHA 5DY3A 3MW7A 1W8GA 2HROA 1U5HA 3UR5A 2QUMA 3TCSA 3WMCA 1RCOB 1JQVA 4O50A 3S5SA 1TG7A 4C7DA 4QFUA 3WUGA 3AHZA 3S5ZA 3AICA 2VFHA 3ATZA 3ZXWA 1QFEA 4MJ2A 3O16A 2TAAA 3RILA 3Q4DA 4CNUA 3AWNA 4FI4A 4PN2A 4YCPA 1OHLA 2XVNA 3FX4A 4IJBA 2ZFAA 3K30A 4S3FA 4IFKB 2EF9A 3RDKA 4E5TA 5EU9A 4WUIA 9RUBA 4IJRA 1MQQA 4FXJA 1CPUA 4NJJA 2J7FA 1A5OC 4WK9A 3IGHX 5CJNA 4ERAA 1K7EA 3CZEA 2XGZA 4EF8A 1V7AA 4PBGA 4YWIA 4D72A 1BPLB 3AJXA 4Q4RA 5I7GA 2XSBA 1HKKA 4AD0A 3NO5A 2HK1A 3GSMA 3MHUA 4R7WA 1YIXA 1QNOA 4W93A 1WKFA 4PUDA 2V3FA 2AGTA 3U8GA 5C54A 4OV9A 1BYAA 3MSRA 3IK2A 5EMYA 1BWKA 3P3BA 5HA7A 1XXXA 2ISSA 5JBEA 4B3LA 1LOLA 3PY2A 3LM3A 1A80A 4ADUA 3CQHA 4GY0A 3OGRA 4WD0A 3TLLA 1W5PA 4D71A 4OE7A 4Y90A 1D3HA 1VPQA 4Z1CA 1GZ1A 3AZSA 3HBLA 3W75A 4HA3A 5EYWA 3NEHA 3VFCA 3A22A 2EG8A 3LHUA 4NIRA 2XFWA 4E4UA 3OLGA 4GG9A 5A6LA 3QMTA 1NQKA 3GD6A 3EDJA 3URNA 1GYLA 2QCHA 4LUIA 3C8NA 2WMFA 1W37A 4XUYA 3E0WA 4LWWA 1UCWA 3TN4A 1W9DM 4CU7A 2XFYA 1G7VA 3BG5A 5CSSA 1V6TA 4PRWA 3QPZA 4JYFA 1MZHA 3V4BA 3H2OA 1H63A 1TWDA 3SY8A 3LLFA 4NQ1A 4XO7A 1C8VA 1HG3A 3KX6A 4Q6JA 4KKXA 5LSMA 1TREA 3BOFA 4UQBA 2DUAA 3OP2A 1E73M 4I6VA 1Q5MA 2EEXA 3W01A 1NFPA 1DJZA 3DAQA 2X7WA 1KM4A 5D4YA 1VPXA 4MNMA 3KFTA 1GKPA 4C1NB 3C2OA 1P4CA 3G5EA 3G24A 5I3KA 3W07A 1VKFA 3T7VA 2HVOA 3CZKA 1ZBWA 1WZAA 4GQ0A 4J1OA 4XZLX 1JPMA 5XINA 3LPFA 5DCDA 3UT0A 4TQTA 2NWSA 3OG2A 1WAUA 4S1FA 4Q33A 1P6CA 3H22A 3TXVA 1QPRA 2C3ZA 1X38A 1KC7A 3FEQA 1VCFA 3ZZ1A 1TPWA 4GFSA 3WLNA 4A05A 3U6WA 2IXVA 3VA8A 3VD9A 4IQJA 3SUUA 3N11A 3NM1A 3LRMA 3STEA 3PG8A 4F79A 1OFPA 3FGCB 1Q6EA 2GQ8A 3QM3A 4GC4A 3OHMB 1L6YA 4LANA 1R85A 3W76A 4UBPC 4U2ZA 2HZGA 3W1UA 3W2NA 4HNUA 1XIMA 3IRSA 5KINA 2EG7A 2VTFA 4XO6A 2XIMA 1KWKA 1OC5A 4J3SA 3NQ6A 3PPGA 4ZBCA 3VD3A 7REQA 3T05A 4JTDA 4CN6A 4JIPA 3QSRA 4Z2GA 1UR3M 3B8DA 3UXAA 2ZRYA 5AYBA 1ISXA 2NQZA 4A3HA 3GXMA 1W1PA 4DWSA 1P0EA 2PI6A 4JBRA 1YX1A 4AZHA 3TCEA 4QM1A 3E0LA 1V6XA 2EJAA 1FVPA 5A6BA 1FXPA 3MMDA 3OPSA 4C91A 4ML4A 5JH1A 3LZ3A 3GNOA 4IFRA 2O9PA 3WNPA 1Z8AA 1HX0A 1EUNA 1V3KA 