4PMXA

Crystal structure of gh10 endo-b-1,4-xylanase (xynb) from xanthomonas axonopodis pv citri in the native form
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
306
structure length
306
Chain Sequence
AAPLAATASKFLGCAYGAQQAPGFAQYWNKLTPENGGKWGSVEAVRDQMDWSTLDAAYRFAQANQMPFQMHVMVWGNQQPEWIKTLRPAEQRREIEQWFAAVAQRYPDIALLEVVNEPLNDPPSKADTGGGNYLQALGGNGDSGWEWVLQSFRLARRHFPHTKLMINDYSITSSAQATQKYLQIVRLLQRENLVDAIGVQEHAFETTPEVAVSVHRDNLDALAATGLPIYITEFDLDGPTDAQQLADYKRVFPVFWEHPAVHGITLWGFRPGLWRDKEAAYLIRADGTERPALTWLRDYVAAHPGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms associated with xylan degradation by xanthomonas plant pathogens.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Hydrolase
molecule keywords Xylanase
total genus 124
structure length 306
sequence length 306
ec nomenclature
pdb deposition date 2014-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmxA00
5IHRA 2D22A 2D0FA 3MMUA 4S3JA 3W82A 2PWEA 3A4XA 2WWDA 1BGAA 4V27A 1WZMA 1NOUA 4MJ2A 2ESCA 2IXUA 1K9DA 4U31A 1H49A 4J3WA 4HZ6A 3GDBA 5ABFA 3AHTA 1DEDA 4W93A 3K4AA 3TTQA 1L0PA 1KXHA 5KEZA 2W92A 3AIRA 1HNYA 1LG2A 3KE0A 1W3KA 1J9YA 4MTVA 3TTYA 2E8YA 5E6ZA 1TMQA 1LL4A 4PCSA 1J0IA 3EMZA 3DHUA 3GXFA 3WNMA 5LA2A 3AMCA 4Q22A 3K1DA 4AIOA 1VJSA 2CITA 3PZNA 3BCFA 1D3CA 3WMSA 3WH6A 2JEPA 3M7SA 1NWTA 1UD4A 2YIHA 2WMJA 1WP6A 1CXEA 4PBGA 1HX0A 2V3DA 1B3WA 4D6DA 1XD1A 4AD5A 2YOCA 1KWKA 1W3LA 1QNQA 5JBEA 3QR3A 3PZVA 4PMZA 1R8LA 4Q7NA 3SUSA 4B3LA 5I78A 1DWHM 4QAWA 2WNWA 1E43A 4PMUA 4CD8A 2O9TA 3FN9A 5TD4A 4ZENA 3WH5A 5IXEA 4KWUA 1KXTA 2PWFA 1ODUA 3SCOA 1R7AA 2EBNA 1V3KA 2WSKA 4YPJA 4C7FA 1VBRA 1LF1A 1W1PA 1ZB5A 5I3DA 3AMKA 3A4AA 4AD1A 2YL6A 2ZUWA 2C8NA 2GUYA 2CBUA 4FF5A 3CHEA 1JF6A 1J10A 1E73M 4PUDA 3DHPA 3BAYA 1FHDA 3W81A 1R87A 2V5CA 3MANA 2JIWA 2V5DA 1CYGA 4IPLA 2XIIA 3GNRA 2GDUA 2WWCA 4Z2KA 3ZSSA 2FHFA 1W3JA 2C0HA 3W0KA 1KGXA 1VIWA 4MNLA 5D9PA 3L4YA 1E56A 4HA1A 4D6HA 3KL5A 4ZXOA 2J8GA 1UKTA 4XX6A 3WQ4A 1UWTA 4U2ZA 3OLGA 1TA3A 1J0KA 3HJEA 3RJXA 1GQIA 3BGAA 5C71A 5M17A 4M80A 1VEPA 2EPKX 1JIBA 3ZOAA 2XPKA 2BY3A 5I77A 3VMNA 2ZIDA 2ZWZA 4D6IA 3GH4A 5JBDA 3L2MA 2WBKA 4JFWA 5EBAA 2V3FA 3AXIA 2J78A 3VX0A 7TAAA 4NF7A 3UR7A 3WQ6A 1F4AA 3BSHA 5CZKA 2CERA 3NDZA 4GI8A 3K8MA 3QGVA 1N82A 1B0IA 2OLHA 1ODZA 4XZBA 2OSYA 1GOKA 3K46A 1J0HA 2D24A 2YBTA 3GZAA 1CTNA 4TXEA 3ZR5A 1TZ7A 2X05A 3AIVA 3NCOA 1UUQA 3ZJ6A 2DIJA 3ZQ9A 3N15A 4E8CA 5A69A 1NH6A 3AMLA 4V28A 5E70A 5A8MA 4PTWA 4H7VA 5A2CA 1UWUA 1E55A 1C92A 3IJ8A 1SR0A 3BXWA 3CHDA 4PUEA 1UD3A 3MS8A 5LA1A 2GDVA 5HPOA 2VT0A 3KWXA 1DHKA 4P8UA 2VRKA 2ZX6A 1V0NA 2G41A 1EHNA 4AD3A 1QNRA 5ABEA 1YQ2A 4PMVA 1BYAA 3T2QA 7A3HA 2DPEA 4WK9A 4XUYA 3POCA 3WNPA 4B16A 3VX1A 4MNJA 3CUFA 2WMGA 5CPTA 3AS0A 4DM2A 1E6QM 3K8LA 3PZIA 2V3GA 1E6XM 1R7OA 3TTSA 3AMGA 4HOWA 3WUGA 1V02E 3WMCA 2YJQA 4FK9A 1HL9A 2BV9A 3CUHA 4FLRA 4H8VA 4V2XA 1XCXA 1M7XA 3TA9A 2G3MA 4X9YA 4H8HA 1W9DM 1U33A 3O2LA 3M46A 3T0BA 1CXHA 4IISA 2YDQA 2JEQA 2DEPA 1FA2A 4LPCA 3W29A 3WKZA 4EANA 1KBBA 3VNZA 3ALGA 4BQ4A 2Z1SA 1Q6EA 1BVZA 4OOZA 3CUJA 2JIEA 3K8KA 3VGGA 3WNLA 3MMWA 1ZBVA 4Z2GA 2ZXBA 3THCA 1XRVA 4JL1A 1EH9A 2PWHA 4P7LA 1UWRA 4P8WA 5D9MA 4EAMA 3WUBA 2V38A 2BHZA 1CPUA 1X6NA 1G94A 3B8SA 1CEOA 4YHEA 2XGBA 4CCEA 3L4UA 5A3HA 5BXPA 5D9NA 2DSVA 3D5HA 5A6SA 1CXKA 3O9NA 4UZSA 5IFPA 4OUEA 1GCYA 4WIWA 2BHUA 5M5DA 4FLOA 3CIVA 1UWSA 4AZGA 3OZPA 3WFLA 3APGA 4R5EA 1E4LA 4PEEA 2ZUSA 1AQMA 1UWQA 4L4OA 4KH2A 2C7FA 1JL8A 1MW0A 2WW5A 5BXRA 3OGVA 1MQPA 2OSWA 2RGMA 1GJWA 3L4ZA 3VIHA 1KGWA 3EBVA 3N17A 2VZTA 4F79A 1NWSA 1M53A 1E15A 3M07A 2JE8A 3A47A 4CD7A 2NT1A 4TX6A 2DSKA 4MAZA 4UOQA 4S3KA 7CGTA 3DYPA 3B9DA 2CHOA 4AEFA 2BVTA 1DP0A 5D9OA 2J74A 1BAGA 1UR0A 4PTXA 3SCPA 4DUVA 3PZOA 1GORA 1BYBA 1ZS2A 1VRXA 3WEZA 1G1YA 3A3HA 3VMPA 4PSRA 1FFRA 4EE9A 5KZ6A 2BY1A 1UR2A 3MUZ1 3AYSA 2WSPA 1C93A 5JBFA 4ACZA 4D72A 5DEZA 1GVYA 2E4TA 2JF6A 4JCMA 4IM4A 2CBJA 2BS9A 4YHGA 1UA7A 2CKSA 4JFSA 4L4PA 1MWOA 3TTOA 4M8UA 1P6WA 1QNOA 2FGZA 3K4DA 1B3YA 2W5FA 1PX4A 2DQXA 4OBSA 3VIPA 1ECEA 4UZUA 1WO2A 4FLSA 3RM9A 5DFAA 4BCEA 2ZXDA 1EDTA 2EQDA 5GQBA 1W1VA 4HA4A 4GKLA 5I79A 3AROA 4B9ZA 4ACYA 3CMJA 4M29A 2WZHA 3AYRA 2DSUA 1MFVA 3CHFA 1BF2A 3AI0A 1GHRA 5GNXA 4GQQA 1W91A 3SCRA 2XSAA 5A8PA 3CGTA 3ZJ8A 5GNYA 4ATDA 3RPMA 3CZGA 2J47A 1E9LA 1OB0A 5CGTA 4GO9A 1KXVA 1S46A 4GZIA 2J77A 4PCTA 1W32A 5JIPA 3OIHA 2BY0A 2VZUA 5HXMA 3GH5A 4QLLA 1E0XA 2D23A 5HDRA 3PTMA 1B1YA 3MU7A 1TCMA 4RE3A 5CPQA 1R86A 1NWRA 4X0VA 4UFJA 1VFMA 3RM4A 4JZ5A 1HT6A 2CETA 3VM7A 1FOBA 4UFLA 4UTFA 4MB4A 1RD6A 3W6MA 3N9KA 1EHAA 5CLWA 1TG7A 1QI3A 2VRJA 3HN3A 4PMQA 1QHZA 4W5ZA 1M04A 3WDIA 2G3NA 1OT1A 2VOTA 4DWSA 1Z32X 4Z2JA 1HJQA 1HP5A 1JXKA 1G01A 1NP0A 2E3ZA 1UQZA 5A6BD 2WZIA 1EDGA 4BQ5A 1KFWA 1EXPA 3F5JA 3LMYA 3VDBA 4M82A 5C8BB 1ISVA 2PBGA 1EA9C 1KXQA 1E70M 1MXDA 2IUZA 1RP8A 1MYRA 1M03A 2DDXA 1YHTA 4P7RA 5FKYA 2WMHA 3SUVA 1UR8A 2W63A 1J01A 1H5VA 3WELA 2OWWA 2NSXA 3VIGA 2YL9A 1V3HA 3IJ9A 2FH6A 3RIKA 1CXFA 1BG4A 4BS0A 1X1NA 1A47A 1Q6CA 3OGSA 4E2OA 2AOSA 5AYBA 4QFUA 1W1YA 3FHAA 4CN4A 2Y8KA 1K9TA 3TP4A 4PMDA 1VFUA 1PZ2A 3RM8A 1VBUA 4UFKA 2D3LA 1JGIA 