4PMXA

Crystal structure of gh10 endo-b-1,4-xylanase (xynb) from xanthomonas axonopodis pv citri in the native form
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
306
structure length
306
Chain Sequence
AAPLAATASKFLGCAYGAQQAPGFAQYWNKLTPENGGKWGSVEAVRDQMDWSTLDAAYRFAQANQMPFQMHVMVWGNQQPEWIKTLRPAEQRREIEQWFAAVAQRYPDIALLEVVNEPLNDPPSKADTGGGNYLQALGGNGDSGWEWVLQSFRLARRHFPHTKLMINDYSITSSAQATQKYLQIVRLLQRENLVDAIGVQEHAFETTPEVAVSVHRDNLDALAATGLPIYITEFDLDGPTDAQQLADYKRVFPVFWEHPAVHGITLWGFRPGLWRDKEAAYLIRADGTERPALTWLRDYVAAHPGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms associated with xylan degradation by xanthomonas plant pathogens.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Hydrolase
molecule keywords Xylanase
total genus 124
structure length 306
sequence length 306
ec nomenclature
pdb deposition date 2014-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmxA00
1E3XA 1E15A 4PCTA 3WMBA 3AJ7A 5CJ5A 4HPGA 4PTXA 1V6YA 1V03A 3KL0A 5DF0A 1JDCA 4TVDA 4IISA 4E2OA 1B3VA 1UH3A 1JYXA 4GI9A 3N15A 5EFDA 2WZIA 4E8CA 2V5CA 5A6AA 4GXPA 1ZS2A 1JYVA 1TCMA 3VMOA 8CGTA 4AZ6A 1JZ7A 1GOKA 2CERA 4AD5A 4X0VA 4PUEA 2BXZA 1WDRA 1FH8A 4W93A 5EBAA 1UHVA 4JKMA 5I23A 1EA9C 3WMSA 2EPNA 4C7FA 1EGZA 3AROA 3F5LA 2XVNA 3PZQA 1Q6EA 1GHRA 2QV4A 1W9VA 3AHXA 4CD8A 3VO0A 3ALFA 3FN9A 5I2UA 4TVUA 1GOMA 4EK7A 2GDUA 3ARYA 1WZLA 1VFOA 3RJXA 1PZ2A 3AHTA 3EDJA 1BHGA 1CIUA 5A8OA 1CENA 4W86A 3DYMA 1CBGA 4AY1A 3VTRA 3VIMA 3IJ8A 4D1IA 3BSHA 3ARTA 3W0KA 4XUYA 4DM2A 3ZJ6A 3VMNA 1RP8A 5D8ZA 2X0HA 5A69A 3W26A 1VEMA 3W53A 1I1XA 3QOMA 4OJYA 1QW9A 4TUFA 1JNDA 3BAYA 2WC7A 3SUSA 1J12A 3TTYA 1CXHA 2VR4A 1XC6A 5TD4A 4PMNA 2XYLA 4V27A 5E9AA 3RILA 5E0FA 3SURA 3GXDA 2DDXA 1G1YA 3PZTA 2X09A 2J7BA 2YDRA 4WSKA 4BA0A 3F5JA 1U2YA 4PMYA 2WCAA 2BY0A 4J3WA 1CPUA 3TP4A 4MB1A 1W2VA 1QI4A 4S3JA 5D4YA 2QMKA 2ZWYA 5JIWA 2WVVB 1ZJBA 4HP5A 2DIJA 2YDSA 4R5EA 2VC9A 2XFFA 5GNXA 4KWUA 3FHAA 1PEZA 4JFTA 3MV01 4W8LA 2OWXA 4AMCA 2DSWA 4GO9A 4ZEPA 2VL4A 3OLGA 3W37A 2CNCA 5FKYA 3UG3A 3ARPA 3ARQA 3BC9A 4CN6A 2EJ1A 1RD6A 1MVYA 3QR3A 4PMOA 3NSXA 3VGDA 2X1IA 1LWJA 2VX5A 1JZ3A 1ZBKA 2FGZA 1UR2A 2OSWA 1OGBA 3AXIA 3RPMA 2WW5A 3NUKA 1C3FA 5HOSA 3GBEA 1FH7A 1SR0A 4UCFA 1QBAA 4PCSA 5DT7A 2CHNA 3SCOA 1R7AA 5ABEA 3AISA 3OA5A 1V6VA 4S3KA 4JKKA 1JF5A 3ZOAA 3IAPA 1R7OA 2GFTA 3WEOA 1OBAA 4UQCA 1OM0A 4CGTA 3EBVA 2D3NA 1QI0A 2JIWA 5CQ1A 5I0DA 2ZXDA 4UFKA 1R87A 2E0PA 3BCFA 3ZIZA 1UKQA 3SUTA 3J7HA 1PX3A 4HOZA 4GI6A 4W87A 1KWKA 1QVBA 1DTUA 3ARZA 4PMUA 4D6CA 4UOZA 6CGTA 2YA2A 2WSPA 3TOPA 5EB8A 1XHGA 2JEQA 2DPEA 3K46A 1B3XA 5CPTA 4V28A 1ISZA 3K4AA 3U5UA 1OIFA 3NIYA 1AQHA 1W91A 3WEZA 1XRVA 4D6JA 3TTQA 1E0XA 4FK9A 1GQIA 5AYBA 2GUYA 4QFUA 3THDA 1BLIA 3WIJA 1XH2A 2WWCA 3WFLA 4LYRA 1SFSA 3PTKA 4URIA 4ZE5A 2GJXA 4JHOA 3VD4A 1VAHA 2OSXA 3W27A 3SUUA 1B30A 4WK9A 1E4NA 3LMYA 1RPKA 1JGIA 3RMEA 2WNWA 3W6MA 1DWIM 3WENA 3WBEA 2ZX6A 1SMDA 3ZT7A 1TR1A 2EPLX 3UR7A 3CH9A 5M03A 2Y8KA 4GQRA 4F79A 2DH2A 2XWDA 5JBDA 3FNDA 2BY2A 3WNLA 1WZMA 3WH7A 2UWFA 1L0PA 1R85A 4A3YA 3VIPA 2W4XA 1AQ0A 3OBAA 1C8XA 1BFNA 1UQYA 1VEPA 2WWDA 4CCDA 3L4VA 5BRQA 3A6OA 1NOWA 3CPUA 5GNZA 4CVWA 1NARA 1OWQA 1FOBA 1GVYA 3MU7A 1JYWA 1B9ZA 3NCOA 5A6BA 2VO5A 2V3EA 4CD4A 3VMPA 1KGUA 1VIWA 3BCDA 1YHTA 1HVQA 3A47A 2WMJA 4WIWA 4RE3A 4JKLA 1UKOA 4DUXA 1M03A 4MPKA 1B2YA 2O92A 1PPIA 1HJSA 2VZSA 2PWEA 1HKMA 2VCCA 1EH9A 2X0YA 1LLOA 2GJRA 3APGA 2DH3A 1G0CA 2GK1A 4P7NA 2RGMA 2E8YA 2ZUVA 1P6WA 1QNSA 2UY3A 3VUPA 4MJ4A 3ZT6A 4MDPA 4P8VA 1XSKA 3SUWA 4EE9A 3OLEA 2X8RA 2OYLA 5HNNA 3W24A 2J47A 4P7OA 3QGVA 5LA0A 1HKIA 3HMCA 4M1RA 2A3AA 3T0DA 2OWCA 3OGRA 4OOUA 5M5DA 2BVTA 3FAWA 4Z2KA 3WMCA 3SIMA 5ABFA 1E5NA 4U2ZA 2J4GA 1DWGM 3TTOA 3QHMA 2Y24A 4JZ5A 1U33A 1N82A 1HL8A 3MV11 3VD7A 2ZUWA 4ZXOA 1HX0A 3GDBA 1UR4A 4TTGA 4U3CA 3CMJA 2V3FA 3ZJ8A 4M8UA 1XD0A 5ECUA 1TVNA 4IUGA 4PMRA 2YKKA 5BXRA 5BXPA 1W32A 1UD8A 1WE5A 3KE0A 2QLYA 3GZAA 4X9YA 2VX6A 4UFHA 1B31A 1EDGA 3PZGA 1EQPA 5I6SA 4Z2JA 1W3HA 1DWFM 3WNNA 1V3KA 1BYCA 4JL2A 4OKDA 2VOTA 1TE1A 2VX7A 4HMEA 1E6PA 1C7TA 3DYPA 4IPNB 3VNYA 1GOQA 4CCCA 4CUCA 3DHPA 1TA3B 1E6RA 3WD2A 4UNIA 5EFFA 1UR1A 4A4AA 3F5KA 1HP5A 5D9PA 1A47A 1UWIA 1E43A 7A3HA 3MKKA 2D20A 3VX1A 2G3IA 3I3EA 2VJXA 3FXYA 4MB3A 2ZXAA 4ATWA 3WQWA 3ZSTA 4JHZA 1DWHM 3B9DA 4UQAA 2FDMA 1XSIA 3M7SA 5A1AA 3EYPA 4UFLA 1JZ5A 2GJPA 4HZ6A 3MUZ1 1E4LA 1JI2A 1JZ2A 3BXWA 4NZCA 2WMHA 2J7CA 1ZU8A 1TVPA 2E40A 5DEZA 6TAAA 4D6EA 4P7LA 1V6WA 2DT1A 2IXVA 2WVSA 2XGBA 1QI5A 2CKRA 2NSXA 1JF6A 1C90A 4HMCA 4A3HA 4DWSA 2W5FA 2PC8A 1V0MA 5EMYA 1UH4A 4U2YA 1EIBA 3CLWA 1J0IA 2XVLA 2YLLA 1WDPA 3AZRA 4M82A 4W7VA 1H4PA 2OYMA 1B1YA 4UQBA 5KZ6A 3FHQA 4OZOA 4NSBA 3CZGA 3A4WA 3WUEA 2CXGA 2BHYA 3MUY1 1TA3A 4CN1A 4Y7EA 4DWSB 2YJQA 4DM1A 1WDSA 2PBGA 4AIUA 5AY7A 1TZ7A 4CU6A 1KBKA 1MWOA 1BYAA 2O9TA 5C70A 2BY1A 4WKFA 3SEPA 4V2XA 3VGFA 1KCKA 1OINA 3VGHA 1BAGA 3BH4A 3VGEA 1V3HA 1PX4A 3ZR6A 4J27A 2PWHA 4H8HA 2FGLA 3L4YA 2XWEA 1PAMA 4M29A 4X0NA 3MMUA 1XH1A 4W84A 3BAKA 3CZLA 1ZBCA 5HBFA 3GYCA 1E1FA 3WUBA 1XYFA 5M3WA 4FLSA 3MUIA 3OIHA 4H2CA 4FLRA 1L8NA 2W66A 1M53A 3UEQA 3CUGA 1H3GA 1KWGA 5FL0A 2EEXA 