3SCOA 3RX2A 4DBDA 1XC4A 3EWDA 1H0IA 2PGEA 4LB3A 4MDOA 3VOJA 4ZTXA 3QBUA 3TIMA 3I6EA 1XD0A 5CZSA 4PGLA 3QTPA 5F1UA 1KR1A 4Q8OA 2ON3A 1U1JA 4PCFA 1QPOA 1FWSA 1EBGA 3WD1A 2J7CA 4WKAA 3FLUA 2HXUA 1X7FA 2BHUA 4S3GA 4ADTA 1NDZA 2E40A 4YMZA 4GNKB 2H8ZA 7A3HA 3TNBA 1TVPA 1YTDA 4X9YA 3NTYA 2V38A 3AIBA 3TWBA 4AWTA 2VENA 4KEVA 1W17A 1UD4A 3QGVA 2CYGA 3AS1A 2GGIA 3AXHA 5IHSA 4B5XA 3FDGA 1GGOA 4YYCA 3C0JA 3MUCA 2XYLA 1AW5A 3WLIA 2WNNA 3KZPA 5CPMA 4UTKA 1Z48A 3IAPA 3R58A 1J8VA 1PTDA 1TTIA 3G1YA 1PKYA 4WXYA 5DELA 1DHKA 4LNCA 4MAVA 4NAFB 4PMUA 1RJPA 3CTLA 3M43A 4QQUA 2WJEA 3ZLGA 3S6DA 2PB1A 2QUUA 4RK8A 2ZX6A 4MKSA 5M03A 1W3NA 4TV5A 3WK0A 4A2SA 2R14A 3IIZA 1O5RA 2IKIA 3OOQA 3F5JA 1Q63A 2QDGA 1KFEA 1FWJC 3F7JA 1H61A 1LBFA 1U30A 2YYTA 2Y5EA 3B04A 3C4UA 3O6CA 4OFCA 1MI3A 3JVAA 3GVRA 4XTDA 5I00A 4NVTA 1FWGC 5FL1A 1NM9A 2VUNA 4RCXA 4GZJA 1RY8A 3FFSA 3UPWA 3F1QA 1IT0A 3ARVA 1J18A 4J4KA 4ZO6A 3M0KA 6ENLA 4I3GA 3U2ZA 5ABGA 2EPMX 5E0KA 4K7VA 1A0CA 4UQAA 1E0TA 3TX9A 1FBAA 1JUBA 1D7KA 5GNYA 2Y8KA 3ZSTA 2J9YA 3BOXA 3S42A 5LA1A 1REQA 1UR4A 3OBEA 3CHDA 1MW3A 3IPWA 1N82A 1W54A 3FIGA 2V82A 2TODA 4YYFA 4JGDA 3PBVA 1IXQA 2OZ8A 3PUGA 3CM4A 1YTKA 3C0QA 3A4JA 2YCIX 2ACQA 3KOWA 1K7XA 4IIBA 4W8LA 1Q85A 4MZ1A 1E9IA 3PZUA 1EXPA 1DJXA 3B9AA 4XV0A 2XH0A 4O1FA 2BY0A 3CUIA 1E5NA 2I56A 1KLZA 1OFBA 4F4RA 4Y8EA 3AYRA 3RN6A 5HPCA 4DELA 7TAAA 3N4EA 2W3ZA 5CC7A 4MWAA 1XFCA 3EB3A 5LIXX 2OFJA 4ZB0A 1R3VA 3TJ4A 1R46A 1B3YA 2CU0A 3NQMA 4NI3A 4DPQA 2VFIA 4H3DA 4FNRA 1W9VA 4GXWA 3IJQA 4DM1A 5HNTA 1P7TA 1I45A 3P8JA 3MHFA 3MDWA 2PZNA 4FF5A 4LC8A 1EP2A 4HMNA 2NXIA 1K77A 4R7OA 1SM9A 3NZGA 2GVJA 4WKHA 1QO5A 4JTJA 2VC9A 5XIMA 3AYVA 3VIOA 3I65A 3ANVA 1FKWA 5EMKA 3UZYA 1AD1A 5I2UA 2OXNA 2ZKMX 6ALDA 3FHAA 4DLFA 1X97A 4P61A 3WDRA 2PDCA 2YZRA 2DFAA 1TSIA 5FEZA 1O1ZA 2D2JA 3TK7A 1Q3NA 1U33A 3TSBA 4L1WA 2NT0A 5FF2A 4NZCA 3LA4A 2NV2A 1GOQA 4NG3A 2DUZA 1W3KA 3O63A 1H62A 1ADDA 4LQ1A 3AMKA 3M5ZA 3VM7A 4S38A 2WWCA 4DJFD 3VABA 4KPLA 1UKSA 2D24A 3HGOA 1RALA 1YRRA 3BLFA 1WOAA 3BG3A 1PDZA 3FJ6A 