4WLCA 4HA3A 3BAXA 1JFXA 4PRWA 3CUGA 1HL8A 4QP0A 4HPGA 4D1IA 1H3GA 2J7EA 1DWIM 1HKIA 1XSKA 1VENA 3VIIA 1UR1A 4UR9A 3SCVA 1C91A 2GFTA 3W26A 3CUIA 4CU7A 3RO8A 4LX4A 1AQ0A 1JF5A 3VINA 2BHYA 1ESWA 8CGTA 1W2PA 1BQCA 3AJ7A 4XZWA 5GPRA 1XCWA 1QI5A 3WH9A 1PPIA 4MAVA 3WN6A 2Y8VA 4UQDA 4D6JA 3VIKA 4LQ1A 2XM2A 3SEPA 4CGTA 1JNEA 1J11A 1JYNA 4CCCA 3BMVA 4JFVA 3WBAA 1Y7VA 1KR0A 3VDAA 4JHOA 3BAKA 1GW1A 1HJUA 3HU7A 1J0YA 5DF0A 5A6AA 2D1ZA 3OA5A 1DWGM 4JAWA 1HJWA 3BH4A 4LYQA 2YKKA 2BXZA 1WAWA 3VD5A 1JZ8A 1DWAM 1XSJA 1GVIA 1ZJAA 4URIA 3MO4A 4DWSC 1EOMA 2UY2A 1NWUA 4R27A 3VILA 4KGJA 2QMKA 1K6AA 3AS2A 3MUY1 3F4VA 4D71A 2VUYA 2FHCA 4WKFA 3LPPA 1E3XA 1KQZA 1UR9A 1GOQA 1CGXA 2XVPA 1MQRA 3UG3A 1WPCA 3ZT6A 2XVGA 2CCRA 2X0YA 2QPSA 4P7QA 4E8DA 2VCCA 3AZTA 3AXHA 4M81A 3AISA 3NIYA 4CCDA 3J7HA 1DWJM 2EPOA 4ACZB 1E3ZA 1PX8A 3ALFA 1UKPA 3JUGA 5HNNA 5BXTA 4MNMA 4TTGA 1QW8A 1OM0A 1C3FA 1O6IA 2VI0A 3GBDA 4P7OA 3VUPA 3VGBA 1UH4A 1E5JA 1QHOA 1ZBWA 5EB8A 3AMDA 3G6LA 1E6ZA 3NSNA 1V6XA 2OWCA 5E0FA 3ARUA 1GOMA 4TOQA 4UCFA 4PYSA 4D6FA 4HPHA 1J12A 1GNXA 4GXPA 2EPLX 4GI9A 3SCTA 1WNOA 1JAEA 2WPGA 3AZRA 1PZ3A 1XYFA 1ITCA 1B3ZA 2VMFA 3SCUA 2TAAA 3ARQA 1EGZA 2ZE0A 1KCKA 1QNPA 2A3AA 4W7UA 2VX6A 1I1XA 3CTTA 3MKKA 3WD1A 4ATWA 1C8XA 3ARWA 3I3DA 1U2YA 4BF7A 5GNZA 2AMGA 1GQJA 2ZUTA 2WCGA 1O7AA 4AC1X 1LL6A 4GINA 4CN6A 2Y2WA 2E0PA 4LXFA 4AZ5A 3W37A 2B31A 2BFGA 1E4IA 3WQVA 5DT7A 3GNOA 4AZHA 1QOXA 3W27A 5D8ZA 3ZIZA 1GOOA 1WDSA 2QV4A 2UY5A 3GBEA 3POHA 3QOKA 2Y24A 2ZX5A 2J7CA 4ZEPA 3AIWA 3U5UA 1OBAA 2WHKA 4GQRA 4WJXA 2HISA 4W84A 1VAHA 1JZ4A 1J18A 1ITXA 5DMYA 3ZT5A 1EO5A 2O92A 1H11A 1SMAA 1SYTA 1UKQA 1V0LA 5ABGA 2O9OA 1UKSA 3N1AA 2WVVB 4H2CA 1D2KA 1H41A 1FFQA 1HKMA 4JKLA 2XYLA 5CG0A 3VIMA 3WEOA 2WAGA 2WHLA 2DT2A 1OD8A 3WQ5A 3MUAA 1OD0A 1RP9A 5FCZA 1B31A 1PEZA 1C8YA 3AHZA 3VIOA 1V3MA 2VRQA 5FOOA 2PB1A 1QBBA 4P8VA 1CGWA 8A3HA 2XIBA 3VD9A 3SUUA 3MV01 2E9MA 2VVNA 3WD4A 1LLOA 1KR1A 2PWGA 1W9UA 4EK7A 3L4TA 1V08A 3GXMA 2XGIA 1H09A 3THDA 2Y4SA 4JCLA 4AIEA 3ZM8A 4F8XA 5HBFA 2YLAA 2GJXB 1G9HA 3WY1A 5A2BA 1UA3A 4MB3A 2J7GA 3DC0A 5AY7A 4LGXA 2DH3A 1LL7A 2W66A 2WLZA 1E4NA 3OGRA 4BA0A 4Z2HA 1ZBCA 5I23A 2VX7A 2CPUA 1VFFA 3ARSA 3WF0A 3OLDA 4J3SA 3WF1A 4BQ2A 1XV8A 4CVUA 1JYVA 3SIMA 2DSWA 2J7BA 1JZ5A 3CLWA 1JZ3A 2F61A 1Q4NX 2A3BA 1B3XA 1WZKA 2OYMA 3CZJA 1HKKA 3QOMA 3ZSTA 4CN1A 6TAAA 2G4FA 4HTYA 4MDPA 4DWSD 1V6UA 3WDHA 4XB3A 2PF0A 2J8FA 2D0HA 1GQKA 3T0DA 2VR5A 1EIBA 1UD8A 1WDPA 4D6EA 3PZTA 3ZMRA 5I0DA 4OKDA 2ZX7A 3N13A 1BTCA 3S6TA 1KGUA 4CKQA 2PWDA 3WNKA 4PMRA 4UQAA 1CGYA 3AIQA 1CXLA 4AMCA 5ABHA 3WQWA 1FP8A 1HJXA 3CPUA 4P8XA 4M56A 1WZLA 3A4WA 2FH8A 5AC5A 1QI4A 5CSYA 1ZU8A 1C8QA 2ZICA 1V3IA 1VB9A 3FAWA 2PI6A 3FHQA 4AD4A 4UOZA 2WXDM 3KZSA 2ZXAA 1AQHA 3II1A 1CLVA 1AMYA 3FY1A 4LYPA 4W7WA 3W25A 5DO8A 1KB3A 3UEQA 5BCAA 1LQ0A 4JFUA 1JZ7A 4IPNB 3KL3A 4B9YA 1CGVA 2E40A 1CZ1A 3CZKA 3AIUA 2EXOA 5A6KA 5CGMA 3NUKA 4TVDA 1FHLA 2WYSA 4NRRA 3I3BA 1CIUA 1UD6A 5F7UA 1ZBKA 1GONA 3GYCA 1QPKA 4FLQA 1ISWA 3ARTA 5ECUA 3AHYA 2EO7A 2W61A 4TUFA 3T09A 1B2YA 2G3IA 3BLKA 2UWFA 4JFTA 1GHSA 4J3XA 1CWYA 4JKMA 2O9PA 3RDKA 3BCDA 5A2AA 1TA3B 2XUCA 1UH3A 2YA2A 4GO8A 4W7VA 4HU8A 2PBOA 4Z2LA 2WZEA 2WANA 5M3WA 5A6JA 4CU6A 4IUGA 4HZ7A 1C7TA 3D3AA 4P7NA 5CSUA 4UQCA 1JD7A 2Z1KA 4UOJA 2VZSA 5BXSA 1J0ZA 4WKHA 2XWDA 3L4WA 3RCNA 3VDCA 1CNVA 4MJ4A 3VMOA 2CBIA 2VQTA 2YA0A 4GIAA 4BQ3A 1JNDA 2DT3A 5A8OA 3U57A 3VGDA 1ISYA 1JDAA 1JI2A 3EDKA 2X1IA 1E1EA 4AXNA 3OLIA 4CUCA 3AS1A 3PZUA 1H2JA 3TOPA 3QHMA 2EEXA 3LPOA 5E09A 4TTUA 2OYKA 1OWQA 2WB5A 3SCNA 4F9DA 3TONA 2AAAA 5D8WA 1FH9A 3AS3A 1H1NA 1QW9A 4PTVA 5IDIA 4TVCA 1HIZA 3W28A 3G6MA 5LA0A 4AWEA 3WDQA 1XH1A 4HOXA 3T2OA 1H4PA 3WF2A 3AIEA 3VPLA 1H0IA 3NJ3A 1D7FA 5IFTA 2CEQA 3W38A 1VFOA 2DT1A 3BLPX 1US3A 1HF6A 3KEHA 2GK1A 4W8AA 4H8UA 1U30A 3VD7A 3UERA 1OIMA 3BAIA 5FD0A 2J4GA 5A6MA 1OIFA 2DSZA 3WEMA 4NRSA 5JIWA 1PIFA 1WB0A 5HOSA 3NSXA 4U5IA 4ZE5A 3AHVA 1XHGA 3WL0A 3ARZA 3CZ8A 4JL2A 4W5UA 1JAKA 3GM8A 5DT5A 4OOUA 1V6VA 4M24A 3RMEA 4RL3A 1UYQA 5CLTA 3WIJA 3WD0A 3WMBA 3WDPP 3CMGA 2WK2A 4OZOA 1V0MA 2CXGA 2O9RA 1JZ2A 4A3YA 3WF4A 3LPGA 4D6CA 3WD2A 3VGFA 4H04A 3BMWA 1GOWA 4DUWA 3UR8A 1VEOA 4PN2A 1VJZA 2Y5EA 1VEMA 1B3VA 4D1JA 1HXJA 4J3TA 1I1WA 1BVNP 3VU2A 2J75A 2BXYA 2VC9A 2E9BA 3WQ8A 4AD0A 2XHYA 3PTKA 1UOKA 1HN1A 1ISZA 6CGTA 1SFSA 4D6GA 3UESA 3MSGA 3SCQA 3QHNA 1PAMA 1JXJA 4GPNA 3VNYA 1UG6A 2ZOXA 1MW3A 4HZ8A 4J27A 3PZMA 3FW6A 4PMOA 4N42A 3BC9A 3OLEA 3U7VA 4YN5A 1GQLA 3CBWA 4AZCB 4MB5A 2J7HA 5E6YA 3WUFA 1WDRA 2EJ1A 4W89A 3IANA 2FGLA 2ZWYA 3B9EA 3EMCA 3N18A 5JUVA 2CBVA 2WMKA 3F5KA 3PZ9A 2EPNA 2WCSA 3MMDA 2F2HA 1F4HA 1OGBA 2VJXA 1WCGA 2VX4A 2WVSA 1B90A 5EMYA 3PN8A 5BROA 1LJYA 3IK2A 3AQUA 1PJ9A 4GZEA 2CKRA 2JALA 1E40A 2ZXQA 1W2VA 1MW1A 5FIPA 4W8BA 4AZIA 3A6OA 4Y7EA 4QCEA 3VM5A 1TVNA 3ARPA 1IV8A 1CECA 1V0KA 1XH0A 4FMVA 1HJSA 3W6LA 2WMIB 2IXVA 3L4XA 3N11A 4H41A 1BPLB 1DWFM 4AEEA 3VO0A 5IHSA 1UHVA 2ZX9A 2Q8XA 4W87A 2D0GA 3WDJA 2ZUUA 5FL1A 1W9PA 2YDRA 4AZBA 2WKLA 3IAPA 2X8RA 3OG2A 4J3UA 3AXXA 2WCAA 1GJUA 2FHBA 3SUWA 1NP2A 1LWJA 4HU0A 4BZYA 4W88A 5A94A 3IJ7A 1UR4A 4X0NA 4KRTA 1CGTA 