4PMZA

Crystal structure of gh10 endo-b-1,4-xylanase (xynb) from xanthomonas axonopodis pv citri complexed with xylobiose
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
303
structure length
303
Chain Sequence
APLAATASKFLGCAYGAQQAPGFAQYWNKLTPENGGKWGSVEAVRDQMDWSTLDAAYRFAQANQMPFQMHVMVWGNQQPEWIKTLRPAEQRREIEQWFAAVAQRYPDIALLEVVNEPLNDPPSKADTGGGNYLQALGGNGDSGWEWVLQSFRLARRHFPHTKLMINDYSITSSAQATQKYLQIVRLLQRENLVDAIGVQEHAFETTPEVAVSVHRDNLDALAATGLPIYITEFDLDGPTDAQQLADYKRVFPVFWEHPAVHGITLWGFRPGLWRDKEAAYLIRADGTERPALTWLRDYVAAHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xylanase
publication title Molecular mechanisms associated with xylan degradation by xanthomonas plant pathogens.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Hydrolase
total genus 124
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmzA00
1V3MA 2PF0A 4CU6A 4W87A 3AI0A 1JYNA 3WEOA 2PBOA 2DT3A 1E6ZA 1QI4A 3VINA 2WVSA 2X09A 3KL3A 1X6NA 2GVYA 3THCA 1PJ9A 3WBEA 3TTSA 3BSHA 4MNMA 2WCAA 4GKLA 1BGGA 2OLHA 2FHFA 2W66A 4MAZA 1UD3A 4XZBA 5CJ5A 2J8FA 1KXVA 2GK1A 2OWCA 3A47A 2J8GA 1TUXA 2ZXBA 3AFBA 1EQPA 1UKPA 4UCFA 1LF1A 1K6AA 2XVLA 5LYRA 3AISA 2GDUA 5JBDA 2WBGA 1QI5A 4JHOA 5CQ1A 5I79A 1PIGA 3CO4A 3BAWA 1NARA 3CH9A 2E9BA 1LLOA 3K8MA 4B3KA 3GXDA 2C0HA 2VZOA 3SURA 3WMBA 1UD6A 1UQYA 4QLJA 1E9LA 3WNKA 2CHOA 2DSWA 1W3KA 4PMZA 2J7DA 2CITA 4PMRA 4U3AA 1LL6A 1XH2A 4AXNA 1VFOA 3HMCA 4ATWA 1EHNA 3NJ3A 1NM9A 4NF7A 1QHPA 5E9AA 4BCEA 1MYRA 1XSIA 1J0HA 9CGTA 4OBSA 1E56A 1ITXA 3UG3A 2FHBA 2XG9A 1EDGA 2DIJA 4LYRA 3ECQA 3AHTA 3AS2A 1EO7A 4LGXA 2D3NA 4AD1A 2VNCA 3AROA 3CLWA 2W4XA 2YJQA 4LPCA 1J01A 3KL5A 3AMCA 3GYCA 4W84A 3RMEA 2D0HA 1D2KA 4J3TA 2EPOA 4ZENA 1DHKA 1UKSA 1V0MA 3PTQA 5LA0A 1V02E 4W89A 1HKIA 4IISA 1JZ3A 2W63A 3WL1A 5I23A 2Y8VA 1W1TA 2E9MA 3G6LA 1CXIA 2VRQA 5A8PA 3L2MA 4CU8A 1C3FA 2FGLA 4PEEA 1RPKA 1U2YA 2XGIA 3VMPA 1VBRA 6A3HA 1QHOA 4A4AA 5F7UA 1DWHM 3PBGA 1CGVA 1UH3A 4WKHA 2J4GA 5DO8A 4IPLA 1NOUA 3M46A 1MQQA 3AHVA 3ARPA 1WPCA 5HDRA 4MJ4A 1NWUA 4AD0A 3VDBA 3MKKA 1AQ0A 1UWUA 5CPTA 1B90A 2GJRA 3WNPA 3WH6A 1CDGA 4C7FA 2QLYA 1EXPA 3AHYA 5M03A 1C93A 2WHJA 1BVZA 1H11A 1IZKA 3ARTA 2VZVA 4HA1A 3ZSSA 1H0IA 4AMCA 1BYDA 5C70A 4C7GA 1E6RA 1Y7VA 2PWEA 1V3LA 5BXRA 4UFMA 2OYMA 3TONA 4D6HA 4AIEA 3LPFA 1E6NA 3GM8A 2DSUA 2PC8A 1ITCA 4TXEA 4UQEA 4PTVA 1RD6A 2CBUA 4OOUA 4QCEA 3T2PA 4AD5A 1VEPA 5AYBA 3AXIA 3AOFA 1GHSA 4NI3A 1ZJBA 4W85A 4D6DA 2G3IA 1WDSA 1V03A 5BXPA 4ZXOA 2CERA 1Q6DA 4U2ZA 2DSZA 4XV0A 1E0WA 3VMOA 2XFYA 4W86A 1BPLB 5LA1A 4AEEA 3L4ZA 1WDRA 2WCSA 3OBAA 4ATDA 3CPUA 5HNNA 1B0IA 2VURA 3IAPA 4ATLA 3WUFA 4AZBA 2OSYA 4L4PA 1LG1A 1I1XA 3PHAA 2FH8A 2VTFA 1W91A 3PZVA 4HZ8A 2DSKA 7CGTA 5KZ6A 5GNXA 3N15A 5FD0A 1PEZA 2WMIB 4Z2HA 3AMDA 5A2AA 1EDTA 4PSRA 3CZLA 3VPLA 1W9PA 4YN5A 4AZGA 1G1YA 2CETA 2YDQA 3AMKA 2W92A 3MMUA 1JI2A 3ZOAA 4DUWA 2IUZA 1V6YA 4J3SA 1H3GA 5CGTA 3N12A 3L4VA 5E6YA 2J78A 5E0CA 1W9XA 3D5HA 1UZ1A 1KBBA 3J7HA 5GPRA 5ABGA 4PUDA 5A6SA 1J0JA 2OWXA 1C8YA 2CKRA 5I6SA 2EEXA 2UY2A 3ARVA 5C8BB 2BXZA 3VIGA 1CGXA 1M01A 3FAWA 4JFVA 3WH7A 3IJ9A 3W6LA 1JZ4A 1BG4A 1QNSA 4MB4A 2EPNA 2O9TA 2DGAA 4FLSA 3OZPA 3WD4A 5TD4A 2XHYA 1KQYA 3WL0A 3VIMA 3S2CA 1JDDA 4TOQA 3ZT6A 4Z2JA 2W5FA 3K46A 1JZ8A 1AQMA 4B3LA 3LPGA 1R7OA 3VD9A 1BF2A 4MADA 4MB1A 2WMIA 3WDPP 5BROA 1UOKA 3ARSA 2EPMX 3WD0A 3OLDA 1S46A 2VR5A 5A94A 1US2A 2BNJA 1HL8A 4GQRA 2WC7A 1CLVA 1E1FA 3CUJA 3I3BA 1K9FA 2DIEA 3RO8A 3AIRA 4P8WA 2Z1SA 2BY0A 4W8BA 4DUVA 4WSJA 4NRRA 1MW0A 4D1IA 3VVGA 4MAVA 4GO9A 4WKAA 4M81A 3W37A 5EB8A 2WANA 1GCYA 3ZT5A 4QFUA 4XUYA 4AW7A 1DWAM 4BZYA 5IHSA 4MNLA 2G41A 2YBUA 4BS0A 1B3ZA 1VB9A 1UR0A 1F4AA 1VIWA 2WHMA 2J7HA 5I24A 1CXFA 3F5KA 1ZBCA 2MANA 3SUSA 1HL9A 4W7VA 1Z32X 1L0PA 1CLXA 3CUHA 3L4XA 1JF6A 3FHAA 1CEOA 1BQCA 1JXKA 3B9EA 4PMYA 2WSPA 5IHRA 