3B9NA 5C5YA 3I6TA 5HJXA 1BVWA 3AAMA 2BVWA 4H41A 4V28A 4CUCA 1MFUA 5FI8A 4NZ4A 5I0DA 3VNZA 1UZHA 4ATWA 1TRDA 4PR4A 1SVDA 2WO5A 3L2MA 1EJVC 3UJRA 1ODZA 3PSVA 3WLSA 1TX0A 5AYXA 3LV5A 3R6IA 1ZP4A 4PB4A 5J5DA 1O94A 2B7PA 2E9MA 4HK7A 2VFGA 1RBLA 3AIQA 3BV7A 3D46A 3CBWA 3WLKX 3GNRA 5A8QA 1TMLA 3DH7A 1JPDX 3TR2A 4UTWA 2CFFA 4EE9A 2DT0A 4PMVA 1Q6LA 1FWBC 3D0CA 4QLKA 5I78A 3CNYA 1JIBA 3WLLA 3EMQA 1TFVA 1WOBA 3CS2A 1BKHA 3BDKA 4L9YA 2NQJA 4WGHA 3NCOA 4HPGA 8A3HA 3GH4A 2J7DA 2YCLB 4H9MA 3INPA 3BGGA 3B40A 4MB4A 1FHVA 3NPWA 3GIYA 1UD8A 3M0IA 5FCZA 2V30A 3WBEA 1TJPA 4JTGA 4O8AA 3W4RA 1J0HA 4QSFA 4UMBA 2ACSA 1L2QA 2Z7GA 3RM9A 1Q8AA 3SFKA 5BXTA 2BY2A 3K8LA 1B3OA 1XYLA 3DCPA 3FAXA 4MFDA 2J8GA 3NZ1A 1RVKA 2JALA 4YS1A 5LA2A 3I7RA 1EOMA 1A49A 3A3XA 4MLJA 4GUJA 4LALA 3HA1A 3BPWA 3T6CA 3AUJA 2FKPA 1Y0EA 3LXCA 1DHPA 1FTXA 1KXHA 4GVFA 4YTTA 4JN7A 5EMUA 4DM2A 1YHTA 1E56A 3ITLA 4WDXA 3QHOA 3A5FA 3RXZA 4J28A 1CB7B 5TBOA 1OINA 3WH8A 1PWMA 1TR1A 4MMWA 3JZEA 4F0KA 3WH9A 1VYSX 1Z44A 3TONA 1UKPA 2ZIDA 3NQ7A 4FLSA 2A21A 4Y9NA 1E4MM 4MKVA 4BK9A 1NOWA 5HUPA 3FY1A 4IIHA 4JIEA 2WSRA 4JTRA 3MWCA 4JS3A 2VGIA 2PMQA 5JXQA 3TZFA 4JQ2A 3P6LA 4N4QA 4PTMA 1OSEA 1YBQB 4J3ZA 4MDPA 2ZVIA 4WX2A 3RNDA 3SEPA 2OKTA 1QI5A 4OGZA 1ME7A 2CEQA 4O14A 4C6KA 1PX3A 4DF1A 1LCOA 4G5DA 1JXKA 3AOFA 3QR0A 2FTYA 3LCGA 1Y65A 3VCRA 1CLKA 2HJPA 3LTPA 1BSIA 1LRTA 4Q8PA 1EJTC 1BKSA 1QBAA 3XIMA 3B9OA 3S2LA 2XVPA 3T2PA 1CW2A 3BMWA 3ARUA 3QQ0A 2WMHA 1EIXA 1RLDA 3S6TA 2XWDA 2Z0IA 4HCLA 2ZZ1A 1LZOA 5K4ZA 3BW3A 4QIUA 1RZMA 1TV4A 3AYSA 2GJNA 2F84A 4KEZA 3VGFA 3KUMA 1XJBA 1K8YA 2YW3A 1S38A 1BRLA 3W7CA 4FF7A 1G5AA 4HA0A 1RBOB 3W37A 4JFTA 4H8UA 3ZJKA 2GQ3A 4LUTB 1C29A 5REQA 1UZ1A 4IH3A 3BURA 3RM4A 1R7AA 3UWEA 3N14A 2DIJA 2ICSA 3VINA 1UP3A 3W7DA 4YPJA 4M56A 3VPLA 4PMZA 1PXGA 4N9CA 3TV8A 3DC0A 1GHSA 1SMDA 3HMJG 1HJQA 4JTAA 5C0QA 1K9EA 1EOKA 4MYAA 1Z41A 4JTQA 4BHYA 1W5MA 3QQ1A 3WLQA 2W9MA 1LROA 3BJFA 4AYGA 4Z2IA 2I9UA 4GX9A 4H9ZA 1AW1A 3MSYA 3P0XA 3ATYA 4LH8A 2ABAA 4UWMA 4XZIA 1F9CA 1WZKA 4GQRA 