4PMXA

Crystal structure of gh10 endo-b-1,4-xylanase (xynb) from xanthomonas axonopodis pv citri in the native form
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
306
structure length
306
Chain Sequence
AAPLAATASKFLGCAYGAQQAPGFAQYWNKLTPENGGKWGSVEAVRDQMDWSTLDAAYRFAQANQMPFQMHVMVWGNQQPEWIKTLRPAEQRREIEQWFAAVAQRYPDIALLEVVNEPLNDPPSKADTGGGNYLQALGGNGDSGWEWVLQSFRLARRHFPHTKLMINDYSITSSAQATQKYLQIVRLLQRENLVDAIGVQEHAFETTPEVAVSVHRDNLDALAATGLPIYITEFDLDGPTDAQQLADYKRVFPVFWEHPAVHGITLWGFRPGLWRDKEAAYLIRADGTERPALTWLRDYVAAHPGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms associated with xylan degradation by xanthomonas plant pathogens.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Hydrolase
molecule keywords Xylanase
total genus 124
structure length 306
sequence length 306
ec nomenclature
pdb deposition date 2014-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmxA00
1CGUA 2O9TA 4P8XA 2YL8A 5I6SA 3F5KA 3W38A 3SUWA 2J8FA 5GPRA 4F9JA 2VRQA 3M46A 3THCA 3K1DA 3A3HA 4W84A 3ALFA 6A3HA 3WH8A 3OA5A 1B3VA 2ZWYA 1QVBA 2W92A 1NM9A 2WZHA 4H04A 3WF4A 3AHYA 1UWIA 4AD1A 2YKKA 1L8NA 5ABGA 3I3EA 2CKRA 4GQQA 1HX0A 3AIVA 1GQIA 2VVSA 1U2YA 4A3HA 1ZS2A 2NSXA 1UOKA 5DT5A 3CZLA 5A8QA 3L4XA 3GNPA 4MJ4A 3AXHA 3EDDA 1E71M 2UWFA 2YL5A 4AEFA 4XUYA 1ISVA 3CPUA 2WMIB 2VX6A 3EYPA 1JI2A 4JFVA 4Z2LA 2VR5A 3VX0A 1CXKA 3CZEA 3VNYA 2NT0A 3SUTA 4PTXA 2Y4SA 1GUVA 1W9BM 2CHOA 2XUCA 2WHMA 2FDMA 4TVDA 2ZUSA 1QI5A 4B3KA 5A6AA 1PX4A 1WE5A 4QP0A 5EFDA 4AZCA 3TTYA 2ZUWA 1IV8A 2WMGA 4FLQA 1TCMA 2J47A 4U5IA 3ZT6A 1ECEA 4HMCA 4M56A 5A8PA 3CMJA 4MPKA 1JF6A 3GXIA 1G9HA 4GI6A 1H3GA 4C7GA 3A6OA 2EO7A 3CHEA 3ZOAA 5IHRA 1E3XA 5CLTA 2G3JA 3BC9A 8A3HA 4MTVA 5AYBA 1XHGA 1YQ2A 4W93A 1LG1A 4IM4A 3WENA 3VOCA 1KWGA 3OB8A 3VIGA 1XD0A 3WDIA 5CSUA 4AZBA 2G41A 3CGTA 5EFFA 2CBIA 2XIBA 4GKLA 1VJSA 2VZUA 3BAJA 1E5JA 1KGUA 6TAAA 5BRPA 1UYQA 2E4TA 4OKDA 3L4VA 4IUGA 7A3HA 2ESCA 1LWHA 4TTUA 4B16A 1C8XA 4HZ7A 2OYKA 2CERA 2GDUA 4JZ5A 4IPNB 5HXMA 1W32A 1W1YA 2BS9A 3IAQA 4XZWA 1UR8A 1ODUA 1NP0A 4J27A 1WB0A 4HU8A 3ARVA 1JFXA 2A3CA 2OSWA 5A6SA 3K8KA 2B31A 5JIPA 4PN2A 3DYMA 1JYNA 2GJXB 4Q22A 1BHGA 1HJUA 1DWIM 3SCSA 3ARSA 5A8MA 4X0VA 4ZE4A 2D2OA 3ALGA 1OIFA 2J8GA 1KBBA 1ODZA 3B9EA 1KCLA 2C7FA 1V03A 1XC6A 2OYMA 4J7RA 1XD1A 4FLSA 2VCBA 3QR3A 2FH6A 4X9YA 4MB4A 1V3IA 3VVGA 4FF5A 3RILA 1MQRA 1C8QA 3AICA 3W81A 1C91A 3W28A 3QOMA 3VDBA 1C93A 1G5AA 1J0KA 2XFFA 4AEEA 2WW5A 2VX4A 1K9DA 1V02E 1B1YA 4V28A 3W0KA 1H0GA 2WKLA 1E1EA 1QNOA 1BTCA 1CXEA 2J7HA 5DO8A 2W91A 4DWSB 3UG3A 5A94A 3SEPA 3KWXA 3WD3A 4HPHA 3AIWA 1EDGA 2HISA 2VT0A 5D9OA 1DWGM 2CHNA 3AIUA 5FOOA 2ZX5A 1H49A 4JL1A 1MYRA 1B3WA 3MSDA 3HN3A 3ARWA 1IZKA 2V5CA 1O7AA 2J25A 3IJ7A 4P7OA 1A47A 4PMUA 5BROA 1EO5A 3UESA 2D0HA 1MFVA 1GOOA 1XSJA 2ZICA 3WEMA 1H11A 1LG2A 1KR1A 2XJ7A 1QBAA 3FHQA 3WNPA 1HL8A 2BY3A 2RGMA 1TMQA 3OZPA 2WZIA 1W1PA 1KB3A 4XB3A 4D6JA 2HVMA 4W7VA 3SCWA 4HA4A 1OT2A 1V3KA 3AROA 2ZX6A 4AIOA 5ABFB 1EIBA 2YL6A 4WJXA 5JBEA 4W8BA 3VX1A 1LLOA 3LPOA 4HMEA 1B30A 4OUEA 3BMWA 2XWEA 3N9KA 1PIGA 3PZVA 1V3MA 1BYDA 4HPGA 3POHA 5CLWA 1E1FA 4EK7A 1Y7VA 5BXRA 3LPFA 1CGXA 3N17A 2RGLA 1HIZA 1W3KA 3WKZA 5HPOA 6CGTA 4GO9A 5FD0A 4PCSA 3EBVA 1XGZA 4UZUA 1JGIA 2WC7A 1DWFM 5A6MA 4HZ8A 5GNYA 2OWXA 1Q4NX 1FP9A 3TA9A 4PCTA 4J28A 4W87A 3FNDA 1HN1A 3WMBA 2ZIDA 4W7UA 3CBWA 4R27A 1HT6A 4PMQA 2PBGA 2X0YA 1JAEA 2QF8A 1U30A 1EHAA 4ATWA 1Q6DA 1ZL1A 4U31A 1PPIA 4C7DA 1MW3A 1WKYA 4E2OA 2CETA 3L4UA 5E70A 3PHAA 3SUSA 2VQUA 3T2PA 1W3JA 1J11A 3K8MA 2GJPA 3WUFA 1DTUA 3W26A 3VM5A 1B0IA 4NF7A 3VIPA 5IFTA 3VUPA 2EPOA 1JDDA 2DSVA 4PTWA 4J3WA 1JZ2A 4XZBA 1J9YA 1ISYA 1CDGA 4PSRA 5FL1A 2G4FA 2XSBA 3U7VA 1LF1A 2FH8A 3WQ6A 1R85A 1YHTA 1UWUA 2CBUA 3VGDA 4DWSC 1MXDA 3PN8A 2O9RA 4RE2A 4MB5A 1MQPA 4PMRA 4OZOA 3PZUA 4C7FA 1OIMA 1GQKA 1FH8A 7TAAA 4BS0A 2ZXBA 1CXHA 3BAIA 2PWHA 4WIWA 4DWSD 3UCQA 3MV01 2A3AA 2AAAA 1WDSA 3FHAA 3ZJ7A 2WHLA 3I3BA 4W5ZA 4JKMA 1J0JA 5A2BA 1HKIA 4J3VA 2F8QA 3W27A 2WYSA 1GOWA 1CYGA 3FY1A 4PUEA 1CNVA 1GW1A 4AZCB 3RJXA 4E4PA 1UQYA 1QI3A 2WAGA 3AIEA 5IXEA 4YHEA 1JD7A 4D6EA 4ZENA 2ZXQA 3RM8A 3WNKA 3WBEA 1QI4A 1E6QM 1V6XA 1UA3A 2J62A 4AZ5A 4KRTA 2CEQA 1JG9A 4TVUA 1J0IA 4BQ5A 3WH5A 3MU7A 5M03A 1UKOA 5M5DA 1GHRA 4JFSA 3AMGA 3BGAA 3CZ8A 3WDRA 2IUZA 1US2A 2ZXDA 4WSJA 1C92A 3BAWA 1KXTA 3ZR6A 3BAYA 3NJ3A 4WK9A 2EBNA 1B3XA 3DYPA 2JF7A 2OSYA 3N13A 3MV11 5FKYA 2ZUTA 1MQQA 2J74A 2VZSA 5CQ1A 1GNXA 3NDZA 3E1F1 1E40A 5IFPA 3WMCA 1E9LA 1W3LA 2WVUA 1UD5A 5E6ZA 1Q6CA 4D6DA 5GNXA 1BLIA 4BZYA 3M7SA 1D3CA 3SCUA 3WEOA 4UCFA 3QHMA 5I23A 1MWOA 1JXJA 3ARXA 1EO7A 4CN1A 1E70M 2WWCA 3SUVA 5LYRA 4AZHA 3QHOA 3OG2A 2WMKA 2DSKA 5I2UA 2BXZA 2CESA 1PIFA 3U5UA 7CGTA 3K46A 1I1WA 1DWAM 1F4HA 3ARYA 2TAAA 3G6MA 3BXWA 4M1RA 3AZSA 5AYIA 5DMYA 1B2YA 5A8NA 3N11A 4UQCA 5HOSA 5I77A 1QW8A 4PRWA 1HVXA 1N82A 2ZUMA 3N18A 1EGZA 2DSUA 2WZEA 5LA2A 4ZE5A 2V3FA 3N04A 1R86A 1KQZA 4UQEA 2DIEA 2VRJA 4LPCA 4JKKA 3W6MA 2YA1A 3AMDA 3KEHA 1V0MA 1PAMA 4CCCA 4TVCA 4UQAA 1G1YA 4GXPA 4BA0A 1UR1A 3BH4A 3GH7A 3CO4A 4OOUA 2J7DA 3WF0A 2D0FA 1VFUA 1VFFA 4PUDA 4GZEA 2JE8A 2J7CA 1RH9A 1CTNA 1XSKA 3GNRA 