3WFZA 3ZJKA 1E6SM 2OWXA 1MQQA 4MDOA 4W8LA 2JFEX 2V3EA 3EMQA 1H0GA 3UETA 3WH8A 2XFYA 4NSBA 1VF8A 1UZ1A 2CHNA 9CGTA 4DWSB 1ZL1A 4B3KA 1E6PA 2JF7A 1AVAA 2WMFA 4AIUA 1UH2A 3KL0A 2J79A 5LYRA 2A3EA 6A3HA 1C90A 1K9FA 1R85A 4JHZA 4W85A 3OBAA 5D4YA 1QI0A 1DTUA 1W9BM 1JDCA 2VZVA 4UFHA 1NOWA 3BSGA 4RE4A 1C7SA 2XVNA 2XFRA 1CENA 4F9JA 4AYSA 3LPFA 2BY2A 3ECQA 1V02A 1LWHA 3MSDA 1KQYA 4AZ6A 1W3HA 1LG1A 3UG5A 3WBEA 1KBKA 3EDEA 4C7GA 1ISXA 1NM9A 2GSJA 3U5YA 5BWFA 2W4XA 4GZJA 1UD2A 3T08A 1W9VA 4RE2A 1HVXA 4AZCA 3RILA 1JFHA 1QHPA 3CO4A 5AYIA 1MW2A 4OBRA 4QLJA 1G5AA 4HMCA 2ZUMA 1OCQA 1E6RA 3L2LA 2YA1A 1GZJA 1B9ZA 2WC3A 1JI1A 1QNSA 2VX5A 4OIFA 1V6YA 2OSXA 4CD6A 2WHJA 2GJPA 4AD2A 3WDRA 4WKAA 3AHXA 2F8QA 3PHAA 2XM1A 3WL1A 2HVMA 1TFVA 1JDDA 1B30A 3QHOA 3EYPA 3S2CA 4PSPA 4U2YA 2QHAA 3VIFA 3DECA 1E0VA 4U33A 2J7DA 1E0WA 3FNDA 4OJYA 2X09A 3HMCA 1BG9A 1IZKA 3T0AA 1PIGA 4WSJA 1QI2A 2RGLA 1EQCA 2YL8A 2A3CA 2GK1B 1FP9A 3VDHA 3ZJ7A 1NARA 4ZE4A 4QLKA 1I75A 3GNPA 4JKKA 1RPKA 1CLXA 3WNOA 3MUIA 5A8NA 3ARYA 3DYOA 5M03A 1UD5A 4NI3A 2E9LA 3AZSA 1EDQA 3VTRA 5A95A 3PBGA 3FAXA 1OGSA 3ARVA 1UZ4A 3F5LA 4CD5A 3CZEA 2DIEA 2FDMA 5I24A 1M01A 1Q6GA 3FXYA 1X6LA 2G8ZA 2WBGA 2QF8A 2CNCA 1NOFA 2VNCA 2DH2A 2GJRA 2W67A 4ZFMA 3ARRA 2OYLA 1K9EA 2WC4A 3O6AA 5E9AA 2D3NA 5A6BA 2X0HA 1QBAA 3ZR6A 2VTFA 4NZCA 3PZGA 3SUTA 2VZOA 4UFMA 2WKGA 3CH9A 1W1TA 2XWEA 3ZO9A 4KGLA 3AFBA 4J3VA 1UWIA 2X2YA 2NW0A 2VCBA 2QPUA 1E4MM 2XVLA 3EDDA 5A6LA 2BVYA 2WC7A 3VD4A 1TUXA 1JG9A 5I6SA 4UQEA 4C7DA 2A3HA 1WDQA 2DGAA 1HVQA 3AICA 3E1F1 4UNIA 5CPSA 3MV11 2WVTA 4DUXA 3WD3A 2EPMX 4F66A 3I3EA 3U7BA 1PBGA 2J7FA 3B9AA 1XGZA 4U3CA 1BFNA 4MPKA 2WVVA 1HJVA 4W86A 1XH2A 1Q6DA 3AOFA 1E5NA 1E71M 2UY3A 2WVUA 3CZLA 3GXDA 2YBUA 3OZOA 4MNKA 2XJ7A 2CYGA 2VO5A 3SURA 1XYZA 3ARXA 4QCFA 3N12A 1JD9A 4LYRA 3VKKA 3WF3A 4KMQA 1WE5A 5HPCA 5ABFB 5I2UA 1US2A 4ML4A 4ATLA 5A8QA 3VOCA 3W53A 1XC6A 2BVDA 4QDMA 1G0CA 2VQUA 4A3HA 2D20A 4U5KA 1OSEA 2VURA 3SCWA 3VIJA 5FL0A 1PX3A 1GPFA 4J7RA 3NSMA 2J25A 1EOKA 1J0JA 1EQPA 2UY4A 2WMIA 3N04A 1GUVA 1CGUA 3EDFA 2W91A 3IAQA 2YLLA 5CJ5A 4HMDA 3DYMA 4K68A 4UQBA 1E6NA 1V3LA 4E4PA 1V3JA 4M1RA 4UFIA 5EFDA 5I5RA 2VR4A 4Z2IA 4CU8A 5BYWA 1CBGA 3UG4A 3VGEA 2WLYA 3WENA 4AW7A 2PC8A 3W4RA 1W9XA 1MVYA 2VCAA 4HMEA 4PMNA 4PMXA 4XV0A 1OT2A 2VL4A 1OINA 1BLIA 1EO7A 2W62A 2QLYA 2XTKA 4N0RA 2J62A 2MANA 2WM0A 2ZX8A 3VGHA 1BGGA 3CHCA 3WUEA 4AZ7A 3OB8A 1BYCA 1HP4A 1L8NA 3BAJA 5CXPA 2CESA 3WSUA 1SMDA 1Q6FA 2D2OA 1KWGA 2NT0A 1TR1A 3T2PA 1OGGA 5CQ1A 2WHMA 3EDJA 1JZ6A 2GVYA 1ZJBA 2ZUVA 3VD3A 1UQYA 3RJYA 2XFFA 4JIEA 2YDSA 1KCLA 5E0CA 4A4AA 2YL5A 3PTQA 1BYDA 5BRQA 1V6WA 1BHGA 1V03A 5BRPA 4HOZA 1BSIA 4AISA 3PZQA 1GOIA 1JYXA 3AIBA 1XD0A 3SCSA 2G3JA 5C70A 1MFUA 4PMYA 1FH7A 1NQ6A 4HP5A 4KRUA 1IZJA 2XVKA 1CXIA 1TE1A 4DM1A 1TVPA 3L4VA 3WH7A 3WNNA 4CVWA 3GH7A 1UKOA 1WKYA 3GTNA 4ZXLA 4AY1A 2GJXA 4U3AA 2VVSA 1A3HA 1CDGA 3M6DA 1FH8A 4CD4A 3W24A 1E1FA 1HKJA 2E8ZA 1IT0A 4EKJA 4B15A 3NDYA 4J28A 4MADA 1WZAA 4MB1A 2DT0A 2ZUNA 3VVGA 1MXGA 2QMJA 2XSBA 3GXIA 2XG9A 3BAWA 4UQ9A 3UCQA 1XSIA 4PTMA 4GI6A 5AC4A 5A1AA 3NYDA 1E72M 2CIPA 4WF7A 1RH9A 5EFFA 4TX8A 3ZT7A 2BNJA 4TVUA 1JYWA 4WSKA 1QVBA
chains in the Genus database with same CATH superfamily
4UTKA 2D22A 3PJTA 3A4XA 5U7SA 1V79A 1ZCCA 1OADA 4CEXC 5HJLA 1XGEA 4K1WA 2IXUA 4PGLA 1WV2A 4HZ6A 3K4AA 3PBVA 2OLSA 1F3XA 1HNYA 3N2MA 2VEIA 3EEZA 4KETA 3KE0A 3GZ3A 5E0KA 1J9YA 4PCSA 3U0HA 1J0IA 2QJNA 4DO6A 3TFCA 3DHUA 1Q6LA 3GXFA 3AMCA 4Q22A 3W01A 1VJSA 3PZNA 3WH6A 4XBSA 2BOFX 2JEPA 1NWTA 3BPWA 2ZRYA 1QCWA 3P67A 4PBGA 2ISSA 1HX0A 1RA5A 3T8LA 1B3WA 4HKPA 3KDOA 1KWKA 1EC8A 2HWGA 5JBEA 4PMZA 1GVRA 4MYXA 4JTRA 3N6QA 1V7YA 1OFQA 3QQ1A 4WY0F 3D0CA 3CV7A 3UFYA 1QK2A 1Q6RA 4AC7C 4ZOBA 3GIYA 4KWUA 4ZB5A 1UP0A 2PWFA 5GJNA 4HNVA 1XIFA 4YPJA 1VBRA 1WXJA 5I3DA 3IRSA 2YL6A 3GY1A 2CW6A 3CWHA 1YE4A 4C6DA 3L0GA 4FF5A 3GVVA 1J10A 3GTXA 4X2RA 4O0ZA 3HGSA 1FHDA 3GS6A 3W81A 4FP1A 4JIRA 4M5PA 5EMLA 2CXEA 1R87A 3IJDA 4ZMGA 1AD4A 2I57A 3DBPA 4R7WA 1YDOA 1J2BA 3P7YA 4L1GA 2FHFA 1W3JA 1KGXA 4PB3A 3CWNA 1E56A 4HA1A 3OYXA 4X61A 4J35A 4AWTA 4DJDA 3KL5A 3BLLA 5F2MA 2FZNA 4Y9PA 3RJXA 2XGZA 4EX4A 4UTUA 1LT7A 4QHRA 1EJTC 2EPKX 4O1DA 3ZOAA 5I77A 2ADAA 2ZWZA 4D6IA 5EMKA 1EEPA 2GLKA 4W9TA 3BJFA 1ZP4A 4JFWA 4AG0A 2J78A 4KIRA 1CT5A 1EUAA 4JY8A 5G4HC 3BVJA 4KEMA 3M0KA 4L6DA 3LCHA 1B0IA 3FEQA 1ZY9A 2E09A 4XZBA 1F74A 2QGYA 4RDVA 1J0HA 3DU0A 3CQ0A 4Z0JA 1TZ9A 1CTNA 3ZR5A 3ABRA 3P62A 1XLCA 2J6XA 1BWLA 2I9EA 3AIVA 5G1TA 1Z42A 3N15A 1HKVA 4O17A 1SZFA 4PB4A 1RALA 3SW6A 4PTWA 4H7VA 5A2CA 4JQ1A 1C92A 3FS2A 3IJ8A 1X96A 1S2UA 1UD3A 2JKPA 3NXFA 3MS8A 5LA1A 4HQVA 2ACUA 1BWKA 1DHKA 1V0NA 5ABEA 4FXSA 3SGGA 4PMVA 4GQ0A 3T2QA 7A3HA 2DPEA 3NPWA 3WNPA 4B16A 1QPQA 2GZXA 2GJNA 4MNJA 3TYDA 4UTTC 3O05A 1U22A 2ZZ3A 4DM2A 3PZIA 1E6XM 4DF0A 3K5XA 4XSLA 3WUGA 3WMCA 6REQA 3IIZA 4Z17A 1OYAA 4Y8EA 4IFOA 5EMMA 4O28A 1S5TA 1GTEA 2ZCGA 1UC5A 3TC7A 2H3DA 3O2LA 3U48A 5FSEC 1MUMA 4TQTA 4N02A 3PTDA 1WBHA 1KBBA 1AK5A 3VNZA 4BQ4A 3L7RA 4IJBA 4PUWA 3QFWA 4ZCWA 3H53A 3M0YA 4BK9A 1ICSA 4Z2GA 3V0UA 4S3FA 1Q45A 1IT7A 4Q8UA 4L64A 3VZYA 4H00A 