2PI6A 5A95A 4UQBA 2IXUA 2JF7A 4J7RA 3SUUA 3ARUA 3WEMA 2JIEA 1M04A 2DT0A 1HIZA 3WBAA 3WNNA 2XGBA 3VGGA 5CZKA 3SCSA 3OIHA 3MO4A 4AYSA 3LPOA 1CNVA 3B9DA 1GUVA 5BCAA 1M7XA 3ZT7A 3VM5A 4BQ4A 3SCNA 2QPUA 3VX1A 3BAYA 1GVYA 2EPLX 2ZX5A 1W9VA 4GI6A 2ZXDA 4D6IA 4UQAA 3RCNA 4F79A 4UNIA 4TVDA 4AEFA 3AIUA 1KXHA 2V5CA 3RM4A 2JFEX 4OIFA 1NWRA 3WN6A 4JZ5A 1MW2A 3N17A 1Q6CA 2OWWA 4WSKA 1QI2A 4HMCA 1E5NA 3W28A 3NSMA 3A4AA 2QF8A 1DWJM 4AISA 3O9NA 1JYWA 3WSUA 2PB1A 4GINA 3T08A 4AZ7A 1FHLA 4HOZA 3B9AA 2X8RA 1YQ2A 3CZKA 4D6JA 4TVCA 3JUGA 1UD5A 3ZJKA 5CG0A 7A3HA 1JNEA 2GJXB 2XM1A 3M07A 2Z1KA 1HJUA 3WMCA 2D0FA 3SCVA 1JI1A 2XIBA 1QBAA 3WH9A 3MMDA 2Y24A 1J18A 3EDFA 4GZIA 1X1NA 2WPGA 3G6MA 4XX6A 3ARWA 2E3ZA 1H41A 1V0LA 2V3GA 1NH6A 5EBAA 2WWDA 3K4AA 1CGTA 1VEMA 3SCOA 1PZ2A 2WKGA 1HP4A 5BYWA 2YL6A 1H49A 3BLPX 3MUZ1 3UEQA 1UR8A 2PWGA 1UWTA 4CD7A 2ZUSA 4UFLA 2JEPA 1V0NA 5IFPA 5HBFA 4FLOA 2IXVA 1XD0A 2XPKA 1LWHA 3OB8A 4PRWA 1EIBA 8CGTA 1CGUA 1UD8A 1WE5A 1ODUA 2WNWA 1OSEA 5E6ZA 5A6MA 4F9DA 2W91A 5LA2A 2WLYA 2XYLA 1ZU8A 3CZ8A 5I77A 8A3HA 3WQVA 1XSKA 4KH2A 2BVYA 4M80A 4RE4A 5I5RA 4U3CA 2GJXA 5GNYA 3IK2A 1BG9A 1WZMA 4U5IA 1J0YA 2F2HA 2XTKA 2G3NA 2OSXA 3VIIA 4PMQA 4HP5A 1TFVA 1CGWA 3CZGA 1WKYA 3T0BA 3RJXA 3ARQA 4AD3A 4TX8A 3N9KA 1QPKA 1XH0A 2GUYA 2J77A 3II1A 2VCCA 2XWEA 4RL3A 2DQXA 3VIKA 1XCWA 1JD9A 2AMGA 3WF3A 4V2XA 4Z2GA 4JFTA 2JEQA 3OGRA 4QAWA 3VGBA 1KWGA 2HISA 2JF6A 4HOWA 3UCQA 1BHGA 2CNCA 1CWYA 4PN2A 1JL8A 1CECA 5ECUA 1JNDA 2BY3A 3VNYA 1BGAA 1JD7A 3RIKA 1HKJA 1HJWA 3WENA 4F66A 1VJZA 3WQWA 1TE1A 1BYAA 1H4PA 2WZIA 3UETA 5A8OA 3W82A 1UG6A 3GNRA 5HPCA 1EH9A 3SEPA 5D9NA 1OGSA 3WF1A 3W53A 4QDMA 2V38A 4TVUA 4UQCA 3DYPA 4PMNA 2V5DA 4OOZA 1YHTA 1WO2A 3FW6A 3CTTA 3DHUA 3K1DA 2ZX9A 3L4UA 1N82A 2VR4A 1GHRA 2WBKA 2WHLA 4JCLA 4TTUA 1E3ZA 1B31A 1UZ4A 2V3DA 3EMQA 3MUIA 3VDHA 3L4TA 2UY4A 3GNOA 1E72M 2G3JA 1MFVA 1V02A 1CGYA 3FAXA 4TX6A 4HMDA 4A3YA 3QHOA 4D6EA 4IUGA 4W7WA 3GH7A 3AIVA 2NT1A 1ZBKA 5FKYA 1OD8A 4DUXA 4PMXA 1JZ5A 1CZ1A 3WF2A 2XWDA 1GQIA 4J3UA 5HOSA 4EKJA 4JFSA 1R86A 3BCFA 1RP8A 4GZEA 4FK9A 2W62A 3PZQA 4JL2A 1DWFM 4MB3A 1GZJA 1VFUA 5M17A 2ZXAA 1JF5A 3IJ8A 3N13A 1UKQA 1VRXA 2YIHA 4CN4A 1HXJA 4CD5A 1HVXA 3A4WA 3O2LA 4FMVA 3MUAA 2WZHA 3FY1A 1C90A 1HNYA 2YKKA 5FIPA 1LL7A 3N11A 4OBRA 4OKDA 3EDKA 3FXYA 1CENA 1E1EA 4AZ5A 1SMDA 2WSKA 1OBAA 2E0PA 1ZL1A 1W3LA 4YHEA 5HXMA 4WK9A 2GSJA 3VUPA 2QV4A 4HZ7A 1NWSA 1UD4A 1V3HA 3OG2A 4WJXA 1JYVA 4AZIA 2WC3A 1W2PA 3WD1A 1HP5A 2DSVA 2WVUA 1J0ZA 1GONA 4MNKA 4V27A 3VD4A 1GQLA 4CCCA 1O7AA 1IV8A 1WCGA 3U57A 1V08A 5D9PA 4J3WA 2RGMA 4J3VA 3VILA 2ZXQA 3SUTA 1NOFA 3OLIA 3VIPA 4A3HA 2XIIA 3EDEA 3SCRA 4CU7A 1KXQA 4CCDA 3EMCA 4KRUA 1V3KA 4GPNA 1GVIA 4W5ZA 2WC4A 2YOCA 1E0XA 1NP0A 3GNPA 4CKQA 1XYZA 4D6GA 5A2BA 1OWQA 1GJUA 2VZSA 2V3EA 4DM2A 1AMYA 3S6TA 4CD8A 3APGA 3A6OA 1G5AA 1JZ2A 3W38A 3KZSA 1QW8A 4H2CA 1W3HA 1QNQA 3W81A 4KWUA 1QOXA 1MQRA 3ZIZA 1VAHA 4D71A 3ARRA 1GOQA 5CPQA 1MXGA 1FOBA 1R7AA 3BGAA 4HPHA 1OGBA 2QMJA 2AAAA 1XYFA 2EQDA 4PTXA 5A1AA 2VX5A 1KB3A 3POHA 1UQZA 1EA9C 2ZICA 2YDSA 1QVBA 4H8HA 3IAQA 2EJ1A 2VX6A 1M53A 4P7OA 4PMDA 1ISWA 3NDZA 4MPKA 3VMNA 2DT1A 2X2YA 3VM7A 4P7NA 4QLKA 3AJ7A 3WDHA 1JG9A 3K8LA 5JBEA 1WAWA 3A4XA 3PN8A 4J3XA 2Y8KA 2CHNA 3DC0A 4LXFA 4W7UA 1OGGA 3BLKA 5JUVA 2YA2A 3PZNA 3WF4A 3WNMA 1UA3A 1TR1A 3D3AA 3I3EA 1HVQA 1ESWA 1X6LA 2VVSA 3VTRA 1C7TA 1W1YA 2ZUTA 5ABHA 1W32A 1HT6A 2A3BA 1J0KA 4W93A 3QGVA 2W67A 1PX3A 2J7EA 2WMHA 3BC9A 3T09A 1J11A 1GOMA 2BHYA 5ABEA 3AS0A 1FHDA 1XRVA 4CVUA 4BF7A 1IZJA 1QI0A 3U5YA 1OIFA 3PZMA 3WDJA 4YHGA 4PTWA 3WUEA 3VD5A 1E73M 5AC5A 4HOXA 5A6AA 3VIFA 2ZE0A 1LG2A 5FCZA 3SCWA 1UWIA 2D1ZA 1DTUA 4DWSC 1K9TA 2O92A 1FA2A 1BFNA 3GDBA 1UWRA 1FH7A 3DHPA 3SCQA 3HN3A 3L4YA 1DWGM 1ISZA 1KWKA 5IDIA 1C7SA 3E1F1 4PBGA 4KRTA 1EDQA 4CN1A 2FGZA 