3WY1A 2WC3A 2D22A 4P7QA 3VIIA 3WQ5A 1UKPA 5D9NA 3ARXA 2XIBA 1WPCA 1HIZA 1JAKA 2QF8A 3VM7A 4KRTA 5A3HA 3UG4A 4CD7A 3EMZA 2EBNA 3LPGA 1CWYA 1C7SA 1GONA 1UR0A 3A3HA 3SCPA 1WZAA 1V3JA 2DSVA 3S6TA 3WH9A 4RE4A 2WKGA 3N17A 3DYOA 1ISWA 2BY3A 3W25A 2PWDA 1V3LA 3CHCA 1CGVA 1LL6A 3WF2A 4QCFA 1UOKA 3WL0A 5CGMA 4XB3A 2BHZA 4CKQA 1PBGA 4AWEA 3AMKA 4DUVA 3AYSA 1W3KA 5ABGA 1CXLA 4OUEA 2IXUA 1S46A 2CYGA 1GVIA 5A8MA 1JAEA 1MXDA 2QHAA 4WKAA 2WMKA 4MB4A 3AZSA 2WMGA 3RJYA 2GVYA 2G3NA 2ZOXA 3CUJA 1UWRA 3W4RA 4CU8A 4QP0A 4UQDA 1XSJA 3SCWA 4W5ZA 4J3VA 3CO4A 2YL9A 1ITXA 3WH6A 4J3UA 3WNOA 4FLQA 1UR9A 3WF1A 1H49A 5AC4A 2WYSA 3N12A 3AS3A 2WHJA 3FY1A 4OBRA 2DQXA 1DP0A 3AXHA 1J01A 3AMDA 4ZXLA 3PZUA 3ZSSA 4QDMA 3ZQ9A 2XHYA 4AZBA 3MANA 4AEFA 1MQPA 1M01A 5GNYA 1G01A 2WVTA 1JDDA 2VCAA 4HZ7A 1W1PA 4H04A 3PZMA 3WQ4A 1CXKA 4WSJA 4J3XA 3WNMA 4F9JA 1NP0A 3VD5A 3UG5A 1K6AA 1KR0A 1D3CA 2D0HA 1E0VA 4CD6A 1W2PA 5KEZA 1UH2A 2JFEX 4P8XA 4WJXA 1WP6A 1E6QM 2YA0A 4F8XA 4HU0A 4J3SA 3BGAA 4DWSD 4PSRA 5I78A 1NQ6A 4RE2A 3VIHA 3IJ9A 3T0BA 5LA1A 5I3DA 2XVKA 4QLKA 3CHFA 3T09A 4MTVA 4AD2A 4TVCA 4AC1X 2WAGA 1ZBWA 2VZVA 2ZX7A 1XD1A 2OWWA 1UR8A 1M04A 2BVYA 2D24A 3NDYA 2W63A 3KWXA 4MDOA 4NF7A 1CGUA 1C93A 1Q6FA 1HJUA 2OLHA 4YN5A 4U5KA 5BWFA 1QW8A 4XX6A 5A2CA 1MYRA 2VRKA 1KBBA 3II1A 1LG2A 3N18A 1BVNP 2J79A 3CTTA 4D6HA 4XZBA 2GJXB 4AZCA 2PWGA 2WMIA 3PTQA 1JZ4A 4F66A 3AIUA 4IM4A 1MQRA 1V08A 3GXFA 4HZ8A 3SCVA 1HJXA 2RGLA 4JL1A 1QNRA 4AZHA 1NWRA 9CGTA 1PX8A 3N13A 4E4PA 3AIRA 1ESWA 3K8LA 4Z2HA 4TXEA 1XYZA 1Q4NX 2C0HA 3VNZA 1WNOA 2VRQA 1SYTA 2WM0A 4PRWA 2FH8A 4HU8A 2YIHA 4P8UA 3VIJA 3MS8A 3OG2A 1H0IA 2YA1A 3ZMRA 3M07A 3WD0A 4JAWA 1OGSA 2UY4A 3GH5A 1GQKA 3WD4A 3UR8A 2E9MA 4FF5A 4C7GA 2J7FA 2A3EA 1GHSA 3WQ6A 1OD0A 2CBUA 3WQVA 1ZBVA 4UFMA 3JUGA 5A6MA 1VBUA 2EQDA 1QHZA 2VT0A 3AICA 2E9LA 3G6MA 5FOOA 3GH4A 4XZWA 1H09A 2A3BA 4BZYA 1QOXA 2XFYA 2DIEA 4W8AA 2X05A 4CD5A 3NSNA 4B15A 1GPFA 3AI0A 1JFXA 1BG9A 4PMDA 4KGJA 4YPJA 4NRSA 1EQCA 1QPKA 1GQJA 5JBEA 2MANA 4BQ2A 3SCSA 2QPUA 1TMQA 3OLIA 4HA4A 3PZOA 2D2OA 1PJ9A 2PWFA 1V0NA 4LX4A 3WH5A 3W29A 2WBKA 2EO7A 4IPLA 5E6YA 2E4TA 4UOJA 2EPOA 4YHEA 1CGWA 1D2KA 3U5YA 1E6ZA 3WD3A 1GJUA 1K9TA 1WAWA 4EAMA 3OLDA 2VZUA 3M6DA 2VX4A 3PZVA 1IZKA 3U7VA 4H7VA 4RL3A 4HOXA 3CZEA 2E3ZA 2VCBA 1Q6DA 1E70M 1E73M 1NH6A 1W3JA 2J25A 3KEHA 4GI8A 1CXIA 3VD3A 2WPGA 4GO8A 3ARVA 5IDIA 1J11A 1QI2A 4PTMA 2YBTA 5IFTA 3CUFA 1MQQA 5D9OA 2DT0A 2XUCA 1EDQA 3AQUA 5BXTA 1W1VA 4MB5A 1UD3A 2XVPA 3T08A 2E8ZA 2XM2A 2OYKA 1WZKA 5D8WA 2VRJA 1X6LA 2WSKA 2WLYA 1UA3A 3RDKA 1MFVA 3HU7A 4W7WA 3W28A 2G3MA 1W9DM 3WF3A 1FP9A 3POHA 5A2BA 4WF7A 1MFUA 1V6UA 3EDDA 4Z2GA 3UESA 1NOFA 5JIPA 1LL7A 4MNLA 3CBWA 3CZ8A 1W9UA 4J3TA 4U3AA 2FHFA 3L4XA 1R86A 3HN3A 5A94A 1J10A 2ZE0A 3PZIA 1CLXA 1G9HA 4YHGA 4JFSA 4PMZA 3BAWA 2FH6A 1E56A 4OBSA 1FH9A 1UUQA 4JCMA 1GW1A 4Z2IA 4LYQA 1VFFA 2JF7A 2OSYA 1UD6A 1HJQA 2J74A 3L4TA 1ITCA 2J62A 1GQLA 2VR5A 2JF6A 5IHSA 2WHMA 1Q6GA 4ATLA 5JBFA 5A8QA 3W81A 2V38A 2WHKA 3WBAA 1GOWA 2CCRA 2VQTA 1UKSA 4JFWA 4XV0A 1QBBA 1TG7A 3AIEA 1KFWA 5A6BD 1QNQA 2VURA 2Z1SA 4ZFMA 2VVSA 3LPPA 1W9PA 4D72A 1CGTA 2NT1A 1EXPA 4U5IA 2Y2WA 1Y7VA 2BNJA 2VUYA 3WL1A 1JIBA 1C91A 3RO8A 1JI1A 2CHOA 1HXJA 1KGWA 4FLOA 4UFJA 2ZX8A 5LA2A 2W67A 3NYDA 5JUVA 4H8UA 1JDAA 2YLAA 4CN4A 3I3DA 3ECQA 1K9EA 2W91A 3GTNA 3PBGA 1JYNA 2XM1A 4JFUA 3EDFA 2G3JA 4W7UA 1E72M 1EHNA 4P8WA 3WEMA 4MNJA 3D3AA 2XPKA 1EDTA 2XTKA 5CLTA 3VINA 4TX6A 4QLJA 1OD8A 4EKJA 3TONA 2QMJA 2X2YA 4UR9A 3WH8A 1HP4A 3E1F1 1A3HA 1BGGA 1H1NA 1C92A 1BVZA 1X1NA 3CUIA 4NI3A 1C8YA 1ODUA 2J7DA 7TAAA 2YBUA 3VIOA 3GBDA 3IJ7A 1JFHA 5DT5A 5BROA 4CU7A 1B90A 2F61A 1OIMA 2BXYA 3AXXA 4L4PA 5CSYA 3CZKA 3D5HA 3WDHA 2D0FA 1G94A 2EPKX 1KGXA 5DMYA 3VX0A 2YOCA 1E71M 4W88A 4FMVA 5ABHA 2PBOA 2W61A 4ACZB 3NSMA 2IUZA 3PZ9A 3CHEA 5A95A 1V0KA 2V3GA 1XV8A 5DO8A 4LXFA 3WDQA 1I1WA 4GZIA 4LYPA 5CXPA 1WDQA 4AYSA 3GM8A 4JCLA 1Z32X 3AMLA 3AIWA 5CLWA 4KMQA 2YL5A 1DWJM 4PSPA 2DT3A 3KZSA 1E4MM 1W3LA 3SCTA 1EOKA 5A6JA 4AZGA 4B9YA 5CZKA 3L4UA 3O6AA 4PUDA 4L4OA 1JG9A 3WUFA 3AS0A 3GNRA 5AYIA 3AHYA 2WZHA 5C8BB 2G4FA 4H41A 1IV8A 4OOZA 1BTCA 3VPLA 3W6LA 2BFGA 2VZOA 4PTWA 2VQUA 1VFUA 1FFQA 3AHVA 4AD0A 4D6GA 2EPMX 3MMWA 2CEQA 4NRRA 3L4ZA 1H2JA 2XFRA 4Q7NA 1D7FA 4MJ2A 2WHLA 5HPOA 4D6IA 4GKLA 1V6XA 1FFRA 2A3HA 4D6DA 4W85A 1GORA 1V3MA 2BHUA 1BQCA 1ZJAA 3EMQA 3CGTA 1E6XM 4AZ7A 1VEOA 2XJ7A 3BAIA 5CGTA 2CPUA 3QHOA 1KCLA 3ARRA 5E09A 3VDCA 1KR1A 3I3BA 3L4WA 2GSJA 4D6FA 4W5UA 3VILA 2Q8XA 4M56A 5IFPA 1J18A 3WDPP 3VD9A 1AMYA 1AVAA 1W1TA 3O9NA 1BSIA 3KL5A 4DWSC 2CESA 1VBRA 3L2MA 4C7DA 1GJWA 3VDHA 5GPRA 1JXJA 2J78A 1WB0A 2D0GA 1HNYA 2VNCA 1E5JA 4HOWA 1XCWA 4LGXA 1JZ8A 2CITA 3N04A 3DECA 2ZUUA 1J0ZA 5DFAA 3VM5A 3AYRA 2WK2A 1OGGA 1CTNA 1E3ZA 4D71A 3VIFA 3A4XA 3DHUA 3N1AA 1E55A 1XH0A 5I5RA 4B3LA 3BAXA 1UWUA 2O9OA 3K8MA 4LQ1A 1TUXA 3VIKA 3ZO9A 3AS1A 3T0AA 2JEPA 2F8QA 1DHKA 1B3WA 1W9BM 4AD4A 1NM9A 4BS0A 3ZJKA 1I75A 3CHDA 5FCZA 1QNPA 4AIEA 3AMGA 1JD9A 1VRXA 1FHDA 3ZR5A 1EHAA 3B8SA 3AOFA 3PZNA 2CKSA 1V3IA 3IK2A 3BMWA 3WKZA 1XCXA 3MUAA 4AW7A 2UY2A 1O7AA 1E40A 3ARUA 1ISYA 2D1ZA 3SUVA 3GNOA 