1HKMA 4XWUA 3URAA 2E5BA 3IUIA 2VUYA 4JTCA 3M0LA 2XIQA 4H2HA 1QWKA 1TJ0A 3C56A 1TA3B 4Z2KA 4KGLA 3DZ1A 4TIMA 4NAEA 4IFOA 1MEIA 2C18A 3G1FA 2ZTKA 1BRLB 2Z2AA 1ITXA 1RJQA 2WQPA 3MDUA 1QNRA 2J9ZA 3LRLA 2O4MA 4JKMA 4KEUA 3QR1A 4ATDA 3WNNA 4DBSA 1Z9AA 3BXWA 3RX4A 1VHNA 3CO4A 2OEJA 1GVEA 1RJRA 5DCEA 4ENLA 5AHMA 3WBWA 1IEXA 3V36A 2FHFA 3OZMA 4QE1A 3IJ7A 1YEYA 2NX3A 1CNVA 2UY3A 3NQEA 3WEMA 2OLSA 4QS6A 3MTWA 3BH4A 4AB4A 1WUEA 2VC7A 9CGTA 3BQ6A 3G8RA 1F5ZA 1W9XA 3CL6A 4KH2A 4QJ4B 3UGRA 1H1ZA 4D8AA 2ZBTA 3V5CA 1E9YB 1PYMA 1QOXA 4QGCA 3DYMA 4AF0A 2YDAA 4R7JA 4NZ5A 5CC5A 2C91A 1YBQA 1JFXA 4AF0B 3WEOA 3ID7A 2YW4A 2ZDSA 2UY4A 4NNBA 3IV8A 3Q45A 3EGJA 5G4EA 5FAGA 4ZQMA 1I4NA 4LVBA 2A1YA 1FCQA 1BD0A 1Q13A 5E70A 2WZMA 2QUTA 1LQ2A 3GFXA 6CGTA 3RCMA 3FN9A 5F2IA 5I3FA 3TW6A 3PTMA 2AKZA 3ARRA 1F6KA 3M5YA 3UQNA 4JTTA 4I8DA 3T0TA 2PWGA 5I02A 4A3YA 3AMDA 4XVDA 1YXCA 3ZOAA 1GW1A 4XD3A 1OIMA 1XBXA 1O5KA 4DPPA 1E15A 1GPFA 2WBGA 1AH3A 3APYA 4P7LA 4J35A 4UFMA 1W8SA 3EA3A 3CHFA 1HF6A 3S5OA 1ENUA 3WJXA 5K2ZA 4NX5A 1EKOA 1R3WA 1NH6A 1S2TA 2C7FA 4A3RA 3GH5A 2WK2A 4AG0A 5BOFA 4C6CA 3DHPA 4LTSA 3A47A 1J10A 3OGVA 4UNIA 2I5IA 3NIYA 4DZHA 2JQXA 3KOZA 2E0PA 1OB0A 4W5UA 5HAOA 4LAZA 4E38A 1P0BA 3H53A 3WBYA 4M1RA 4R34A 3VCNA 4GX8A 3TQVA 3BSHA 3D3FA 3QV9A 4E8DA 2BX7A 2DZAA 4DJEC 1W5OA 7REQB 3YPIA 4KW2A 3PZVA 4C6JA 4MVAA 4UFKA 3B05A 4Y7EA 1VIZA 1K9TA 3K5XA 3S1UA 4Z2LA 1R3YA 1K3UA 3FK4A 3RGTA 2IQDA 5H8PA 4O0ZA 3N4AA 4PBEA 2PEVA 5D9OA 4FMVA 2AQVA 3CB3A 3VMOA 3K4DA 4EANA 1QI0A 2ZXBA 4KF1A 3D47A 3F4WA 1GCYA 1GKQA 2Y62A 2NXHA 1WP6A 2FTWA 2HV5A 4LY8A 3T1GA 3CU2A 4FK9A 3GVWA 2ZRXA 2XIIA 4DY1A 3LV6A 3SY5A 1LWIA 2WHLA 2PBOA 3CQJA 4O28A 3UVAA 2OQYA 2QCDB 3NPXA 1RLCL 1HL8A 1KM5A 5L6UA 3TFCA 4DWSB 1U1UA 4CVUA 2PPGA 2X05A 1F74A 4MZ8A 4UTFA 4Q7BA 3SIMA 4QAIA 2R1KA 3STPA 1ONXA 4XBJA 3N18A 2X30A 4PULA 3G77A 2MANA 2XU2A 4DBEA 1C8XA 2CW6A 4AD3A 2J7GA 1PVNA 1O5XA 2QCNA 4HHLA 3DBPA 3CUXA 5FEPA 5FJOA 3VO0A 3SGUA 1YW1A 2QVNA 3LLDA 3PP7A 4GK8A 1I1WA 2XDFA 2FB2A 4MADA 4O54A 2Z6IA 5TIMA 