2HVMA 4JAWA 1O6IA 4B9YA 3OLEA 3WDRA 4PMUA 2VCBA 5I78A 2YL9A 3UERA 2BY2A 5DFAA 5E0FA 1JFHA 1K9DA 1RH9A 2CESA 2UY5A 1UYQA 1G9HA 3GBDA 2JALA 3AXXA 2GJPA 3PTKA 2NW0A 1E6QM 3ALGA 5E09A 3PZOA 1JZ7A 4K68A 3AZSA 4ACZB 3AMGA 1ISYA 2W61A 3BSGA 2VO5A 3VD7A 3UG4A 2DT2A 1E6PA 4E8CA 2DEPA 1W2VA 3DECA 2WK2A 2ZX6A 1CPUA 1W9BM 2WAGA 1JYXA 1CYGA 3OZOA 1QBBA 2YA0A 3W6MA 2VOTA 5BXSA 4GI8A 1E4NA 1ZB5A 5BWFA 1DWIM 1TVNA 4LYQA 3CGTA 3W4RA 2V3FA 3ZO9A 3NIYA 2VRKA 3CIVA 4N42A 3W24A 1R87A 1E6SM 2QMKA 1XCXA 3EDJA 3QHMA 1XSJA 5A6BA 1XHGA 1WZLA 4BQ5A 4B9ZA 1VFMA 1VF8A 3RJYA 4MTVA 4S3KA 1HJXA 4M1RA 3BMVA 3AIQA 1EHAA 3IANA 4IM4A 3U7BA 3PZTA 4Z2IA 3BAIA 4C7DA 2WVVB 4CVWA 4U33A 4XB3A 4JFWA 1E70M 3QOKA 5I3DA 3UR8A 2XVNA 1MFUA 3U5UA 4AZHA 4JHZA 3WUBA 2PWHA 2VVNA 3LPPA 1V6UA 1ZJAA 4ACZA 5AC4A 5CSUA 2F8QA 2XVPA 3NSNA 1FP8A 1W1VA 1GOWA 5GQBA 1BSIA 2BFGA 1MQPA 1GW1A 1E0VA 1KQZA 2CKSA 1U33A 4RE2A 4UFKA 4CD4A 2BV9A 3WH5A 4HZ6A 3RDKA 5I2UA 1UWSA 3CMGA 1Q6GA 1D7FA 1GQKA 3VU2A 4H8VA 4MJ2A 3OGVA 4J28A 4P7LA 4HU8A 1XH1A 4AY1A 3WQ4A 2XSAA 3ZR5A 1E5JA 5DF0A 1HN1A 2X0YA 4QP0A 1KCKA 3RM8A 5FL0A 3WELA 1WZKA 4XZWA 3W27A 3WIJA 4MNJA 1HJVA 5DEZA 6CGTA 5M3WA 4EANA 2WMFA 1UKTA 2X1IA 5DT5A 1R8LA 3ARXA 5CGMA 4PMVA 3TA9A 5EMYA 4JFUA 3RILA 3CMJA 2JIWA 3VOCA 4P7RA 3M6DA 1EO5A 3OGSA 1I75A 1QW9A 2WVVA 1CXLA 1B9ZA 1BLIA 3UR7A 3NCOA 1E43A 1B3YA 3L2LA 2YLLA 4E8DA 1J0IA 3CUFA 1NOWA 1HJSA 1PZ3A 4JL1A 3EMZA 1CTNA 3WKZA 1UR1A 7TAAA 2PWDA 5D8ZA 1OCQA 4F9JA 1XGZA 1B30A 2Q8XA 1QHZA 3WQ8A 3FN9A 2ZUNA 1MW3A 2GFTA 4AC1X 2XVKA 5BRPA 2GDVA 3TOPA 2J74A 3HJEA 3F5JA 3I3DA 5BRQA 1B2YA 4MB5A 2VC9A 1PX4A 4IPNB 3RPMA 2XSBA 4X9YA 3F5LA 4BQ2A 5M5DA 3GBEA 2BVDA 3BAXA 1OT2A 1BYCA 2C7FA 1LQ0A 4KMQA 3AYSA 1UH2A 3DYMA 3BAKA 4BQ3A 2CYGA 1EQCA 1SMAA 5A6KA 1HKMA 1AQHA 1WP6A 2YDRA 2CIPA 2BS9A 1QNRA 1V6WA 5A3HA 3WFZA 3VIOA 3CBWA 1KGUA 1JGIA 1MVYA 1KGXA 1B3VA 4Z2LA 3UESA 2D24A 5KEZA 4JIEA 4U5KA 1GOIA 4JCMA 5CLWA 2G3MA 1WNOA 4W88A 1Q6FA 2D2OA 1UUQA 3W25A 2Y2WA 1UR2A 1OD0A 4CD6A 1M03A 1HJQA 2BY1A 2CBIA 2OSWA 4AIUA 3W29A 2OYKA 1UH4A 2DH3A 5D4YA 3N18A 3BH4A 3EYPA 3CUGA 3WQ6A 2WYSA 3CHFA 2CCRA 3MMWA 1H0GA 1ODZA 4CUCA 3THDA 1WB0A 3WNLA 4WF7A 3ZJ7A 1GNXA 3CZJA 1B3XA 2RGLA 4UOJA 1FP9A 1UA7A 1E4MM 1UR9A 5BXTA 2BHUA 3VD3A 2J7CA 3BAJA 1ZBWA 4B16A 4H8UA 4CN6A 3TTYA 3SCPA 4UOQA 3VGHA 3GH4A 5ABFB 1SYTA 2WCGA 1A3HA 4URIA 2G8ZA 4B15A 3FNDA 3PZ9A 3VX0A 4D6CA 1E6XM 3AXHA 2TAAA 4AZ6A 3DYOA 2WKLA 4H41A 3PZUA 4TTGA 4R27A 2VI0A 3VGFA 2ZX8A 3POCA 5A8QA 1BTCA 1H5VA 4CGTA 3AZRA 1GOKA 4HPGA 5A8MA 3N1AA 4D72A 1VFFA 4UR9A 4LQ1A 2G4FA 3A3HA 2E9LA 4ZE5A 4QLLA 3LMYA 1PIFA 1JZ6A 1BVNP 4EAMA 2FH6A 2ZIDA 2VJXA 4PUEA 4X0VA 3MU7A 3WFLA 4M8UA 2WHKA 2ZOXA 3ARZA 2WVTA 3MANA 4UOZA 4HU0A 5A6BD 4WLCA 1ISVA 1XC6A 2YA1A 1ZBVA 2E8ZA 1CIUA 2E4TA 1EGZA 3NYDA 1PBGA 3PZGA 2J62A 1NWTA 3T0AA 2O9PA 2A3EA 3CHEA 3ZQ9A 5ABFA 1LWJA 2WB5A 4U31A 1CXKA 1Q6EA 4U2YA 4M56A 3VGEA 2YL8A 3ARYA 3WH8A 1OIMA 4OJYA 4GQQA 2VZTA 3WNOA 2EXOA 5CSYA 3WDIA 1F4HA 1JAEA 3W0KA 2J47A 2UWFA 3VDAA 4P7QA 2J7FA 4DWSD 2F61A 1UD2A 3TP4A 2A3AA 3ZM8A 2ZUWA 3QR3A 4NSBA 1VENA 2Y5EA 2XVGA 4ZXLA 2J7BA 3BXWA 3HU7A 4UFJA 3WUGA 4X0NA 2VZUA 2O9OA 1MXDA 1GPFA 5I0DA 4W8AA 3MSGA 4M24A 3BMWA 1DEDA 1K9EA 2VQTA 2JE8A 3VKKA 2WMGA 5DMYA 4N0RA 1US3A 4GI9A 4RE3A 1VBUA 2WMKA 4Y7EA 1E71M 4CCEA 3VO0A 3TTOA 1GORA 1TVPA 2XJ7A 1NQ6A 4AIOA 3PZIA 3WY1A 4Q7NA 2D0GA 2E8YA 1FH9A 4PTMA 1TA3B 2YBTA 4AZCB 4D1JA 4UQ9A 1BYBA 1VJSA 4UZUA 4UQDA 1V6VA 2CBVA 4E2OA 4WKFA 3ZR6A 2ZWYA 1BAGA 1JDAA 4PMOA 1B3WA 2E40A 1GJWA 3AICA 3GH5A 1VEOA 1OB0A 1E3XA 4FLQA 1LL4A 3PTMA 2D23A 3MUY1 2VT0A 3B8SA 5IFTA 3WQ5A 3T2QA 2VCAA 1JFXA 2CBJA 2EBNA 1TCMA 1CBGA 2FHCA 1E4IA 3GXFA 3AIWA 4PSPA 4ML4A 5GNZA 5AY7A 2WZEA 4R5EA 4UFHA 1KR0A 2EPKX 3ZSTA 1KBKA 2J7GA 4MDOA 1WZAA 1V6XA 3IJ7A 3VIHA 4GIAA 