1WO2A 5GQBA 1K9DA 1DWAM 1V02E 2XIIA 3ZM8A 4TOQA 4ACYA 3OB8A 1US3A 5BCAA 4J28A 4UQEA 1LQ0A 3WNPA 1VENA 3SCNA 3WF4A 1CXEA 1KXVA 2Y5EA 5A8NA 2ZUSA 3RM9A 3WDIA 1B0IA 3PHAA 4AISA 4HPHA 4AZ5A 1FP8A 2HVMA 3S2CA 4MNMA 1B3ZA 3POCA 1G5AA 3ZT5A 5ABFB 1MW1A 2A3CA 4PYSA 3QHNA 5A6SA 4GZEA 4N42A 4AD1A 1UZ1A 4AIOA 2WLZA 1NWSA 4Z2LA 1V0LA 4W8BA 2J75A 5E0CA 2CIPA 3AMCA 3OGSA 1CLVA 2GDVA 6A3HA 2Z1KA 2G8ZA 2J7HA 3GXIA 2YL6A 4MNKA 4HA3A 5CPQA 3HJEA 5A8PA 2FHBA 3NDZA 4AD3A 4W89A 5IHRA 5HDRA 3O2LA 1QI3A 2WZEA 3WDRA 3U57A 3WD1A 3W38A 4QLLA 1HKJA 3WF0A 2W92A 3CMGA 2V5DA 2BS9A 3GH7A 2VVNA 3RM8A 4BQ5A 1QNOA 2WVUA 2V3DA 3OZPA 1NWTA 2WKLA 4U31A 1GUVA 4B3KA 2HISA 1KQZA 3ZJ7A 1O6IA 1RH9A 1H0GA 1HF6A 2WBGA 1J0KA 4B9ZA 3RCNA 1J0YA 4JFVA 3B9AA 4TTUA 2GK1B 2FHCA 4GINA 4JIEA 3VGGA 4HTYA 2CETA 1KXQA 3AFBA 1X6NA 3WELA 2DSZA 2XVGA 1OCQA 3AIVA 2C7FA 3CIVA 3FAXA 1MXGA 3AS2A 1R8LA 2ZX5A 1JNEA 3AHZA 2XG9A 3DC0A 5C71A 1HN1A 4WLCA 4E8DA 2D3LA 4H8VA 3VDAA 7CGTA 2E9BA 1UD5A 2C8NA 3TA9A 1HJVA 4PMXA 4KH2A 3OZOA 5AC5A 2J7GA 1E9LA 2O9RA 2WVVA 1UD2A 3LPOA 1H41A 4ATDA 1VF8A 5A6LA 5M17A 4KGLA 2Y8VA 5I24A 2WMFA 1UKTA 2EXOA 3LPFA 3EDKA 1UA7A 2UY5A 4ZE4A 2XGIA 4QAWA 4UOQA 3N9KA 2J8FA 1LJYA 3IAQA 4M24A 3KL3A 1ZL1A 3VDBA 1UG6A 3ALGA 1CYGA 2Y4SA 5IXEA 4F9DA 1CXFA 3F4VA 3BLPX 1JZ6A 3MO4A 1BF2A 1UD4A 1HJWA 1J9YA 4UZSA 1CGXA 1M7XA 1NOUA 4R27A 2DEPA 1ISXA 1BG4A 3WDJA 2JIEA 3EMCA 2ZX9A 3THCA 3SCQA 2YL8A 1UQZA 3WFZA 1JL8A 1MW2A 2J8GA 1CGYA 5CPSA 1KQYA 3U7BA 4EANA 1BGAA 4OIFA 5CSUA 3GXMA 4BQ4A 2ZICA 1BYDA 1GCYA 4CVUA 1EO5A 1GNXA 3T2QA 2DSKA 4PBGA 2ESCA 3BAJA 1W1YA 4P7RA 3VGBA 2JE8A 2JALA 3W82A 3AIBA 2WCGA 3ARWA 3T2PA 4PEEA 1E0WA 2ZUTA 3RIKA 1KB3A 1K9FA 4AXNA 3TTSA 3BSGA 2CBJA 2WB5A 3VU2A 4PTVA 2ZIDA 2VTFA 1B3YA 2ZUNA 1MW3A 1BPLB 1F4AA 5HPCA 5BYWA 4UFIA 1LF1A 1VJZA 4ACZA 3MMDA 3AIQA 4AZCB 1DEDA 1LG1A 1MW0A 2WC4A 1UWSA 3WQ8A 2WANA 5E6ZA 1HVXA 3EDEA 1CEOA 3MSDA 5A2AA 3FW6A 2G41A 5I79A 4QCEA 3VKKA 2ZXBA 5A6KA 4KRUA 1RP9A 3BLKA 4MAZA 4BCEA 2VZTA 4AZIA 4GPNA 2NW0A 1ECEA 1VJSA 8A3HA 2B31A 1NWUA 1QHPA 2J7EA 1LL4A 1SMAA 2ZUMA 3AZTA 4WKHA 3K4DA 1QHOA 3NJ3A 4PN2A 2PF0A 3IANA 1HKKA 4BF7A 1KXTA 4MADA 4MAVA 4UZUA 4HMDA 5E70A 4UTFA 1WKYA 4UQ9A 4B16A 1IT0A 1CZ1A 1Q6CA 3K1DA 2DGAA 1E1EA 4GZJA 1WCGA 2VI0A 1CDGA 4M81A 1YQ2A 3SCRA 4K68A 2W62A 1EO7A 1LWHA 1XGZA 2VMFA 3RM4A 1BYBA 2AMGA 1VFMA 1F4HA 2AOSA 4PMQA 3K8KA 4ZENA 5I77A 5FL1A 3N11A 2PI6A 1E4IA 1AQMA 1PIFA 5HXMA 1ZB5A 2XSAA 3MSGA 4N0RA 1H5VA 1KXHA 2CBIA 1OT1A 2AAAA 3WN6A 1PIGA 3BMVA 2YDQA 3ARSA 1GOOA 1JXKA 1OT2A 3L2LA 2TAAA 3UCQA 2D23A 5D9MA 3GNPA 1H11A 2DSUA 2ZXQA 3QOKA 4CCEA 2XSBA 4HA1A 3A4AA 1C8QA 5FD0A 1CNVA 4Q22A 2DT2A 5CG0A 3UERA 3SCUA 2BV9A 2F2HA 2BVDA 2NT0A 1IZJA 3OGVA 4D1JA 4M80A 3T2OA 1JD7A 2ZWZA 1J0JA 3CUHA 4U33A 2CBVA 1V02A 2WMIB 1E6SM 1GZJA 1US2A 2QPSA 1U30A 3VOCA 1TFVA 3CZJA 4LPCA 1UYQA 4GIAA 5BRPA 1CECA 3WSUA 4ML4A 1FHLA 3PTMA 4DUWA 1UZ4A 1W9XA 1FA2A 4TX8A 4BQ3A 1OB0A 1PZ3A 3G6LA 1HL9A 3WNKA 3WUGA 5BXSA 1ISVA 1GOIA 3VVGA 4GQQA 4PMVA 5LYRA 4J7RA 3PN8A 1EOMA 2O9PA 5F7UA 1VB9A 4AEEA 2WXDM 1NP2A 1HT6A 1UWTA 1ODZA 3B9EA 3M46A 2PB1A 5FIPA 2J77A 1J0HA 1E6NA 2WCSA 1UWQA 1OSEA 3VIGA 3UETA
chains in the Genus database with same CATH superfamily
2YZRA 3AJ7A 5CJ5A 3N6HA 4HPGA 3DFTA 3ATZA 1JDCA 2I17A 4TVDA 3DFYA 1OFOA 1TX2A 5EFDA 1K1DA 4GXPA 3U48A 1JYVA 3LBMA 1FRBA 4AZ6A 4BHYA 1GOKA 4AD5A 1KRMA 4LAKA 1MMFA 1S3TC 2BXZA 2PDCA 3G1SA 1F3EA 2YFOA 5EBAA 3STGA 2GSHA 3G1RA 1JUEA 3N2CA 4C7FA 2A7RA 3SI9A 3KWSA 3F5LA 1RV8A 4B5VA 2XN0A 1H61A 1PB0A 1SZFA 4MM1A 1EUAA 5I2UA 3B8DA 3CM4A 4QM1A 1GOMA 5D04C 4JYEA 6REQA 1FHUA 3OODA 4LB4A 3AHTA 3SFWA 1NU5A 3EDJA 1BHGA 1LQ2A 4PA8A 4HNTA 1SGJA 3T1GA 4AY1A 3THQA 5C6MA 4GYJA 1J6OA 4L5ZA 3W0KA 4ZQNA 4G8TA 5D8ZA 5MF5A 2WQDA 3W53A 4Q4KA 1QW9A 2YB4A 5CPNA 4B5NA 3C52A 3O15A 4JIHA 1R2SA 3C4UA 1AFSA 2VR4A 3W2MA 3VDGA 1XWYA 3ZS4A 3MSYA 3AYVA 3BZJA 4PMNA 1YYAA 4QROA 1WOAA 3H2AA 3RILA 2NV9A 2DDXA 1G1YA 1RLCL 3PZTA 3GXPA 2NXGA 3F5JA 1U2YA 1GEHA 1XG4A 2WCAA 4GWEA 5C9XA 1EGMA 1P6CA 1QI4A 2ZWYA 2GLKA 2DJLA 1ZJBA 2YDSA 3N4AA 4R5EA 2VC9A 4LVFA 4MHBA 3LHZA 2XFFA 3FJNA 3SJNA 3CPRA 4LCRA 5GNXA 5D03A 1MRAA 1OABA 3MV01 1QNVA 4R33A 4Y9AA 4ZOAA 4AMCA 2DSWA 4GO9A 4QJ4B 3F03K 3W37A 5AB3A 3ARQA 3C86A 5E9XA 4XTIA 3P8IA 5G2IA 2Y5JA 1XX1A 3QR3A 4LALA 5AVHA 1XL9A 2X1IA 4HNLA 1XFCA 4DLMA 3LCGA 1FH7A 3QQ1A 4ZOCA 4WZHA 1HQTA 2CHNA 3AISA 1GZ1A 1XLCA 3BV7A 4S3KA 3M0XA 3EXTA 2L5HA 3RHGA 3TDFA 3FGCA 2GFTA 4UQCA 4IQDA 4LB3A 4AHPA 2D3NA 2I9UA 1OFBA 1XUUA 4EPEC 2JIWA 4W9TA 4IMGA 5CQ1A 5I0DA 3W02A 1UKQA 4HSHA 3PPFA 2CXEA 3J7HA 4D8AA 4H1ZA 4HOZA 1KWKA 4X63A 4ZOEA 2YA2A 5FJPA 1OQFA 3TOPA 1XHGA 3K46A 1B3XA 2Y70A 4MG4A 3PBYA 3U5UA 4O0ZA 3B8VA 3WEZA 3QQWA 5DBUA 4FK9A 1O5QA 3MWCA 3R0DA 4ZE5A 3FIGA 3VD4A 3M9YA 1QW7A 2OSXA 2I57A 5TNVA 3W27A 2A5HA 4WK9A 3F4NA 3LMYA 1JGIA 3UU0A 3SB0A 3SM0A 1WKDA 1QPNA 2ZX6A 4PUUA 3B3DA 1GYMA 4RXFA 4GQRA 5TQLA 5XIAA 4PFMA 2BY2A 1WZMA 1HKWA 3WH7A 3E0VA 1A5MC 1I60A 3HPXA 3ITOA 3ZLHA 3BOXA 2NUXA 3EWBX 1XLIA 1K7EA 1C8XA 4M1BA 3MI2A 1BFNA 1UQYA 5BRQA 5H6HA 4DNMA 1NARA 4RE0A 1O4UA 2FMNA 2YCLA 3N9SA 