3GVRA 4JL1A 4ICMA 2FQIA 2X42A 4EAMA 4WJ8A 1DE5A 1CPUA 4YHEA 5CZ0A 2RDWA 4S2CA 1R46A 1XDJA 4J40A 3MKVA 5A3HA 5D9NA 3AUOA 3HPZA 1CXKA 3O9NA 5IFPA 3C2YA 1E9ZB 1GCYA 3CL7A 1TWZA 2Z1BA 3L68A 3EKLA 1XYAA 4EIVA 4AZGA 4DXKA 3OZPA 3WFLA 4R5EA 1IF2A 5CAHA 1AQMA 3FK4A 1F9CA 4L4OA 3RO6A 1MW0A 3TQ0A 1DIOA 2WW5A 3TA6A 5BXRA 3O7UA 5G1MA 2OSWA 3SO7A 2O4QA 2PU1A 3W70A 1EPXA 2ZVIA 3HB9A 2VZTA 3M07A 4W4QA 4CD7A 4QDWA 4TX6A 5BWAA 4IIFA 2TRSA 3DFTA 4S3KA 5D30A 2CHOA 2PDXA 4AEFA 2DZVA 4FR1A 4WSHA 1UR0A 2QPXA 4MFEA 3GFYA 4DUVA 2YFOA 3BLFA 3QTPA 1AZ1A 1HTIA 3W7KA 2YCIX 3NPVA 4P5UA 4NL1A 1VRXA 1VC4A 1G1YA 3WEZA 2R1NA 1UR2A 4CNTA 3VKAA 3CU2A 3NG3A 1UASA 9XIAA 2PZ0A 4PBFA 4IM4A 1D8WA 4YHGA 4ADSA 2PDBA 3W84A 2W5FA 3DFSA 5JU6A 3RXZA 1IYXA 1QWGA 5DFAA 4BCEA 1E1CB 2FZ8A 1SJDA 1EDTA 1TX2A 1O68A 3LUTA 2JKEA 1W1VA 4GKLA 3JRKA 4HYWA 2F9RA 5D32A 3CMJA 3WLTA 3RX4A 3PPFA 4XZLX 1TQJA 4IP4A 2IQDA 1UMLA 5GNXA 1W91A 3ZJ8A 3TW9A 4ATDA 2I14A 2NQHA 5CGTA 1KXVA 2FFCA 1S46A 4GZIA 2J77A 1K1DA 1KM4A 2YR1A 1W32A 2QUTA 1FKXA 3UJSA 4A6GA 4ZO6A 1P7TB 2PTDA 1HGYA 5AHNA 3JZEA 3UJFA 3D47A 1EF2A 3S9ZA 3IUDA 1DQWA 1B1YA 4L56A 5AHFA 3MKCA 4LBRA 1S2VA 2HS8A 2Y7EA 1BQGA 4ZTXA 4QE1A 4X0VA 1H7PA 2OX1A 4N4QA 1YBQA 3VM7A 1JRBA 4EVZA 1FOBA 4EWJA 2DW6A 4H6EA 4GX9A 3LCIA 4YL2A 3OEXA 2XDFA 4OE7A 4DI8A 1EHAA 1QI3A 2C91A 1N8FA 1YTDA 3VFLA 1Z32X 4Z2JA 1ENUA 1HJQA 3QQWA 1EGVA 1LCOA 2VKZG 4GBUA 1NP0A 4KCWA 3U2EA 1EDGA 4PFMA 3LMYA 3VDBA 4M82A 5C8BB 1G6CA 3GG1A 5D04C 2PBGA 4RE0A 3E5BA 1EA9C 3AXMA 1MXDA 2IUZA 5FJPA 3EWCA 1M03A 2O4MA 1XIDA 5CC5A 2WMHA 3BUVA 1UR8A 3NPUA 1J01A 1H5VA 3WELA 1BTMA 5AECA 4C6BA 2O7QA 3H7VA 4G7EB 5H8PA 2YGYA 3LS9A 1V3HA 1C8VA 4JDYA 4H6KA 1FCQA 1CXFA 1BG4A 4BS0A 3GW0A 5HUPA 3HPFA 3FX4A 3N6JA 4CN4A 2Y8KA 4UIOA 5HANA 4PMDA 3UJ2A 5F2IA 3RM8A 1VBUA 4ZODA 4GQBA 1M7JA 4UFKA 2FDSA 4OFCA 1XUZA 4WLCA 5BZAA 3BAXA 4JTDA 1JFXA 3RHGA 4BI6A 2P53A 3FGCA 4D1IA 2OEJA 5FA5A 4XD6A 3EOSA 1DWIM 3GNXA 1VENA 1UR1A 3MJMA 3L65A 4I7UA 4O1FA 3T4CA 4GHRA 3RO8A 4LX4A 3WLQA 2QUMA 2BHYA 4IPIA 5DRCA 2OQHA 3CC1A 4XZWA 1S3HA 3A3WA 4UQDA 5AVNA 3I6RA 4GI4A 1QRQA 4LQ1A 1JNEA 1YLVA 1WUFA 1XQLA 4JTCA 4LFYA 1JYNA 4E38A 3RR1A 4JFVA 2B7QA 1ONRA 1Z6KA 3W7OA 3HG4A 1ME7A 3BAKA 1HJUA 1TV7A 4XAYA 3MHFA 2D1ZA 3WQFA 3BGJA 1P1MA 3TW7A 4IF2A 3BH4A 2YKKA 2DIKA 3QTGA 3HZ3A 1JZ8A 1DWAM 4I9TA 3N2OA 3U4AA 4AAJA 3V5FA 5I3HA 3MO4A 4C6IA 1KBLA 3FEMA 1OZQA 2VELA 4HCLA 2QMKA 1Q8AA 3CH0A 3F4VA 5CJNA 2VUYA 1E3XA 2HBXA 4GXMA 3UG3A 1EWEA 2QKFA 4YTSA 2WNNA 3HGJA 1QPRA 2CCRA 2X0YA 1S5VA 1R2SA 4GYPA 4E8DA 3NIYA 3H24A 2Z7KA 3B4UA 1A5KC 4B4FA 3WMLA 3VABA 3CNYA 4P7OA 3VGBA 1UH4A 4J2MA 1E5JA 1QHOA 1O5KA 2Z29A 1EUNA 3OG3A 4PRRA 4AH7A 1OF8A 3JR2A 3NSNA 2VDGA 5E0FA 5H8MA 2QCGA 3ARUA 3W1TA 4IMEA 4TOQA 1Q2SA 2V30A 5G4EA 1ML1A 2RJHA 2Y88A 1J12A 1GNXA 1TYGA 4B92A 2EPLX 1WNOA 2OO0A 2JBMA 1JDEA 2TAAA 3LMZA 1KCKA 2PEVA 2PDPA 1REQA 1I1XA 3CTTA 3KRBA 3TZNA 3K2GA 1C8XA 4N7QA 1S2CA 4BF7A 3XISA 4LVGA 5GNZA 3LRKA 1AQFA 2ZUTA 2WCGA 1TTJA 4ECLA 4GINA 1A5NC 3CEPA 3MCOA 3EX6A 4AZ5A 2DVUA 4D2JA 3HA1A 4WDWA 3SADA 3SECA 2GWGA 4FNRA 2B7OA 5DCEA 1E4IA 1NFBA 4I7VA 1QOXA 1GK8A 3W27A 3GFXA 3G8RA 3GHUA 2GVJA 3GBEA 3VA8A 3O06A 2WNZA 2FZBA 2TPSA 2J7CA 1F73A 4C6CA 1QU4A 4H1ZA 3KVLA 4DY1A 3S6DA 1VAHA 1ITXA 3FJ4A 5DMYA 5H91A 2Q71A 2PLCA 1SMAA 5HQLA 2O9OA 3FA3A 1L6FA 3VZZA 2WVVB 1R3YA 1FFQA 4JKLA 4IX2A 5CG0A 3TR2A 5D2WA 4LH8A 1T6MA 3E0VA 3CAWA 1RP9A 4UMBA 3JZUA 3VIOA 2VRQA 5FOOA 3VI2A 1EJWC 2FB3A 4NZ3A 3SUUA 3QZAA 2PWGA 3SN0A 3URNA 4IQEA 3MDWA 4HA0A 3L4TA 1V08A 2YW4A 2XGIA 2FTWA 3U2ZA 2Y4SA 4AIEA 1J6PA 4UUIA 5HNRA 4AB4A 2YLAA 3U2CA 1G9HA 1VPXA 4GYKA 2J7GA 1Q8JA 2CLIA 3MZNA 1HGWA 1E4NA 3G1DA 4Z2HA 2BG5A 3ARSA 3WF0A 1XV8A 1Q6QA 3SIMA 1T96A 2DSWA 1JZ5A 3V16A 2BWGA 2C15A 1NQKA 2Y70A 1RUSA 3GQYA 4LAKA 3CZJA 1J8VA 2V6AA 3O15A 4NJIA 3ZSTA 4CN1A 2G4FA 4HTYA 4MDPA 4DWSD 1V6UA 3WDHA 3G1RA 2V67A 2V0TA 3T0DA 3CAKA 3GFZA 1W17A 4R88A 1Q3NA 1EIXA 3RNDA 1AZ2A 2NSOA 3WNKA 4PMRA 4ZOEA 2GGGA 3P82A 3Q2DA 1Z41A 2VFDA 4AMCA 4L7ZA 4DLFA 3Q65A 2QUUA 4M56A 7REQB 1TWIA 1FCVA 3LGGA 4AU0A 2CLFA 5F1UA 2BXVA 4AHOA 1ZU8A 3GG0A 4GUHA 4K3ZA 1V3IA 5M1TA 4LEQA 4AD4A 2PI6A 4BF5A 2ZXAA 2IPWA 3WLMA 3MO7A 2NWRA 4JYFA 2GOUA 3OPSA 3C2FA 3V5CA 2QEZA 1EP1A 5GJMA 3LI1A 5CG7A 3B3DA 2H6RA 5HNTA 4JGDA 2ZTJA 4MZ8A 1FDYA 3BJSA 2CLEA 3W7NA 4Y8FA 1QT1A 2QAPA 1PKMA 1WBJA 3KL3A 1ZHAA 4B9YA 5CJMA 2R9RA 5BU9A 2Q3RA 3CZKA 1RBOB 5CGMA 4KEUA 3I3BA 2Z4GA 1CIUA 2JQXA 4C6MA 2EPHA 5HULA 1ZBKA 3GYCA 2UV8G 4I90A 3WJSA 1RBAA 5ECUA 2W61A 3CJPA 2UWFA 6TIMA 1W1IE 3C2EA 1VGAA 4JKMA 4XO7A 3B8UA 4W7VA 2YA2A 3TYCA 3PBWA 1K8YA 1VYSX 4IUGA 1C7TA 1T8QA 1GG0A 4I6VA 1AH0A 1TV2A 2Z1KA 1RAKA 1RZMA 4RPQA 5IBXC 1RY0A 2Z2AA 3VDCA 5AFDA 2ZZ7A 3CLMA 5EKYA 4GIAA 1UB3A 2QXWA 1JNDA 3CM4A 4Z1BA 2P76A 4HYVA 5A8OA 3U57A 5KZDA 2INEA 3QSTA 2OZ0A 3O0KA 1FWBC 3AS1A 1VP5A 1E0TA 2F84A 3TOPA 2CLLA 1S5MA 5LZLA 1RXOB 5E09A 2B7PA 1UCWA 2YCKX 4F9DA 1KKOA 1H1NA 4IPJA 3G6MA 1K7EA 1OX5A 2Y7DA 4AWEA 3MUCA 4HOXA 3T2OA 3WF2A 3FKRA 4MWAE 5IFTA 2CEQA 2QCNA 3W38A 2DT1A 1BVWA 4H8UA 2F7FA 3GXTA 1OIMA 4O50A 1LLWA 4UMCA 4DXVA 2WSRA 2DSZA 3WEMA 