2CBJA 2BHZA 1QOXA 2Y8KA 4U33A 5BCAA 3VD5A 5ABFA 2BY1A 2J7BA 3GXFA 1QNSA 2CCRA 4TUFA 1JD9A 3VINA 4KGJA 1EQCA 3WH7A 3T2QA 3CTTA 4ZFMA 4Z2GA 1NH6A 3WNOA 4AIUA 3AIBA 4CVWA 1L0PA 1E0VA 4MB3A 2UY3A 1UR0A 2IXUA 2WVVA 2E3ZA 3J7HA 2YBUA 1FHLA 3AZTA 4CD4A 1DWHM 3OLEA 1BG4A 3FAWA 4B9YA 1ITCA 5DEZA 1M01A 5D9PA 3NYDA 4WLCA 1AQ0A 2DT0A 3NSMA 3WFLA 4MNJA 2WC3A 4MAZA 1JAKA 3BSHA 1W1VA 1HJVA 1QBBA 3VMNA 1K9TA 1QHPA 3CMGA 3CZGA 4LYPA 1OB0A 3DHPA 2A3EA 2YIHA 4D6FA 3GDBA 2XM2A 1W9DM 4UFKA 5D8ZA 2DT2A 3IJ9A 2BV9A 2XGIA 3HJEA 3TTQA 2ZX7A 2J4GA 3VD9A 1C7TA 2DPEA 4U5KA 3U7BA 4J3XA 4RL3A 2YOCA 1UQZA 1OCQA 3PTKA 1H1NA 1VIWA 2XIIA 4B15A 1CLXA 1TA3B 2AOSA 3KZSA 3AQUA 3QOKA 4EE9A 2E0PA 2PWDA 5CPQA 1SMAA 5FIPA 3WDHA 1JZ3A 1DP0A 3SCVA 3OZOA 1UD2A 1OD8A 2WLZA 5EB8A 1X6LA 1Q6FA 3AISA 3T08A 2G3MA 3GBDA 4FK9A 1XRVA 4NZCA 1OSEA 1V3JA 4DUWA 1FA2A 2NT1A 2EEXA 4OJYA 1XCWA 3AJ7A 2DIJA 1TZ7A 1MVYA 2D1ZA 4XX6A 5KEZA 2UY5A 4KH2A 1ZJBA 1MW0A 3VIMA 5I3DA 1HJWA 3ARUA 3BLPX 1RD6A 3GXDA 4N42A 2DQXA 1DEDA 4J3SA 4OBSA 3KL5A 3ARQA 2BNJA 1KR0A 2VURA 2VVNA 3GH4A 3K4AA 4GIAA 4PMOA 4W86A 3CIVA 3VDHA 5ECUA 3PTQA 1E55A 1BYCA 1CECA 4B9ZA 1JZ7A 2V3GA 5D9MA 3SCNA 1V6YA 2DDXA 1IZJA 3VILA 1UR2A 4HOZA 1M7XA 1OGBA 3VO0A 2EXOA 2DGAA 5DFAA 2CKSA 4BQ2A 4AZIA 1B31A 1CGWA 4CUCA 4M29A 3U57A 1KXQA 1R8LA 1JYWA 1US3A 1GVYA 5BXTA 4AZ6A 4W85A 2WSPA 1KBKA 2E40A 2GFTA 3PZIA 4FLRA 3N12A 1UR4A 4ZXOA 4D6HA 3QGVA 1E6XM 2VX7A 2FGZA 1E6SM 1E72M 1JL8A 1EOKA 4PMZA 4AY1A 4KRUA 1DWJM 4JFUA 3CZJA 3OLGA 3S2CA 2IXVA 1V6WA 1ESWA 1JNDA 3RPMA 4MJ2A 1NOWA 5CG0A 3WBAA 1EHNA 3ZT5A 3NSNA 3CUHA 3PZMA 1CENA 5A95A 1VRXA 3WD1A 1VBRA 2D22A 2BVTA 1W9XA 1VFMA 3AI0A 1B3YA 4UFLA 1HL9A 2PBOA 3OBAA 1WAWA 3HMCA 2C8NA 3FAXA 3DC0A 4MDPA 3TOPA 3WQ4A 4D6CA 2D23A 3PZ9A 3OGSA 3VKKA 4AMCA 3BAKA 2WBGA 1E43A 2X09A 1WDRA 2O9OA 4W8AA 5A6LA 1MW1A 2XHYA 3VGHA 5FL0A 1VF8A 3N1AA 3GBEA 1JZ6A 1ITXA 1V0LA 2GDVA 4P8VA 4PMYA 2WMFA 4D1IA 3MS8A 1H0IA 3UERA 1QHOA 3O9NA 3MUY1 1GOQA 3IANA 2YA2A 5E0CA 4D71A 3WUBA 3W29A 1UKSA 4D6IA 1H41A 1B3ZA 1TFVA 3WELA 2X8RA 1VENA 1W9UA 3WQ8A 1AVAA 1E56A 3NDYA 1X1NA 4QFUA 4QCFA 4QLJA 4L4OA 5I0DA 1OWQA 3UR7A 3WL0A 2XG9A 1XYZA 2WBKA 3ARPA 2PB1A 1OINA 4DM1A 2JFEX 1KXHA 3WMSA 4AISA 1OT1A 1EDTA 4KGLA 3VDAA 3SURA 1EDQA 3BAXA 5A6BA 2Z1KA 1KCKA 1GZJA 3AMKA 2WMHA 2GK1B 1NQ6A 4W7WA 1JYVA 2YLAA 5JBFA 1KFWA 3DYOA 5D9NA 4AXNA 2VNCA 3MMWA 4CU7A 2E9MA 2YJQA 1GOKA 3LMYA 4JHOA 2E9LA 2WNWA 2XVPA 2Y2WA 3FXYA 1UH4A 4JAWA 1M53A 1JZ5A 1PEZA 4P7LA 3WQVA 1UWRA 3AMLA 5CSYA 5A1AA 3SCRA 3BCDA 3EMQA 4Z2HA 1UH3A 2VTFA 1LL7A 3W6LA 1OGSA 2Q8XA 2X1IA 4MADA 4M8UA 3G6LA 4AD4A 1FH7A 3O2LA 3VIOA 1JZ8A 4FLOA 5BYWA 5A69A 2J7FA 4MDOA 2QLYA 2ZWZA 3L4WA 3S6TA 5GNZA 4PBGA 4UOQA 4RE3A 1HP4A 4AIEA 1MFUA 1I75A 2E8ZA 4AWEA 2CPUA 3ZO9A 1XCXA 3VNZA 3W4RA 3TTOA 3FW6A 4R5EA 2NW0A 2XWDA 3ZSSA 3WD0A 2VRKA 3W24A 1JI1A 1NP2A 4CD8A 3TTSA 3IAPA 3CUGA 1V02A 2EPNA 5CGTA 2GJXA 3UG5A 1J12A 3D5HA 1LQ0A 4AD2A 1DHKA 2QV4A 1UKQA 4QCEA 4RE4A 3MMDA 1PJ9A 3NIYA 3RM9A 2PWFA 4KWUA 1HJXA 1V6UA 3VIFA 4U3AA 3AYRA 1JDCA 3VTRA 1VBUA 4IPLA 1H2JA 2O9PA 2MANA 2G3IA 2DH2A 3KL3A 1VB9A 5IDIA 3T0BA 2WCAA 3II1A 4M82A 3K8LA 2J77A 1BYAA 1Q6EA 1V3LA 4UTFA 3ZQ9A 1XSIA 4PMXA 4TTGA 5EBAA 3EMZA 1CXIA 2G8ZA 4HOXA 2UY2A 3PZOA 4UQDA 3OGVA 5IHSA 4JIEA 4JKLA 3CUFA 3A4AA 3B8SA 5HBFA 2V38A 1CXFA 1NWRA 4AD0A 4EKJA 1GCYA 5CJ5A 5EMYA 4ACYA 2ZUUA 5LA1A 2FHCA 2X05A 3PZQA 4LYQA 3AOFA 2OWCA 1EXPA 1WZAA 3LPPA 3VGFA 4W88A 1JZ4A 1BF2A 3WUEA 1FFQA 4CVUA 1RP8A 3CUIA 3F5LA 3PZNA 1GPFA 4TXEA 4BQ4A 2ZOXA 5I24A 1OGGA 3ZMRA 2VMFA 3MKKA 5CPSA 1M04A 4OIFA 3KL0A 3THDA 1KXVA 2W63A 3MMUA 3MSGA 2Y5EA 2WPGA 1UWTA 2QHAA 4H8UA 4P8UA 3BSGA 1MW2A 1AMYA 1AQHA 4U2ZA 1WNOA 1E73M 2WVSA 1JDAA 1J10A 4HZ6A 2XSAA 1ISXA 2BFGA 1BFNA 1CPUA 2PWGA 2ZUVA 4CGTA 2A3HA 3AHZA 1VEOA 4GI9A 4GO8A 4WF7A 5DT7A 4LX4A 1UR9A 3WDJA 1E3ZA 2JEPA 4OOZA 4JCLA 3WH6A 2EPMX 4Q7NA 1OBAA 4AW7A 2VCCA 4U3CA 4NI3A 4Z2IA 4F8XA 3ARZA 1UG6A 4NSBA 4Z2JA 5M17A 1GHSA 4J3UA 1WCGA 2QMJA 4ATLA 3I3DA 2WHKA 4D6GA 2WMIA 2W61A 3DHUA 3EDKA 4B3LA 3A47A 3IJ8A 3F5JA 5AY7A 2F61A 4EAMA 1ZJAA 1JF5A 5BRQA 2OLHA 1WZKA 1E5NA 5FCZA 3W25A 1BGGA 3SCTA 2D3NA 1NWTA 4F79A 3GXMA 3ZJ6A 4JL2A 3GYCA 2OSXA 3ARRA 2V3EA 1P6WA 5D4YA 4BQ3A 4J3TA 3L2MA 2E8YA 2J7GA 2VX5A 4UFIA 1GOIA 3CH9A 5ABEA 5LA0A 3KE0A 2JIEA 4WKFA 5HDRA 1VEPA 3VIHA 2QPUA 1U33A 1CBGA 4FMVA 4H8HA 4P7QA 4GINA 2WLYA 5E6YA 1XH1A 2G3NA 2PWEA 3GTNA 2EPLX 3M07A 2GK1A 4D1JA 1BYBA 5A8OA 4CCDA 2X2YA 1W2VA 1WO2A 1ZB5A 4P7NA 2QPSA 2F2HA 4WKHA 3GZAA 3L4ZA 3LPGA 3VD4A 1QPKA 3SIMA 2YDRA 3L2LA 3RJYA 1ISWA 4AC1X 2GJRA 3U5YA 1E0XA 4UOZA 3GH5A 4MNLA 3WEZA 1UA7A 1E6ZA 2WHJA 1BPLB 1NOUA 2J78A 5JBDA 1GVIA 1RPKA 4PSPA 2EJ1A 2VOTA 3AS2A 1KGXA 1UZ1A 2D0GA 1R7AA 3SCOA 5GQBA 1VAHA 2J79A 2WM0A 1WDQA 4EANA 4HTYA 1BGAA 3PBGA 4UZSA 4LYRA 1BVZA 5M3WA 1G94A 5ABHA 1D7FA 3WDQA 1W91A 2BXYA 5AC4A 5DF0A 1UD6A 3APGA 2JALA 1UHVA 1W1TA 3UR8A 4HP5A 1BVNP 4UOJA 4L4PA 2XVLA 1JIBA 1LJYA 1QI0A 1QNRA 4CU8A 2FGLA 1MXGA 4ACZB 3GNOA 1W2PA 3UG4A 1TVPA 4CD6A 4V2XA 4TX6A 4X0NA 3NUKA 3AHXA 1HKJA 4UR9A 3VMOA 5AC5A 3B9AA 2CITA 1LWJA 2VZVA 4BCEA 2WB5A 4GZIA 