3W23A 2V82A 3GO2A 3NCOA 5BMWA 3UY7A 2V3EA 2VHLA 2ADAA 4S38A 4Z0JA 1P0EA 4RE3A 3URNA 4LAOA 3KUMA 4R53A 4DUXA 1B2YA 2O92A 1PPIA 4AYGA 1HKMA 1UP2A 1GKRA 3BVJA 3PBWA 2X0YA 2DH3A 1G0CA 4KEZA 2FB3A 4P7NA 1PTAA 4GVGA 4K39A 3W6YA 1P6WA 1QNSA 1JQXA 4B5XA 4E8GA 1KD0A 3IK4A 3VUPA 3ZT6A 3EA3A 4POCA 1OF6A 1XSKA 4EF8A 2X8RA 3W24A 3B03A 4LEQA 4P7OA 4ILSA 1IEIA 4LF2A 3KZPA 1HKIA 4GY0A 4UTTC 1D3HA 4EPDC 3P8JA 3QN3A 4Z2KA 3WMCA 1VP5A 2J4GA 3QY6A 3NVDA 3SRDA 3WLRA 3W87A 4JZ5A 4NZ4A 1HL8A 1T6MA 3G1DA 3RK8A 2VFDA 4OV4A 4QEHA 2FVKA 4I5UA 5ECUA 1OFPA 3TXZA 4JEQA 5B7YA 2FZNA 2HDJA 2RDXA 4RJEA 4I7UA 4DJEA 2BX7A 1JULA 3M0JA 3KTCA 3TTEA 5HUPA 1V7YA 2OZ8A 1W3HA 3WNNA 2DW7A 4I7WA 4JL2A 4OKDA 1WUFA 1E6PA 3F7JA 3TCSA 3DYPA 4IPNB 1O5RA 2E5BA 4CCCA 1EC7A 3NEVA 3ORWA 1F8MA 2RH9A 4LCSA 3TX9A 1MNZA 4ICCX 4JTJA 2R24A 2E28A 2Q01A 4X9SA 3UWWA 3QH2A 3I3EA 4C6DA 4ATWA 4NXSA 3WQWA 1OFAA 1DWHM 2HV5A 4K8EA 4KCUA 1Z6KA 3M7SA 2RDTA 1JZ5A 2GJPA 1KV8A 1VJIA 1K7XA 3WLJA 3MUZ1 3ANUA 1EYEA 3BO9A 1KTCA 4NZCA 2B0MA 2J9XA 1ZU8A 4GLEA 5HMSA 3QXBA 2Z1XA 2QVNA 1LOLA 1FWWA 4FHAA 3HQOA 4RV3A 1OYAA 4RZBA 2DT1A 2WVSA 4HN4A 3EKLA 4UTLA 2VWSA 3UVIA 3QYQA 3EWDA 4Q6XA 1V0MA 4U2YA 4L6OA 5I02A 1SFLA 4KEMA 1B1YA 1K8CA 3FHQA 4NAEB 2GGEA 2REQA 3CPGA 4NSBA 3CZGA 3FJ4A 4NNAA 1KCZA 2BHYA 3VAVA 1QCWA 1R2TA 2PBGA 2AKZA 4PR4A 1KBKA 1MWOA 1TMHA 4QG9A 1K77A 2PLKA 3W83A 3SEPA 1YDOA 1XW8A 1GVEA 1N8FA 2GVJA 3LD5A 1BAGA 3VGEA 3ITLA 5K7JA 2PWHA 4H8HA 4JR5A 4QE4A 4IP5A 1DIEA 1GGOA 3L4YA 1M9HA 3N14A 4X0NA 2EF9A 2C16A 3MMUA 4C6QA 1XH1A 2RKXA 4AHQA 3VNJA 4G2DA 1E1FA 3P67A 5M3WA 2V6AA 2D69A 1J96A 1LCOA 3P14A 2Z1VA 5FF0A 1VZWA 3OIHA 4H2CA 1ECQA 2VP8A 3ZYZA 3HG5A 2ZE3A 3FXGA 4RPQA 1RLDA 2WC3A 4UBPC 1IIHA 2V5BA 1QASA 4GBUA 2QCDB 4GFIA 1HKVA 1JAKA 3MP5A 5D02A 3B8TA 3VM7A 4O16A 4HA0A 3AXMA 2PCQA 5JMUA 3JS3A 3T0TA 4CD7A 2Y61A 4M3PA 1DJHA 3EMZA 3A3HA 3SCPA 1ME9A 1SO5A 1V3JA 3S6TA 4MKSA 4WRHA 3WH9A 3FEQA 4DZ5A 3NFUA 5I3JA 1ISWA 4EOUA 2IKJA 1QOPA 3NQVA 4DJFA 2PPGA 2PWDA 3W25A 3SSJA 4O1BA 1MI3A 3R4IA 4DBUA 1LL6A 5B7ZA 1UOKA 1BKHA 5CGMA 4XB3A 4QS5A 1QK2A 2H3BA 3AMKA 3UJFA 4TMBA 4OUEA 1BWKA 1QO2A 2W79A 5BNKA 1JAEA 2X0SA 1IEWA 2QHAA 4WKAA 4JS3A 3RJYA 5CBIA 3QV9A 2PTZA 2YZ5A 3QMSA 1DJWA 3DEQA 1F61A 4UQDA 1XSJA 3RCYA 3SCWA 1EKOA 4J3VA 1EC8A 4BF9A 4FLQA 1DKWA 3VA8A 3WF1A 1SQ7A 2DORA 1H49A 3N12A 1YTKA 3MB9A 3AMDA 3GG7A 3P5YA 4HNCA 4ZXLA 2PDNA 1AD1A 3ZSSA 3BMXA 4A29A 5DANA 1HL2A 4PC8A 3O6CA 2R1PA 2WVTA 2QDHA 4I6KA 4HZ7A 1W1PA 3TFCA 3WQ4A 1CXKA 3GFXA 6REQB 2OX1A 2FDSA 1RK6A 4CQDA 2R8WA 4AEOA 1K6AA 1D3CA 3FV9A 3OIXA 1UH2A 3BICA 1QFEA 2YA0A 2DZVA 2Z7KA 3U2CA 3BGAA 5F4XA 3KOYA 4A35A 4IGNA 4N2YA 1XDMA 4H6EA 3TMLA 4HK7A 4RE2A 3C2EA 4DZIA 5LA1A 3AAMA 3NQBA 1O5KA 1JUKA 5BOOA 3LNPA 2HS8A 1QTWA 3C2YA 3EWUA 3VUSA 1AW1A 1TYGA 1DJIA 3C0QA 1TPWA 1EJTC 1BEUA 1UR8A 3IVUA 3Q65A 3NDYA 3TYEA 3E6EA 3KWXA 4NF7A 4YN5A 5BWFA 2VRKA 9RUBA 3L0GA 1BXNA 5KZDA 4D6HA 4EWJA 4XZBA 2GJXB 4AZCA 2XZ9A 1TZ9A 3UWVA 3STFA 1JZ4A 3NZRA 4F66A 3WQDA 1V08A 2ZKMX 4DF0A 3H4GA 5IM51 5CPLA 4JL1A 1ELSA 4REQA 4KW2A 1VLWA 3HA1A 1XBZA 1PX8A 3N13A 1ESWA 4LS1A 3K8LA 2W27A 3IARA 2C0HA 2VYOA 4FX7A 2GUUA 4PRWA 1U83A 4IX0A 2YIHA 1B9BA 2F84A 3P62A 3OG2A 3ZMRA 1UC5A 5D32A 3QC3A 3LRKA 4MYAA 1GQKA 5K9CA 1VFLA 3GSMA 5G1YA 3UR8A 1F74A 3Q2DA 1KNWA 3OJGA 2J7FA 2OQYA 2HRWA 3WK0A 4C1KA 3WQ6A 1OD0A 2CBUA 1OZMA 3JUGA 1AA1B 1YXYA 1Q45A 2GVLA 5FOOA 1ZPTA 4XZWA 2Z29A 1SZNA 1QOXA 3MYPA 3IGHX 3R43A 2X05A 3NSNA 5EMMA 3AI0A 1VYSX 1BG9A 4PMDA 5AN7A 4KGJA 4H6QA 3DHFA 4UCGA 5EBUA 3VI2A 1OC7A 4DYJA 3PUGA 3GTIA 2HROA 1EL3A 2YW4A 1TMQA 4HA4A 2QQ6A 3GG8A 1V0NA 4MY8A 3WH5A 3W29A 3GLCA 5E6YA 4IPLA 9XIAA 1CGWA 1LM1A 3FJ6A 1F7BA 3UP8A 3EWCA 4GYFA 2F9RA 5KSWA 4C6MA 3OLDA 3ITXA 4XBJA 2R1MA 4H7VA 4RL3A 1O95A 5CSSA 2E3ZA 3G22A 1W3JA 1NH6A 2ACQA 2Z2BA 4GO8A 2I5IA 3GU2A 1Q7QA 3WG6A 2ZC1A 4EXBA 5D9OA 1UUMA 4LVDA 3AQUA 1W1VA 3S83A 4DX3A 2XM2A 2PDUA 5D8WA 4LVGA 3YPIA 2VRJA 4JTTA 2V2DA 2WLYA 3R7MA 4H4IA 4E38A 1FP9A 1UMLA 4OVXA 3POHA 4LSBA 1MFUA 3EDDA 4PODA 3M0ZA 1W9UA 3F4WA 2G4JA 4QR6A 1M7PA 4YNGA 4YHGA 1G9HA 1F07A 4JTAA 1R3RA 1P1MA 5AVNA 3N2MA 2FH6A 1J5SA 1GW1A 3PJTA 4LYQA 4Z2IA 1K8YA 2OSYA 4YTTA 1FXPA 2ZADA 1FWAC 2ZCGA 1GQLA 4IQEA 4Q4RA 1AW5A 3NZQA 4XSMA 3LSCA 4DXXA 4ATLA 3U4FA 3W74A 2V38A 4XAZA 1LOQA 3WBAA 3QZ6A 4IJRA 3PUDA 3MTWA 4XV0A 1Q4WA 5A6BD 2VURA 1YRRA 3LTYA 2YXGA 1W9PA 2BGNE 4K7YA 1CGTA 2ZVRA 3HQPA 4R34A 2BNJA 5JQ9A 3IIZA 4GIEA 2CLPA 2C1GA 4U10A 4FLOA 3TXVA 5EMKA 1Z48A 1BKSA 3QLLA 3LQGA 3OW1A 2YLAA 2OXNA 5DY2A 2ZQ0A 3ECQA 4WOZA 1K9EA 3GTNA 3L0NA 3PBGA 4DZAA 1XIHA 2XM1A 3PFRA 1C9DA 4IFKA 3I6RA 1K70A 1HGYA 3SFKA 2GVGA 4P8WA 3C8FA 4QXIA 4LUSA 5KMYA 5F1UA 1N55A 4TX6A 1DXEA 3PAJA 3G1HA 2BSLA 4EKJA 1TV3A 2X2YA 3ZWSA 3M43A 1K02A 3DGRA 1G7UA 4AWSA 2J7DA 3GW0A 7TAAA 3VIOA 5IRPA 3GBDA 4ICNA 4H9MA 4FNUA 4GYKA 4XQ6A 3EB3A 4CU7A 4KCTA 1B90A 2F61A 1OIMA 3AXXA 3A5VA 4L4PA 3CZKA 3IVSA 3D5HA 3GW3A 4F2BA 1G94A 4N02A 1KGXA 1RJQA 3VX0A 1E71M 4FMVA 2PBOA 3OOQA 3G1YA 4ACZB 1E9ZB 1KFEA 4Q4PA 1AJZA 1U5JA 2OZ3A 2HBXA 3CHEA 5MHBA 1ZP4A 2EKGA 3EEZA 4CQCA 1NIUA 3I7QA 4JCLA 1H7XA 3M41A 5T26A 