2LLEA 5JIWA 2Q6ZA 1PIFA 3NSXA 4ZE5A 1UWAA 3EXTA 1F61A 1XHGA 4FIQA 6REQB 5J5RA 3CZ8A 3LCXA 2RDXA 3LBOA 5DT5A 2R1MA 4OOUA 2GJLA 4C6NA 1W3TA 5REQB 4E3TA 1K02A 1UYQA 3WD0A 1QDSA 2DJLA 3WDPP 3CMGA 4UTJA 4XO6A 4FZIA 4A3YA 3LPGA 3T1GA 2EHHA 4O4VA 4A3QA 4XZNX 3CHVA 3LXCA 4ZQOA 2DV0A 1VJZA 1JCJA 3HTWA 2Y5EA 1VEMA 2HV5A 4TV5A 1HXJA 1I1WA 3SY5A 3PR2A 5DXYA 2PU0A 2VC9A 2E9BA 3ANVA 3WQ8A 3UU0A 3M0LA 2PDNA 4GCXA 3BDKA 3Q94A 6CGTA 1SFSA 1SJCA 2OQLA 3BMXA 3QHNA 1LP6A 1PAMA 3SCQA 1KKRA 4F40A 3VNYA 3WLLA 5I03A 5CSSA 2ZOXA 3ABQA 3E0LA 2EKCA 2QQ6A 1RK6A 4KS0A 4DJFA 3V0SA 1TPH1 4N42A 3B97A 4O1CA 3CBWA 3KOZA 3R4IA 4EXBA 5I7GA 1ZSXA 3VE9A 4XBKA 5D2VA 3HJZA 5C9RA 1EKOA 5HWMA 1IGWA 1OGBA 1PKLA 3THAA 1F2JA 1OY0A 4M7TA 1WUEA 3SR7A 1BXBA 3GU2A 1LJYA 3PF3A 1I2RA 4MF4A 1MZRA 4GWEA 3AQUA 1PJ9A 2CKRA 1NDVA 2BZNA 2PP1A 2V81A 4LAOA 2WJFA 3WLOA 3A6OA 5HMSA 4Y7EA 1TX0A 4XVDA 1TVNA 4POCA 3VDGA 3W83A 1V0KA 1KM3A 1S2TA 2WMIB 2IXVA 3PC0A 2NVCA 4IG2B 2E1DA 1S2AA 4H41A 5CKSA 3BG9A 3TJIA 3VO0A 2I56A 4XZ9A 1SZRA 5FL1A 2ZUUA 2PTZA 1T5AA 1W9PA 3A13A 2ZRVA 5EY5A 2FHBA 1NP2A 1OEPA 2O55A 4W88A 5JVLA 4KRTA 4FNTA 4C6QA 4Q8WA 3WFZA 3ZJKA 3CYJA 3W3OA 4MDOA 3LQLA 4W8LA 2PRHA 4O1AA 4ALDA 5IDZA 4K2SA 3UETA 3WH8A 2XFYA 1D3HA 1VJIA 4H9MA 1UZ1A 3UNTA 4RNIA 2CC0A 4DWSB 2FJKA 4B3KA 4BHYA 1K77A 1XQKA 3EA1A 1SFLA 2FLIA 4RPPA 4EPDC 6A3HA 1C90A 1R85A 1YTEA 1CI1A 1JDCA 2PDUA 1LOSA 4DLMA 4RE4A 5HMDA 4NAEB 3QPYA 3VC5A 1J79A 3CPGA 1TREA 3EWXA 1IR1A 4AYSA 3LPFA 1MO0A 1V02A 4WDTA 3A21A 1K7FA 4DEFA 4XTIA 4C60A 4C7GA 1OK6A 1ISXA 1NM9A 1YDNA 1IWAA 3VCRA 3OVQA 1UD2A 1NJJA 4HYRA 5I3KA 2J9XA 3T08A 1E51A 1LQ2A 1W9VA 3TYEA 1OCBA 1HVXA 3IRDA 4AZCA 3RILA 3VXGA 1JFHA 2G37A 4LY4A 5AYIA 1K3UA 3LXBA 3G1HA 2XU2A 3BL3A 4C5YA 2ZUMA 1EPVA 3CPRA 1O1HA 4GVIA 1B9ZA 2WC3A 5D09A 1JI1A 5AYXA 2VX5A 1FWJC 2VUNA 1P5BA 1V6YA 2WHJA 2GJPA 3W2NA 3WDRA 5BW6A 4JR5A 4WKAA 3TWAA 3WL1A 2VGGA 1O12A 7ENLA 3LM3A 2PFHA 1PTDA 3TR9A 3ZS4A 2VFFA 1JCXA 3W7IA 3S2CA 4MIMA 3W7JA 2GQAA 1VHNA 1E0VA 4U33A 2J7DA 1E0WA 2X09A 1BG9A 1P48A 3PJWA 1PIGA 2ZZ2A 4US6A 1IXQA 2A3CA 1FP9A 1D7KA 1NARA 2OT0A 4DPPA 3USZA 3QY8A 3D6NA 3GNPA 4JKKA 4Q8PA 2E6FA 5A8NA 5M03A 4NI3A 3AZSA 3FOKA 4Y2WA 3VTRA 1VLIA 4ERGA 3F5LA 3WJXA 3PAOA 3U3HA 5G2HA 2BDQA 3R11A 4K39A 1TIMA 2DIEA 4LUIA 3TQVA 3FXYA 4GY7A 1X6LA 3P74A 2DVXA 5DMLA 2VNCA 1XYLA 4OVXA 1KM0A 2V2CA 3MBDA 4C1NA 2W67A 3V18A 5A6BA 3ZR6A 2VTFA 4F0KA 4O4WA 2EJAA 3R79A 3SUTA 4X60A 1W1TA 4FX8A 4KGLA 4WY0B 4J3VA 1IIHA 3FDGA 1ITQA 5LIUX 3GDTA 2QJHA 1EJVC 3QC3A 3NQ7A 3DG6A 1JG9A 5I6SA 4UQEA 5AHEA 1XYBA 2A3HA 5C9UA 4GY0A 1HVQA 3MV11 4DUXA 4TMBA 1DJYA 3AWNA 3WLHA 1WOBA 2RH9A 3LQGA 3QR1A 1YMYA 1XGDA 3WLRA 3WG6A 3MDUA 1XH2A 3TYUA 2A6NA 3CZLA 4YYCA 5LSMA 1XIEA 2OT1A 5JXQA 3N9RA 1K6WA 4L9YA 1IXOA 1Q13A 5CPMA 4BEQA 1XYZA 1TELA 4QCFA 3W7CA 2Q02A 1JD9A 3N12A 2I9UA 3OP2A 4J4KA 5HPCA 5ABFB 2NX1A 5A8QA 5CEWA 3DHDA 1XC6A 4OV4A 1XDMA 4RKAA 4I5RA 4U5KA 2VURA 4HSOA 5FL0A 5E5CA 3U6WA 3IGXA 3NSMA 2F38A 6ALDA 4HNCA 3IUHA 4DZHA 1GKRA 1GUVA 4GLEA 4YNGA 4HMDA 5C0QA 1N55A 1E6NA 1KRBC 1V3LA 3KUMA 4E4PA 1RD5A 1V3JA 4M1RA 5HMEA 4UFIA 3QJAA 3A9BA 3TCEA 2ZZ5A 3NWRA 2D2JA 3W23A 1PHQA 5BYWA 1FXPA 2WLYA 3WENA 3CXOA 4JQ3A 3W4RA 4YJ5A 4PULA 4PMNA 3TNBA 4PMXA 3W7MA 1UPMB 2VL4A 1OINA 3NOEA 1PWMA 1ZGDA 4N9EA 4ZL1A 3JS3A 3N9SA 3VGHA 3WUEA 1QOQA 3OB8A 5HMFA 1L8NA 5CXPA 1XDLA 3WSUA 2P10A 1Q6FA 2VP8A 4GC3A 4KQNA 3W76A 2P3ZA 1ELSA 3LBMA 3DZ1A 2GVYA 4Q32A 3RJYA 5E0CA 3TSMA 4A05A 4A4AA 1BYDA 4HOZA 2ABBA 1BSIA 1GOIA 2G5WA 4PMYA 4Q4SA 3HG2A 2I16A 4BY3A 3IGSA 1LORA 3ORWA 4DI9A 4DAIA 4DM1A 3TMLA 3WNNA 3QXBA 3FIGA 4ZXLA 3XIMA 2I17A 2NLYA 4IHCA 1VCGA 1OFRA 1FH8A 1QMLA 3VOJA 3EEGA 4Y9NA 2A5HA 2NX9A 4J28A 1WZAA 2DT0A 3EOUA 4US5A 2QMJA 2XIQA 4HHMA 4G2DA 3GXIA 2XG9A 4LAZA 1RQHA 4UQ9A 3SJNA 3ZYZA 3UCQA 3C8FA 4PTMA 4GI6A 4O14A 5A1AA 2CIPA 3MSRA 4WF7A 2VFHA 4TX8A 3ZT7A 2YX0A 2OKOA 4WD0A 3UZ5A 4S3CA 3CL8A 2HE5A 3F4CA 3QQ0A 4LNYA 4LT9A 3W7PA 5IHRA 1MRQA 4S3JA 3UQNA 4B5UA 1POKA 2QVNA 3NA8A 3SGUA 1T40A 1BGAA 1FTXA 1WZMA 3GTIA 5CZJA 3WYZA 4MJ2A 2ESCA 3RLHA 1K9DA 4U31A 4R85A 2W9MA 1VH7A 4GMEA 1L0PA 3WK2A 1TPB1 1KXHA 1FCUA 2W92A 5I07A 4ZB0A 4WXYA 4MTVA 2QCMA 4Q4OA 2Z28A 3TMQA 4UC5A 3O07A 4GYFA 3NQGA 3NPXA 3K1DA 4GOAA 1D3CA 4B2DA 5AZ1A 1WP6A 3H4GA 4GVFA 2ATMA 3L5AA 5DANA 4D6DA 2X1SA 1QNQA 4G6CA 3QR3A 3H21A 1R8LA 3GKFA 4IZGA 1JPIA 1DWHM 2XN1A 4N9CA 4PMUA 5EYWA 2C71A 5TD4A 3GHRA 1KXTA 3K13A 1ODUA 2REQA 1R2RA 1DJXA 2WSKA 3UYIA 2EKGA 4IQLA 1W1PA 3A4AA 4AD1A 4K37A 2C8NA 4PTDA 2QUNA 4XIMA 1DIDA 1ICPA 3KOYA 4LS1A 4MG4A 4PMJA 4XUGA 3CHEA 3TJLA 1E73M 3BAYA 4RR4A 2V5CA 4H6QA 3MANA 1B4KA 4LJ3A 4Q4KA 2BP1A 2V5DA 4IMGA 3SY1A 3UXLA 1CYGA 2QR6A 3GR8A 2MNRA 2XIIA 1A3XA 2WWCA 3TC3A 3FA5A 1EZWA 2WJZA 3W0KA 5D9PA 4C1NB 1RJRA 4LY8A 3H12A 2OZ3A 3GC5A 3ELFA 1EXBA 4D6HA 1XLKA 5M2FX 3HQNA 5XIAA 5HR6A 3MT1A 1UWTA 2BBFA 2WJEA 1DBTA 3E2VA 4DJDD 2AQWA 3QY6A 2QZRA 3QR0A 2PS2A 3GDKA 4M80A 4H9YA 3NL3A 1JIBA 2XPKA 2RKXA 3VMNA 3EX2A 1ZJHA 5FAJA 1GYMA 2NV2A 4JTIA 3M16A 3G0SA 3GH4A 1SFJA 2DQWA 4IT1A 3LLXA 3VX0A 4NF7A 3UR7A 3IK4A 4ZO7A 3RITA 3QH2A 5KTLA 1F4AA 3BSHA 3GG8A 