4TX8A 4M24A 1J0HA 3T0DA 5A2CA 1ZU8A 3AIQA 2DH3A 2XM1A 4GZJA 4WSKA 1ZBKA 2C0HA 4E8DA 2VZOA 1HXJA 2VCAA 2YDSA 4YPJA 1BAGA 1NWUA 1TR1A 1SMDA 2PI6A 3AHTA 4XV0A 3HU7A 3K4DA 5CPTA 1V08A 1GJUA 4UNIA 1UD4A 4JCMA 4W89A 3BCFA 1JFHA 3DECA 3PZTA 1SFSA 4LGXA 5C71A 4MNMA 3RM4A 3ZT7A 1H5VA 1LL4A 4AD5A 3AXIA 1LL6A 1GOMA 4QLLA 2FHFA 1KQYA 3TP4A 1CGYA 1V0KA 1E4MM 5JIWA 3WDPP 3WSUA 1GQJA 3CUJA 3ZM8A 2W5FA 2QMKA 1E4NA 2WXDM 2WWDA 4QAWA 1QI2A 4GI8A 2D20A 4W8LA 2YL9A 3WNNA 1CGVA 3ARTA 2WMJA 1EQPA 4JFTA 5CXPA 4CN4A 1Q6GA 4PTMA 1GORA 4NRSA 3MUZ1 3CHFA 1KWKA 2GVYA 4CU6A 4UFHA 1HP5A 4H7VA 3VMPA 4P7RA 5C8BB 4Z2KA 1GQLA 3WQWA 1IT0A 2V5DA 2X0HA 1UD8A 4H8VA 5E9AA 4AYSA 2BHYA 2J7EA 5F7UA 4AD3A 1UKPA 1EH9A 4OBRA 2ZUNA 3SUUA 4TOQA 4F66A 3AS3A 1CXLA 1UD3A 5I79A 4F9DA 3T2OA 1XH0A 3ZJKA 3EDEA 2BY0A 1EOMA 3WN6A 4CKQA 3ZIZA 4PMVA 4PMDA 1WPCA 2DSWA 1PBGA 1VEMA 4Y7EA 1E15A 1UKTA 2V3DA 3SCPA 1BSIA 3TONA 3ZR5A 3WUGA 3SCQA 4HU0A 1PX3A 1AQMA 1WZLA 1WDPA 3MO4A 1K9EA 2XFRA 2OWWA 2W67A 3RDKA 2YLLA 3WF1A 2Y8VA 2CNCA 3FN9A 1X6NA 2ZX9A 1BG9A 3W37A 1E6PA 1K9FA 3WNMA 4IISA 4N0RA 1CZ1A 1VJZA 1QHZA 3OLDA 1CIUA 1R7OA 1QNQA 1HJQA 1HNYA 4UQBA 2JEQA 1WP6A 2D3LA 1CEOA 1W3HA 2WC4A 4JHZA 5TD4A 2WKGA 2DT1A 5A3HA 3MANA 4S3JA 4ACZA 1J18A 5BWFA 4QDMA 4DWSA 1WZMA 4URIA 2J75A 2WCGA 4CD7A 1CGTA 3ZSTA 2CXGA 3GM8A 5C70A 1C7SA 1GONA 1HKMA 1ZBCA 1TE1A 4M80A 3EDFA 1TA3A 4PMNA 2AMGA 1KGWA 3VIIA 3WD4A 4BF7A 3POCA 3EMCA 3WNLA 1HVQA 1XYFA 1G01A 1I1XA 8CGTA 2XPKA 3VGEA 1J01A 2CBVA 1VFOA 5CGMA 1V0NA 1JNEA 4WKAA 3WIJA 4HA1A 1D2KA 1FH9A 1RP9A 5E0FA 4MAVA 3WQ5A 3BLKA 3AZRA 4MB1A 4YN5A 1UUQA 2WK2A 4QLKA 3WF3A 1HF6A 1K6AA 1E0WA 2OYLA 3D3AA 3CLWA 2BHUA 1E6RA 2VI0A 3JUGA 4NRRA 1V3HA 4PYSA 4U2YA 3VGGA 3VD3A 1W9PA 1PX8A 1NARA 1S46A 1UWQA 3M6DA 3NSXA 3N15A 1CLVA 1TUXA 3RMEA 1JXKA 1EA9C 3WF2A 5HNNA 1C3FA 3L4YA 3AS0A 2DEPA 1JYXA 3L4TA 2D24A 1HJSA 1GJWA 2PC8A 5A2AA 1V6VA 3VPLA 1R87A 2ZE0A 1W9VA 3QHNA 3AFBA 3T0AA 1UWSA 3VGBA 1PZ2A 2WANA 1CWYA 2VL4A 1H09A 3AMCA 3AXXA 1J0ZA 5BXSA 1Z32X 1J0YA 4H2CA 2WCSA 2Z1SA 3PTMA 4DUXA 1NOFA 1OD0A 2YBTA 3OGRA 3MUIA 4AZGA 3WL1A 1FHDA 2W4XA 5D8WA 3WY1A 3UETA 2E9BA 3CHDA 1G0CA 1A3HA 1F4AA 3W82A 2XVKA 3F4VA 3T09A 2XVNA 1UZ4A 3ECQA 1M03A 1H4PA 4V27A 3W53A 4UFMA 4H41A 2VZTA 2XYLA 1UH2A 2Y24A 3PZGA 3VM7A 2PF0A 4YHGA 3AHVA 4GQRA 3O6AA 1C8YA 3ZJ8A 3VIKA 3UEQA 2VQTA 2ZX8A 2ZXAA 4CN6A 2GSJA 4DUVA 3VU2A 2O92A 1B90A 5CZKA 2XVGA 2EPKX 4GPNA 5BXPA 3IK2A 1HKKA 3WFZA 4JFWA 1FOBA 2WSKA 1ISZA 4MNKA 1BQCA 4E8CA 2VC9A 3OIHA 2CYGA 4PEEA 1C90A 4A3YA 3RO8A 2FHBA 3A4XA 3WD2A 4S3KA 1B9ZA 1ZBVA 4KMQA 4LQ1A 4W5UA 2VO5A 2VUYA 1E6NA 1SR0A 2GUYA 4A4AA 2JF6A 3AS1A 1PZ3A 1QW9A 3B9DA 2DT3A 4ZXLA 1OM0A 3BMVA 2XFYA 2W66A 3AIRA 4M81A 1FP8A 2YDQA 5I78A 5JUVA 1XV8A 3MUAA 1ZBWA 3VIJA 2W62A 2EQDA 2BY2A 4LXFA 5E09A 1E4IA 3OLIA 3VDCA 3CZKA 5A6JA 1TVNA 2DSZA 3WH9A 3CHCA 4DM2A 2VJXA 3AYSA 5A6BD 3RIKA 5A6KA 1TG7A 3A4WA 4ATDA 4ZEPA 2JIWA 1QNPA 9CGTA 4HA3A 2VR4A 1SYTA 2A3BA 3VD7A 2XTKA 4HMDA 4CCEA 4HOWA 4P8WA 5I5RA 4CD5A 4K68A 3NCOA 2UY4A 2BVYA 5KZ6A 2WVVB 2WVTA 2CIPA 1E4LA 1XH2A 4PTVA 4AZ7A 4ML4A 1NWSA 1O6IA 4UFJA 2BVDA 3RCNA 3EDJA 2XGBA 2YA0A 5HPCA 4UQ9A 1FFRA 4D72A
chains in the Genus database with same CATH superfamily
2O9TA 4P8XA 3F5KA 4F9JA 3M46A 1XISA 3K1DA 3A3HA 3GD6A 3RPTA 1BTMA 3WG6A 1W0MA 3OA5A 2IQTA 1B3VA 3T4CA 5T9CE 3T81A 5HAOA 1UZDA 4RLIA 5TF0A 4Y6GA 3BLFA 4AD1A 2AGTA 5ABGA 2ZA2A 2CLPA 4C6NA 2PTYA 1GQIA 3IS4A 1W1ZA 3G1DA 1QCWA 1UOKA 3Q65A 4Z0JA 3B8UA 3GNPA 5LNVA 5LKYA 1CLKA 1E71M 2UWFA 4OHQA 3LRMA 3EYPA 2C18A 3NAVA 2VR5A 4GCAA 3LCXA 4HPJA 3VNYA 3LHVA 3SUTA 1L2UA 4PTXA 1GUVA 2XUCA 5CSSA 3F2BA 4B3KA 1AW5A 4RNJA 3FGCB 2WMGA 1XQLA 1ZP4A 4C6DA 2J47A 1FDZA 4U5IA 3ZT6A 1ECEA 3P84A 4A21A 4MPKA 1V4YA 3GXIA 1G9HA 4PL2A 4NI8A 3A6OA 3PUOA 2EO7A 2ZZ5A 4DX3A 1R5YA 2NSOA 2CLFA 3BC9A 1V8EA 4Q8UA 1TR9A 1XHGA 4W93A 3A3WA 1UASA 3OB8A 1IR1A 4K1GA 1XD0A 3WDIA 3CGTA 2CBIA 2EKCA 4K38A 4PB4A 1OX6A 1WBHA 1UYQA 2E4TA 1H1ZA 3L4VA 4IUGA 4OKDA 3TWBA 4NJGA 4B16A 5CPLA 3RNDA 4HZ7A 1TTJA 1V77A 1EA0A 3PSVA 1MDRA 4JZ5A 4TQTA 5HXMA 1RY0A 5FESA 3ARVA 1Y0EA 1SFTA 4PN2A 1UP3A 3DYMA 1JYNA 3SBFA 4Q22A 1HJUA 3CWOX 5TQLA 3ARSA 5A8MA 3KCJA 3S2NA 2J66A 3ALGA 2VELA 3SDOA 2DJLA 5DY3A 2C7FA 2OYMA 5DMMA 4J7RA 2OJPA 4XZ9A 3HA1A 2QXWA 3LK6A 1O1ZA 3N2XA 3RRXA 3DI1A 4UWMA 1K77A 1UOZA 3OA3A 2PCEA 3W81A 5HINA 2WW5A 4LY8A 4WVXA 3W1XA 1E1EA 3P14A 1QNOA 1CXEA 2J7HA 3KRSA 4Z1CA 5A94A 4YWIA 3USZA 4JIQA 1GW9A 4L9ZA 1ZPTA 5IBXC 1MYRA 4HCDA 1B3WA 2V5CA 1O7AA 3L66A 3B0VC 4DXVA 2OO6A 3EX1A 4P7OA 3CO8A 3DFHA 3H53A 5FEXA 1MFVA 3GHTA 3DFPA 4YWSA 4IGMA 3FHQA 3WNPA 2OT1A 1HL8A 3HG2A 2FVLA 3OZPA 1W1PA 4LRSA 1KM6A 2OR2A 3M0LA 1KB3A 2NXHA 4CCZA 4ZTYA 5C54A 4D6JA 3C61A 1EF3A 4XQ6A 4X9SA 1OT2A 1V3KA 5DELA 1I4NA 5JBEA 3MP5A 3VX1A 2R6OA 1LLOA 1JPKA 3BMWA 5GJNA 1TRDA 1N55A 1UR3M 1DTNA 3W7QA 4EK7A 2PDQA 3S0CA 4GGHA 4HVXA 4HYRA 6CGTA 4GBUA 1M7OA 3THUA 1SO6A 1XIDA 2HJPA 3W2NA 2WC7A 2TRSA 3GR7A 3GDLA 5GNYA 4EXAA 2Y1HA 4HNTA 4M6VA 2B7PA 4MY8A 4IWWA 2ZIDA 4JTCA 4W7UA 1OHLA 4PMQA 4IT1A 3WJSA 1R2SA 3M0HA 3W2MA 1RAKA 4PUNA 1U30A 2X1RA 5HNRA 1EHAA 