2NX3A 1Z32X 4QQ3A 2ZC8A 1DWJM 4MSSA 1XYCA 1QPOA 1YPIA 2XZ7A 3KZSA 2FGBA 1EOKA 4AZGA 3MDUA 4B9YA 5CZKA 3L4UA 2PRHA 2IS7A 2MUCA 4HZMA 1LORA 3NGJA 1H7NA 1DE5A 1Y8BA 4OOZA 4ROPA 4PUKA 2VZOA 3R8RA 4Z17A 4PTWA 1FWNA 4US5D 4EX4A 3HGRA 1GTEA 1LLWA 1TV5A 3L4ZA 6ENLA 4Q7NA 4O18A 5AC7A 4MJ2A 1OC5A 4GKLA 3ANVA 1FFRA 4D6DA 1GORA 1Q3NA 1V3MA 2BHUA 4NQ1A 1LDCA 2NWSA 3EMQA 3VFLA 2XIOA 5D33A 1S2WA 1E6XM 5CC7A 1LQAA 2AL2A 4JTRA 4XKYA 1CB7B 2P10A 4UMBA 4QG8A 3FA5A 3TYAA 3KW3A 3KBNA 1XLJA 1IR2A 1J18A 3NL3A 5I3IA 3O9NA 1BSIA 3G1VA 2CESA 4C7DA 5GPRA 1GT8A 4ZSUA 2J78A 2V81A 3C2VA 3WQPA 1E5JA 3NQMA 3SJ3A 1JZ8A 3HFTA 3GHRA 3JZUA 4O10A 4MZYA 1QO5A 4Z08A 3CL8A 1CTNA 3VIFA 1T0OA 1ZZMA 3I6TA 3H70A 1L6GA 3TQ0A 3BAXA 3K8MA 5MKGA 3TN6A 2ZZ4A 3AC0A 3T0AA 4ZO9A 3OTRA 1Q63A 1EX5A 4AD4A 4UXDA 4PMJA 4BS0A 2YXXA 1AJ0A 4HK6A 4PCPA 1XICA 1FHDA 1XPGA 1EHAA 3QMTA 3ZR5A 1JVNA 5CPMA 4NZJA 3Q4DA 1TJRA 3VC6A 3SECA 2ZZ3A 3UPWA 2QYGA 3ITCA 4S3DA 3WBXA 4PBEA 5C2GA 2D1ZA 1WO2A 1K9DA 1V02E 4L80A 2NQHA 4ACYA 3VOHA 1F2JA 3V18A 3W9ZA 4J28A 3W71A 1LQ0A 1SR9A 3WF4A 1QT1A 2Y5EA 4OQVA 3RM9A 3DDMA 3PHAA 4AISA 2HVMA 1B3ZA 3POCA 2B7PA 3ZT5A 5ABFB 2VGFA 5HJXA 3RRAA 1FKXA 5A6SA 1JCYA 4N42A 3CUXA 1ME7A 1OX4B 1IR1A 1KM0A 1UZ1A 4DHGA 1E9IA 5E0CA 3LLDA 4J2PA 1HTIA 3MHGA 4MNKA 3DFHA 1OJXA 5HDRA 1QI3A 3K4WA 3U57A 3RX2A 3WD1A 3W38A 1KTNA 1HKJA 3I4EA 1XINA 2V5DA 4I5RA 2BS9A 5CC5A 2VVNA 1POKA 2ZBTA 3OZPA 3S2MA 4U31A 4DVOA 1JR1A 2OTDA 2CLKA 1XIFA 3B8UA 4HKPA 3N2XA 1BWLA 4PZVA 4JHMA 3GTXA 4GK8A 1KFJA 4LV9A 3QRHA 2GK1B 3W7CA 3VGGA 3R11A 4HTYA 1IXPA 2CETA 2EGZA 3GWQA 4DIAA 3LA4A 2EJAA 2QKFA 2XVGA 4LYKA 4GFSA 1Y5VA 2ZX5A 3NL2A 5G2HA 1A5NC 4QX4A 3TA6A 1UIPA 1X98A 3HGOA 2D3LA 3UCCA 4BJHA 2V63A 3GDTA 2E9BA 4FX6M 4XTDA 3SSZA 3M0YA 1LBLA 4NAFB 1JCLA 2YFNA 2XN2A 1XIMA 1PTGA 1E9LA 3UXKA 1SW0A 1WKEA 2YPIA 1VF8A 5A6LA 3SY1A 3R2GA 2Z1WA 2ZVIA 2Y8VA 2WMFA 1PL9A 3LPFA 3KL3A 3PPCA 4RK8A 4QS6A 4C6CA 4GMEA 1GVQA 4C5ZA 1R9ZA 3W1NA 4O1AA 5T9CE 3O6YX 4AWTA 3GVGA 1K8XA 3FYOA 2VELA 3V36A 1CXFA 1OEPA 1WA3A 1BF2A 4IIGA 3DUGA 4F3HA 4R27A 1A0EA 4GCAA 2YL8A 3SCQA 1KM4A 1JL8A 5K4ZA 3LBOA 4NX0A 3RF9A 3OYZA 5LSMA 1Q6LA 1BYDA 1GNXA 2DSKA 3MP3A 6XIMA 3SBFA 1KRBC 1UASA 2VGGA 4O4WA 1Z8AA 3W82A 2ZRVA 1P7TA 3RR4A 3V5FA 4LAMA 4GXMA 4PEEA 3MDWA 1E0WA 2PCEA 3RIKA 3EX6A 3BLEA 5AOUA 2Q71A 3NQEA 2HSAA 2VTFA 3P3BA 1M41A 3TR2A 3I6EA 3FVMA 4AZCB 1TJPA 1FVPA 1DEDA 1W17A 4BI7A 5JVLA 1V77A 3S1GA 3LN3A 5FF3A 2J88A 2WSYA 4GKTA 3QJAA 1GKPA 5CCZA 5A2AA 1KV5A 1SU5A 3IRSA 2G41A 1OVDA 4M6QA 3C0LA 3PS7A 1TRDA 5I00A 3ZR4A 2VZTA 4L1WA 2FZ9A 4WY0B 4IL0A 4GPNA 1ECEA 1NWUA 1QHPA 3N4EA 4RNFA 1SMAA 1EEPA 2C0AA 1QHOA 3ITTA 3SGZA 1Q7MA 4PN2A 4QE1A 2PDJA 3G1AA 3IANA 4FNSA 1HKKA 3N3TA 3VNDA 5C9WA 3H6OA 3TZFA 2O4QA 1XLKA 4B16A 2FKPA 4JYDA 1H60A 1S1PA 2AL2B 3O16A 3DENA 4LBRA 4XO7A 3LGEA 4CLMA 1IIGA 5HNTA 4IMEA 1XLBA 3WQEA 1UR3M 1VFMA 3B05A 3WK3A 3M5VA 1F4HA 2AOSA 3K8KA 5I77A 3N11A 2VC7A 1RQEA 4HNUA 3KBMA 4U4MA 1ZCCA 4M7TA 1ZB5A 3FSUA 3OG3A 1DJNA 3GC2A 3MHFA 4N0RA 4QBXA 1H5VA 4XWUA 4AU0A 1OT1A 4J1OA 3O3RA 3ES8A 2RDUA 2YDQA 4NL1A 4FNQA 2D23A 2XSBA 1C8QA 2QCCA 2OT1A 2XH4A 1CNVA 4IIBA 4KT2A 2BVDA 3JVAA 3XIMA 2NT0A 1VBJA 4D1JA 3T2OA 2ZWZA 4WHBA 4L6HA 1GZJA 2QPSA 3NR0A 3NO1A 3CZJA 3NEHA 3GR8A 3VE7A 4GJJA 3VKAA 1QOQA 4AH7A 4EVZA 3BW2A 1XS2A 4XAFA 2QUUA 4JTSA 1OB0A 4I5XA 5BXSA 1O94A 1ISVA 4ALDA 4WR3A 2W3ZA 2IKHA 4J7RA 5D38A 3BUVA 4AEEA 2R1KA 4E5TA 5FIPA 5KETA 1UWQA 4DPQA 1OSEA 1XGEA 3OZYA 3UETA 5DBTA 4DBSA 4PCTA 4GVFA 3GG1A 1TPFA 4K2SA 3U2ZA 3UA3A 5XINA 4FEZA 5CC3A 3CMFA 2ZA3A 1PDYA 4AQLA 5REQB 1IT8A 1R2RA 1R3QA 5FAJA 1DHPA 4GH3A 4YTUA 3KCJA 2HQAA 2CERA 3I10A 3GS6A 4X0VA 1XFBA 4HMNA 1W3NA 1UHVA 5D2VA 1EA9C 2EPNA 1EGZA 3S5ZA 1MDRA 1DJXA 3PZQA 2NQ9A 2QV4A 1W9VA 4YVVA 4CD8A 2NQJA 3L21A 2DUXA 3GTHA 4DPPA 5KZMA 2X40A 2YCJA 1WZLA 1VFOA 1PZ2A 2OQHA 3PAOA 1CENA 5HANA 4RNIA 3LI0A 4UB9A 5EY5A 1OFEA 3AU2A 3VIMA 3W01A 3UXLA 1A5UA 4E0CA 4XUYA 1WKFA 3VMNA 2X0HA 3H21A 3W26A 1A4MA 3QOMA 5LIUX 1GJPA 1N8IA 4G1KA 1DYSA 3P74A 3SADA 4KWSA 4PTNA 5M2FX 2YGYA 3TTYA 3UZXA 2YCEA 1EJVC 2RFGA 1XC6A 4CEUC 2X2GA 3FA3A 5GJMA 8XIAA 5E9AA 3SURA 1AH3A 4UR7A 4AVNA 1KKOA 2J7BA 4PMYA 3PP7A 1R30A 4J3WA 3TP4A 2YSWA 3C61A 1RBOB 1W2VA 4GNVA 3FKRA 1OX5A 3KLLA 4MZ8A 3AUJA 3GQYA 3GHUA 5JIWA 1FKWA 2DIJA 3RAOA 1OCNA 2Q8LA 4GQBA 3FHAA 1PEZA 5HWNA 4W8LA 3NZPA 3GNNA 4ZEPA 7REQA 4IT1A 2VL4A 4J3ZA 4UTJA 2E77A 2ZA1A 1KFCA 3LHYA 3S2JA 3EX3A 2WV8A 4MY1A 1TPH1 3NSXA 3VGDA 3T0CA 4OWGA 2VX5A 1JZ3A 3H7RA 1CI1A 1I2OA 3AXIA 2IQDA 3NUKA 1TV4A 1T96A 1SR0A 1YX1A 4DBEA 2BGQA 5DT7A 3RR1A 4G5DA 1T8QA 3PFMA 3FLUA 4JKKA 3ZOAA 1WYIA 4C6PA 4H7CA 2E6DA 4M6PA 4E2DA 3TKFA 1PCKA 1ONXA 4CGTA 3DZ1A 1TZZA 1I0DA 3ITGA 1MUWA 1XLFA 3QKEA 3L9CA 5DQPA 2ZXDA 3A64A 1VS1A 1PIIA 1OYBA 4NNBA 1UW9A 3C6CA 4GI6A 1W1IE 3P2VA 4JTHA 2R14A 1UC4A 5I7GA 4NJGA 6CGTA 4JY9A 4K37A 5EB8A 2DPEA 1SSGA 3LRMA 3K4AA 1RVKA 4E2BA 3L5AA 1ME8A 1XYMA 3TTQA 3OVRA 1EPXA 1GTHA 4B4HA 1UUOA 2V5LA 1GQIA 1IQ8A 1KM5A 4QFUA 3FA4A 1DPMA 1EIXA 3WFLA 4URIA 3PTKA 1ZFJA 1US0A 2BODX 5BRBA 1VAHA 4Y90A 5KINA 4Z1YA 1PKNA 3SUUA 4C6EA 1E4NA 1VC4A 4O1FA 