5CZKA 3PFRA 3K8MA 3QGVA 1N82A 1SJAA 3E0WA 2E67A 1B57A 1U83A 4EF8A 2PZNA 4UTTA 4KCTA 1XR2A 2DUXA 2R94A 5AC6A 4QJ3B 1P0EA 4MHBA 1KM6A 1O4UA 4ERIA 1UUQA 1TRIA 3EB3A 3ZJ6A 1LBMA 2DIJA 1ZQ5A 4E8CA 1YYAA 3IEBA 4ASTA 5FF0A 4V28A 5E70A 5A8MA 2PMQA 3VUSA 1UWUA 3W7HA 2B4GA 1G4TA 3BXWA 2HS6A 2WPBA 2Y8UA 3GC2A 3PUEA 3VK5A 4LBUA 1KFKA 2GDVA 3S9IA 3KWXA 4U4MA 4P8UA 2ZX6A 3SDOA 2X30A 1YQ2A 1DXFA 3H2AA 4H83A 1IXPA 3CUFA 2WMGA 4LV9A 4Y9MA 4UNKA 5CPTA 1E6QM 3QMTA 1KFBA 2ZBTA 3B8DA 4I9AA 4LUJA 4YTRA 4WR3A 2YJQA 3C61A 3R2GA 4FLRA 3HQPA 4V2XA 3N6HA 3TX9A 1M7XA 3SQMA 3PUOA 4X9YA 1W9DM 3L0NA 2ZVRA 1T41A 3PAJA 3GUWA 3UPBA 2PDMA 3T0BA 4Y90A 3S2NA 1YXYA 4MPQA 1FA2A 3ABZA 4QJ1A 3DI0A 4QG8A 4H9VA 2RDTA 1BVZA 2PLKA 4KCUA 5FI8A 3VGGA 2PGFA 3WNLA 4BI5A 4FALA 4RW3A 4DHGA 1O1ZA 1JEZA 1GT8A 4P7LA 4F0LA 5D9MA 2ZC1A 3DFNA 1SPQA 3VE7A 3ZVHA 2V8ZA 4PCFA 3W07A 3TCSA 1A3WA 1G94A 1M9HA 3B8SA 1CEOA 5C55A 4FOUA 2JKAA 2XGBA 4G7EA 4GQGA 4WOQA 1XBXA 2FVLA 3KBNA 3QMSA 4ZQCA 4LSBA 4FLOA 1Z7AA 3CIVA 1L6GA 1E4LA 4PEEA 3GWQA 5SWUA 1G4SA 1UWQA 4J2PA 1JL8A 3EWBX 4O11A 1GJWA 3EBVA 3N17A 5JQ9A 3FCPA 2JE8A 3A47A 3GR4A 8XIMA 7CGTA 3PJUA 4R34A 3B9DA 4S23A 1VBHA 2E5DA 1P1XA 3USBA 1BYBA 4LS0A 3NVDA 5A8GA 3CS2A 3B9NA 1XRTA 2ZADA 3I4KA 3A3HA 1W3NA 4PSRA 4EE9A 3FFSA 4E2VA 1C93A 4IH3A 5FACA 2Y85A 3U2OA 1NDWA 3OHMB 4B5TA 1GVYA 1UBSA 5FF7A 2E4TA 4RDYA 4JCMA 2V69A 2BS9A 5REQA 3L12A 2CKSA 4ROQA 1MWOA 4JFSA 1VBJA 1W37A 1P6WA 1XIJA 1QNOA 4GE8A 3MZ2A 2J8TA 3VIPA 1C29A 1S38A 4UZUA 4AHPA 3RM9A 4US5D 1Z69A 4QE5A 1Z8AA 3PB0A 2EQDA 5GQBA 5C9ZA 3R89A 1LM1A 3H2FA 3FSTA 5I79A 4XKMA 3AROA 3C2RA 2QDGA 2NQ9A 3B03A 4B9ZA 1XX1A 1GVQA 2WZHA 4JS3A 4Q8MA 4NIRA 2DSUA 3AYRA 2OZTA 1MFVA 1R38A 3S6OA 2HTMA 3AI0A 4MFDA 4GQQA 2PDCA 4AMAA 1GKPA 3EXRA 1OB0A 3HGRA 1A5OC 3SIZA 4NKCA 2P1FA 3IPWA 3UJEA 2PWVA 4H4IA 1E0XA 4AF0B 5L6UA 1EJUC 4CNSA 2HXTA 5CPQA 4RE3A 3BOXA 1OFEA 3RM4A 4Q7IA 4UFLA 2HPIA 4MB4A 4O54A 2XFWA 3W6MA 3ITGA 5CLWA 1TG7A 3C0SA 1DTNA 4JEJA 1BF6A 1TV5A 3TVAA 4MVAA 1DIEA 1TMLA 3MHUA 1JXKA 1G01A 3IGUA 1FWGC 1UQZA 5A6BD 2WZIA 5C5YA 4KEZA 3W73A 2WSQA 4TX9A 1ZTVA 1ISVA 1KXQA 1E70M 4IQJA 3UD6A 1KLYA 4AVOA 5B7YA 3GG7A 3SUVA 8RUCA 1N2VA 4JTFA 2OWWA 3CAVA 3UPMA 2CLKA 4NVTA 1GEHA 2YCLB 2XINA 3W71A 2A7RA 3RIKA 1Y65A 5DXXA 3V5OA 3APTA 1Q6CA 5G2WA 4QS6A 2V5JA 3NQBA 2QCEA 4IG2A 1K9TA 4LYKA 1GQNA 2P0IA 4Q8OA 1SR9A 5K2ZA 4REQA 2OKTA 1P0NA 4HA3A 4PRWA 3CUGA 5FJOA 4H6RA 4Q4PA 1HL8A 4RW5A 3HPXA 4FOKA 3ENLA 1H3GA 1Q85A 1TJ0A 4XVEA 4WXZA 3E38A 1RQEA 5LNRA 5T9BG 3VIIA 4UR9A 3OQEA 4AIBA 4HZMA 1C91A 3KS5A 3B8TA 4LRTA 4NZ5A 2GFTA 1AW5A 3LXAA 3T0CA 3H2MA 1JF5A 1ZUAX 2W27A 1ESWA 1W2PA 1BQCA 3HG5A 3AJ7A 2NZLA 5GPRA 1T8XA 8XIAA 1PPIA 1UIPA 2Y8VA 4L4MA 4ZO8A 4D6JA 3QPZA 3WQEA 1E1CA 5G5IA 5TF0A 4DYEA 3XINA 3SEPA 3LZ5A 4CGTA 4XBJA 1UP2A 2YDAA 3TK7A 4CCCA 2XN0A 3WBAA 1KR0A 4GISA 3LRMA 1L6YA 1T99A 4Y6GA 3DBNA 3VDAA 4A8NA 1NIUA 1QK0A 4IPPA 1J0YA 3NEHA 2OR2A 2TMDA 4X2PA 3IVTA 1NTHA 4AHQA 3GNNA 4YTQA 4JAWA 1HJWA 2X0SA 2FZDA 2ZZ6A 2PA6A 3VCNA 1LYXA 2PE4A 1XIBA 1ZJAA 1LTDA 1QNVA 4LBSA 2FKPA 1NWUA 3GDLA 2PSNA 2V9DA 2SFPA 3VILA 4KGJA 1K6AA 4R7OA 3MUY1 4DELA 2ATSA 1XFBA 4N6EA 2A85A 3PBYA 3L67A 3WO8A 1EX5A 1KD0A 5C7HA 2CWXA 3B04A 3MYOA 3IJQA 1DKWA 3B8IA 2VD9A 4M81A 4JEQA 3E96A 3J7HA 4K6AA 3DGBA 3BARA 5E93A 3YPIA 4LVFA 3ALFA 1UKPA 3GD6A 5HNNA 3FJ6A 3UZWA 3T05A 3DG7A 1BRLB 4ZQMA 1OM0A 1C3FA 2VI0A 3TH6A 4UCGA 5E1QA 5DRIA 1BXNA 4P61A 3TOYA 4G7FA 4YTTA 3G6LA 1RR2A 3PBUA 2VEKA 3EWDA 3RN6A 4JTJA 2ZRZA 2HMCA 2WPGA 2YW3A 1SFTA 2E6AA 1B3ZA 1EGZA 5CC6A 1QNPA 4W7UA 2VX6A 4RZ6A 4YCOA 4I8YA 2F6KA 2OO6A 4V1XA 3WD1A 3GVGA 4ATWA 3ARWA 5MF5A 4WVXA 3V1PA 2AMGA 2C16A 1O7AA 4AUBA 1LL6A 1DXEA 2Y2WA 5HJXA 4LXFA 5D2TA 4ES4A 1DYSA 2B31A 3FYOA 4DBWA 2JGQA 2BFGA 2BMBA 1Z44A 4M1BA 3WQVA 4TO8A 1S39A 1AJZA 5TIMA 3ZIZA 1GOOA 1EL3A 4ADTA 3MW7A 4QJ4B 1SSDA 1H50A 2ZX5A 3GDRA 3MI6A 3MUXA 5LGZA 3U5UA 1OBAA 5CAKA 4WJXA 4W84A 2QJGA 3ZT5A 4GKTA 1UKSA 3INPA 4JQ2A 4FNSA 2VEPA 2XYLA 4HK6A 3WQ5A 3MUAA 1OD0A 3HO8A 4Q8VA 1A4LA 1CGWA 4K8GA 2XIBA 3VD9A 2X7WA 3MV01 2E9MA 4NU7A 4D8LA 1KR1A 1NU5A 5BNKA 2B7NA 5LNWA 1IEVA 3THDA 3IVUA 3ZM8A 3MMTA 1U1JA 2GJXB 2D2HA 5A2BA 4MB3A 4DNMA 4LGXA 3FVMA 2DH3A 3OYZA 1LL7A 1PDYA 2FTPA 5K4XA 2Z2BA 3B40A 2PRMA 2H90A 5I23A 1XLGA 2XZ9A 4IIDA 3M0ZA 3WF1A 4CVUA 2F61A 3VZXA 2NQZA 1B3XA 1US0A 2OGYA 3QW4B 4G1NA 1X97A 2NVAA 5EL1A 3G3MA 1HKKA 3QOMA 3LCWA 1ONWA 3MJYA 4XB3A 2AKZA 1WOAA 2J8FA 2D0HA 2TSYA 1MUWA 2VR5A 1WDPA 4FAMA 2PF8A 1UJQA 3ZMRA 2HCVA 4OKDA 2ZX7A 1WQ5A 1XLIA 4HN8A 3N13A 3EWUA 3MYPA 2NV1A 3S2LA 2NUYA 4PE8A 1XBYA 2Q3OA 4MLJA 4UQAA 4QXIA 4PR4A 1CXLA 1SZGA 1HJXA 4P8XA 3M5ZA 1U5VA 5CCZA 1WZLA 3UWYA 1ADDA 3GVQA 4HSHA 4DBSA 4O1EA 3TYZA 1F07A 1QI4A 3E2RA 4JOMA 1C8QA 4WZHA 3UWEA 4UOZA 3FHQA 2WXDM 3KZSA 3STFA 3OTRA 3II1A 3THQA 2IKHA 1CLVA 3UZYA 1AMYA 3FY1A 4BI7A 1K8CA 4LYPA 3PG8A 3W25A 3EOLA 2ABAA 2QCCA 1ZPTA 4JFUA 1JZ7A 1OHLA 4IPNB 3M0MA 2YXGA 3G1AA 2OCZA 4C6OA 4A22A 4DYKA 2YSWA 2QDEA 1AJ0A 3T44A 4C90A 1M68A 1UD6A 3PSVA 1GONA 2YPIA 3CV6A 3LYEA 4FLQA 3LERA 2VDIA 4MZYA 1TTIA 4O15A 3T09A 3BW4A 1Y8BA 3RK8A 3GW3A 4MWAC 3CV2A 