2QCLA 3TX9A 3PPGA 2YW4A 5K7JA 4C7DA 4E2OA 4NX5A 4ZQCA 4ZTXA 1B9BA 3PHAA 5GVJA 3PS7A 4G1NA 1Y5XA 3NL5A 2GJPA 2W6RA 2ATMA 5LNWA 2WKJA 2J9YA 3VM5A 2H6RA 4R7WA 3VIPA 3H55A 5C9XA 2D2JA 4J3WA 5CBBA 3TA6A 3W3OA 4O1BA 1CDGA 2BMBA 3VNDA 4FHAA 5CH9A 3KAOA 3WQ6A 3D6NA 2HROA 2O7SA 1DHPA 4FX6M 5SWUA 4MB5A 3W2KA 2FB2A 1Q4WA 3SR7A 3C5QA 1OIMA 4RX0A 3OBEA 3G3DA 4A35A 3ITVA 4L9XA 1MI3A 3IV8A 1FWHC 3UJRA 3FHAA 2KZHA 3FJ4A 4EXQA 2OGJA 4W5ZA 5A2BA 1S2TA 1HKIA 3BG9A 3MHUA 3PULA 1VH7A 4GE8A 3FY1A 4PUEA 3QVQA 1GW1A 3R5EA 4H1ZA 3UWUA 4AZCB 4IIBA 3RJXA 3AIEA 2Z1WA 2F7FA 3RXZA 1SPQA 5AN7A 4D6EA 4DBDA 2WJEA 3WLJA 4NX0A 3L67A 3WNKA 3Q94A 4WUIA 1RJPA 1Z7AA 1QI4A 1V6XA 3C56A 4XD6A 3NM3A 4FXFA 3CIXA 4BQ5A 5D05A 3FSTA 3MU7A 1UKOA 3JVAA 4N4PA 3AMGA 3BGAA 3S4TA 3WDRA 4KESA 1US2A 5F1VA 4WSJA 1QUMA 3BAWA 3ZR6A 4YTRA 3LN3A 3BAYA 2EBNA 3EKZA 1B3XA 1ZNNA 1P4CA 3N13A 2ZUTA 4AVOA 3MUXA 1S3TC 2FPYA 4GACA 2WM1A 3NDZA 1QASA 4E2DA 2DFAA 3UWQA 3VOHA 4DB7A 1GEHA 1BRLB 2FFCA 1E9LA 3WMCA 1W3LA 3LB0A 1Q6CA 2G4JA 4D6DA 1BLIA 3KBMA 3UY8A 3SCUA 1XIHA 4UCFA 1GVOA 2Y89A 5I23A 4CN1A 2R94A 1L6GA 3SUVA 5LIXX 4AZHA 3VK5A 3DN5A 1XLLA 4YXGA 2DSKA 1EEPA 4PTNA 4AU0A 3WJYA 3O7UA 1PIFA 7CGTA 2XH2A 3P2VA 2TAAA 3BXWA 4M1RA 1G4SA 3W1LA 5EKYA 5A8GA 1ZENA 2XH7A 3OQ8A 3N11A 4UQCA 4J1OA 4PRWA 1T6MA 3VNJA 3N18A 2DSUA 2WZEA 2ZZ3A 4M3PA 3QQWA 1KQZA 3MI3A 1UUMA 4GXWA 2ONEA 4LS0A 1DV7A 3AMDA 3KEHA 1V0MA 4CCCA 1TYGA 4UQAA 1UR1A 3BH4A 4G7EB 2J7CA 1RH9A 1CTNA 1PB0A 1TPWA 4G6CA 2CBJA 2BHZA 2Y8KA 5BCAA 3VD5A 4ASTA 5ABFA 2J7BA 3GXFA 1TMHA 2CCRA 3U2CA 3VINA 1XBYA 3WH7A 4IGSA 1NH6A 1XICA 3AIBA 2ZTJA 4WZHA 2PGWA 2X42A 1IXPA 2UY3A 3BGGA 3T8QA 4LCSA 4KPLA 4S3CA 3VOJA 2IXUA 2WVVA 2E3ZA 5FJPA 2YBUA 1Q8JA 1UBSA 3CS2A 5D2XA 4NAFB 4GIYA 1DWHM 4ZO7A 4EPBC 3C3NA 1FWTA 4B9YA 1EJTC 1CW2A 4WLCA 1PKYA 5D03A 4K2SA 4IL2A 2FVMA 3T78A 4C6IA 3EKGA 1W1VA 3T0TA 3QR0A 4MZ8A 3M0IA 4IFOA 3EA3A 2FZ9A 3IV3A 1A4LA 2JKPA 5MKGA 1S5TA 3GXTA 1AFSA 2OU4A 3GDBA 3QQ0A 4OBTA 2A2IA 3TTQA 1YNQA 4QE5A 3VD9A 4UB9A 2CLIA 4U5KA 3ABRA 4J3XA 1XGEA 1TVLA 3R13A 2YOCA 1UQZA 1OCQA 5BZAA 6ALDA 4JX4A 3NPVA 2MNRA 3C2OA 1CLXA 5CCZA 2BOFX 1DIOA 1KFBA 3TFXA 1SMAA 1WOBA 5FIPA 3WDHA 3SCVA 4ZQRA 4H2HA 4IJRA 3EGJA 1H7OA 3OZOA 3B0XA 1UD2A 1PYMA 3LLXA 2WLZA 2BGNE 3H2OA 4PRTA 3KTXA 1X6LA 3HGJA 3AISA 3UWYA 3GBDA 3PG9A 2C1HA 4O0ZA 3LD5A 1XRVA 1V3JA 1KKOA 2EEXA 3HPXA 3AJ7A 2DIJA 2D1ZA 1MVYA 1FDJA 1QT1A 3LMZA 3TH6A 2UY5A 4ZOEA 3GU1A 3DFTA 1MRQA 1A0DA 3OZMA 1GK8A 3TC3A 3ARUA 3BLPX 3GXDA 1I0BA 1IWBA 4J3SA 4OBSA 4MUPA 3W1NA 1POKA 2JGQA 3R6IA 1A3XA 2VURA 3K4AA 5KINA 3RG6A 4B92A 3JZEA 4GG9A 3VDHA 2OODA 1AJ2A 1OFDA 2TMDA 1E55A 4FOUA 3PPFA 3PWIA 3B4YA 3WLSA 2HRWA 5CAKA 1JZ7A 3SCNA 5AZ1A 3HFYA 4DXKA 2J24A 1UR2A 3D3FA 1M7XA 4BI5A 3VXGA 1SQ7A 4OQVA 2CKSA 4BQ2A 2J8TA 4ZA0A 1B31A 1CGWA 2WO5A 4CUCA 4M29A 1KXQA 3UY7A 2QS8A 1JYWA 3LXAA 3KHDA 4IIGA 2WSPA 2E40A 1PUDA 2HEJA 2Z29A 4NXSA 2HXUA 4P61A 4FLRA 1UR4A 1NDVA 4RV3A 4ALDA 1YPIA 1E6SM 2VWTA 4YMZA 3BJTA 3W02A 4PMZA 4NAFA 3U6WA 1JULA 2Q3RA 5AZ0A 1XIJA 4KRZA 4XAZA 2H8ZA 3CZJA 1MEIA 4MJ2A 1NOWA 4C60A 4DO6A 3CL7A 5CG0A 1JDFA 3ZT5A 3NSNA 1O94A 2G5WA 4QDPA 1VRXA 4OE7A 1W17A 5MKGB 3E0FA 1W9XA 3UVAA 2ISVA 3M47A 1B3YA 4UFLA 2ZZ7A 4I9JA 3R10A 3FAXA 1D8CA 1LWIA 4K37A 3STEA 4L61A 1US0A 4QROA 4AMCA 4BF9A 3BAKA 2YCKX 1WDRA 3B9OA 2HWGA 1UIOA 2XHYA 1CT5A 3CPRA 1I2PA 3GBEA 4RW5A 4QG8A 4P8VA 4C6BA 4D1IA 1H0IA 3WO8A 4PMJA 3O9NA 3MUY1 1GOQA 4WSHA 5E0CA 3IIZA 3WUBA 1DQUA 2G0WA 4D6IA 4HK7A 3NQ7A 2X8RA 1W9UA 1RQEA 1AVAA 1VFSA 3A3XA 4F4RA 4QCFA 1M7PA 1LLWA 5I0DA 3IIPA 3UR7A 2V5BA 2XG9A 3KZPA 3UZWA 2WBKA 3TKFA 3ARPA 2PB1A 4C6LA 4ZBCA 3PUDA 3HPZA 1OT1A 3F4DA 3SURA 1EDQA 2ISFA 1GZJA 1NY1A 2WMHA 3NPWA 2YLAA 3OBKA 3HO8A 3DYOA 3JS3A 3WLTA 3A22A 3MMWA 4G2DA 4HMNA 3Q45A 3I10A 5H8UA 2YJQA 3LMYA 4JHOA 1EGMA 2Y2WA 2D2HA 4JAWA 3W1TA 4PRRA 2ZFAA 2Z1XA 3AMLA 5CSYA 1OX5A 1KFJA 4KT2A 4HA0A 4IIFA 2UV8G 3TN4A 1OGSA 4FX7A 4EPKA 5E93A 1C29A 1OFQA 4KEUA 4MADA 4NASA 1K4GA 4LB3A 2QT3A 5BYWA 4MDOA 4LF1A 3UJ2A 3OP2A 2ZWZA 3S6TA 3GVGA 4PBGA 4JTDA 3L0NA 4C91A 4RE3A 4PUUA 4YYCA 2E8ZA 4HNOA 3QF0A 3W4RA 3TTOA 2C91A 3FW6A 2R24A 4KQNA 4R5EA 1VRDA 4N4QA 3Q58A 2XWDA 4OT7A 3W24A 1NP2A 3TTSA 1RCQA 1MUWA 1V02A 5CGTA 3BLOA 4JQ4A 4AD2A 3TLQA 2QV4A 2AMXA 3TROA 4EVZA 3QMRA 1UKQA 3B0UX 4GYPA 1T5AA 4JIHA 3AYRA 3C0JA 1F3TA 1VBUA 4FOJA 3W1QA 1C9WA 1H2JA 4PH6A 4TMCA 1EJSC 1JRBA 4XO7A 5DCEA 4PGLA 2RUSA 3T0BA 2WCAA 3II1A 4BY3A 4M82A 3GTXA 3T55A 2YCLB 1D8WA 4FIQA 2G50A 2OGYA 1TELA 2CW6A 2QCFA 1JUBA 5EBAA 4WY0F 2NLIA 3TSBA 5IHSA 4O53A 3LXCA 4AD0A 4ENLA 4EKJA 3PVFA 2A6NA 2E6AA 5D30A 5CJ5A 5C9ZA 1DYSA 2Q71A 3AWOA 1BXCA 3E9AA 1HO4A 2QDHA 1GKPA 4YTTA 3BLIA 1IWPA 3LGGA 3VGFA 4W88A 1JZ4A 1BF2A 3WUEA 4I5XA 4WY0A 1AG1O 3GWQA 1FFQA 2FZMA 3FLUA 3E74A 4BQ4A 1UMLA 4S3EA 1OGGA 1SSDA 4UIOA 3SM0A 2VMFA 2E5DA 1WDDA 2HSAA 2PDNA 3CEPA 2W63A 3MMUA 3T42A 2VKZG 1UWTA 2QDEA 3H21A 3UXLA 3ZVHA 3W2JA 1S2CA 4N9CA 4U2ZA 2WVSA 1ECQA 2H3DA 4LT9A 3WQGA 2X7WA 3MHGA 2VFEA 3LI0A 4FO4A 3B8VA 6REQA 1BFNA 1CPUA 1GG0A 1S5WA 2Y70A 4CGTA 1AZ2A 1VEOA 3NM1A 2I7GA 3WLQA 2R82A 1OG6A 3WDJA 2V9DA 4JNYA 