5A6TC 1FXQA 3RMEA 2OO0A 3W6MA 3UWYA 1FWRA 3S1VA 4I7VA 2RAGA 4E4UA 4QSFA 1TR1A 3HG3A 4GQ0A 3CH9A 1K3UA 1R9YA 1YNYA 4A8IA 1Z41A 4A8LA 1A5BA 1S5VA 2E25A 1UPPA 2BDQA 3GDLA 3ES7A 1L0PA 4PEKA 1I2NA 2B7OA 3T4CA 3IUIA 2W4XA 1JPIA 3OBAA 4HN8A 1VEPA 4CCDA 3A6OA 4B2DA 1W37A 4O8RA 8XIMA 4OFCA 5FSEC 1FOBA 2OEKA 1JYWA 5A6BA 2VM8A 2VO5A 2C15A 4AXKA 1VIWA 2POZA 2HNHA 4WXYA 3A47A 2WMJA 3WK2A 3HBLA 2EG7A 1UKOA 3NXFA 2Z27A 2PWEA 4ZQOA 3WLKX 2GJRA 2GK1A 2FLIA 1OK6A 2WNNA 2RGMA 1J8VA 4P8VA 5L9FA 8RUCA 1ALDA 5HNNA 2X16A 2DU2A 3TQKA 3ELFA 2B7NA 1TV7A 1EWDA 5LA0A 1W54A 1LRQA 1FCBA 2YBVA 1MRQA 2OWCA 3OGRA 2W9MA 5M5DA 3OBEA 2Q02A 4JDYA 4TU1A 4Y9NA 1IGWA 2QJJA 2FMOA 1IYXA 1DWGM 3QHMA 1UPMB 4PUJA 3G3MA 5B80A 4ZXOA 4JTUA 3GDBA 3M7WA 1UR4A 3UT0A 4U3CA 1LROA 3ZJ8A 5C9ZA 4YCPA 3LHUA 2F38A 4KEVA 4IUGA 4PMRA 3QW3A 3KLKA 1W3TA 3EOUA 4KIEA 3TJLA 4MJZA 2XH0A 3KS6A 1WE5A 2FFCA 3GZAA 4X9YA 3GNDA 1G4TA 5I6SA 4F2UA 1QDSA 1XYBA 2FZBA 2I5QA 3TLLA 2W6RA 1BYCA 2VOTA 4HMEA 5G5IA 1MEWA 4GQGA 3IJQA 3IJLA 2OZTA 1GOQA 3DHPA 4YXGA 3WD2A 5BOEA 1YDYA 4JIPA 4UNIA 5EFFA 1UR1A 3F5KA 1HP5A 4ORIA 1UWIA 3P80A 7A3HA 2H9AA 3BE7A 4I9JA 2ZXAA 3TWBA 2Z7GA 4JHZA 4S39A 4XIAA 4UFLA 5AKQA 5FJOA 3CQHA 1FDZA 3KOZA 2QV5A 4HK5A 1JZ2A 5HR6A 3BXWA 1SO4A 3G1XA 1RD5A 4XKYB 3CT2A 4I9TA 3NDOA 2E40A 4DO5A 2C1HA 2PDWA 3NQGA 1GG1A 3LYEA 6TAAA 4U28A 1T99A 4D6EA 3EOOA 1ONRA 5G4WA 2IXVA 3H8AA 3M6YA 2QDEA 1R5YA 1XJBA 3WMLA 1NY1A 2AAMA 1JF6A 1DV7A 2W5FA 3IV8A 2PC8A 4R7JA 1XISA 3PSWA 5EMLA 1M1BA 3MP4A 1OG0A 2INFA 3RO6A 2CZEA 3L66A 1WDPA 2X1SA 4GIYA 1EB3A 1X8CA 2QCDA 4W7VA 1RUSA 4UQBA 1S2UA 1SUXA 5KZ6A 3U2EA 3V16A 3A4WA 2ZTJA 1GEQA 4P61A 5IOBA 4Y7EA 2PDPA 1WDSA 3M5YA 4AIUA 4CU6A 2HVOA 1P7TB 1AG1O 2O9TA 3R0KA 2FTYA 2ODOA 1H62A 1TJ2A 3VGFA 1YBQA 1FUYA 3BH4A 4LUYA 1PX4A 5I03A 3PNZA 3IJIA 3LBCA 4N9DA 4JNZA 1NF7A 4HU4A 4AMAA 3EX1A 7XIMA 3BAKA 4H7ZA 2Q6ZA 1ZBCA 1EWEA 3GYCA 3CTLA 2H90A 1XYFA 4WJEA 3GTFA 1ITUA 3WLIA 3DKJA 1NDYA 3B8IA 2QW5A 2Y89A 4FF7A 3ITYA 1IF2A 4FB7A 2DZSA 1EA0A 3IUDA 4IP4A 3GFYA 2EEXA 3WY1A 3TW7A 3H24A 2YB1A 1KFBA 3WQCA 2D22A 4ZB5A 5CAKA 2XIBA 4NUWA 1WPCA 3PM6A 5EMUA 3QM3A 2I56A 4ES4A 1O5XA 2EBNA 3WLNA 1UR0A 4RZ6A 4NZ1A 4GACA 4IIFA 2WKGA 1ONWA 1HGWA 2V67A 5T8GA 2BY3A 1V3LA 4UMCA 1PYFA 1X97A 1CGVA 3MHUA 2NSOA 2BGSA 3IGXA 2UZ9A 3FKKA 2HPIA 4CKQA 3AYSA 3TLQA 4PB3A 5HNRA 2IXUA 3ZZ1A 3WLPA 1GVIA 5A8MA 1IEQA 3B40A 4S3CA 1MXDA 1EFZA 2WMKA 4MB4A 1MO0A 2WMGA 2ZDSA 2H6RA 1B54A 2ZOXA 4OTKA 3S2LA 1UIOA 4PE8A 3W4RA 1C9WA 1KM1A 3LQLA 2IPWA 2NQLA 1SFTA 1A3XA 3H2CA 1H5YA 1UMYA 3WH6A 2D73A 1UR9A 3H4WA 2PUZA 4E4FA 3I65A 3KVJA 2WYSA 3AS3A 2WHJA 3AXHA 2G95A 1TRIA 4FPSA 2Q3OA 3VE9A 4QDMA 3NNTA 2XHYA 4AZBA 1VPQA 1EBGA 4FNRA 4XAGA 4AEFA 3ZVHA 1FTXA 3O0FA 1JDDA 3KBSA 4MF4A 3DAQA 4H04A 2I9EA 2OG9A 2ZFAA 2EHHA 2DVTA 3ZVHB 4IL2A 4DF1A 1W2PA 5KEZA 1TWIA 5LNUA 1E6QM 1E0UA 5HAOA 3KRSA 2NX1A 3I4KA 1R3TA 3VIHA 3LB0A 3APTA 1JCMP 3PANA 3T4WA 1KRAC 2DVXA 4QLKA 5LGXA 3THAA 3T09A 3DESA 4C6LA 4AD2A 3KX6A 2TMDA 4JN6A 3WK1A 4TVCA 3AXKA 3DXIA 2ZX7A 2OWWA 1S39A 1P0BA 4TQTA 2D24A 4KIRA 1F05A 1PYMA 2ISVA 1K4GA 5K4XA 3NM3A 1PKLA 1Q6FA 1HJUA 3M64A 4XX6A 5XIMA 3W1RA 3WJWA 2CLHA 3TW9A 3AU6A 1LG2A 4MWAD 1O12A 1H1ZA 2GWGA 2WMIA 3PTQA 1IEVA 5M1TA 3KS5A 4NG3A 5J04A 4XAPA 4IM4A 1MQRA 2X41A 3GXFA 1FWIC 3NL5A 1OCJA 3K30A 3VKDA 5H2ZA 2ATSA 1TJ0A 4E4PA 4WJ8A 2DZAA 4O11A 4TXEA 5SWUA 1WNOA 1SYTA 3H2MA 4NAEA 2C91A 5D09A 1THFD 4JXCA 1TCDA 3RFAA 4JQAA 3GH5A 1AH0A 2YR1A 2C71A 3CT7A 4FF5A 2OKOA 5LGZA 2A3EA 3HQ1A 1ZBVA 2JQXA 3UGRA 3N19B 4JQ1A 3QBUA 4B5WA 2A3BA 3OHIA 1XIBA 4Y9PA 4R88A 2GYIA 4XZHA 4FALA 1RCOB 4YPJA 1UOZA 4NRSA 1O60A 3VCNA 4DJFD 2KX9A 1M68A 4BQ2A 1S5WA 3OLIA 1Z7AA 3VNKA 4QIUA 3CV2A 4M7SA 2D2OA 3PPHA 2PWFA 4NY2A 4GE8A 3COTA 3U0HA 2EO7A 1W5PA 2E4TA 4YHEA 4C6BA 3H2FA 3LV5A 1E6ZA 3RXZA 3UNDA 4C1NB 1XBYA 2VZUA 4RNHA 3MVTA 2VX4A 1IZKA 3U7VA 4M6VA 3CZEA 4JTGA 3EXRA 3M0MA 1GYLA 3E2SA 1Q6DA 1E73M 3KEHA 4GI8A 5CPOA 1VRDA 3HOJA 3VD3A 1FWDC 3ARVA 4PTMA 2YBTA 5IFTA 3WQOA 4P2VA 1GYNA 3E9AA 5E5CA 1QMLA 2NLYA 2RDWA 4IGMA 1EZWA 3PB0A 1UD3A 1M7JA 3B4YA 3K1GA 3GVQA 3UPBA 4X61A 3WZ0E 3EKGA 3L12A 3P93A 2GOUA 1MFVA 4W7WA 3WF3A 2G3MA 1XGDA 3VOJA 2A85A 5D37A 4O50A 1V6UA 4C91A 4Z2GA 3UESA 1ICPA 1LL7A 1UP3A 3F2BA 2OEJA 3T55A 3NM1A 2BWGA 1R86A 4BEQA 3KTSA 1TPDA 2ZE0A 3PZIA 1KA9F 1IGSA 4DJDD 1RY0A 1DXFA 4QJ1A 3WLLA 1JEZA 3BAWA 2PA6A 2I16A 4JCMA 4RCXA 3VZYA 2JF7A 1VLIA 4OGZA 1UD6A 5LNVA 1ITCA 2ZRZA 5DXYA 3LCHA 4GA8A 4XZ9A 2VR5A 1Q6GA 3TMQA 5A8QA 2C6QA 4AUBA 1LT8A 1W8SA 3MSRA 3SN0A 3MKCA 3W7MA 2CCRA 2VQTA 2J24A 4JFWA 5ENLA 1QBBA 3A3XA 3RPDA 2Z1SA 1WXZA 4TX9A 1OFDA 2VVSA 4R7OA 2GDQA 3GG0A 1PV8A 4YLWA 4D72A 1R47A 2QPXA 5TF0A 2Y2WA 2QAPA 4HBKA 2VUYA 1TPB1 3W88A 4GUGA 2CZFA 1O68A 2CHOA 4OECA 1HXJA 2J13A 3LCLA 4RNJA 4JPGA 2E7FA 2DZXA 5C54A 1ZALA 2YCIX 2W67A 1IHIA 1TTIA 3EOLA 1TKKA 4CN4A 3GR4A 3QVQA 1UCWA 2Y7EA 5C0QA 1OF8A 1RVGA 4JFUA 4DJDC 1ZJIA 4H8NA 6PTDA 4YJ5A 1EHNA 2C79A 4S3AA 4V1YA 3WEMA 3SW6A 1YDVA 1W6TA 2XTKA 1IWAA 2QT3A 3KRUA 2Y63A 5CLTA 5CBBA 1Q8JA 4QLJA 5LXXA 1Z3NA 1OD8A 3WCZA 3RGTA 1P5BA 2QMJA 3E1F1 1A3HA 1BGGA 2FJKA 1C92A 