3NUKA 2WLZA 1PPIA 3AIBA 5D9OA 1PX8A 2FDMA 3NSXA 3SUVA 2J79A 5JIPA 1JXJA 2X0HA 1EOKA 1HX0A 4MDPA 3QOMA 1C91A 3AS1A 5FL1A 3AIEA 2ZUVA 1FFQA 2CXGA 1TA3A 3KEHA 5DT7A 2D22A 4AZCA 1DP0A 3GZAA 4JKKA 3AYRA 4UZSA 2A3HA 2BVTA 1W9UA 4F8XA 3L4WA 3GXIA 5A6LA 4ZE4A 2ZWZA 3RM9A 3VIJA 1OT1A 1ZS2A 3VNZA 5JBFA 1W9DM 4PCTA 1V3JA 3GXMA 3QHNA 3MV11 1U30A 2XFRA 4EE9A 3SCTA 4ZFMA 1OM0A 3WMSA 3AS3A 3WEZA 4FLRA 3OA5A 2DH2A 4DM1A 2VRJA 3CHDA 2VQUA 5CPSA 2YLAA 2O9RA 2XUCA 1ECEA 1I1WA 1TG7A 4HA4A 1KCLA 2VX7A 4PYSA 1JAKA 4H7VA 1AVAA 3FHQA 1UHVA 2PBGA 2VMFA 1H1NA 2EO7A 2QHAA 3WDQA 4HTYA 3AHZA 2DPEA 4HMEA 4M82A 1FFRA 1GOOA 1A47A 3SCUA 3WF0A 4H04A 1C92A 1SFSA 3ZJ8A 1HKKA 3KWXA 3AHXA 1OINA 4Z2KA 3CHCA 1WDQA 2B31A 2C8NA 1C8XA 1J9YA 1R85A 1CXHA 4GO8A 4UTFA 4DWSB 2OYLA 2WWCA 3TTQA 3N04A 2A3CA 1E40A 4KGLA 5CXPA 1IT0A 4BA0A 2PWFA 1UKOA 1E15A 1KGWA 2D20A 2VUYA 1B1YA 2AOSA 5C71A 1KR1A 4JKLA 4D6FA 1TZ7A 2WMJA 3ZMRA 1LJYA 4GZJA 5FOOA 5D8WA 2XFFA 2YL5A 1L8NA 5A69A 1D3CA 2NSXA 1V0KA 4L4OA 1W1PA 2WW5A 2BXYA 1UWQA 4OZOA 4E4PA 1G94A 1E55A 1NP2A 1E4LA 3OLGA 1Q4NX 3KE0A 4WIWA 1FH8A 2X05A 3WD2A 3ALFA 1UR4A 2QPSA 4KGJA 4QCFA 6TAAA 4V28A 4LX4A 4Q22A 3K8KA 4AD4A 4ACYA 1V3IA 3AQUA 4NRSA 1XD1A 3AZTA 3CZEA 5JIWA 1HF6A 4LYPA 4FF5A 1H2JA 1WDPA 5AYIA 1G01A 2J75A 1C8QA 2J25A 4ZEPA 3ZJ6A 3WD3A 4TUFA 3NDYA 4P8UA 3AMLA 4P8VA 3T0DA 2UY3A 4NZCA 4OUEA 2NT0A 2ZUMA 4DWSA 3SUWA 5IXEA 5A6JA 1RP9A 2BHZA 1J12A 1KFWA 1J10A 2XM2A 4M29A 1ISXA 5EFFA 1H09A 3W26A 2WXDM 2VX4A 3MV01 4S3JA 5A8NA 2CEQA 2ZX7A 3T2OA 1JIBA 1EOMA 3CUIA 5E70A 2DDXA 4UFIA 4HA3A 3O6AA 5D9MA 1MWOA 4GXPA 2CPUA 5A2CA 2WM0A 1MW1A 5HPOA 1W3JA 1JDCA 2ESCA 2GK1B 1PAMA 2VL4A 2Y4SA 1XV8A 4AD2A 4EK7A 1QNPA 4P8XA 3KL0A 3F4VA 3BCDA 1SR0A 1GQJA 1KXTA 3SIMA 1QI3A 4YPJA 3K4DA 3M7SA 4W8LA 1QNOA 3U7VA 4PCSA 3GTNA 3EBVA 4J27A 2ZUUA 5EFDA 3MSDA 1CXEA 4W5UA 3VDCA 4JKMA 3UG5A 1G0CA 1P6WA 3EDDA 2D3LA 1TMQA 5CLTA 3MS8A 4AWEA 3VGDA
chains in the Genus database with same CATH superfamily
2PF0A 4CU6A 2A7PA 3H22A 3G22A 4GYJA 1OHLA 4HJWA 3W1LA 3AI0A 3T0CA 1PSCA 1QI4A 3VINA 2IKHA 3SQLA 1X6NA 1PJ9A 1Q3NA 1LDCA 4UIOA 4IQLA 4GKLA 1XGDA 5E9XA 3OU8A 1RBLA 5C9ZA 1ZY9A 3A47A 3TYDA 1AA1B 3ID7A 1VFSA 3UXKA 5CG7A 3WO8A 1LF1A 1TIWA 5A6TC 3SFWA 4RDZA 5LYRA 5MKGB 3CTLA 3AISA 5FSDC 3M1ZA 3RLHA 4JHOA 5CQ1A 2V2HA 3LTSA 3QVQA 4CLMA 1LLOA 2ZKMX 3MMTA 4KEMA 2C0HA 2VZOA 2NWRA 4QBXA 4XWUA 4QLJA 3P67A 3PWGA 3LA4A 3WNKA 4PMZA 1WOAA 1W5QA 2ZRVA 3MDWA 3QPZA 4E6MA 4U3AA 4PTDA 3FGCB 1YXDA 3TR9A 4HCHA 1VFOA 2REQB 1X38A 2VGBA 5L9FA 3CWOX 1VP5A 3BL3A 4NF7A 1QHPA 1NFBA 1VYRA 4JY8A 5I3GA 3V5OA 1IGWA 2QGHA 9CGTA 4OBSA 4LALA 3SI9A 5AOUA 2GPTA 2IQTA 1EDGA 1BKSA 3M64A 4LGXA 1WV2A 5I00A 3AROA 3VE7A 2YJQA 2ON3A 3TYUA 3LN3A 5EGRA 1NIUA 4IQDA 5MKGA 1D2KA 1J5SA 2YCLB 4K7VA 1UKSA 1V0MA 3LOTA 4G6CA 2VFIA 3WL1A 5I23A 2BGSA 1W1TA 3G6LA 3BGJA 2VRQA 4GC4A 3PULA 3CV1A 2ZVIA 3M43A 5AKQA 5A8PA 1YTDA 1C3FA 1EJWC 4MUPA 3M41A 4HIBA 6A3HA 2QCGA 4MJMA 5HA7A 1QHOA 2TODA 4A4AA 3FGCA 1DXIA 1C9WA 1UR3M 2QW5A 5HQLA 3P7YA 2REQA 4MYXA 3DESA 3T6CA 3AHVA 3GFXA 1WPCA 5HDRA 3NZQA 2O7QA 1UCWA 4JTTA 3ABOA 3C6CA 3WNPA 3WH6A 3L0GA 4LBRA 1C93A 1E9ZB 4K8EA 4HSNA 2VZVA 4HA0A 3WK1A 3ZSSA 5A8GA 3W22A 3BTNA 3NQ7A 5BXRA 2YCLA 3TONA 4X60A 3VZZA 4IJRA 3TJ4A 3PWAA 4XBKA 4LH8A 4TXEA 1RD6A 2CBUA 4OOUA 3SADA 1XUUA 5IDZA 2PP0A 1GHSA 1F5ZA 1ZJBA 2HPIA 4D6DA 2G3IA 5BXPA 3MTWA 1GVFA 2CERA 4U2ZA 4XV0A 1A0DA 2XFYA 4W86A 2Z1XA 5CGQA 3L4ZA 1OFPA 1WDRA 2WCSA 3OOQA 4FXRA 2HV5A 3QYQA 4B5SA 3BLOA 4L4PA 1LG1A 3FJ6A 3WLKX 3NQBA 1Q13A 2VTFA 4UTUA 1WKDA 1OABA 3PZVA 2HCVA 7CGTA 3QPEA 5KZ6A 2VDHA 3UPBA 2R1NA 5T8GA 3KOWA 3M16A 4LNCA 4XO6A 1OC7A 2BP1A 3CZLA 4HZMA 3T4WA 1W9PA 3WJZA 2RJHA 4LCSA 3LHTA 4LAZA 1DJQA 5D2XA 1RBOB 4MKSA 3ZLHA 1S5TA 3GAYA 3MMUA 5CGTA 1Q6RA 2Q8LA 3L4VA 4M7SA 