1XLAA 1Q13A 3HPFA 1OBAA 4I8YA 4AMAA 4LCQA 4NI3A 4UXDA 3W00A 4F8XA 3WQPA 5M17A 1GHSA 1RD5A 1WCGA 2EG7A 2GGGA 2GQ3A 2WHKA 1WXJA 4E6MA 1I0DA 3VI2A 3BDKA 5AY7A 2F61A 4EAMA 2E6FA 2H9AB 5BRQA 2XGZA 4EF9A 4JIIX 3GG1A 4JQ2A 3KLLA 4MJZA 2QUVA 2D3NA 1NWTA 3VFLA 2IMRA 5CZ0A 2QCMA 3GXMA 4FR1A 4YTSA 2QJGA 1KV5A 1LBLA 3HBLA 2A0NA 3P7YA 2ZRYA 4UFIA 3CH9A 4S23A 1GYMA 4UTIA 4HNNA 2OX4A 2NWRA 1NF7A 3GTNA 1OYAA 3KTCA 5A8OA 2PDKA 5TAOA 4GYJA 1LOLA 1JRCA 4PB5A 5I7GA 1ZB5A 1LRQA 9XIAA 4C6MA 4YL2A 3LPGA 3QY6A 1M6JA 2GJRA 4OVXA 4F2TA 4GVFA 4CQAA 1E6ZA 5BW6A 2WHJA 4I8DA 1YXCA 2J78A 4DYEA 1O5XA 3K1GA 3UZZA 4CNTA 5KETA 3AS2A 4NAEB 5D04C 2RH9A 4NKCA 1UZ1A 4MZYA 5H91A 2R8WA 3LZ3A 2QYGA 1O5KA 1WDQA 4LUIA 3BQ5A 3QPZA 2PLKA 1MUMA 4ICNA 1V93A 2EAWA 4LYRA 3SW6A 1G94A 5ABHA 1D7FA 5DF0A 5BMWA 2GVLA 3BGJA 2JALA 2FMNA 4HP5A 4I5RA 4Z08A 3OOQA 1XDLA 4JTIA 1DIKA 7XIMA 4UOJA 3NDOA 4L4PA 1JIBA 1KKRA 1QNRA 4CU8A 2FGLA 1W2PA 3UG4A 4Z1YA 4CD6A 2TODA 2VEKA 4L65A 1YDYA 4UR9A 3VMOA 5AC5A 2CITA 3URAA 1FWBC 2VZVA 3I6RA 2WB5A 3M64A 4IICA 1JJKA 3FA4A 1F6PA 3B40A 3RN6A 1J0HA 1EZ2A 3CEUA 3TCEA 1ZBKA 4WDTA 1GKQA 1EBGA 5HQEA 3GVVA 1H7PA 4DVOA 1Q5MA 3F4CA 2PS2A 1YXYA 1IXNA 2EG6A 2HQAA 1GJUA 3AWNA 1M65A 3FJLA 4JCMA 4F0RA 3BCFA 1JFHA 3MP3A 3PZTA 4W9TA 4F2BA 3RM4A 3S5SA 3T4WA 2P1FA 1PTDA 2P76A 4L6OA 1UC5A 1V0KA 1ZP3A 1OCBA 3WDPP 2OB3A 3ELFA 4GUGA 1GQJA 3CUJA 3ZM8A 2W5FA 4QBXA 3C8FA 4GI8A 4W8LA 2WZTA 3QXBA 4NILA 3WNNA 2WMJA 1T41A 1ONXA 4JFTA 3GK0A 5CXPA 3M5ZA 1Q6GA 4NRSA 3LHWA 4LUYA 3VCCA 3APTA 3SIZA 4UFHA 3B04A 5LIKX 3IK4A 3QZEA 3H2FA 1GQLA 1YNPA 2V5DA 5E9AA 2BHYA 2J7EA 1Z41A 1FVPA 1L6SA 2GVEA 3WJXA 1A0EA 3EA2A 3AS3A 4LVBA 3ZVHB 3L5LA 4MIMA 1F3EA 4M6QA 2SFPA 2IKJA 2FJKA 3FOKA 1GVQA 2NX1A 1KM5A 3SAZA 3ZJKA 1FX6A 5HR6A 3WN6A 4PMVA 2PTDA 4PMDA 1S2WA 6REQB 1WPCA 2DSWA 2VDGA 1VEMA 2FKPA 1BSIA 3ZR5A 2I14A 4HU0A 3SCQA 3E5BA 1AQMA 3SGZA 1O5RA 2OWWA 3UWEA 2W67A 3CJPA 1SSGA 3G8RA 2PFHA 1JPMA 4DF0A 3PBMA 4NNCA 2ZX9A 2ZE3A 4R7JA 3E49A 4IISA 3BMXA 1L6YA 3OLDA 3EWDA 3ERPA 4QJ3B 2VFHA 3HPSA 3T44A 4J2PA 1WP6A 2D3LA 1CEOA 1KFCA 3MBDA 3O8AA 3B8DA 3KW3A 4YVXA 3AYVA 2DT1A 4Z17A 4S3JA 1AL7A 4JTHA 2J75A 4GK8A 5C70A 1C7SA 1ZGDA 2A4AA 1ZBCA 3MCMA 3EDFA 1OEPA 3POCA 3FIGA 3T07A 1R6WA 2QULA 2XPKA 1PO9A 1CX9A 2CBVA 1V0NA 3WIJA 2DZSA 1OF8A 4MAVA 1QNVA 3CQJA 4CNUA 4YN5A 3BICA 1UUQA 4QLKA 2ZRUA 3TYCA 1K6AA 2NQLA 3E2QA 5F2LA 5F4WA 3JUGA 4UTKA 4PYSA 5AC6A 3LENA 4U2YA 3VGGA 4IP7A 3VD3A 3MSYA 1PX8A 1NARA 4MOZA 2OVLA 3PANA 1CLVA 3GX9A 3TQPA 3XISA 1C3FA 3NO5A 1QK2A 3AS0A 4ERAA 2DEPA 3LM7A 3WZ0E 2D24A 3G1VA 3NNTA 3O0KA 5A2AA 3ZS4A 3CQHA 3EOLA 3GC4A 3VGBA 3AFBA 4FNQA 1SUXA 1PZ2A 3OIXA 4DZIA 4BHYA 3AMCA 2CLHA 5I02A 3AXXA 1J0ZA 1X8FA 3L65A 4PUWA 4H2CA 1SO5A 3W75A 1YPFA 4DJDA 1ADOA 1NOFA 2DVTA 1G4PA 2G95A 1A0CA 5TIMA 2Y62A 4AZGA 1LCOA 1L9WA 2W4XA 3UD6A 4Q4PA 3TC6A 1A3HA 1UW9A 3G0UA 3P81A 5CC5A 3F4VA 2ZTKA 1XXXA 3ECQA 3MT1A 4A29A 4LS2A 2ZA1A 5IBXA 1UH2A 5FEPA 2DV0A 2V8ZA 5GJPA 1VHNA 2PF0A 1H50A 4YHGA 5DCBA 5G4HC 5U4NA 1OX4B 3E3HA 2PURA 2Y5SA 4PTDA 4E3VA 5G1MA 2VQTA 2ZX8A 1K70A 3I7RA 2ZXAA 3VU2A 1O95A 4ZSTA 4TMBA 4ZVJA 3B4UA 4GOAA 3WLNA 2PDBA 3FYOA 3PUEA 2OOGA 2FHBA 4U4MA 2V69A 4AF0B 4GXMA 4KMQA 2VO5A 4Q7IA 1XLJA 3UF9A 5IOBA 5HJLA 1SR0A 4LBSA 2V5KA 3G1SA 1NAL1 3W7DA 4C6FA 2DT3A 4ZXLA 1EIXA 3HV8A 1W54A 4BKNA 4HHPA 4LAOA 3S1XA 4US5A 1SW3A 1GVSA 3GDMA 4Y2WA 1EZWA 3NXFA 4R9OA 3WQCA 1G6CA 4KCWA 3CZKA 4NP7A 1HO1A 3DZ1A 2DSZA 4WEVX 5G4EA 2VJXA 5CEWA 3TW6A 3S47A 4ZEPA 2WNNA 5C55A 3VE7A 4Q4QA 5I5RA 1MNZA 3NCOA 3OJGA 2ZZ2A 2AQVA 2CIPA 1DKWA 4UUIA 2NLYA 1ICSA 4PTVA 4AZ7A 4IPPA 1R47A 4XKYB 1NWSA 1W8GA 2A79A 4FI4A 3RCNA 4F48A 2YA0A 1OCJA 4ZL1A 1FFRA 4D72A 1TV7A 1JVNA 3W38A 1I45A 1A4MA 1PTGA 2J8FA 3FA3A 2VRQA 1LYXA 2QCEA 3XIMA 5BU9A 3ALFA 4GUHA 5CC6A 2Z6IA 4IG2A 5HANA 2ZWYA 1QVBA 2W92A 1NM9A 2WZHA 3QBUA 3AHYA 1SR9A 3MJYA 1UWIA 3ITLA 2ZC8A 3CQ0A 1ICPA 1YBQA 4B5VA 2V2CA 4PCNA 2CKRA 4JYEA 4ZB5A 3QH2A 1HX0A 2VEFA 3S2JA 1QO2A 3UG8A 3MSRA 1ZAJA 1U2YA 4A3HA 4AXKA 3CZLA 4KBXA 3JZUA 4GQ0A 2ZRXA 4FALA 1TWWA 2JGYA 5T91A 1ISVA 2P0IA 1A5UA 2WMIB 2VX6A 4PB3A 1JI2A 4Z2LA 5DMLA 3CZEA 4RDZA 1MEWA 1OFPA 2Y4SA 3GZ3A 1W9BM 2CHOA 4X61A 2FDMA 1QI5A 1XLHA 4MUZA 2B4GA 1PX4A 3CPGA 3HV9A 1J96A 5AHFA 2QJNA 3KUMA 3MI6A 1M9HA 1G7VA 1IV8A 1RA5A 4FLQA 4M56A 5A8PA 1A5MC 2FLIA 1QW7A 1JF6A 4ZCWA 1H3GA 2YCEA 3CHEA 3ZOAA 1E3XA 2PP3A 2G3JA 3EWCA 4RZBA 8A3HA 4MTVA 5AYBA 4IM4A 2XZ9A 3VNKA 3VIGA 5CSUA 5FI8A 1QU4A 5EFFA 4XTIA 2VZUA 4Y9PA 4EX4A 3CWNA 4LCRA 7A3HA 2ESCA 3W71A 3MZNA 2R14A 2ACRA 4S3AA 2KX9A 2CERA 4C6KA 4O1DA 2WJFA 3IAQA 4XZWA 5E9XA 1KD0A 1PE1A 3DOPA 1JFXA 3MPGA 5KZDA 2OSWA 4FS9A 4LV4A 5I3KA 1XF0A 1DWIM 3N9SA 3OTRA 4X0VA 1KBBA 5C5YA 5DRCA 1DVJA 3OZYA 3EXSA 4FXSA 4PEKA 1TPDA 3NQAA 4XG1A 3I65A 5AHNA 2FH6A 4GD0A 4FZIA 1V3IA 4FF5A 3RILA 1C8QA 3SN4A 3OVQA 3VDBA 4KEVA 1J0KA 3PBUA 3STCA 3IGHX 1Z44A 2DZPA 3C2RA 3W0KA 3OYXA 2GLKA 2YB4A 5DO8A 2W91A 4DWSB 3M7WA 4MFEA 4XAFA 1Q3NA 2VT0A 1P0NA 5D9OA 1DWGM 2CHNA 2CU0A 1K8YA 4FF7A 3A4JA 2J9XA 3CAVA 1H49A 4JL1A 3MSDA 3HN3A 3ARWA 1IZKA 5D2YA 1TV4A 4JTKA 1ZJHA 2H8XA 4B90A 3IJ7A 3RHGA 2NWSA 