2OT0A 3QEZA 4GZEA 1QPQA 1B5TA 3SCWA 2DZVA 4Z1YA 2PUZA 3QV6A 5CPSA 4MAZA 1CLXA 4ECLA 1NOFA 3QTGA 4ROQA 3O6AA 2OYMA 4FX7A 3C2VA 1O7AA 2CXEA 3RPMA 6XIAA 1MVYA 2EAWA 2GJPA 1CXIA 5H8UA 2OT1A 2VRQA 4AFYA 4K2SA 2VEIA 1W1IE 2PF0A 5DT7A 5ABTA 2R6OA 1E71M 4AHOA 4TX9A 2I9EA 1OGGA 1YYAA 2JK2A 4W7WA 4DWDA 3GLCA 1VHCA 1EFZA 3T8LA 1SZFA 1C3FA 1F8MA 4V15A 4GYFA 5HJYA 1QW7A 2V6AA 9XIAA 1IEVA 4Y9AA 5DLCA 2JIEA 1TPVA 2L5HA 6XIMA 5HXMA 4RDWA 1XIDA 3N34A 5A69A 4V1XA 1J2WA 3CWHA 3SCQA 3VGGA 1DBTA 2NT1A 3B3DA 3THUA 1E40A 1VFMA 2Y1HA 4JTSA 1RD5A 5EKYA 3PB2A 1I8JA 3B8VA 4B2DD 1RCXB 2AL2A 3E0FA 3QLDA 1JZ8A 4YN5A 1SJDA 4ZQOA 4L5ZA 2FVLA 4K8HA 1VFOA 4Q7NA 4IPNB 1RV8A 3KS5A 3CPRA 1IZCA 1KFLA 4B4FA 3U2EA 3FSUA 1TVNA 3LCXA 5CZ0A 2VX7A 5AFDA 2OOGA 3S2JA 4A8RA 2XHYA 3MMWA 3NQAA 4ZE4A 1NY1A 3ABSA 3E5PA 1TPUA 1UASA 3V7PA 3E9AA 2Y2WA 4HHMA 3M7SA 5BOEA 4NNAA 2C0AA 2PLMA 3VD5A 1W5QA 3NQ8A 5E6YA 2WPGA 1XX1A 3A9IA 3VIGA 5CGTA 1ICQA 4XZ9A 4ZQRA 1KO0A 2X0HA 4CEUC 1DWHM 5C7VA 3WO8A 4W8AA 2PDUA 3KHJA 1XFBA 4EPDC 2DW7A 3CPUA 1NAL1 4F9DA 4XKYB 5F4WA 1E70M 4X63A 4W89A 4YHGA 4YVVA 3G0UA 4JHZA 5I79A 1B3WA 4CQDA 5JBFA 3GXIA 1OADA 3L0GA 1G0CA 1WNOA 2WVSA 1E1CB 3R5EA 4S39A 2A0NA 2OGJA 4L6DA 1UPPA 1UOZA 1J5TA 1GYMA 1DJYA 3IIXA 1ITQA 4UIOA 1E4IA 4ZMGA 4A8IA 3SUVA 4V2XA 3LCHA 3STGA 3TC6A 1E6PA 4F40A 2BXYA 1UUOA 4GQGA 1K70A 1FWWA 2PWUA 2X0SA 3OGSA 4JX4A 2SFPA 1S5TA 3N04A 2YJQA 4DO6A 2A7PA 3GTIA 2IKJA 1J96A 1OJXA 2W63A 4CD5A 2PDYA 1W91A 2WVTA 4ZB2A 2R1LA 5HULA 1E51A 4IIDA 4JX6A 4GUGA 3MSDA 4ACZA 4Q8UA 3R89A 3UWVA 4HOWA 2UBPC 4EAMA 1GYNA 2OMAA 1UD6A 4GQQA 3J7HA 3USBA 5D33A 4I9AA 4D2JA 2DORA 2PE4A 4MNJA 3DFQA 3IVUA 4U31A 4DUVA 3KS6A 1JF5A 2YXXA 2PTZA 3EMZA 4EX4A 2OTDA 3LMZA 5ABHA 2VELA 5EBAA 1HVXA 3M0HA 4PL2A 4TOQA 5A5WA 2WBKA 3BAJA 4GYKA 3KVLA 1Q6CA 1KBKA 3CAKA 4I7VA 4YHEA 2GOUA 1MXGA 1ZY9A 3AU2A 3JZUA 4MB3A 4ONVA 3QMSA 1I60A 3WBAA 5CEWA 3V3WA 3GVQA 2EBNA 4X22A 3ITTA 1DP0A 3EWXA 3OB8A 4GBDA 3CEPA 2RHGA 4XTIA 5CSRA 1TZ9A 5A2AA 1DJGA 4GVIA 3LU2A 1WXJA 4LEFA 2Y88A 2DSUA 