3TMLA 1W9XA 2CZFA 2ZRWA 3L66A 3D5HA 3HM7A 3J7HA 2EG8A 2PGWA 1OEPA 1J0JA 1W5OA 4KCVA 3S1XA 2QCHA 2OODA 2Y7GA 2CKRA 3VABA 2EEXA 2UY2A 2BXZA 4I7VA 3BWWA 1M01A 3E5BA 2DUZA 3N2MA 1L6FA 4QTGA 3W6LA 3P93A 2ZDSA 2EPNA 2CU0A 4QDWA 1PTGA 4FLSA 3STPA 4PE8A 4LBSA 1IEXA 4R34A 1W5PA 4PR4A 4WDTA 2H3DA 4FS9A 3VIMA 4Z2JA 3VD9A 2VC6A 4PC8A 2WJFA 4NVTA 2GQ3A 3LSBA 3IIVA 3WD0A 2VR5A 4GQRA 1XLLA 2WC7A 1H7XA 2HROA 5C0QA 3HGRA 3W85A 3GTIA 3AIRA 3HA1A 5HK4A 3T05A 3PK7A 4W8BA 3CAWA 1MW0A 4MAVA 2DVUA 1A4LA 4WKAA 4ZCWA 3ZT5A 1G4TA 1S2VA 4XUYA 3RXZA 2XH0A 4I3GA 2P5NA 2YBUA 1VIWA 3N2BA 2P3EA 2WHMA 5I24A 1O1HA 4ADUA 2VFHA 1QOPA 4YTQA 2FTPA 1ZBCA 2F6XA 3SUSA 3S5NA 1HL9A 4XD5A 1PO9A 1Z32X 1L0PA 3ISIX 2PDGA 1R3YA 2RAGA 3FHAA 4E5TA 2V8ZA 3B9EA 1HZYA 4YTUA 1M41A 4GVHA 3LNMA 5IHRA 4LEQA 3EWZA 2IXUA 4C65A 3QKZA 3SUUA 3ARUA 3WEMA 5G4HC 1E0TA 3OIHA 1K8CA 3KAOA 1GG0A 1V51A 4WVXA 2OPJA 3ZT7A 1A4MA 3DI0A 2HXUA 1QCWA 3CV7A 1EJTC 4GI6A 4N9DA 1Q7ZA 5HR6A 1HW6A 1KBJA 4C6JA 5G2WA 4GGBA 4PL2A 3B8VA 2KAUC 1V77A 3RM4A 4XK2A 3FVDA 4H7ZA 1MW2A 1YADA 1Q6CA 4IIGA 1JPKA 1VBJA 3THQA 3W28A 1KM0A 3NSMA 1XLMA 1PL9A 1KKOA 4GINA 3V0SA 4NZJA 4HOZA 2QCFA 5D2YA 3ZJKA 7A3HA 1JNEA 1S3HA 3ZWSA 2FPTA 3VA8A 5KZDA 1QBAA 3PPGA 4JTUA 4FIRA 3TJXA 3RR4A 2Y24A 3KLLA 3C8FA 1X1NA 2WPGA 4TU1A 4XX6A 2E3ZA 4W4QA 2PF8A 1H41A 1P4CA 2WWDA 3JW7A 4JTJA 1CGTA 5KETA 1XI3A 1A5BA 2NQZA 3TJIA 3WQEA 3O6DA 1HP4A 3C0SA 3N6QA 4NL1A 1D8CA 4YYCA 3EOLA 3N2TA 2PWUA 4CD7A 3QMRA 2ZUSA 5AYXA 5CSRA 2JEPA 3H26A 2XN2A 3EWYA 4QROA 4EXQA 3KHDA 1KA9F 1RD5A 2IXVA 4FOUA 3OB8A 3M7WA 1EIBA 3B04A 1CGUA 5EA9A 1ODUA 3KCLA 2W91A 5LA2A 1S1RA 1FVPA 1W1IE 3PG9A 3WQVA 1XFCA 5C2XA 1YDVA 2PRMA 4KRZA 5GNYA 1GTEA 1P0NA 4IP7A 4DEFA 1BXCA 2R1LA 4RCXA 3VIIA 3HPFA 1TFVA 1CGWA 1WKYA 3T0BA 2R9RA 1QPOA 3TROA 1JCJA 2J77A 3Q65A 4K37A 2DQXA 3EPOA 4OTKA 1JD9A 2GL5A 4C6DA 2W79A 3TFXA 3WF3A 4QAIA 2BZNA 4JFTA 4C6OA 3EWWA 2HISA 3UCQA 2CNCA 2HRWA 3GSMA 3SY8A 4K36A 1JL8A 4FNRA 1JNDA 4I5UA 5F2LA 3VNYA 3GR7A 4B5VA 4B5NA 3WENA 3WQWA 1UUOA 3WJWA 3UR5A 5CCZA 3FKKA 3TMQA 3W82A 3VZYA 5HPCA 2ONEA 3WQDA 3W53A 1VLWA 2VHLA 4QDMA 3ITOA 3NPVA 4HYVA 1KFBA 3DYPA 5EMUA 3AJXA 5DX7A 4YTSA 3DHUA 2ISDA 1N82A 3UT0A 2OXNA 4JX6A 1GHRA 3VKBA 1M7JA 3LCLA 1UASA 4ZOAA 3MUIA 4E4FA 5CH9A 1Y5XA 3L4TA 1TJPA 1E72M 1CGYA 4HMDA 4IUGA 1FCQA 1NF0A 2I5QA 3FEQA 4JXCA 2X42A 3G24A 1OD8A 3MVTA 2FB3A 4QJ1A 1Q45A 3GUWA 3EWDA 3A23A 4XSMA 3GUGA 3UWWA 5HOSA 4IFRA 1FWWA 2HE8A 3BCFA 1Z7AA 4FK9A 2W62A 1A5MC 1QDSA 5AECA 4MB3A 2H8XA 3ITXA 3GHRA 2ZA1A 3IGXA 3N13A 2HWGA 1F7BA 1VRXA 1XDLA 1GGOA 4IGSA 3TYCA 2Y89A 3FY1A 4C6IA 3GVGA 4I5XA 3T44A 3V16A 4G7FA 1P1MA 1LL7A 1IT8A 3GO2A 3VYLA 4OKDA 2ZRUA 3FXYA 1QPRA 5H8PA 1ZL1A 1W3LA 3PJWA 5HXMA 2DZAA 2NX9A 3UZYA 3FFSA 1UD4A 3TOYA 3OG2A 3R4IA 1X1ZA 2ANUA 4IIHA 3HG2A 3OYXA 3GDMA 4PUUA 1J0ZA 1GONA 3NL5A 4J3WA 3PBWA 3T1GA 6XIAA 1SFJA 2ZXQA 4ZO6A 1AUSL 2GVGA 1KM5A 1NOFA 3FA4A 2IQDA 3KZPA 3OLIA 4A3HA 2PTZA 1EF3A 3SCRA 3ME3A 1KXQA 3ENLA 2PD9A 6TIMA 4J2MA 4GPNA 1ZZMA 2YOCA 3W1AA 1G7VA 1LP6A 1XYZA 3UR2A 4U10A 3S6TA 4CD8A 1G5AA 4BKNA 3PANA 1W3HA 1F8MA 4WXZA 1NDVA 1QOXA 1MQRA 5I3HA 2QULA 4D71A 4HPHA 2Y8UA 3P2VA 3TR2A 1XYFA 4PTXA 1B9BA 5CPMA 1OF6A 2VX5A 1S5MA 5AC6A 3KWSA 1DE5A 1FWJC 1PS9A 2C15A 1U22A 4ZMGA 1TREA 2I1OA 2RKXA 1ISWA 5K9CA 1X39A 4QLKA 3AJ7A 3WDHA 3EX1A 3CK5A 3W7CA 1WAWA 3A4XA 4J3XA 1Y5VA 3DC0A 5EYWA 4W7UA 3PNZA 1QOQA 1W1ZA 4HPJA 1MDRA 4IJBA 5I3KA 1UA3A 1UC4A 4D8ZA 2VVSA 4GABA 5F2IA 2NV2A 1A5CA 3BUVA 5HAOA 3QGVA 1XIDA 5F2GA 2W67A 1XLHA 3CMFA 5ABEA 3S1WA 3VE9A 4JTEA 3G1FA 3OQEA 1OIFA 5CJMA 2OFJA 4YHGA 4C1KA 3VD5A 3TCSA 3VIFA 1EC8A 4WDWA 3TSMA 1U5HA 1G4SA 1AQFA 1DTUA 4C6LA 4CQ8A 5D38A 2O92A 3GDBA 4MJZA 1TQXA 6REQB 1AJ2A 3L4YA 2R94A 5J8LA 5FJPA 1DWGM 3GC5A 1ISZA 3PBUA 4YWSA 5IDIA 1KFEA 4I9JA 5A5WA 1ITUA 