1UWAA 1XBZA 1H11A 4Q8TA 3KBWA 3HGRA 1TREA 1TMQA 4O0QA 2Y61A 2V2HA 1FWSA 1DQXA 3QY7A 4XB3A 4HA4A 1A5AA 3HF3A 4UNKA 2ZX6A 5ABFB 1EIBA 4HSNA 3WBYA 4HMEA 1B30A 5I06A 3RU8X 3SFWA 1NIUA 3OYZA 3PZVA 1V3MA 2OEMA 5CLWA 1Y7VA 2RKXA 1CGXA 3FXGA 2RGLA 1HIZA 1R3WA 3NWRA 4GO9A 3KFTA 1TKKA 3QFEA 5A6TC 4EPEC 3EBVA 2PLCA 4JY9A 3W2LA 4A3UA 5A6MA 3UXKA 1Q4NX 3TA9A 3GO2A 4W87A 1LOQA 4GNVA 4YTUA 4ZZ9A 1HN1A 3WMBA 3CBWA 5DQPA 2PBGA 1JAEA 3SN1A 1N7KA 3LV5A 4A8RA 1OZQA 4U31A 1B5TA 1WKFA 4KW2A 1MW3A 4RKAA 5KZMA 2CETA 1TPVA 3QC3A 2I17A 2O56A 1Z48A 4IL0A 4OV4A 1J11A 3K8MA 3PNUA 4RNFA 3WUFA 1DTUA 4RJEA 1JDDA 1WXYA 1LM1A 1LBMA 2YYUA 4JICA 2RJGA 5HATA 2PRLA 4WR3A 3CUZA 1ISYA 4WGXA 3KOYA 4PSRA 1B54A 3TW7A 3IJDA 1LF1A 1A5NC 1UJQA 2FH8A 3DDMA 5FA5A 1YHTA 2WQDA 2CBUA 3VGDA 4DWSC 3PFRA 3R12A 1TUFA 4PMRA 1TZ9A 1YDNA 3DKJA 4JR5A 4BS0A 2ZXBA 4L7ZA 1SZNA 4DPPA 4DWSD 3UCQA 4IXHA 3QLLA 1I6NA 3CU2A 2WHLA 3V16A 4DYKA 4J3VA 3W27A 4NUWA 1GOWA 3TYBA 3RLGA 1FCBA 2J88A 1CNVA 1R46A 1UQYA 3FGCA 5M2FX 3T0CA 1UPPA 1S1PA 2OQYA 3K30A 1E51A 3GVWA 3G18A 2BGQA 1AJ0A 1E6QM 1ADSA 2J62A 3DHFA 3UCDA 3IGSA 3UVIA 1OFEA 4HNCA 1JG9A 4PFMA 2DUZA 4L80A 3ORWA 5M5DA 3NG3A 4J9JA 3TN3A 2R1LA 2ALDA 2IUZA 1IT7A 2ZXDA 1T96A 1C92A 3TJ4A 3H70A 4RDWA 5CAHA 2VFDA 3SZ8A 1EX5A 3UA4A 1OC7A 3DYPA 4GIRA 2V67A 4K1WA 5FKYA 1MQQA 2VZSA 3CB3A 5CQ1A 1GNXA 3R7MA 4B4FA 1E40A 1S3HA 1J2BA 4DQWA 5GNXA 2DZVA 1O60A 4JDYA 4BZYA 1D3CA 5E0KA 2PWUA 4RDYA 3QHMA 4QR6A 1MWOA 1EO7A 3H4WA 2WWCA 4DBWA 2OKTA 3QHOA 4YIWA 4YVPA 1Q6OA 3OG2A 3HQPA 2BXZA 3NQ2A 1TIMA 2I5IA 1GYNA 3W7LA 3AYTA 1F4HA 1X97A 3QC0A 3G6MA 3O6CA 4LU0A 4PR4A 5BOOA 3EEGA 3PY2A 4ZQOA 2ZZ4A 3F7JA 4XBJA 1P6CA 1ZALA 2OT0A 1XPGA 3EWUA 3TAKA 5LA2A 1XX1A 3VNLA 4UQEA 2DIEA 4DJDC 4JKKA 3W6MA 5FSEC 2XH0A 1PAMA 2YZ5A 1G1YA 4GXPA 4BA0A 2QCDB 3CO4A 1F05A 4OOUA 2J7DA 4JBRA 3ZZ1A 2D0FA 1VFUA 2QUMA 2XH4A 3PG8A 1SZFA 5CPMA 1NU5A 2ZCGA 2BY1A 2Y7GA 1QNSA 1EQCA 4H6EA 1Y8BA 4ZFMA 5IDZA 3S6OA 3QV9A 4K8GA 5LSMA 3MP4A 4KEZA 1PYFA 4J40A 2O55A 3IJQA 1AK5A 2GQ8A 3J7HA 3C0LA 3RRAA 1GG1A 4QM1A 2F38A 4WGHA 2BB0A 5G2IA 1BG4A 4Z1BA 1ITCA 1M01A 5D9PA 3P74A 4OTKA 3NSMA 1NVMA 2WC3A 4MAZA 1G7UA 5MHBA 3UXIA 4DYJA 2D2GA 2I57A 4Q4OA 3VMNA 5C9WA 3REQA 2C3ZA 3CZGA 4LH8A 4LYPA 2ISSA 4HPXA 3GVQA 3EWWA 2AL2A 1FKXA 4UFKA 1W9DM 2DT2A 1KM4A 3CNYA 3IJ9A 3A13A 3R8HA 1IEVA 1IE7C 5D09A 2C1IA 1ITUA 4GVGA 3GAKA 3GB6A 5EA9A 3AQUA 3QOKA 2PWDA 5CPQA 1O5QA 1JZ3A 1DP0A 1K4HA 1K02A 3V5OA 1VCGA 3MB9A 2PODA 5EB8A 1Q7ZA 1RV8A 4LNYA 2I5QA 3FS2A 4Q33A 3PWGA 1K7FA 4NZCA 1FA2A 3IUHA 3I4EA 1XCWA 1RVGA 1NELA 4XX6A 1O12A 1HTIA 4PBEA 5DMNA 2GUUA 3VIMA 3MYOA 2DUXA 5I3DA 4I7WA 1RD6A 4N42A 5J5DA 3C86A 2JKAA 3ABQA 1HKVA 3ARQA 2EHHA 4J5NA 5AC7A 2CZEA 1PVNA 4O54A 5GJMA 4PMOA 2PRHA 4GIAA 3KBSA 4X22A 1XWYA 2VUNA 3C3UA 4W86A 3CIVA 5ECUA 3DG3A 4HSHA 1I2OA 3NPUA 4LW7A 1IZJA 3K13A 1F8MA 4R7OA 4L9YA 1KM0A 1IEIA 1KTCA 3JU2A 3T9PA 1SGJA 3V7PA 5K9CA 4AZIA 3U57A 3EWZA 1HZYA 4W85A 3GDRA 1KBKA 3WMLA 2GFTA 2ACQA 1TV8A 5D38A 3QGVA 3SJ3A 3W7OA 2VX7A 1EJ7L 4NIRA 3CV2A 1EOKA 1PS9A 4HU3A 1X1OA 3CT2A 1VP5A 7ODCA 4EPDC 3DG6A 1P7TA 2NUXA 3OLGA 2IXVA 1RK6A 1V6WA 1ESWA 3KWSA 3LCWA 3WBAA 4R3UA 4A2SA 2QKFA 1AZ1A 4O10A 5A95A 1KBLA 1VBRA 4E4UA 2D22A 2BVTA 1RBAA 3STPA 3AI0A 1HL9A 1E9IA 3OBAA 1WAWA 1NF0A 1QWGA 3TK7A 2ZYFA 3SQLA 4MDPA 3WQ4A 3PZ9A 3TSMA 3NQVA 2E68A 5G2HA 4LS1A 3W7NA 1QAPA 4W8AA 4DBEA 3MWAA 5LNRA 4N7QA 1ZLPA 3VGHA 5FL0A 3U0HA 1VF8A 1JZ6A 1ITXA 2I5GA 1V0LA 3M41A 1A53A 2PDFA 5XINA 1U1UA 3LSCA 4NZFA 1UKSA 1EJUC 4GUJA 3HOJA 3RPDA 1H41A 3RMJA 1NQKA 3MWCA 3WQ8A 4AHQA 2F6KA 3QGKC 2HBVA 3O0FA 4QLJA 4L4OA 3WL0A 1XYZA 4KFOA 1N2VA 4H9VA 1TE6A 1OINA 3LLDA 5F1UA 4DM1A 4KFNA 3C52A 4KGLA 4MMWA 1YDVA 2Z1KA 4IMAA 4PBFA 3DERA 3TYAA 1AMKA 1YW1A 4W7WA 2JQXA 4F0LA 3S1VA 1QXLA 1IXQA 1OFAA 4ORMA 1TV5A 2E9MA 2WNWA 4IPIA 1PEZA 4IMGA 4DNMA 1G4EA 5G1YA 3E0VA 3LTYA 1VBGA 3EMQA 2BZNA 4Z2HA 3IEBA 2VTFA 3O16A 1TIWA 3B8TA 4ZB2A 4ICCX 3M4HA 3O2LA 3VIOA 1JZ8A 4FLOA 3T05A 3GYEA 2J7FA 1E1CA 1FQ0A 3TVAA 3WLHA 4R53A 2Z28A 3RLUA 4CQBA 2BLEA 1I75A 4HGXA 5DN1A 1IIHA 1IF2A 2JKEA 1KFEA 1ZFJA 3WD0A 2Z4GA 1JI1A 1VCFA 3IAPA 2E67A 4S3GA 1J12A 1QPRA 2GJLA 3IUDA 4CQ8A 1ME8A 1XR2A 2Y8UA 3GFYA 2GJNA 3MMDA 1TQXA 5HK4A 3RM9A 2PWFA 3VIFA 4O11A 4HK5A 3UPWA 5FF2A 1P43A 2J13A 3SO7A 2PUZA 4FIRA 1LOSA 2DH2A 3TYEA 1XG4A 2OOFA 3PUGA 3QPYA 3IVSA 3QFWA 3WX7A 2DJXA 1OYBA 3TC7A 3FEQA 5BU6A 4ZODA 2OQLA 4LVFA 4NT0A 1V3LA 3W7JA 4V1YA 5CZSA 4ES4A 4PMXA 1HUVA 4TTGA 3CT7A 3GQYA 3PJTA 3RCMA 1CXIA 1VPYA 1FXQA 3GNNA 3LBOA 4UQDA 1THFD 1KM2A 3CUFA 3A4AA 3B8SA 4LVGA 3WQEA 4HNVA 3FEMA 5T8GA 4LUSA 2Y7FA 4G8TA 3SI9A 4DJEA 4IFKB 4UTMA 1GCYA 2E77A 4LEFA 5EMYA 1P0BA 2HPIA 2ZUUA 5LA1A 2FHCA 4LYQA 1IGWA 3AOFA 2OWCA 1EXPA 4UTLA 3BJFA 1WZAA 3G1RA 4PZVA 3CUIA 3F5LA 2ZOXA 5I24A 4L1GA 4E2VA 3ZMRA 1EPXA 4IX0A 3E2VA 1JUEA 3MKKA 3AUJA 1M04A 3KL0A 3THDA 3UZXA 1KXVA 2WSYA 3ATZA 1F3XA 3BG3A 2VHLA 4P8UA 2XN0A 1MW2A 4P2VA 1DJIA 1WNOA 1E73M 1ICQA 1JDAA 4O1EA 2ZRVA 4GQGA 3W22A 1ISXA 2VEPA 4GX8A 2FFIA 2FDSA 3CB8A 3BL3A 3KCOA 2ZUVA 1R0MA 1XYAA 2WOQA 4IUOA 3M5VA 2FB3A 3OU8A 4NVTA 1UR9A 2ZKMX 2QCNA 2JEPA 