3LPGA 1J0KA 4Q6XA 4DHGA 4X60A 1DIDA 3SUTA 5L9FA 1VJZA 4I7WA 4Y9PA 4HZ8A 4IP4A 1TPEA 3WF4A 1LF1A 4KBXA 4DRSA 4HPHA 4B4HA 5D32A 1RA0A 4L6HA 3TN6A 4MNLA 3VTRA 4DZAA 4HNNA 2XM1A 1IZKA 3FKRA 4RE2A 3I3EA 3N3TA 1RQEA 4WDUA 1TE6A 2WC3A 3BZGA 3A3WA 2ZE3A 4FHAA 3II1A 3KCJA 4FOJA 1KGWA 4UFJA 2ZZ7A 5CBJA 4KFOA 4QJ3B 1SFLA 2BLEA 3EWWA 2ESCA 2BHYA 3W73A 1QPNA 3S1VA 2YL5A 3T44A 2WSPA 4AISA 1ALDA 5JQ9A 4PUNA 3ZT5A 4CQBA 5H2ZA 2PWEA 2VEKA 3DFOA 3PUEA 4NT0A 6PTDA 7PTDA 2ZUTA 1XINA 3OG3A 5B7YA 2FZ9A 1PKLA 3TA6A 5EFDA 2VEFA 1K7FA 1A0EA 5AHNA 1V6WA 1JXJA 1HFBA 1AQMA 1XRSA 1Y5XA 3THAA 2CLFA 4ZO7A 1UC5A 4GIAA 1EF2A 1AZ1A 5KZEA 5I3HA 4CQ8A 3RU6A 4EWJA 3PZ9A 4MUPA 4O1CA 1IZJA 1SO3A 2GGGA 3GYCA 1ZB5A 3EOOA 2CC0A 5I5RA 2BFGA 8XIAA 4GO9A 3TAKA 4XB3A 4N6EA 1MQRA 5CAKA 1A4MA 2D23A 3UCCA 2PDPA 2QZRA 4DJDD 4L9XA 5D8WA 1SQ7A 1GQKA 1UH4A 3CK5A 3O0FA 1AD4A 1JG9A 3SW6A 3E38A 4J3UA 3WJYA 4IMGA 1JL8A 1SW3A 1QT1A 1XG4A 2DT2A 3VMPA 2GQ9A 3VNDA 3MC5A 4DJEA 1E0WA 3GDTA 3LRKA 1LQ0A 3BWWA 5D30A 4DNMA 1LLZA 4UTTA 1M9HA 3RO8A 2CLMA 4CNNA 4RW3A 1JVNA 3FCPA 2ZX5A 2OX4A 4GA8A 3MP4A 5FEXA 3T08A 2FMOA 2PC4A 1J6PA 4QG6A 3QZAA 3GM8A 5SWUA 3O15A 2PU1A 2J77A 3A24A 1UWQA 4EVZA 3IK4A 3B97A 1VF8A 3U4AA 3CMGA 2ZWYA 2IKHA 3MYOA 1R2TA 1E6RA 1BGGA 4O53A 3SO7A 4M6QA 3W3OA 4BR1A 3BSGA 2VRKA 2H9AA 4MWAC 2QPSA 4J3XA 4I5XA 2PP3A 3AIRA 3HG3A 4UTWC 5A95A 3IVSA 3UZZA 3B0YA 1B1YA 5I24A 5T9CE 5AHIA 2WM0A 3LQLA 4F0LA 2FJKA 3CZJA 1WBJA 3H23A 1JNDA 1GQIA 4XAYA 3UPMA 3PANA 1XRTA 2Q71A 1M7JA 2YGYA 1IV8A 1OD0A 3ABZA 2OU4A 2X1IA 2XH4A 1EIBA 1CXKA 3ZLHA 4RL3A 3DFSA 3L5LA 5B80A 3OLIA 1LBMA 1TCMA 3EOSA 4ZFCA 2F9RA 2J6VA 3O0KA 4I9JA 1VP5A 1W56A 3C3NA 1L6GA 5CPNA 3S83A 3ES8A 5E9XA 2JIWA 4DQWA 3DGBA 4WOQA 1Q6QA 1UD2A 1UWUA 2X1UA 3U0HA 2QVHA 3KBVA 3C0SA 2GK1A 3B4YA 1V3IA 1TV2A 1ISWA 3MZNA 3NOYA 4PODA 1T96A 5A6SA 5A2CA 1I2OA 1UC4A 3PJXA 3LCWA 3ISIX 3GTFA 1MQPA 3VZZA 1O5QA 2J88A 2E8YA 2IMRA 2OKOA 1G4SA 4S3JA 1X98A 2QDHA 3LSBA 3RLHA 2F6UA 3MP3A 3TLQA 1FX6A 5AVNA 3PWAA 1EGZA 3S9IA 3QFWA 1E9LA 2J8TA 1ZJIA 