1TV5A 1WQ5A 3QLDA 3GC2A 1T0OA 3H2EA 1EDQA 4CN1A 2HVMA 4YMZA 1J93A 4A6GA 4B9YA 3OLEA 1KM3A 2O4QA 3UERA 3G18A 4Q8QA 2J88A 2X1UA 5B7YA 1IT7A 2CESA 4WZHA 1O5RA 4GVGA 2P10A 2JALA 3AXXA 1JRBA 3ALGA 4M0XA 1XYCA 3UPWA 5KTLA 1SUXA 3PWIA 3WFAA 4IMFA 1UP3A 4L1GA 1E0UA 1TJ1A 3R89A 3USZA 4CQCA 4JGDA 4E8CA 3R43A 1EJ7L 1A3WA 5LSMA 2XIJA 1VQTA 2WK2A 1CPUA 1TJRA 4GYKA 1CYGA 1ML1A 4FXFA 1XRSA 3E2RA 3ERPA 4GI8A 5DMMA 6REQA 2E1WA 1ZB5A 5BWFA 4US5D 4QSFA 3DFPA 3W24A 3LGEA 4OWGA 3LTYA 1E6SM 3GIPA 2TMDA 3NQ6A 3I68A 1WZLA 4BQ5A 4B9ZA 1RBAA 2YW3A 3AIQA 3IANA 3PZTA 4Z2IA 2X16A 2ZZ4A 4GHRA 4CVWA 2WSQA 1JPDX 4JFWA 3STGA 3QZ6A 1UJQA 2DVXA 3UR8A 3RCYA 1MFUA 3DBPA 1PCWA 2JKPA 2PZ0A 1KKRA 5D30A 3WUBA 4D8LA 2V81A 3O63A 5FF3A 1K03A 3D46A 3TYZA 4TX9A 3UZJA 2FQIA 5GQBA 3UG8A 1KQZA 2CKSA 4L9XA 1EP2A 4UFKA 4JNMA 3R12A 5FJOA 4CD4A 4HZ6A 3RDKA 2X1RA 5I2UA 1UWSA 3LG3A 4EF9A 3W23A 1WUFA 3PJTA 2NXHA 1WA3A 3WQ4A 3ANUA 3ZR5A 3OW1A 4DO7A 4XO7A 1E5JA 4JYFA 3SSZA 1DV7A 4FEZA 5D33A 3ITVA 4XZWA 1IZCA 2NXGA 5M3WA 1UKTA 3FJ4A 3DG3A 3KCJA 1SSGA 3DIPA 1TWSA 4PMVA 5B7ZA 1IXOA 4PB4A 2G50A 4JFUA 1FWEC 3NPXA 4P7RA 1VD6A 4RPPA 3OGSA 1MUMA 3CU2A 1I75A 3JU2A 3IEBA 3W7GA 3EWBX 2OZTA 1B3YA 3L2LA 3W02A 4O10A 3IIPA 2YLLA 3CUFA 3DHDA 1WDDA 4N6FA 1HJSA 3SRKA 1H63A 4DXKA 4ZSTA 5D04C 2PWDA 1HKWA 2YFNA 1Z44A 1B57A 1XGZA 2Q8XA 1QHZA 3BSMA 3LHWA 3APTA 1I45A 3JS3A 5T9CE 4B5TA 1S39A 5BRPA 4GX9A 2J74A 1N7KA 1VRDA 5BRQA 3DFHA 5E1QA 2XSBA 4X9YA 5M5DA 2BVDA 3BAXA 3UWZA 3QPYA 4KMQA 2CYGA 3F03K 1SMAA 3P6LA 1RCQA 3GTXA 1WP6A 3C52A 2CIPA 2HBVA 1V6WA 3PTDA 3R8RA 4GWEA 2PTXA 3TSBA 1XM3A 1KGXA 4IQEA 2J66A 4LV4A 3C0QA 5KEZA 3L68A 2HJPA 4U5KA 2G3MA 4O54A 4FB7A 4N2YA 4G1KA 1LLWA 2R14A 3C2FA 1UWAA 4C6KA 4AMAA 1Y5WA 2BY1A 2CBIA 1UH4A 2DH3A 4FXSA 3N18A 3BH4A 1GZGA 3CUGA 2WYSA 3H7RA 1XW8A 1H0GA 1EPVA 2RHGA 4NKCA 1F61A 1WB0A 3WNLA 4WF7A 1GNXA 2YW4A 4XAZA 1KD0A 2A7NA 1E4MM 3VC5A 3LHVA 1R3TA 4QG6A 1QNVA 4MFEA 3P84A 3OO2A 4CN6A 4HNUA 4G7EB 1DIOA 3H2MA 3TK7A 1A3XA 3CLMA 1SYTA 2HZGA 5K4XA 3QBUA 2G8ZA 3OVPA 1A5UA 1N8IA 2ACQA 5C9XA 3AXHA 1A50A 4OFCA 1MZRA 4AZ6A 1SO3A 3CEPA 3U6WA 2WKLA 3WLLA 4H41A 4UUIA 2PDMA 4TTGA 3I7QA 1TWZA 4KFPA 4IGHA 5A8QA 1BTCA 4GBUA 1H5VA 4YU1A 3GXNA 2PDLA 4MYAA 1VHCA 4ZOBA 5A8MA 3UP8A 3HMJG 4O14A 3EXSA 1XIHA 2E9LA 4ZE5A 4PRTA 3FVMA 4ASTA 2QVHA 2FIQA 1F76A 3WFLA 1OCNA 2C6QA 4M8UA 2WHKA 1IR1A 4US5A 1W5MA 4WLCA 1ISVA 2VEFA 1CIUA 2C0AA 4GH3A 2QPXA 1PBGA 3Q37A 4MZ8A 4M1BA 3T0AA 4H9ZA 5BW6A 1VJIA 4G7EA 3CHEA 4ZQPA 3ZQ9A 2ABAA 1PIIA 1B54A 3WLHA 1Q6EA 3M0HA 3STCA 5AC7A 3WH8A 4DNHA 3WNOA 2X1TA 1RK5A 5BWAA 1F4HA 1Q66A 3W0KA 2O56A 2J47A 4FX6M 2ZCGA 4DWSD 3BLEA 4EPEC 2F61A 4POCA 4JX5A 1FDYA 2D69A 3P61A 1LT8A 1VENA 3QZAA 5TF0A 2J7BA 4DBDA 3HU7A 4L64A 5TIMA 3EX2A 1CT5A 3WUGA 1W3NA 3CL7A 4X0NA 2VZUA 1MXDA 1GPFA 2XIMA 4NT0A 5I0DA 2XH2A 3CUXA 3MSGA 4JTAA 1K9EA 3VKKA 3BICA 3L5LA 4JTKA 3BQ6A 4N0RA 2NZLA 4LJ3A 1H7PA 4UC5A 2RDWA 1Q85A 4GX8A 4LS2A 1VPYA 5DN1A 1TVPA 1NQ6A 3PZIA 3F4WA 3QTGA 2I5IA 1FH9A 3UZZA 4S1FA 2A7RA 5REQB 2OQHA 4UQ9A 2OGYA 1UB3A 2CBVA 3FDKA 2PDUA 1WBJA 3BJFA 4LVBA 5C5YA 3GVQA 3FJLA 2QAPA 4E2VA 4WQ6A 3UWQA 3IGUA 3W75A 3C61A 1GJWA 4WCJA 4EACA 1WYIA 4FLQA 3MUY1 4Z08A 2INZA 5LNWA 2VCAA 3DENA 1PHWA 2EBNA 2X2GA 3TZNA 3WLOA 3W70A 3AIWA 5GNZA 1NDWA 5AY7A 4NZFA 2NLIA 4ZO9A 4R5EA 3WQOA 4UFHA 3W00A 1UC5A 3ZSTA 1KBKA 2J7GA 2OQYA 4MDOA 1WZAA 3IJ7A 1RCOB 3IJDA 2CLEA 3VIHA 4S39A 2Y61A 2PDYA 1DORA 2WLZA 3AIBA 1O4UA 1W0MA 5JIPA 3LB0A 2GWNA 1EOKA 1J8VA 4J5NA 1FFQA 5REQA 5DT7A 3AALA 3WJXA 4UZSA 8XIMA 1TWWA 1W9UA 1RJPA 1SFLA 2VWTA 3HG4A 3RM9A 3KP0A 5JBFA 3IPWA 5CSSA 1F3XA 3GXMA 3QHNA 4AVOA 2R1KA 1KTBA 3MV11 1U30A 3O16A 4JEQA 1D9EA 3DFTA 3WMSA 1EZ2A 3TAOA 3LCFA 2DH2A 1I2RA 3ABSA 5CPSA 2XUCA 4HA4A 4ZB2A 1JAKA 5FJIA 3UWEA 1B4KA 3FHQA 4MWAE 2FZDA 1PE1A 