2PDIA 1XM3A 3RDKA 5A2AA 1YNPA 2PBOA 4Z2LA 4HZ7A 3D3AA 1B5TA 3QLLA 2P8BA 4UQCA 1JD7A 4ADUA 4UOJA 2VZSA 4C5ZA 4JQ4A 1J0ZA 2BGSA 1EB3A 4QIUA 4IIBA 4WKHA 2XWDA 1CNVA 1KCZA 3IIVA 2YYTA 1XLDA 2CBIA 4JTKA 2PCEA 1V93A 4NJHA 3UWVA 1YPXA 3DAQA 3VGDA 3B0UX 1ISYA 1OX4B 4I6KA 3E49A 3OLIA 3G5EA 4YWIA 4CUCA 3TJXA 3PWIA 3P8JA 2I1OA 2QS8A 3QHMA 1KTBA 3R0UA 5DY3A 3T9PA 4NJJA 3UGVA 4TTUA 4GH3A 2WB5A 3SCNA 3EWYA 2Z25A 3TONA 2B81A 3UPWA 5IDIA 3CL6A 4TVCA 3IGHX 1HIZA 3W28A 3D3FA 3WDQA 1XH1A 4JTEA 2PDWA 3PPGA 2JGYA 2YXXA 3NJ3A 3M5XA 2CZ5A 1VFOA 3BLPX 1E9IA 3VYLA 3TN6A 3N2CA 2GK1A 4W8AA 2DZTA 2QDHA 1J93A 3UERA 5FD0A 5HINA 1OIFA 4NRSA 3M0JA 1WB0A 4R3UA 1ZNNA 3B05A 4U5IA 4HJFA 3AHVA 3WL0A 4GNKB 5AYYA 4PUJA 2G3FA 4ERAA 4JL2A 4A2SA 3GM8A 5XINA 3RMEA 5FJUA 1JGMA 4RL3A 5CLTA 3RCMA 3HMJG 4LEFA 2WK2A 1LWIA 4ROPA 4M6VA 1FVPA 4X9SA 4OZOA 4L6HA 2GSHA 1V0MA 2O9RA 3FKKA 1JZ2A 3HQ1A 3VGFA 3CUZA 2BASA 3BMWA 4HPNA 1R47A 3QM3A 1H1YA 1LBFA 3HM7A 4MJMA 5TQLA 1H7RA 3PFMA 4Y9AA 1V4YA 3AALA 3C8NA 4C6PA 1B3VA 4J3TA 1BVNP 3VU2A 1OQFA 2XHYA 4DF2A 4PODA 1HN1A 1ISZA 1V51A 3ZWSA 5C2GA 5CPLA 3QGKC 1XRFA 1JXJA 1L2UA 1DHPA 4GPNA 3BOFA 3GDMA 1RVGA 3R8RA 3P0WA 4QR6A 3ZLFA 3FW6A 4PMOA 3U7VA 4R7JA 3TJ4A 2QYGA 1GQLA 1XBVA 3MVIA 1W5OA 3JU2A 1JUKA 2INFA 2BOGX 1ZAHA 2F2KA 1WDRA 2V5LA 4JPGA 4B2DD 3H2OA 4MGGA 5JUVA 1R3VA 2WMKA 3PZ9A 4R53A 2A7PA 2WCSA 4WCJA 2DJXA 3TEVA 1WCGA 1OYBA 3OW1A 5EMYA 4KERA 3OU8A 1F8MA 4RZ5A 4RDWA 2A79A 5D05A 3ITXA 4JIQA 1W2VA 3SRKA 1L6WA 4J5NA 1K4GA 4B4HA 4PUNA 4QCEA 4Z1AA 2ZQ0A 3ARPA 3DOPA 4PC8A 4CNNA 2BVWA 3S5YA 1IV8A 1HJSA 2VC5A 4KWVA 1BPLB 1L8PA 4AEEA 5FF2A 4ZBCA 1UHVA 2DW7A 3F2CA 2ZX9A 4IGSA 3TIMA 2XZ7A 1DJHA 2WKLA 3IAPA 3S42A 3SQLA 3OG2A 1VCVA 2WCAA 3AXXA 3S2MA 1LWJA 4HU0A 4BZYA 5A94A 4NZJA 2IKGA 4X0NA 5I09A 3BGGA 2WJDA 4YS1A 2PTXA 1TTQA 1KC7A 1QWKA 1TPUA 5DMNA 1VF8A 4JIHA 1WAUA 1YKWA 2CLPA 3VNDA 1JPDX 3UXDA 4E6MA 4JX6A 1KM1A 5L9FA 4JHZA 1S3TC 1QI0A 3IUIA 1XICA 1CW2A 2D73A 2VZVA 1OFOA 3BSGA 1FX6A 1SZEA 4WUIA 2XVNA 2OQYA 4ENLA 4F9JA 3KVMA 3EA2A 3A9IA 3BQ5A 1ZJIA 4NXSA 2YCJA 1KQYA 4HIBA 3TROA 1FWAC 4AZ6A 3UG5A 1M7OA 3EDEA 5BWFA 4JICA 4GZJA 3IV8A 3W7GA 1KFEA 2P5NA 2ZA1A 4DJFC 4ICNA 4LUYA 2AQOA 4S3GA 1G4PA 3I10A 3AU6A 2C18A 4OBRA 4QLJA 4CQ9A 1LROA 5KINA 2YA1A 2EF9A 3UJRA 4F2BA 4JBRA 3MHGA 3HBLA 1HW6A 3GC4A 3B0XA 1SO5A 1U5JA 2OSXA 3P84A 4L61A 3LGEA 3H4XA 1MEIA 3AHXA 4RK8A 2F8QA 2W3ZA 3PHAA 3ES7A 3JVAA 3DX5A 2Y62A 4Q6JA 3ZR4A 1I6NA 4AQLA 1TFVA 1B30A 1UOZA 3NDOA 1VZWA 3DECA 1WDWA 3NQDA 4INFA 4JYDA 3FNDA 3HMCA 4D9PA 1IZKA 3T0AA 1GZGA 4WSJA 3S2JA 1QI2A 2RGLA 4DYJA 3N2TA 2GK1B 2YB1A 1Q7QA 1ME8A 3TNOA 3UY8A 1DPMA 3FA4A 3UNDA 5FJIA 1I75A 4JTGA 1CLXA 3MUIA 1IWPA 4LU0A 3DYOA 1TR9A 3PBGA 3KCLA 1OGSA 3GX9A 3CZEA 3EPNA 3TDFA 1M01A 2BB0A 3AO0A 3OVRA 3A22A 2CNCA 1NOFA 4CEUC 5C6MA 3L9CA 5F2GA 2DH2A 2GJRA 4M51A 3PUGA 3OJGA 4NYUA 2OYLA 1K9EA 5E9AA 3O6AA 2D3NA 1QBAA 3QPEA 3GAYA 5HATA 2OTDA 3THUA 2XWEA 3ZO9A 4DBEA 1W8GA 4LWWA 3AFBA 2X2YA 2VCBA 1XWYA 1E4MM 3QZ6A 1TPEA 1JVNA 2IPGA 4IWWA 1PWLA 1TUXA 1XL9A 2WZMA 1JPKA 1V77A 3WLJA 5FJRA 2E77A 2WQPA 3BO9A 3EWWA 2RFGA 3WQDA 4KWSA 1K8XA 2QGHA 4XTDA 2J7FA 1XGZA 1H7WA 4U3CA 1BFNA 2TYSA 4YXGA 2NUXA 1Q6DA 3AOFA 3ABXA 2YBUA 3OZOA 4IP5A 4IIHA 1PYMA 4GGBA 4LYRA 1TPFA 3VKKA 4DX3A 5I2UA 4IJRA 1US2A 4ML4A 4ATLA 3OBKA 1SW7A 3W53A 5IM51 3APYA 1KFLA 1G0CA 2VQUA 4C6LA 2D20A 4DNHA 3OOQA 5DCDA 4FF7A 2NX3A 4CNUA 2J13A 4NP7A 1KW1A 1EQPA 3H2CA 3MWAA 2UY4A 5FSDC 1BWVA 1QO2A 2FB2A 3SN1A 4DF1A 4PL1A 2QJJA 1KBJA 2VENA 4XZIA 5AZ0A 3DYMA 4K68A 1QFEA 4DJFD 5I5RA 5FAGA 2YCEA 1GPWA 4GACA 4LV4A 2ASHA 5DMMA 3KLKA 3CV1A 1MVYA 5G4WA 4HMEA 1F6YA 4H01A 4PB5A 2VR2A 1OT2A 3MQTA 2ZYFA 1VCFA 1WKDA 1P6BA 2BLEA 4PCNA 2W62A 2QLYA 4HD5A 1FWRA 4N0RA 3PP7A 3CHCA 4AZ7A 1HP4A 4LB3A 1C9WA 2CESA 1X1ZA 2D2OA 1DXIA 4H9UA 2NT0A 4BF9A 2OFJA 1S1RA 4QSHA 1LZOA 2HDJA 2OEKA 2WHMA 4E2BA 5U4NA 2ODOA 1UQYA 3ABOA 1GEQA 2O0TA 2XFFA 2YDSA 3UWUA 1KCLA 3W7DA 2PDGA 2CWNA 3PTQA 3V75A 5BRPA 1V03A 3QF0A 3LHZA 2AL1A 4EWND 5C70A 2GPTA 4TV6A 4HP5A 2EG7A 4KRUA 1IZJA 3ICJA 3NL5A 2XVKA 1CXIA 1RV8A 2G4JA 3WH7A 2OOGA 1M41A 1UKOA 1WKYA 5DX7A 3P93A 4F0SA 3MVTA 4PFHA 1B9BA 4U3AA 2VVSA 3F4DA 3UG8A 5EMJA 4UB9A 4NASA 2RJGA 1VHCA 1HKJA 2E8ZA 4QSFA 1D9EA 2G50A 3TTEA 3GU9A 2Z7GA 4B15A 3VVGA 2ZC8A 2XSBA 1FQ0A 4A3RA 3KBSA 3P81A 5TAOA 1PTAA 2QCLA 1JRCA 1XSIA 3ZXWA 1OFPA 2OLAA 1VFLA 5EFFA 3ZVHB 1JYWA 4WSKA 1QVBA 5H8UA 4IGHA 4KCVA 2D0FA 1I9CB 2WWDA 5LHFA 1M5WA 3W02A 3P6LA 1XG4A 1H49A 4J3WA 5ABFA 3UZZA 4MM1A 3CB8A 5B7ZA 4W93A 2GGHA 5KEZA 5T9CE 3LTSA 3M44A 1JCYA 2EG6A 4KT2A 3TTYA 2E8YA 1LL4A 1EC7A 3LA4A 3NL6A 4PH6A 1R3SA 2HZGA 2Y6ZA 3A5FA 3KCOA 3WNMA 5LA2A 2HXUA 3BCFA 4HB7A 3B06A 1UD4A 3PANA 2YIHA 2WMJA 1QXLA 3DG3A 4AD5A 2YOCA 1W3LA 3CQHA 3PZVA 1X38A 3SN4A 5I78A 4QAWA 5ECVA 2WNWA 3WCZA 1E43A 4CD8A 2O9TA 1XRSA 5IXEA 3CIWA 1TJ1A 3SCOA 1R7AA 3EGJA 4FEZA 3W2MA 3MBFA 5JH1A 3KLLA 4QE4A 6XIMA 1LF1A 3AMKA 2OELA 3H7RA 1GVEA 1QR7A 1H61A 4PUDA 3DHPA 2NWSA 4H7CA 2PGEA 1P0BA 2JIWA 3S0CA 2EG8A 5KZEA 5C2XA 1K7XA 2PLJA 3S83A 1LQAA 5ABTA 2GDUA 3ZSSA 2C0HA 4MNLA 3EA3A 3L4YA 4EF9A 4NZ4A 1LUCA 4DAFA 