4DLMA 3AHXA 4WGXA 3VAVA 3MS8A 3WLHA 1EDTA 3REQB 2O92A 1NFBA 1RVGA 2FPTA 2GDUA 1XGEA 2GWGA 4JY9A 5BOOA 4ERIA 3S0CA 1HKWA 4X2RA 5TF0A 5FL0A 1Y7VA 4OBTA 3QGKC 3AZRA 2VWSA 2BHZA 3VDBA 2FHBA 3L21A 4JQ3A 4RKAA 2NWRA 2C1HA 1BTMA 3HTWA 3T07A 2Z29A 3VFLA 5I07A 2DH3A 1LDCA 1XH0A 4DUXA 1BWLA 3NSMA 3UYIA 2VGBA 4LVFA 3WJWA 1DTNA 3HG4A 3AIVA 4QROA 5DCBA 2PDMA 3CZLA 3BAIA 4AX6A 4CCDA 3GDKA 4A35A 4B16A 5LGZA 4HB7A 4FOUA 4R53A 3S46A 3AXKA 1T41A 2W62A 4AW7A 4DXKA 3PWGA 2GZXA 4TTUA 1B30A 2QUNA 4IGMA 4L1XA 4WLCA 2ISVA 4G1KA 1XLEA 4X3ZA 2O9RA 1UUQA 1UJQA 1ZBKA 4KERA 4M7SA 3I7SA 1QBBA 1EX5A 4AQLA 2QJHA 2GGHA 3VI2A 2ZCGA 4HOXA 1O95A 5LHEA 3EMCA 1EL3A 1V0NA 1GVQA 3IGUA 4AWEA 4HN8A 4R5EA 1AJZA 1XYZA 1TWSA 1M41A 5G4HC 4LS2A 4LS1A 1E72M 4IL0A 1XLFA 5KITA 3FXYA 2CESA 3L68A 1IE7C 3UJ2A 5HNRA 1FRBA 5MKGA 4HPXA 3WQGA 4WSJA 4P7RA 1D8CA 4UR7A 4UTMA 3WDQA 3WSUA 3UNDA 1ECEA 4UR9A 4Z2HA 3DBNA 3VOHA 4TX8A 4UNLA 1GQNA 3DX5A 4D6CA 4BZYA 2OODA 3V0SA 2JKAA 3Q37A 3DERA 3SCVA 2DZBA 3KBWA 4BI6A 1TTQA 4TR9A 4LY4A 4RNJA 4MWAE 5G5IA 3W7QA 4RDYA 4LAOA 1BFNA 2X1TA 2OLHA 3NOEA 4GGHA 1F8IA 5BMXA 4HMDA 1IXOA 1ZJAA 4HP5A 4HA4A 4E6MA 4GBUA 1QCWA 1VQTA 5EGRA 3QF0A 4AVNA 3OVGA 1UB3A 3WLPA 1R7OA 1UWRA 2F6KA 3FEMA 3QR3A 4IGHA 3VGBA 2PS2A 3T09A 4JOMA 4C7FA 1QW8A 4UTTC 2OSXA 2JEPA 4C60A 5C71A 3CV6A 3USZA 2GFTA 3CLWA 3V1HA 4F2BA 3W1LA 1GOIA 3E0IA 1JGIA 3OODA 1QI2A 1OCQA 1IWPA 1F6PA 3ARTA 3TJIA 3R4IA 1BXNA 1KCXA 3R1ZA 2ACUA 1NDVA 3TTQA 4E2VA 4GKLA 3WLJA 5HQEA 1IR1A 1EEPA 2HBVA 3B9DA 1IEWA 2G5WA 3LNPA 2WM1A 7CGTA 4C5YA 2VI0A 3EEGA 3TH6A 1BEUA 2D2GA 3GC5A 4JN6A 4M19A 4HQVA 1ISYA 4KFPA 1EJUC 2BBFA 1W1YA 2VWTA 2VC6A 1HXJA 2CBVA 3BL3A 3VC5A 4O57A 4J3TA 3UR8A 2KZHA 1A5KC 2WZTA 3NL6A 4ERGA 1SMAA 3WDIA 5CAHA 4HNTA 4OWGA 5CPOA 1TMQA 2QPXA 3WYZA 2CLIA 1HKVA 2UV8G 2ODOA 1J9YA 3VOCA 2ANUA 3HV9A 3TDFA 3R10A 1Q6FA 1FWFC 1R2RA 1LL4A 5C2GA 1M7OA 3OIHA 1DJIA 3FYOA 4HYRA 3NQVA 2RDUA 4MNKA 2ZXAA 4ZA0A 3RJYA 3W2UA 2ZRWA 1KCLA 3CH9A 4I7UA 1TELA 3P60A 3KL3A 3MVIA 5TNVA 4WDWA 3FVMA 4MJ4A 3AMLA 