2ZTJA 2PBGA 2VMFA 4HTYA 1US0A 3AHZA 1T7LA 4HMEA 4YYFA 2PGEA 4H9YA 4GNVA 1FFRA 2AGTA 3WF0A 2V67A 1UPMB 5JQ9A 1VLIA 3KVKA 3T42A 5LGZA 3MHUA 2C8NA 3EB3A 1YRRA 1JCTA 2PA6A 3RX3A 4DWSB 4UTFA 2WWCA 3MDUA 2A3CA 4DF1A 2PCQA 4BA0A 3ITYA 2O55A 2VUYA 4QQUA 1DIKA 4L6HA 3GU9A 4LFYA 4XKYB 4Q8PA 4GZJA 3GAKA 1L8NA 2AKMA 2CZEA 3WBYA 3MKCA 2ODOA 3PR2A 1RCXB 1W1PA 4OZOA 1ZLPA 1G94A 1E55A 4NJKA 4I5RA 3M5ZA 1FDZA 4PB3A 3JR2A 4ZQNA 2X05A 2VEPA 2E09A 4ML9A 2A4AA 4LX4A 3A13A 3EEGA 3U4FA 4C6PA 1V3IA 3TW9A 4Z17A 3CZEA 5JIWA 1TB3A 3N4EA 5KMYA 5BMXA 4FF5A 1G01A 2J75A 4DPQA 2J25A 4D2JA 3TU9A 3AMLA 3MJMA 3XINA 1FY6A 4DWSA 2CLLA 5IXEA 3EKGA 1RP9A 3NZGA 3Q45A 2XM2A 5LNSA 5EFFA 3W26A 2VX4A 3MV01 2CEQA 3T2OA 1TJ0A 4GC3A 1UOZA 3UWYA 4XKYA 1FWSA 2C16A 4LVAA 1MSSA 3H7VA 3LXCA 4NUWA 2CPUA 2WM0A 3GYEA 1W3JA 4TV6A 1EUAA 1JDCA 4M6PA 3SJ3A 1AFSA 2Y4SA 1XV8A 3F4CA 2R1MA 3DHFA 5CZSA 5K2ZA 1XICA 1JULA 3BW4A 1EEPA 1SR0A 3MBFA 1V79A 4JTHA 4KF1A 2QCCA 3DKLA 2X1SA 4J4KA 1Z6KA 1W8GA 4PCSA 2PU1A 3JRKA 3CAKA 4CQAA 2OMAA 1KC7A 5EFDA 2P53A 3MSDA 3VDCA 4PUWA 1REQB 1G0CA 5CLTA 1TMQA 3MS8A 5J5RA 2YXOA 4GUIA 3VXGA 1SJAA 2VDIA 1EF2A 1AODA 4J35A 5HWNA 2X09A 2PTWA 3W6YA 2GVYA 3THCA 4DELA 2V5JA 3WBEA 3TTSA 3BSHA 1TV7A 3G0SA 5F1VA 1BGGA 1ZQ5A 2FHFA 2PE4A 4FPSA 1P48A 5CJ5A 1ADSA 2J8FA 4OQVA 2VELA 2OWCA 2J8GA 4ZO7A 1DYSA 4NJGA 3MSYA 2B7OA 4F0MA 4WUIA 1EQPA 3NO5A 1UKPA 1VYPX 2ZE3A 2PUZA 2BVWA 1K6AA 2XVLA 4FR6A 4I7UA 4RDVA 3W01A 1UBSA 5I79A 3Q4DA 3THAA 4O0ZA 3BAWA 5LIWX 5HQMA 4HQVA 2FJUB 2GSHA 4E4UA 3U8GA 1NU5A 3GXDA 3NQ8A 2YZRA 4UMBA 1REQA 4HN8A 4WD0A 3WMBA 1UD6A 1E9LA 5XINA 2Z7GA 4HHMA 2DSWA 2J7DA 1LL6A 4AXNA 3HMCA 4ATWA 3SB0A 1ZALA 1T5AA 1NM9A 3FX4A 2PD5A 1MYRA 2FKPA 1SQ7A 3CL8A 4PFHA 7ENLA 2NQ5A 3DXIA 2FVKA 1E51A 1M68A 2WM1A 4NAFB 1VR6A 1AW1A 2FHBA 2PDKA 3ECQA 3W2KA 3AS2A 5GVJA 2GJNA 1NQKA 3UJFA 2D3NA 4AD1A 1XDMA 2W4XA 4HKPA 3KL5A 3AMCA 1XGEA 3GYCA 4OGZA 3ZXWA 1T40A 4Z0JA 5DQPA 4J3TA 3GRIA 1O68A 3ABQA 4IZGA 4W89A 2PDHA 3PFMA 4IISA 2W63A 3AYTA 2ISSA 2QUNA 2BMBA 3WQGA 3O7UA 3ATYA 5MHBA 3UJSA 3EOUA 1XIBA 4CU8A 1FXPA 2VEGA 4MLJA 1RPKA 1FWAC 2V2CA 1U2YA 4EXAA 2AL2B 5BU9A 2GZXA 2XGIA 1VBRA 4IMDA 4I6KA 4ZB5A 2V0TA 4EP8C 3WG6A 5AYZA 3O0FA 2QF7A 3DGBA 4IPLA 4JHMA 3M46A 4TO8A 1PKNA 3VDBA 4AD0A 1NWUA 1EXBA 1EGVA 1XPGA 1B90A 2Y6ZA 3MJYA 1CDGA 4K38A 1EXPA 3TYEA 3R5EA 4NAFA 3DDMA 3MI2A 4JTDA 4R53A 4FOKA 1R2RA 3EXRA 1E6RA 5HUOA 4XVDA 1Y7VA 3K4WA 4D6HA 3RG6A 3LPFA 4IG2B 1E6NA 2Z2UA 3GM8A 2PC8A 3ICJA 5G1YA 4NNCA 3HJZA 4EWND 3LGDA 1GEQA 4OHQA 4M5PA 3T2PA 3I10A 1RHCA 1VC4A 5AYBA 5JXQA 3AOFA 2PDWA 4V33A 1TELA 1WDSA 2AL2A 4WEVX 4XZMX 1Q6DA 3UZ5A 3W84A 3TDFA 1E0WA 3VMOA 3BOXA 4AB4A 4I9AA 2A85A 4AEEA 3OBAA 1XISA 2E6AA 4XIAA 2VURA 1PHQA 5FF7A 4OV4A 3WUFA 4AZBA 2HEJA 1I1XA 3PHAA 2E28A 3NEHA 2FH8A 3LHUA 1W91A 1PVNA 4HZ8A 5HINA 1KBLA 5LHEA 1PEZA 1LQ2A 4H01A 4Z2HA 1ALDA 2W27A 3R0KA 3DFNA 1EDTA 1DQXA 2E6DA 3E12A 4IPIA 4DUOA 4AZGA 4HBKA 3QRHA 2W92A 4ES4A 3UZWA 3G1VA 4DUWA 3ZOAA 1XLEA 4ICCX 4UR8A 4IG2A 5E6YA 3V0UA 2D2GA 3G77A 1W37A 2VWSA 3HF3A 4LVGA 5GPRA 4RX0A 3UJRA 3EA2A 5CC6A 4G1NA 4JEJA 1PKYA 2ZC8A 1C8YA 4JFVA 3WH7A 3IJ9A 1ME7A 4RNHA 4GUHA 4UTWC 1QNSA 5DBUA 1GT8A 3SRHA 2DGAA 2Z28A 2POZA 1XJBA 3QQ1A 2WO5A 5G4EA 3OZMA 3WL0A 1OX4B 4LVDA 5EY5A 1JDDA 4TOQA 3ZT6A 4B3LA 3QW3A 1F73A 2V69A 4IXXA 1DPMA 4ZODA 4A22A 3WDPP 2CWNA 2FPYA 4IPPA 1EJUC 1UOKA 3ARSA 3WLRA 4QG8A 1US2A 4NASA 1CLVA 3CUJA 3WJYA 1WAUA 4GRSA 3KLKA 4P8WA 5DCEA 2Z1SA 2P0IA 4DUVA 2HVOA 4HNLA 1A0CA 4GO9A 4IL0A 3FOKA 1OCJA 3W37A 1AD1A 1Q7MA 2WANA 5KITA 3IUDA 4QFUA 3NL6A 4WY0B 1M1BA 1DWAM 2YX0A 2Y5JA 2G41A 4BS0A 1B3ZA 1VB9A 1UR0A 1F4AA 2PDJA 1TCDA 3GD6A 3W07A 1D3GA 4MSSA 2QDEA 3B40A 3F5KA 2MANA 3OHMB 2IPFA 3VOJA 1TX0A 3LCWA 5AYYA 3FKRA 4PCPA 2F6UA 2J9XA 4QX4A 2C1HA 1GVQA 2WSPA 1OX6A 5E5CA 