1TJ2A 3M1ZA 3N14A 4JCLA 3A21A 2HE8A 4ZB0A 1EUNA 2EPMX 4AW7A 3G22A 3I7QA 3ANVA 4U3CA 4Z2IA 3E6EA 1XDJA 2REQB 2GDQA 3TFCA 4J3UA 2QMJA 3I3DA 2VDHA 4ZOAA 1FCUA 2XFWA 4Q6JA 2EGZA 4B3LA 3A47A 2WNQA 4QJ1A 3QSTA 2BTMA 1WQ5A 1SVDA 3CQIA 2ATSA 4IP4A 4JTFA 3ME3A 4F79A 4FEZA 3NXLA 3ZLHA 2OSXA 3ARRA 4HB7A 2V3EA 1P6WA 5D4YA 4J3TA 1S2UA 3L2MA 2E8YA 3CWHA 2ZA3A 1GOIA 2PC4A 5C9UA 3BCJA 1S38A 3KE0A 2JIEA 5HDRA 3FDKA 2FPTA 4R85A 3S5OA 4XD4A 4O12A 5E6YA 4K7VA 3M07A 4D1JA 1J6OA 4FOKA 4AHOA 2F2HA 4WKHA 3N6JA 1JCXA 3FK4A 1J79A 2Z2UA 5D2VA 3R79A 3L4ZA 5DBTA 1Q6QA 4OFCA 4FNRA 4LUSB 5D37A 3RJYA 1ISWA 5BWAA 3N4FA 4LWWA 4UOZA 1M5WA 3GH5A 4MNLA 1UA7A 4DBUA 1BPLB 1ME7A 3DFYA 5G2WA 1RPKA 3ZYZA 1GQNA 2VOTA 1OFBA 1XINA 3N4EA 3W83A 1LROA 4C6EA 2Z2BA 2QVHA 5CBJA 1UROA 1R7AA 3EOOA 3R94A 3SCOA 4AEOA 2IW0A 2J79A 2R1PA 3O63A 4EANA 3FCPA 4DEFA 1BGAA 5C6MA 3PBGA 4UZSA 2QIWA 5AC4A 1W91A 3N9RA 1UD6A 1X38A 1W1TA 4HT3A 4IXXA 1G67A 8XIMA 1OC6A 1WXZA 3WLLA 4IQEA 3PC0A 1JPIA 2Q3OA 3DCPA 1MXGA 2CWNA 3GNOA 3M9YA 2QJHA 1TVPA 4TX6A 3NUKA 1FBAA 3AAMA 3B9AA 1LWJA 3SQSA 4TX8A 4M24A 3M43A 2C0AA 3CQKA 4MWAE 3BV4A 4UC5A 1I2NA 2Y0FA 1RXOB 2C0HA 4Z1AA 2G97A 2OZ8A 3FA5A 2VZOA 4E8DA 1HXJA 3N2MA 4RUBA 4ZO6A 4HD5A 1A5OC 4XV0A 3HU7A 3K4DA 1V08A 2VEIA 4H6KA 4ZOCA 3TQKA 2X0SA 1ZRQA 1QPNA 5C71A 1PWMA 3G1AA 5FF0A 1YXDA 1LL4A 3FV9A 1YEYA 3S6DA 1AD1A 2FJUB 3QV6A 1GOMA 3NZPA 4MF4A 2FHFA 1IXOA 2I9EA 4LSBA 1XLKA 3QM3A 1RJQA 3WSUA 4RZ4A 4YU1A 4E38A 2QMKA 2WXDM 2WWDA 4QJ5B 2D20A 4HJWA 4GVIA 4H9UA 3I68A 2QUUA 1KC7A 5CKSA 1ZSXA 1EWDA 3P80A 4IQLA 4FX8A 4IHCA 2GVYA 4NNAA 2B0MA 3U48A 2YCJA 4Q8PA 3E5PA 4JNMA 4QS5A 4A3RA 2YBVA 4H7VA 1VJIA 5C8BB 4MYXA 4Z2KA 4GJ1A 3RAOA 1IT0A 2VD8A 1UD8A 1J4EA 4AYSA 5F7UA 3R1ZA 1UKPA 4TOQA 2F6UA 5EL1A 4WDUA 1B57A 2VGFA 1AQFA 2CC0A 4NQ1A 1WUEA 3P0XA 4XKYA 1EP2A 1XH0A 2P0OA 4AVFA 4KIEA 2Y88A 3ZVIA 4CKQA 4PCFA 1F5ZA 1RY8A 2DVUA 3E2RA 1DJGA 4Y7EA 1TJ1A 3ITYA 2ALRA 5AHMA 1IHIA 3TONA 3LNPA 1WDPA 3MO4A 3RDKA 5HJYA 2R1MA 4HHLA 5DY2A 1VLWA 1O68A 2VFFA 2Y8VA 3C2FA 1W3IA 3UGVA 2CNCA 1XIMA 4REQB 4HHMA 3W37A 2X41A 3PNZA 1CZ1A 3T40A 5U7SA 1QNQA 4G1KA 1HNYA 3GHSA 4UQBA 4JTAA 3ZXWA 2JEQA 4G7FA 4Q8NA 1T99A 2OFJA 4DI9A 1PTAA 2HNEA 4O19A 2WKGA 2J6XA 3NQDA 3MANA 1P0KA 5IRPA 1QR7A 1H62A 3N3MA 4URIA 1XLDA 1SW7A 3GM8A 1W56A 3IIOA 1TE1A 3PBVA 4M80A 2JK2A 4PMNA 1KGWA 3VIIA 5PTDA 3GU9A 1YX1A 3EMCA 2Y6ZA 4H9XA 2QVNA 3PJXA 1TPUA 2V0TA 3STFA 2GOKA 4MY1A 3GHUA 4XUGA 3AZRA 1R9YA 3N34A 4V1XA 3NQEA 3D3AA 2ASHA 3W86A 5HR7A 4JDBA 4CNOA 4NRRA 4F0KA 4IH3A 3MCOA 2YXXA 3M6DA 1QDSA 3EX4A 1RJRA 4U28A 3GKAA 1Z9AA 4GH1A 3PBWA 1JXKA 4GH3A 1K7EA 5HNNA 2QGHA 2C71A 4YCOA 3EWYA 1JYXA 3R8GA 3RYSA 3L5AA 4JTRA 4H8NA 5D2WA 2ZE0A 2HE5A 2WANA 1CWYA 1Z3NA 1HG3A 3EWBX 2PA6A 3SADA 1Z32X 2Z00A 1WKEA 4X2RA 6ENLA 3PTMA 4DUXA 4HSOA 4LANA 3KLKA 4LJ3A 4UTJA 3D46A 1BRLA 3UZJA 4B91A 3MUIA 3S5YA 1FHDA 1X7FA 3LUTA 3GG7A 3CHDA 4LUTA 1G0CA 1XBVA 3KOWA 2XVKA 2QUTA 1XRFA 3SRKA 1PV8A 4WQ6A 2WV8A 1M03A 3RCYA 1H4PA 4O17A 1XLEA 2QCHA 3S2MA 3H7UA 2FZ8A 2VZTA 4ZSUA 2B7OA 3AHVA 2QR6A 4GQRA 1TWZA 2OMAA 3ZJ8A 2FQIA 4NXKA 4LF2A 3DENA 2ON3A 3TR2A 2CZDA 2GSJA 2O92A 1B90A 4Y8EA 2A1YA 1SO3A 5BXPA 5FJTA 3IK2A 3FKKA 3M0JA 1HKKA 1L6WA 1X7IA 4E8CA 3OIHA 2CYGA 4PEEA 3LTSA 3PF3A 1C90A 2X16A 4A3YA 3A4XA 3A5FA 1TSIA 4S3KA 1A5SA 4GZ7A 1ZBVA 3T7VA 3RO6A 3HQ1A 4C6JA 4QIUA 1MO0A 2Z6JA 4QSHA 4US5D 3AS1A 3S83A 1K6WA 2RDUA 1AH3A 3MZ2A 2W66A 3AIRA 4PUJA 5LGXA 3L68A 4UTWC 3TXZA 1EJWC 3W76A 5JUVA 1XIFA 2WPBA 1D3GA 4R88A 5CC7A 2YYTA 3VIJA 3MY9A 3W7RA 2EQDA 1HFBA 4V15A 3LOTA 3H8AA 1GPWA 3OLIA 3VDCA 4Y8FA 4B4HA 3WH9A 4DM2A 4V33A 1RUSA 5A6KA 3A4WA 4ATDA 2JIWA 5REQB 1QNPA 3PB2A 1SYTA 1KTNA 2A3BA 3VD7A 1W1IE 4CD5A 1FUYA 4KEMA 2Q09A 2WVVB 2WVTA 1E4LA 1PCWA 1VKFA 2P53A 4I9MA 5DXYA 4GYKA 2ZRZA 3EXRA 5EY5A 4UFJA 2GWGA 4GMEA 3TDFA 5HPCA 3A12A 2IPGA 1C9DA 4ICMA 2YL8A 3A23A 3A9IA 5I6SA 3M0KA 3FKRA 5GPRA 1XDMA 4M7SA 1AW2A 4AIBA 3A64A 1LRNA 2OZ0A 1GTHA 4DIAA 1B4EA 5JXQA 3LYEA 4H04A 4R34A 4A3QA 3I6EA 1S5NA 1MMFA 4GC3A 2YKKA 1E0UA 3I3EA 4BI7A 3R89A 4GQQA 2VVSA 2NSXA 3KOFA 4A6GA 5A8QA 3LA4A 4QGCA 4MJ4A 4HPNA 4ZQMA 3EDDA 3UXDA 4AEFA 4XUYA 4EACA 2QPXA 3BSMA 3CPUA 3W72A 2UZ9A 1YPXA 3QKEA 4HCHA 1H7NA 4DZAA 4AWTA 4JFVA 2POZA 3VX0A 1CXKA 5J8LA 4MGGA 1XJBA 1Q7QA 4NYYA 4RE0A 2WHMA 4TVDA 2DZWA 1KLYA 2ZUSA 5A6AA 4N6EA 5EFDA 1A5LC 3TW9A 1T8QA 5H8MA 2PWVA 2ZUWA 4NZ1A 3C2VA 1E9YB 3UWZA 1TCMA 2WJZA 1V5XA 3CMJA 4ORIA 1QFEA 5T9BG 4IF2A 3RITA 5F2GA 5LZLA 3M5XA 3H2AA 4N6FA 5CLTA 5EU9A 1JQVA 4FSAA 3LSBA 1RHCA 1LG1A 5CJNA 3WENA 1KWGA 4PCPA 4AZBA 4GKLA 1VJSA 3BAJA 4E4FA 1E5JA 5BRPA 4ZQNA 1WUFA 1GGOA 1VPQA 5HMDA 1GKRA 2CZVA 4GYPC 4JTSA 3WK0A 3UR2A 1NP0A 2GSEA 4A8IA 4HU8A 2A3CA 3K8KA 4FAMA 1XLFA 3M5YA 1DOSA 3G2GA 4GY7A 3SCSA 4TR9A 5REQA 2AKZA 1E0TA 1OIFA 2PDYA 2I1OA 1S5MA 3IACA 1V03A 1XC6A 3DKLA 2VCBA 4FLSA 4X9YA 3H24A 4MY9A 4MB4A 1L8PA 1KO0A 1FWCC 2P88A 4QG9A 3W84A 3GIPA 3QOMA 3ABSA 1C93A 1FCQA 4AEEA 2VX4A 1V02E 4IIHA 1B1YA 4QDWA 2ANUA 1VHCA 3KTSA 1T8XA 3UG3A 3KWXA 3R0DA 4FPSA 4HPHA 3WJWA 3AIWA 2XDFA 1EDGA 2HISA 5HWJA 2R91A 3CV6A 7REQB 3BO9A 3AIUA 5FOOA 2X2GA 3MVIA 