3O05A 3CUIA 3L2IA 3CQKA 1C8YA 3PWAA 1HZYA 1IE7C 3IJ7A 3CC1A 2V8ZA 5DT5A 5BROA 2DUZA 5KITA 2BXYA 4NU7A 2HVNA 4L9ZA 2C18A 2BBFA 6ALDA 2ZYFA 4W88A 1X1OA 2HCVA 3TVAA 2I5GA 7REQB 4XIMA 3HMJG 4NILA 1DJQA 4MFDA 1V0KA 4FSAA 4A6GA 1X1ZA 3QY7A 3WX7A 3V0TA 1I1WA 1EZ2A 1WDQA 4NXKA 5CXPA 3GM8A 5FJJA 5KTLA 1Q2SA 3GDKA 3FOKA 3AIWA 5CLWA 4AFYA 1YE6A 3NQ8A 2VDGA 3N25A 4YVXA 1E4MM 3FSTA 2WQPA 3KP0A 2F2KA 5H1WA 5A6JA 2JBMA 1N2VA 4O1DA 3AS0A 5CJMA 4ZTYA 3EKZA 5CJNA 2WZHA 4H41A 3E2QA 4C6NA 5FF7A 1PZ1A 2C3ZA 1BTCA 2DUAA 1VFTA 1XRFA 2BFGA 1FFQA 4S2BA 3MPGA 1RBLA 2CEQA 4NRRA 2VGIA 3EX4A 7TIMA 1D7FA 3D3FA 4QGCA 2PDMA 4D6IA 2WJFA 4PGLA 4F0MA 3M5XA 1ML1A 1PWMA 3LERA 2XIJA 1BQCA 2FFIA 1SM9A 4JTCA 5FJTA 5I06A 4H01A 4IX2A 2XJ7A 2CPUA 5DMLA 4GY1A 1QWGA 5E09A 4NJKA 3Q58A 3A21A 1T7LA 2O7SA 3DG3A 3GK0A 2Q8XA 3R5EA 5IFPA 3VCCA 1W1TA 4FA3A 4DWSC 1HG3A 5LHEA 3L2MA 2BMBA 1JXJA 2PD9A 3PPGA 3R8GA 1ZGDA 4ZQCA 1HNYA 2VNCA 4HOWA 1YIXA 3UW6A 4YTSA 5DFAA 4FO4A 4ZR8A 3QY8A 3ME3A 2C1IA 2LLEA 3EB2A 3GVRA 3A4XA 1XIIA 2XIQA 3DHUA 5LNRA 4I9MA 3BG3A 3N1AA 5DMMA 4HCDA 5I5RA 3TC6A 4B3LA 3W7EA 4XVDA 2OGJA 3UR5A 3DX5A 3VIKA 3AS1A 1X96A 3S3GA 2JEPA 2F8QA 2D2GA 2NLIA 3Q67A 3W7LA 5JH2A 3A5FA 2NUWA 1YNPA 1NM9A 4IGHA 2Y8UA 4E3TA 3ATYA 2Z6JA 2QJGA 1JD9A 4O28A 2VD8A 3B8SA 4TMCA 1IT7A 2CKSA 1V3IA 4XUGA 3BMWA 1AH4A 3WKZA 1XCXA 4ZZ9A 4KFNA 3MT1A 4JYFA 1DTNA 5CZJA 5FEXA 1ISYA 1V79A 3SUVA 3GNOA 4J40A 2XIIA 3A9BA 1TTJA 1W5QA 3ZM8A 5BCAA 4UQEA 3SQMA 3OEXA 1CXEA 2ZUSA 1E0TA 4O1EA 3WDIA 1B0IA 4BFAA 4QTGA 4AZ5A 2FVLA 3S2CA 1G5AA 3M16A 4WOQA 4GZEA 3TU9A 4AD1A 1NWSA 1SO3A 3DG6A 1V0LA 3MY9A 2P1FA 2GDVA 3URBA 2Z1KA 6A3HA 3GXIA 2YL6A 1ZLPA 3LLXA 3R89A 2MNRA 1IWPA 4IFRA 1EJRC 5CPQA 5A8PA 4K6AA 3NDZA 1JCJA 1F73A 5IHRA 4IIDA 3O2LA 1FY6A 3WDRA 4FX8A 2FTPA 3BOFA 3LUTA 5I07A 3NVTA 3QKZA 4F2TA 5C7HA 2X7VA 2UBPC 2WKLA 2OELA 1GUVA 4H19A 1R3WA 3STCA 2HISA 1YNQA 1TPEA 1K7FA 4NKCA 3ZJ7A 3S0CA 2DV0A 1ZENA 1HF6A 1J0KA 2FVMA 4B9ZA 3RCNA 1BRLA 3IV3A 4WDTA 4TTUA 1WDDA 1QR7A 2C13A 1VCFA 5F2GA 3N6QA 6TIMA 2DSZA 2Z28A 2OB3A 1MXGA 1R8LA 3UZYA 5TBOA 1JNEA 2QVHA 2XG9A 1T41A 4E8DA 2QS8A 5K3VA 4H8VA 2WO5A 3GKAA 3TA9A 3AWOA 3DKLA 4KH2A 1E9YB 1GW9A 4QRNA 4WDUA 4CNSA 2O9RA 1UD2A 3LPOA 3BW3A 2IQTA 5C2CA 3EA1A 5I24A 1UKTA 3U4AA 3EDKA 4FXFA 1UA7A 2HTMA 2XGIA 1LJYA 2VDHA 4M24A 4XKMA 4IICA 2PMQA 4QNEA 1UG6A 4L4LA 4RDVA 2R1NA 3ALGA 4JIQA 5J5DA 2Y4SA 5IXEA 3F2CA 3BK0A 4F9DA 3IIPA 3BLPX 1JZ6A 2A6LA 4PFHA 1UD4A 1J9YA 1U1JA 1KM3A 4IMCA 1NOUA 2GUBA 1ISXA 3WDJA 1GPWA 3THCA 4ROQA 2PP3A 1KQYA 5C2XA 1C29A 4BQ4A 4OV9A 2ZICA 2FPTA 3BAJA 1W1YA 1UROA 4MFEA 3VGBA 1RQHA 2JALA 4HSOA 1SZEA 2O0TA 3S42A 3T2PA 2ZUTA 1K9FA 3TTSA 3URAA 2GWNA 3VU2A 2ZIDA 2QJMA 1H7OA 3HPFA 3PWIA 2ZUNA 5G1MA 1F4AA 4B5UA 1SFJA 3W7KA 5HA7A 1DJYA 1FWHC 3PJWA 4KS0A 4NJJA 4HB7A 4C1NA 3BG5A 4PCFA 1F9CA 5U4NA 1LG1A 2WC4A 3EWWA 3N2BA 1TREA 4JQ4A 3MSDA 4LU0A 1L6WA 3FW6A 2OQLA 3TROA 3DU0A 3DERA 4E2VA 1AK5A 3PG8A 4QCEA 3VKKA 1DVJA 4KRUA 3BLKA 3BQ5A 3WLQA 4MAZA 2GL5A 4GGBA 2WJEA 4BCEA 3W2LA 3GYEA 2HPMA 2V69A 5D30A 5F4WA 8A3HA 2B31A 2J7EA 4A3QA 3EPNA 1KW1A 4Z1CA 4MUPA 3UZJA 2IW0A 4IXXA 4BF7A 1SW7A 1KXTA 3BLFA 4MAVA 5E70A 3WLTA 4UQ9A 1XLDA 1CZ1A 3KXQA 1JRBA 4JTLA 2CW6A 1CDGA 4M81A 5AZ0A 1ONEA 1V4YA 4NT0A 3SCRA 4J5NA 2E5CA 3LCIA 3E3HA 4ZQPA 1BXCA 1XGZA 1BYBA 3CK5A 4ZENA 1Y65A 4S3EA 2EKCA 5FL1A 1FWFC 4HJFA 4KFPA 1Q6OA 2PI6A 4HYRA 2EPHA 2P0IA 1V51A 4DYEA 1PIFA 5HXMA 2XSAA 4UTWC 4ORMA 1ZNNA 1KXHA 5G4EA 2CBIA 4XSLA 2AAAA 4TO8A 3WN6A 2OKTA 1ZQ5A 1PIGA 4PUWA 3ARSA 4LWWA 2WJZA 3D47A 2DSUA 5EMJA 1Q5MA 4DBWA 5CC6A 5A8GA 5LHFA 1T5AA 3UWQA 4ZSTA 2BV9A 1R0MA 3FJLA 4UNLA 3HGSA 1IZJA 1EJUC 3MMTA 1JD7A 2DZUA 2PDFA 2CBVA 3TQVA 2FTWA 1V02A 1E6SM 1US2A 4ZMGA 3WYZA 1U30A 3TV8A 3SY8A 2XH7A 1CECA 2QEZA 3SN4A 3PTMA 2PFHA 1PWLA 2QAFA 4XG1A 2BZNA 1UZ4A 1FA2A 3GU1A 4DN1A 1SO6A 1UBPC 3LM3A 3WUGA 5HULA 1LLZA 1I9CB 1GOIA 4OE7A 3VVGA 4PMVA 5LYRA 1EOMA 2O9PA 2PSNA 4AX7A 2WXDM 4N6FA 1IEXA 2NZLA 2REQB 1PKMA 1RPXA 2WCSA 2Z2AA 1Y0EA 4L1GA 2SFPA 2WM1A 1E3XA 3WMBA 4IPPA 1V6YA 1FDJA 3KL0A 4HIBA 4CQ8A 1K6WA 4E2OA 3OVPA 3L65A 1UH3A 3BPWA 3WLHA 4FXSA 2V5CA 3W73A 3BW4A 3L5MA 2DZBA 2EAWA 3KHDA 3VMOA 8CGTA 3QV6A 2OODA 4GUIA 3SQSA 1JZ7A 3HFYA 4PUEA 1LOSA 3H53A 1FH8A 4W93A 4Q6JA 4JKMA 1M65A 5I23A 3NPVA 1DQXA 1OFRA 3AROA 2XVNA 4UTWA 4US6A 1GHRA 3AHXA 1KFLA 4GJ1A 4LJ3A 2OVLA 3FN9A 4DO6A 2GDUA 4MMWA 4YTQA 3W86A 3RJXA 3O63A 4FIQA 1RQBA 5A8OA 2WNQA 2ZZ7A 2OOFA 2RUSA 2DW6A 4W86A 3DYMA 4AY7A 3ZLFA 4A8NA 1P1XA 3VTRA 3S5SA 3TW6A 1S2AA 4D1IA 4DM2A 3ZJ6A 2E1DA 3N4FA 4ASTA 2FZ8A 3QYSA 1I1XA 4Q8PA 1OADA 4OJYA 1NFGA 4TUFA 1JNDA 1AQFA 3BAYA 2VC6A 2WC7A 5T9BG 3SUSA 1J12A 1CXHA 4M19A 4QNWA 2HJPA 2XYLA 3KM8A 3UZZA 3MUCA 4KBXA 3O07A 3GXDA 3F2DA 3G0UA 3H12A 4A2SA 1W8GA 4CEXC 2VFFA 4BA0A 3H7VA 4FNTA 1NQKA 1XUZA 4MB1A 3QTGA 4S3JA 3LMZA 2QMKA 5HK4A 1F3XA 1G4PA 3FYYA 3GB6A 2DZWA 2WVVB 4EXAA 4HP5A 4IUOA 2XISA 5G2WA 4IF2A 2YCKX 4JFTA 4BF5A 3BJFA 3WJYA 1S2CA 2CNCA 2DFAA 3UJSA 5FKYA 4CQ9A 3UG3A 3ARPA 3BC9A 2P53A 3G0XA 1RD6A 1MVYA 4PMOA 3HG2A 3MI3A 1LWJA 2FGZA 4F4RA 1OY0A 3MZ2A 3RPMA 3IJDA 2WW5A 5FEPA 1C3FA 3NZGA 