4HHHA 4WQ6A 5KITA 3TC6A 2J8GA 1UKTA 3WQ4A 4NQ1A 4U2ZA 1W5QA 3U8GA 5KMYA 5H6HA 3ABSA 3ZVIA 3IJIA 1GQIA 3CK5A 1AG1O 2HK1A 4BJHA 4FS9A 3KFTA 1IHIA 4S39A 3UXKA 2ZIDA 3W75A 5JBDA 1H1ZA 3BWWA 3R7MA 5EBAA 2V3FA 7TAAA 4MY8A 4DWDA 1BXCA 2QIIA 3S1XA 3NDZA 4GI8A 3UZJA 3FV9A 4I9JA 1F5ZA 2CZVA 4ZB2A 2OSYA 1PE1A 2WM1A 1GOKA 3K46A 2Y61A 1OX4A 1F6KA 2OX4A 3CQIA 3GZAA 1TJ2A 4TXEA 3E3HA 1PO9A 1TZ7A 5JH2A 1POJA 1EBHA 5EPDA 5DCBA 1P4CA 4GRSA 5D2YA 1F05A 4O18A 3ZQ9A 4Q33A 2ZRUA 5A69A 4RZ4A 3AMLA 5FF3A 3T78A 3KBWA 3RF9A 3UWZA 3VNJA 4Q8QA 3TZFA 3QV6A 5G2IA 4R9OA 4NT0A 4GVGA 4F48A 1VRDA 1SR0A 3CHDA 2C1GA 1DJGA 2VRKA 3E12A 2I7GA 1Q4WA 3HGOA 1EHNA 4AD3A 3VOHA 1HO1A 3SSZA 1XS2A 4WK9A 3POCA 4V1YA 1BEUA 1TJRA 2V3GA 1R7OA 3AMGA 4HOWA 1V02E 6XIAA 1BSLA 4FK9A 1KRCC 3P3BA 3KBMA 4H8VA 4HN4A 1XCXA 1OG6A 4E0CA 2G3MA 3LHVA 2PWUA 1T0OA 1Z48A 4H8HA 1X8CA 3BLDA 3N3TA 1WXYA 1U33A 1H7NA 3RAOA 2REQB 2YDQA 4C6EA 4LPCA 4HMNA 3WKZA 3W29A 3N25A 3ALGA 3DDMA 2IKJA 1Q6EA 3UYCA 1IEQA 4OOZA 3CUJA 4JTHA 2JIEA 3K8KA 2NXIA 1ZBVA 3MMWA 5J04A 2POTA 2PLMA 2ZXBA 4L5ZA 2IW0A 3THCA 3ATYA 2DZWA 3G1XA 3UBPC 3O3RA 3R6IA 3WUBA 3S1WA 3QN3A 2Z6IA 2V38A 1X6NA 1EZ2A 2QJMA 3QC0A 2OEMA 1XLFA 2YCLA 3N14A 5FEPA 5BU6A 2Z24A 5AHMA 5BXPA 2DSVA 3FYYA 3E5PA 2BHUA 3DESA 5M5DA 4RNFA 3APGA 2ZUSA 4EP8C 4ONVA 4ORMA 4P2VA 1PHWA 1MSSA 4REQB 4KH2A 3EOOA 3OGVA 1MQPA 2PD5A 2RGMA 5AC8A 3VIHA 3L4ZA 4JTAA 4UMAA 3KOWA 4F79A 4UBPC 4UOQA 4MAZA 2DP3A 5E9XA 3OBEA 1E9YB 5HK4A 2OMAA 2BVTA 4DO7A 5D9OA 2J74A 3PULA 4PTXA 3SCPA 1TCDA 2GGJA 3PZOA 1GORA 4HCHA 3BANA 3UP8A 2OJPA 3DFPA 1FFRA 3AWOA 5KZ6A 3H22A 3AYSA 2X1RA 2WSPA 4DB7A 4D72A 1NFPA 3TN4A 3G1SA 4FNPA 4C91A 1VFSA 3F2BA 2QVHA 2JF6A 3UGRA 1X1OA 3R58A 1OF6A 1WYIA 2GWNA 3WLIA 2FGZA 3K4DA 3KTSA 1B3YA 3CB3A 3EKGA 1PX4A 5DELA 2DQXA 2ZFAA 4FLSA 3VKCA 5J8LA 1QASA 2E28A 3C0LA 4LC6A 2OGJA 1TV8A 2PTWA 4ZGYA 4HA4A 1R3WA 2YZRA 1XKYA 3FSUA 3BZGA 4KIEA 4MOZA 3BG5A 3SCRA 4OWGA 5A8PA 3H4WA 2ONEA 5GNYA 4Z08A 2PUZA 3BLIA 2R82A 1DJQA 2KAUC 3TYBA 1V8EA 3W88A 4UWMA 2F6UA 1SVDA 4PCTA 5JIPA 4HPXA 1A0CA 1IR2A 1EBGA 4MY1A 2VZUA 5HXMA 3GH5A 4QLLA 1KNWA 3H70A 3W7RA 4NAEA 5BRBA 2J6VA 3PTMA 4GUFA 5HDRA 3NR0A 3MU7A 1LT8A 2PURA 4L1XA 2G0WA 1FWSA 3ERPA 3M0IA 1NWRA 1KFCA 4DJED 2GVEA 4RLIA 4UFJA 1VPYA 2GVGA 1Q7ZA 3ATZA 4N6FA 3R5EA 1VFMA 1HT6A 3P80A 5J5DA 4UTFA 2QCHA 3FJLA 4PMQA 4W5ZA 1OK4A 1M04A 3ME3A 1OT1A 1HP5A 8TIMA 4N2YA 2OODA 1AA1B 3F5JA 1YRRA 2PRLA 2IQ0A 1TE6A 1TO3A 3BCJA 3EPMA 1RP8A 4B91A 3OIXA 1MYRA 3UCDA 1XKJA 1YHTA 4P7RA 5FKYA 3STGA 4K8EA 3UVIA 5I00A 3GTFA 3PB2A 5CC7A 1B3OA 5A6TC 3VIGA 1IWBA 1SW3A 3LCGA 3VKDA 4S38A 1X1NA 3KHDA 3OGSA 4Z1CA 4E2OA 1R3TA 2AOSA 1D8CA 4QFUA 4XWUA 5AYBA 1IE7C 2CHRA 1R30A 3TP4A 1VFUA 1THFD 4Q3MA 2FIQA 5GJPA 1MNZA 1IQ8A 4O19A 4YVPA 1H60A 4PUUA 3OZYA 1VS1A 2UBPC 2ON3A 1HKIA 1OJXA 1W3IA 3MI2A 5F2LA 1XSKA 3EXSA 4D8AA 1W8SA 4NAFA 2Z1WA 1I2QA 3SCVA 2C6QA 2ZZ4A 1XPGA 1W5MA 3W26A 2GVLA 4CU7A 1OG0A 1TWDA 1AQ0A 4PL2A 4L1WA 8CGTA 4QBXA 3ES8A 3QLDA 1XCWA 1QI5A 4HBKA 2J27A 3N4AA 1NDYA 4NYYA 2XM2A 1VFHA 4WY0A 3NQMA 4HK5A 4KFPA 1XFCA 4RCXA 3MP3A 2H8ZA 1GTHA 3BMVA 3LHUA 3T81A 1Y7VA 3BLEA 4IX0A 1HL2A 4RDZA 3SJ3A 4GC4A 3W2KA 2R1KA 3KTCA 4GGHA 1XXXA 3LU2A 2C13A 3T6CA 3OA5A 1R0MA 1NVMA 5LXXA 4OUIA 5C2CA 1HO4A 2BXZA 1RBLA 2IQTA 3GXNA 3M0VA 2QJIA 1G7VA 2E25A 4HNNA 1M7PA 3A4JA 4FR6A 1X7IA 4DWSC 1EOMA 1MEWA 3DIPA 4CQBA 1YEYA 2UY2A 4R27A 4UR8A 1FY6A 4FXRA 4Z1DA 5I3JA 3LG3A 3TUUA 2A21A 3STCA 3LPPA 4DJEC 4B5NA 1UR9A 1KRMA 4NXKA 4PA8A 1UROA 1WPCA 4NNCA 1IEXA 3M5YA 1RJQA 2QULA 3MP5A 3DFQA 3NQ6A 4P7QA 2ZRXA 1KV5A 2VYOA 2VCCA 3AZTA 3AXHA 3AISA 3WJZA 1DWJM 3BW2A 4R33A 3WJWA 1H5YA 4ACZB 3F4WA 1JPHA 5GVJA 3LB0A 2VWTA 2XH4A 3W1QA 3EAUA 3GBDA 4IGMA 4C6FA 3URQA 4KESA 2AAMA 2RAGA 1E6ZA 4CLMA 2DZXA 1V6XA 3OODA 1GOMA 4UCFA 4PYSA 4HPHA 4UTLA 3DEQA 1SZNA 3SCTA 1JAEA 5AB3A 3HFTA 1ECQA 2VOMA 1PZ3A 1XYFA 4LANA 1ITCA 4NX0A 2ZE0A 5I3GA 2A3AA 3QY7A 1TWSA 1S2WA 3I3DA 1A5MC 1OX6A 2AGKA 1JCTA 1O5XA 3RPDA 4AC1X 3HPSA 3W2UA 5C9XA 1Z3NA 2E0PA 3LI0A 2E5BA 3BW3A 5DT7A 5CC3A 3EX4A 5D8ZA 3O6CA 1PB0A 1WDSA 4NI8A 2UY5A 3POHA 1VD6A 1TPVA 1V7AA 2Y24A 3UW6A 5D2XA 3RLUA 2VEMA 4ZEPA 3PWAA 2WHKA 1A4MA 4GQRA 3G3DA 5F4SA 1JZ4A 3E2SA 1J18A 5LHEA 1XIIA 1SYTA 4MSSA 1V0LA 3R43A 1N8IA 3GSMA 4IFKA 2GSEA 3N1AA 4AY8A 1H41A 5K3VA 5B80A 1DORA 3WEOA 2WAGA 1OD8A 3TAOA 2J9YA 1B31A 2E5CA 3CEUA 3E6EA 2PB1A 1QBBA 4P8VA 8A3HA 3S1GA 4Q6XA 1TPDA 2NQJA 2WZTA 2Q8ZA 2GDQA 1LLOA 4PCPA 4ZR8A 3H26A 5FESA 1W9UA 4EK7A 4YWSA 4H9XA 1PXGA 3GXMA 1WDDA 5LNVA 1XLAA 4O8RA 1H09A 4Z42C 4JCLA 3UR5A 4MUPA 4F8XA 5HA7A 5HBFA 1HQTA 3STPA 3WY1A 5AY7A 2W66A 3G2GA 1QTWA 2BTMA 2WLZA 4MWAD 3W85A 4BA0A 1ZBCA 3H8AA 1W5NA 2CPUA 2VX7A 1VFFA 2QV5A 3W1AA 2J7BA 1JZ3A 5TBOA 3UR2A 1FDZA 1Q4NX 4S3EA 3CIXA 3GK0A 2OYMA 3URBA 6TAAA 1OFAA 2RDUA 1KM5A 4MLRA 2PF0A 1HKWA 1GQKA 1AFSA 5AHLA 4LVAA 4HHPA 3TN3A 2E6DA 1ZENA 4D6EA 3VKJA 5I0DA 5CPOA 4Q4MA 4CKQA 2X41A 3VNIA 4JQAA 3C2OA 1JCLA 1CGYA 4A29A 3WK3A 3WQOA 5KSWA 5FJTA 1FXQA 4NG3A 5ABHA 4B90A 1FP8A 3MY9A 2XH0A 3WFAA 4A21A 3NQ2A 1UPPA 3A4WA 1ZALA 2FH8A 5AC5A 2ALDA 5CSYA 2ZICA 1VB9A 3FAWA 4JY9A 2X7VA