1BWVA 4GYFA 4PMUA 5BROA 3TLLA 1EO5A 4YCPA 3UESA 4AC7C 4Y96A 4RZ5A 3DEQA 4LV9A 1LG2A 3VAVA 1KR1A 2XJ7A 1MEHA 5I00A 1EUAA 3MKCA 1QBAA 4L4LA 4L4MA 1SFJA 2QCDA 5AECA 2BY3A 1IWAA 1IEWA 2QAPA 5I03A 4ZO8A 2WZIA 1VBHA 1FWNA 3HB9A 3TCSA 4L6DA 5C7HA 3GW0A 4W7VA 3SCWA 3UWVA 6XIMA 1KRAC 3EZ4A 4RXFA 1ONEA 4W8BA 3TR9A 3WJZA 3RUBL 1FHVA 3DIPA 4BF5A 3FJNA 1BYDA 3POHA 4JS3A 1EC8A 3NO1A 3NVTA 1OK6A 3EPMA 1G4TA 1ZTVA 2XN1A 4DRSA 1W31A 5HPOA 4IQJA 3ZWTA 1EKOA 4JQ3A 2G3FA 3PBYA 2C13A 1IZCA 1J93A 3UQNA 1NEYA 1JGIA 1DWFM 3FNDA 2V30A 3S3GA 3H22A 1HT6A 3NPXA 5D32A 2NQJA 1U22A 2YGYA 5EMUA 4IGHA 3P3BA 7TIMA 2DZTA 1PPIA 1L2QA 3W2UA 3VKDA 4LUJA 2XIOA 5HJXA 1WKYA 4QJ4B 1TJPA 1XLBA 1PZ1A 2FPVA 3NR0A 3JRKA 3K4WA 4KWSA 3L4UA 1MUCA 2OG9A 1GVRA 3HM7A 4MKSA 1GTEA 1QMLA 2Z7GA 3VUPA 2EPOA 4PTWA 1QWKA 2QJIA 1F7BA 1F76A 4XZBA 1J9YA 3LV6A 3N73A 3QN3A 2J9ZA 3GU2A 1UCWA 3U7VA 1RLCL 1FWGC 1ADDA 3E0LA 3PN8A 3IIXA 2QEZA 1MQPA 2ZVRA 4OZOA 4K7YA 3TJIA 2YCLA 4C7FA 1FH8A 3CM4A 1SJAA 7TAAA 3BAIA 3LDVA 1EX1A 4DJED 5L9FA 5FAJA 5HWNA 3MV01 2A3AA 2AAAA 4NZ3A 4HYVA 4XAYA 4EWND 3EX2A 1YE6A 1P1MA 2V82A 3I3BA 2PLJA 4JKMA 1J0JA 1XLCA 3S42A 3FSUA 1PKNA 4Z0SA 2WYSA 1CYGA 5DX7A 2QNEA 4E4PA 2WAGA 5IXEA 4Z42C 4YHEA 2PGRA 5HMFA 2ZXQA 3S2LA 3WBEA 1JDEA 3N19B 3U2OA 1JPDX 4AZ5A 2CEQA 2ZRWA 2QZRA 3WH5A 5M03A 3HQNA 2GGHA 4UR8A 1GHRA 4JFSA 2NV2A 3IARA 3LRLA 2UBPC 3KM8A 1DJZA 4K36A 3UZ5A 1KXTA 2Y85A 3NJ3A 3P93A 1KNWA 3L0KA 4K8EA 1RA0A 4WY0B 2J74A 3OO2A 2PDWA 4DWDA 2E1WA 5IFPA 3W7GA 3MC5A 5E6ZA 2YCIX 4IIDA 3WEOA 4XTDA 3Q4DA 1FRBA 3W1RA 2OO0A 1E70M 1KBJA 5LYRA 4Q8VA 1RLDA 2DP3A 4S3FA 3ANYA 2XSXA 4K8HA 1FKWA 3V75A 1QOPA 3LG3A 3R43A 4GRSA 3QV7A 1TPH1 1UBPC 3U5UA 3TZFA 3B05A 1PCKA 1I1WA 2HDJA 3ZLGA 1RZMA 4ADTA 3ARYA 4DZHA 1AA1B 3AZSA 3G1HA 1XS2A 1B2YA 1LT8A 5HOSA 3D47A 2IPFA 1F9CA 1XQKA 1HVXA 2PDXA 1N82A 2TPSA 2ZUMA 4O4VA 2H9AA 1UP0A 4IX2A 3K5XA 3URBA 4IMDA 2A7PA 4ZE5A 3KBJA 3CXOA 3N04A 1X6UA 1VYPX 1PL9A 1EXBA 1DJQA 4TVCA 3HQOA 3GH7A 3EKLA 3WF0A 1R30A 1VFFA 3G1YA 3ABZA 4GZEA 2JE8A 4NZJA 1M1BA 1XSKA 3GNRA 2GGEA 1Q6LA 4F2UA 1QOXA 1A50A 2QDDA 3S9IA 4TUFA 1JD9A 2QJMA 1HQTA 1SZRA 4O1AA 2BG5A 3T2QA 3CTTA 4AIUA 1XLIA 4MB3A 1OY0A 2VWSA 1NFBA 3HG5A 4DELA 1LUCB 3TEVA 3C6CA 3AZTA 4UTUA 1AUSL 3GUGA 5FAGA 5DEZA 2C14A 3GAYA 3PTDA 2J27A 3LBMA 1D9EA 1Q6RA 3WFLA 1W5NA 4OWGA 4G7EA 3BSHA 1YADA 3FFSA 4MHBA 1TX0A 1QHPA 2NXIA 3F2DA 2QW5A 3V0SA 3DHPA 2A3EA 1PHWA 3TOYA 1TQJA 2F84A 1P0DA 2B81A 3PAJA 2Y7DA 2XM2A 5D8ZA 3NQ6A 3DI0A 4RW3A 1VS1A 3FVDA 3HJEA 2BWGA 2OEKA 1C7TA 2DPEA 5G4WA 1U5HA 1BXNA 1EGVA 3U2ZA 1MXSA 4RXGA 3WLOA 3PTKA 4DO7A 1VIWA 2BOEX 3KZSA 3NQMA 5F4SA 1AD4A 2E0PA 5HUOA 4EE9A 4QRNA 4JN7A 2HV5A 5F4XA 4EWJA 1OD8A 1W5PA 4GI4A 4JQAA 3GE7A 2FZBA 3MW7A 4FK9A 4MG4A 1AH4A 1OSEA 4Y9MA 1EC7A 4B5XA 4AY8A 3G5EA 1TZ7A 1TMLA 4XSMA 1MZHA 1ZJBA 3O1NA 1RCOB 1MW0A 1H60A 3KL5A 1AL8A 3RLVA 2ZQ0A 1K8CA 1K8XA 2BNJA 2CLMA 3M0ZA 3WBWA 1B4KA 3BOLA 3GH4A 1YIXA 2QDGA 3W1AA 3B8IA 3CL6A 2HS8A 2YFNA 2Z2AA 1BYCA 1CECA 1FHUA 1TO3A 3BLEA 3Q2DA 5A5WA 4ROPA 5D9MA 3BW4A 1UUOA 3U4AA 1XGDA 3KVKA 4JPGA 2O0TA 4M7TA 1P7TB 4HOZA 1OGBA 4G56A 3VO0A 4FNSA 2EXOA 4O13A 3TNOA 2OELA 3NA8A 3S9ZA 1OK4A 2E28A 4EXBA 1GJPA 2D69A 3PWAA 1R8LA 1GVYA 5BXTA 2CLKA 2HS6A 2BODX 4ZMGA 5HQMA 3N12A 3OVGA 3KDOA 4C6CA 4JHMA 1P48A 1RBLA 1DJWA 3GY1A 1RR2A 1JL8A 2HXTA 4AY1A 3IIVA 2QAFA 3H7VA 2P5NA 4L1WA 1NDWA 5BOEA 2ZDRA 5AVNA 3RPMA 1DPMA 2OX1A 4N2YA 3PZMA 1CENA 4ONVA 3WD1A 1JCMP 3WK1A 3SGGA 1X96A 4WXYA 4O16A 1EFZA 3MMTA 3QZ6A 2F9RA 3WLRA 3HMCA 2C8NA 2PZ0A 3NEHA 3PFMA 1F6KA 4JTTA 4D6CA 3ATYA 3IRDA 5EPDA 1S2AA 4JIRA 3VKKA 2PDHA 3W6YA 3W88A 3C8NA 4MKVA 2X09A 4XIAA 3VE9A 5A6LA 3QW4B 1MW1A 3UP8A 1YMYA 1ZQ5A 4QNWA 2R9RA 2NQHA 2GDVA 5LIYX 4PMYA 2WMFA 3MS8A 3UERA 1QJWA 1QHOA 3IANA 4GWEA 1FY6A 2E7FA 3EAUA 3NFUA 4D71A 4PFHA 3W29A 2X30A 3BW3A 1B3ZA 1VENA 1E56A 3BOXA 3NDYA 1X1NA 5DLCA 3DUGA 4YVVA 2Z7KA 1MDLA 1UJPA 4NJKA 3H6OA 4E3TA 2ZZ6A 3PK7A 3NZGA 2VC7A 1KXHA 3WMSA 3LEPA 3VDAA 3BAXA 4XVEA 3W1MA 5A6BA 4N9BA 2AKMA 3QY8A 3AMKA 2ICSA 3BLDA 3LHYA 3FYYA 3LGDA 1ZJIA 5JBFA 3OQEA 1KFWA 2PTZA 5D9NA 1UMYA 3PSWA 3L23A 2VNCA 2I56A 3G1FA 1GOKA 2E9LA 1WBJA 4M0XA 1M53A 3IRSA 1JZ5A 3B8WA 3GFXA 3AO0A 5A1AA 3W07A 3SCRA 2BBFA 4D9PA 1ML1A 2OLAA 2I16A 3W6LA 1ITQA 4N02A 3BARA 2P3EA 2ABAA 2X1IA 4CLMA 1FTXA 4M8UA 1SFLA 1W8SA 2Z0IA 3CYVA 3V35A 1FH7A 1VZWA 1M41A 5A69A 3RR4A 4QXIA 2V2DA 2WNZA 4YJ5A 1Q2RA 4IJCA 4M5PA 3LI1A 3L4WA 5GNZA 4J3ZA 3G0XA 4UOQA 1HP4A 4AIEA 3BQ6A 2YPIA 4AWEA 1BKSA 2CPUA 4XAPA 4QS6A 3ONCA 1NDYA 1VD6A 1NDZA 3ZSSA 4QEHA 3IJIA 1R3YA 4ECLA 3KVLA 1FWIC 1PZ0A 2EPNA 3UG5A 1DJXA 4F3HA 1OVDA 4XK2A 1LQ0A 3GRIA 1DHKA 5AHIA 5E1QA 2VOMA 4QCEA 4RE4A 1PJ9A 2Q02A 4IFKA 3NIYA 3CUXA 1U1JA 3A5VA 3U8GA 5AYXA 4HZMA 1LZOA 2DVXA 3VTRA 4IPLA 2PU1A 4GHRA 2G3IA 2H3BA 4AH7A 5ABTA 1VB9A 5IDIA 3NTYA 2NVDA 3C4UA 2ISDA 3TNBA 3K8LA 3UPMA 4H4IA 4J4KA 3E0WA 2J77A 1Q6EA 4UTFA 4KERA 1SU5A 3YPIA 3M0YA 3QJAA 3BJSA 2G8ZA 4HOXA 3PZOA 3OGVA 4HNLA 3EX6A 4JKLA 5HBFA 3UT0A 1TV2A 4L6HA 7REQA 3EOUA 1NWRA 1P1XA 3F4NA 4LALA 4E8GA 4ACYA 1AH0A 1N8WA 3QYQA 4B5SA 2X05A 4TX9A 4DJDD 3WLIA 4AG0A 4IMFA