2C13A 2BY3A 4JTFA 3ABOA 3CAVA 4IXXA 2VZVA 3L66A 5FF4A 1GOKA 4WY0F 3RK8A 3WUEA 3JR2A 1XUZA 2J7EA 1KQYA 3TOYA 5BW6A 4KCWA 4CCZA 1V08A 4NYYA 3SR7A 1HP5A 4Z2JA 3VK5A 3I4KA 2AL2B 1VAHA 4JTUA 1E0XA 1W1B1 1MFVA 5LNRA 2I57A 3HGRA 4WSHA 4FX8A 3CMJA 3E0VA 2XVGA 4PFMA 4E2BA 3WK2A 3MBFA 1SW7A 3VC6A 4LRSA 3HB9A 1PEZA 3HPXA 1H1YA 4PH6A 3EA2A 5D2TA 1R0MA 4D8ZA 5E1QA 3WQFA 3TQKA 3BGAA 4V1YA 4CCEA 3D6NA 2NXGA 3SCSA 1DVJA 2CLLA 4BJHA 4QCFA 4G7EB 2VZUA 1R3SA 4RXFA 4HNCA 5LZLA 3NUKA 1S2UA 2OGYA 3N12A 3ZYZA 1J01A 5GPRA 2CZEA 3VKKA 1TPB1 2PLKA 1XSJA 3U57A 1ZUAX 3N2MA 4YL2A 2EO7A 1K6AA 1AK5A 1O4UA 1AW2A 2BDQA 2YA1A 3KDNA 3TYDA 2E6AA 2ZYFA 1ECQA 2XN0A 1DPMA 4A4AA 4RE0A 2J74A 2P3ZA 4LYKA 2FFIA 4QRNA 3WD4A 3DDMA 3E2QA 1C7SA 3NDZA 2VGGA 3NM3A 4GH1A 2RKXA 1A50A 9XIMA 1DWIM 3ZJ8A 2PLJA 3AC0A 3GC4A 2YCKX 1B57A 2J6XA 2JFEX 3K8KA 2V81A 1KXVA 2O7SA 5AHEA 1C9DA 3KTXA 3O1NA 3TNOA 5KZ6A 3GNDA 1OZMA 4TVCA 1JDFA 3NJ3A 1KKRA 4M29A 4E2DA 1LWJA 3LG3A 2VQUA 5FOOA 4H83A 8TIMA 4Q22A 2JKEA 2J66A 4DJDC 1YPIA 1H50A 1ME9A 2WOQA 3SAZA 5M3WA 1MO0A 1XIJA 1J12A 1JCTA 1YDVA 4IMEA 3LHVA 2CLOA 4NL1A 2OVLA 1QHZA 5A1AA 3RRXA 2ZZ3A 3WY1A 4F8XA 2FZBA 4UTHA 3BLKA 3W72A 2VYOA 4EAYA 5DN1A 1E3ZA 1E1CA 3DFHA 3KL5A 3F03K 3PZIA 1OYBA 2Z28A 1NIUA 1UZ4A 1ZHAA 1EHAA 2D22A 3GXTA 3HOJA 2V5CA 3UYCA 4B9YA 2FGLA 1FWCC 4QSHA 1RP8A 3RLUA 1YKWA 1BHGA 1OF6A 4LRTA 2PDBA 3P81A 1YNPA 2V2CA 1OEPA 4FX6M 1C92A 1LLOA 4V33A 5GVJA 2IPJA 3GVGA 4ZENA 3NXFA 2HVNA 1CIUA 1LG1A 1GJWA 3HIJA 1UQZA 3MP5A 4Q8QA 2PWDA 2VEMA 5EFFA 3RU8X 3M16A 3ZM8A 3CIWA 1VRDA 2DSWA 1XLDA 3BAXA 4JIHA 1E4NA 2PDHA 1XLLA 2X09A 1OX4A 1TV5A 5A8GA 3DYOA 1DXFA 4LVAA 2POZA 3RPDA 3NSNA 4LT9A 4A21A 4CLMA 4DUOA 1V7YA 5D9NA 5LIKX 4FNUA 4LYRA 1VZWA 1AFSA 3OU8A 1NOUA 2XIBA 1VPYA 1F3WA 2E6YA 4JL2A 3VUPA 3NZQA 1CXEA 6REQB 2XGBA 4FEZA 1R3RA 2R91A 3G22A 1EXBA 2HRWA 1MZRA 1OYCA 2B31A 3D5HA 3P0WA 1XC6A 3C2YA 3MI2A 2E77A 1AQ0A 1W9PA 1EUAA 4NASA 3DHFA 4B3ZA 2FDSA 4LF1A 1B4KA 3L12A 1H7RA 3SCUA 3WG6A 4PUEA 2EQDA 3H21A 2BGNE 1HN1A 3QHMA 3N2OA 3FW6A 4X0VA