3GBEA 4Y8EA 2TRSA 4PCSA 1XRTA 3SCOA 1GOXA 1LRNA 4EXQA 3LLFA 2YCLB 4NX5A 1JF5A 5D2YA 1NVMA 3K13A 1OM0A 1WBJA 2FPYA 3L23A 1ADSA 4JQ2A 4UFKA 1R87A 3BCFA 3VZXA 3ZIZA 4GNJA 1OK4A 3N6JA 4MWAA 4NZFA 1QVBA 1DTUA 3LTSA 4PMUA 4DI8A 4D6CA 1R3SA 2A4AA 3CO8A 4IGSA 4A8RA 3NIYA 1AQHA 4BKNA 1ZCOA 1W91A 3WJZA 1Q2RA 5CEWA 1XRVA 3V75A 1E0XA 5TIMA 5AYBA 5I3GA 2E67A 1BLIA 3BLLA 3HM7A 3WIJA 1XH2A 3PF3A 1Z42A 4WEVX 4JHOA 5EGRA 1KFKA 4RR4A 3THUA 4OU1A 1RPKA 4WXZA 1I0BA 4UIOA 3JW7A 1DWIM 3TUUA 3R94A 4RLIA 2ICSA 1MEIA 3GIYA 2AGTA 1GWJA 4X60A 4LV4A 4R3UA 1SMDA 3ZT7A 2EPLX 3UR7A 3QFWA 4F79A 2ONEA 5JBDA 3WNLA 3BLIA 1TWZA 1KM2A 2V0TA 2AQWA 4A3YA 4MY9A 1AQ0A 2Y6ZA 1R3YA 2WWDA 1EUNA 3L4VA 3LNMA 2FIQA 3SY5A 3CPUA 5GNZA 1SVDA 4P5UA 4EPBC 1OWQA 4BWLA 3USZA 3MU7A 3LGDA 3OQEA 1IXNA 5H91A 4RZ4A 3T05A 3GFZA 1JQVA 4CD4A 3VMPA 1UWAA 1YHTA 2YW3A 1P0DA 1PS9A 4WIWA 4FIRA 4JKLA 4C60A 5E93A 3C3UA 4DQWA 1MSSA 2VZSA 4RDWA 3QR1A 1LLOA 2NV2A 3APGA 2A1YA 1S5MA 3GE7A 1XPYA 1YXDA 1FQ0A 4MJ4A 4MDPA 4V15A 3SUWA 4EE9A 1Q66A 2OYLA 2WNZA 4Y9OA 3NOEA 3QGVA 4KKXA 1B5TA 3UZWA 3T0DA 2BOGX 3N29A 2CLFA 3APYA 3G18A 2BVTA 1H51A 3MJYA 2QULA 3FGCB 4L61A 1E5NA 1LBMA 1WV2A 3TTOA 4WQ6A 4HPJA 1G4SA 1U33A 1N82A 2DQWA 5GVJA 3CV6A 4MIMA 3MV11 1HX0A 4KESA 2CU0A 2V3FA 4D8LA 3TQPA 1XD0A 3HJZA 1TPVA 3LHWA 3B9NA 5AC8A 1D9EA 1B31A 3ITVA 3PZGA 1EQPA 1XLAA 3ERPA 4HCHA 1DWFM 4GX9A 3BWWA 3TAKA 1TE1A 2VX7A 1A0CA 1C7TA 2AKMA 4CUCA 4RXGA 5CGQA 1E6RA 2GQ3A 4LY8A 3E2VA 1S5TA 1U5VA 3HO8A 3DBNA 5D9PA 1RJRA 3OPSA 2D20A 3S6OA 3VX1A 1UP0A 3FXYA 4MB3A 1MDLA 1OC6A 3ZSTA 4L64A 9XIMA 4Q32A 4XD4A 4ZOBA 1XSIA 5A1AA 3EYPA 1EX1A 3H23A 1UBSA 1FHVA 3JU2A 4N4PA 1VYPX 3RLGA 2A79A 2JKPA 3PSVA 3DBPA 4PB4A 2J7CA 1VIZA 4QDPA 3W2NA 3VC5A 5BW6A 1J93A 2Y85A 2BTMA 1R9XA 4A05A 4GYPC 2XGBA 3NQFA 2NSXA 4GUHA 4Q8UA 1VKFA 4A3HA 3QMRA 1A80A 1XYLA 5EMYA 2NWRA 2OCZA 1KM6A 3G1FA 3GXNA 1EJWC 3O8AA 1EIBA 3CLWA 1J0IA 2XVLA 3MJMA 1XLLA 5H8MA 1H4PA 4LF1A 1AL7A 1Q8AA 4OZOA 4Z42C 3RX4A 2PTYA 2CXGA 2G97A 1LBFA 4CN1A 4GCXA 4DYKA 4DWSB 2YJQA 2A3LA 5F2IA 1GVOA 3F1QA 5AY7A 1PDZA 1TZ7A 1N7KA 1AMKA 3Q94A 3XISA 1BYAA 3E5PA 2BY1A 4LUTB 1DE6A 2V5KA 1KCKA 3QGAC 4F0KA 1OINA 3VGHA 1ZY9A 4DJFC 4H2HA 1V3HA 4LNYA 3ZR6A 2R1LA 4AHOA 4LTSA 3PUEA 4I90A 1PAMA 2O55A 3EZ4A 1OX4A 4JX4A 4IH3A 4CNTA 7PTDA 3CZLA 3EOEA 3D6NA 3HTWA 4YU1A 1SZGA 3MUIA 4UWMA 2B4GA 3G3DA 2Y0FA 3N73A 4HNVA 1H3GA 5FL0A 4L6DA 4F0SA 4AC7C 1W5NA 3VIIA 3KDNA 1YMYA 3WQ5A 4LCQA 1LZOA 2EG8A 5D9NA 1HIZA 3TE9A 3TEVA 1KO0A 3OP2A 3VXGA 2POTA 3QW4B 2QF8A 3RNDA 1GVSA 4KRTA 1RCQA 2ZZ5A 4LVAA 2CZVA 5A3HA 4F0LA 3UG4A 2IKGA 4I3GA 3LPGA 2INEA 1CWYA 1C7SA 1GONA 2VFHA 4IQJA 1K8ZA 2DSVA 4FNPA 5HQLA 3W7NA 3D46A 4DAFA 2PEVA 4RE4A 3N17A 1NDWA 3UD6A 2CLMA 1SSDA 4QCFA 3G77A 4DZHA 3MBDA 2H8ZA 2BHZA 4C1LA 1WDWA 4FR1A 1PBGA 3W7QA 4O52A 3W1LA 2VEKA 2B81A 3IGUA 4Z1BA 2Q8ZA 3UJRA 3NURA 1LUCB 2OGYA 4O0QA 4DXVA 3AZSA 4KETA 2HK1A 2Y1HA 4O4VA 2GVYA 3HIJA 1JPMA 2WOQA 3CUJA 4QP0A 3H54A 4W5ZA 3CO4A 2YL9A 2ATMA 2OEMA 4J3UA 3LTPA 4GVHA 2RHGA 3IGSA 4H9UA 3S47A 5IBXC 3H2NA 3IIOA 3FY1A 4OBRA 3EAUA 1BSLA 4Q8WA 3W1UA 3O6DA 3VFCA 5L6UA 2PTXA 1SJCA 3PZUA 1DBTA 1FWSA 1MQPA 3SGGA 1M01A 3E49A 1FX6A 4KRZA 4MPQA 4B90A 3C8NA 3PZMA 3VKCA 4WSJA 1NP0A 3LOTA 3VD5A 2ALDA 1KC7A 3UR2A 5DRIA 4MLRA 3SRHA 1GK8A 1K4HA 4P8XA 1M7OA 4WJXA 1WP6A 4F8XA 2WPBA 1XBXA 4J3SA 3S5OA 1M6JA 4DWSD 5C9UA 1D7KA 5I78A 1NQ6A 4Q3MA 3O0KA 4UTMA 3OHMB 1EJSC 5I3DA 3CHFA 4BR1A 4MTVA 3TK7A 4AVOA 3WJSA 2VEPA 2FB2A 5CAHA 3ISIX 4FOUA 3PWGA 4ZQRA 1PKYA 3XINA 2BVYA 5H8PA 2W63A 4Y96A 1CGUA 1C93A 2P5NA 3R79A 4U5KA 3EOSA 1TTQA 4H00A 1KBBA 3VABA 5BZAA 3IVTA 2ISDA 2PZ0A 1VFSA 3CWNA 3N18A 5K2ZA 1BVNP 3CTTA 3DFPA 4INFA 5H8UA 4L1XA 3R58A 1MEHA 2DZTA 2XIMA 3AIUA 3QC0A 4RW5A 2RGLA 3BTNA 4XD5A 1W1B1 3TC3A 3UY8A 4YCOA 3CQIA 4GJIA 3PB2A 4Z2HA 1GKQA 1XYZA 2QR6A 1Q4NX 3FEMA 4O17A 3VNZA 2VRQA 3ANYA 4AF0A 2FH8A 3E0WA 4HQVA 1VHNA 4DB7A 2YYUA 2ZRWA 4P8UA 5BMXA 4LBUA 3WQFA 3L68A 4HYWA 4JAWA 2UY4A 4EF9A 4FXRA 2E9MA 5J8LA 4C7GA 3LCFA 4XAYA 3KOFA 4ONVA 4UFMA 5A6MA 1VBUA 4TR9A 2VT0A 3AICA 2E9LA 3G6MA 4JD4A 1Q6RA 3BARA 1TX0A 4BZYA 5D05A 4W8AA 2YYTA 4LUTA 3NPXA 3VCRA 1GPFA 3W84A 1JFXA 5EYWA 3W70A 4B15A 4Z0SA 2WKJA 1EQCA 4H9YA 5JBEA 5F2MA 2FZDA 3P84A 3SRKA 3F4CA 1JGMA 3TJ4A 4GY7A 3WQGA 1KTBA 1OYCA 3ZXWA 3O1NA 4AAJA 2P50A 5FA5A 1S1RA 4LX4A 5RUBA 2GQAA 2WBKA 2Z2UA 5LZLA 5K9DA 2H8XA 2EPOA 5AHNA 3LSBA 2CZ5A 4C90A 1GJUA 1K9TA 1WAWA 4EAMA 1LUCA 4HTBA 3PZVA 1YDNA 4HOXA 4O14A 1RK5A 1SPQA 2VCBA 2J25A 5LNWA 4NZ3A 4M5PA 2NQZA 2WPGA 4GXWA 4REQB 5IDIA 1J11A 1QI2A 1XIDA 3CUFA 4UTHA 1EP2A 4ZL1A 2FYMA 3QGKC 1JDEA 3W7JA 2DT0A 2OO6A 3NL6A 3TZNA 3EWYA 4GNKB 3TR9A 3QF0A 3T08A 3ABSA 2E8ZA 4G9PA 2OLAA 1W3IA 1P4CA 2TODA 4LAZA 3GD6A 4LUJA 4S3GA 1X6LA 3S1XA 4B4FA 3BJSA 1X7FA 4NYYA 1UA3A 3IWPA 3RDKA 3SO7A 2V30A 3HU7A 3W28A 4CNNA 4WF7A 4YIWA 2GJNA 4PL2A 5JIPA 4LRSA 3CZ8A 4J3TA 5LNSA 2ASHA 2FHFA 3IUHA 5A94A 1J10A 2QZRA 4ZGYA 3BQ6A 4JFSA 3EWZA 3TOYA 3C2FA 1CLKA 1XKJA 1FH9A 1UUQA 1ITQA 1TIMA 4YWIA 4O12A 1A5LC 2QDGA 1TWWA 3CAQA 3S9ZA 3PJXA 4ADTA 5IHSA 2WHMA 5JBFA 3M0IA 5FJUA 4JX6A 1LWIA 1GOWA 2H3DA 3WBWA