2PI6A 5A95A 1OX4A 2V6AA 2JF7A 4J7RA 4DNMA 3RRAA 1EWDA 1ZHAA 2JIEA 2NQHA 2DT0A 5K3VA 3NOEA 2XGBA 3PBMA 3MO4A 3OVRA 1CNVA 2NSOA 3B9DA 1M7XA 2QUVA 2QPUA 2ZBTA 3UY7A 1XLCA 1GVYA 1JDEA 3UXDA 5F4XA 4Q8TA 3FCPA 1SJDA 2YCIX 4O53A 1KXHA 1T6MA 2VP8A 4HNNA 4WY0A 4JZ5A 1DXFA 3BV4A 1XFBA 2OWWA 1ZCOA 1QI2A 4LVFA 3A3WA 4E0CA 4H4IA 2DFAA 1ZUAX 3PAOA 3UVAA 1RZMA 2PB1A 3T08A 1FHLA 4C60A 2X8RA 1YQ2A 3BURA 4TVCA 3JUGA 5CG0A 4IMAA 3SO7A 4IWWA 3CH0A 2PTYA 1ZSXA 3WZ0E 1TYGA 4DXXA 3NQDA 1HJUA 2OOGA 2D0FA 1R2SA 4NU7A 2V5BA 4ROPA 2W3ZA 3MHFA 2Y0FA 1ICQA 1FX6A 3IJ6A 1J18A 3L65A 2B81A 2WNNA 4O52A 5TNVA 1Z69A 4LOCA 5CC5A 3N14A 1XINA 3M4HA 1V0LA 1NH6A 3OVGA 3LBCA 3G0XA 4O15A 4UXDA 3VUSA 4R9XA 3D6NA 4O19A 3SR7A 3SCOA 2QJIA 1XLDA 3QV8A 1O5KA 4H8NA 3A12A 4A35A 1POKA 1PUDA 4C5ZA 2KX9A 3T81A 2BXVA 2YL6A 1H49A 1R9ZA 1DBTA 3MUZ1 1MI3A 3UEQA 1GOXA 4D8AA 4Q6JA 1UWTA 4B91A 2CFFA 3PF3A 4UBPC 2OU4A 4DHGA 4PRWA 4Y90A 3MZNA 8CGTA 3NQFA 1SW3A 1FWNA 2WNWA 1OSEA 3UBPC 3CYVA 2PEVA 8A3HA 1XSKA 3PS7A 3VFCA 4B2DD 2CHRA 4JTGA 3APYA 1WZMA 2MNRA 5JMUA 3C2RA 3GG7A 1LOSA 2ISVA 4HT3A 4J9JA 5BRBA 2G3NA 4PMQA 4M6VA 5KINA 2INEA 4WGXA 4TX8A 4GUJA 3E0FA 3C2EA 3U4AA 1FCBA 1XCWA 1BXBA 2AMGA 8TIMA 3T78A 5F4WA 3WLMA 4V2XA 1P0BA 1SGJA 2H90A 7XIMA 1KWGA 4QAWA 2JF6A 4NJJA 1CWYA 1KM4A 4N7QA 1Y0EA 4PN2A 3TCEA 1TZZA 5AFDA 5ECUA 4YLWA 1NVMA 4MWAD 3CWHA 1IWAA 3M0YA 1BGAA 2Q3OA 3RIKA 4J2PA 4F66A 2XZ9A 3VNLA 3MCOA 2WZIA 5A8OA 3UETA 2DY3A 1SZRA 1AMKA 1UP0A 3WF1A 2RJGA 1M5WA 4PMNA 3SN4A 1WO2A 3B0PA 3CTTA 3UW6A 3MKVA 2VR4A 2WBKA 3B06A 2WHLA 3QFWA 2E5DA 2PC4A 3MBDA 2UY4A 2VD9A 3E0IA 3LCIA 2G3JA 4JTFA 3B0XA 3HPSA 5T91A 2WQPA 1DJYA 1V02A 1XKYA 2VFGA 4JICA 3PUGA 4JDBA 1I4NA 2NT1A 1V6TA 1R6WA 4MFDA 1YW1A 1FCVA 7ODCA 1H61A 2E25A 3GVRA 4LC8A 1DHPA 3B9NA 4C6CA 1EL3A 1G67A 4BJHA 3W7MA 2DVTA 3IIOA 4PMXA 1JZ5A 1CZ1A 2XWDA 3NNTA 4JIHA 4J3UA 1UROA 2RFGA 4JFSA 4CNOA 3M5VA 2WV8A 2D2JA 1RP8A 3MP5A 3G1RA 4JL2A 4L7ZA 3N2OA 4EPKA 2VXNA 4GIEA 1XXXA 5M17A 1JF5A 1M6JA 1S2AA 2YIHA 4CN4A 4CD5A 1HVXA 4FMVA 3MUAA 1W3TA 3G5EA 1ADOA 2WZHA 1XG4A 2MUCA 3PUOA 3PG8A 4FIQA 1YNYA 2YKKA 3JZEA 3N11A 1B4EA 2NUXA 4QM1A 3V35A 1E1EA 4AZ5A 5HJYA 2E0PA 1ZJIA 3D47A 1PYFA 4Q4MA 2GSJA 3TJLA 4HZ7A 4WJXA 3QGKC 1W2PA 3WD1A 3VD4A 2IKGA 1IV8A 2O0TA 1WCGA 4RZ4A 3U57A 4DWDA 2C13A 3CT7A 1KLZA 2RGMA 2GVEA 4J3VA 1X96A 2C18A 1MNSA 4O18A 3VIPA 1IF2A 4CCDA 3EMCA 2PMQA 4K1WA 3BE7A 3CXOA 4G9PA 3GIYA 4W5ZA 2WC4A 2P8BA 1ZCCA 2VOMA 1NP0A 3TXZA 1GJUA 2VZSA 3TYBA 2UV8G 1AMYA 4G2DA 1JZ2A 3KZSA 1F07A 2P88A 1QW8A 2OTDA 4DLFA 3HOJA 3CL6A 3W81A 1K3UA 3GWQA 3ZIZA 3ARRA 1MXGA 4PL1A 5I07A 1R7AA 4UTTC 1DJWA 4KKXA 3TN4A 4Q4PA 1TPH1 2QMJA 2FPVA 3C3NA 3S3GA 2BB0A 4MF4A 2AAAA 2EQDA 3HFYA 3P62A 3TC7A 8RUCA 3F2CA 4MWAB 1KB3A 1YTKA 1VPXA 5FEPA 2QKFA 1EA9C 2ZICA 4WHBA 2WZTA 2YDSA 5IRPA 2E67A 4P2VA 3OP2A 4GE8A 4K39A 1M53A 2Z27A 3ZVHB 3VMNA 2FVMA 1LRNA 4P7NA 3M0LA 2NUWA 4L5ZA 5HNTA 3K8LA 5JBEA 4GNJA 3ONCA 1TE6A 2Y8KA 3E5PA 1XIIA 1OGGA 2XU2A 2OQLA 1TV8A 3NM1A 3WF4A 3D3AA 1HVQA 1ESWA 4KPLA 3TW6A 1KRBC 2FDSA 4TMCA 1C7TA 3JZUA 1W1YA 1IXPA 5CZ0A 4AC7C 3B0UX 5ABHA 1OQFA 1HT6A 3S9YA 2VYOA 2A3BA 4W93A 4TV5A 3HTWA 4IMGA 3H2AA 2WMHA 3T09A 1J11A 1GOMA 2OCZA 5F4SA 2HBXA 4A8NA 4KBXA 3VAVA 4CVUA 1IZJA 4R9OA 3PZMA 1Q4WA 2QDHA 4MWAA 1R3SA 2GDQA 2AAMA 1E73M 4V15A 3ABRA 3FK4A 1XPYA 5CPOA 3GXTA 4QIUA 1VZWA 2YPIA 5KZEA 4K6AA 1W3IA 2OKOA 1FA2A 3MO7A 1BFNA 5LZLA 3P74A 1UWRA 3ZVHA 1S5VA 3SCQA 4JQ3A 1XLFA 1QT1A 2WJDA 4KRTA 2IS7A 2FGZA 1XC4A 4JAWA 2ZQ0A 1O6IA 1TR9A 1S1PA 3KVJA 4IF2A 3IRDA 3WDRA 2DZSA 5HR7A 1QK2A 5GJMA 1K9DA 1RH9A 5DMNA 2R24A 2UY5A 2C91A 1G9HA 1JR1A 1TPC1 4RUBA 5FF4A 3NO3A 2ZRZA 3PZOA 5LGXA 1KNWA 1ISYA 2W61A 3BSGA 4DJFC 3UG4A 1S38A 1E6PA 3QZEA 4JDYA 2DEPA 4H19A 1RVKA 3DECA 1W17A 3S2MA 1JYXA 1YDNA 1QBBA 1DQUA 5AB3A 5BU6A 3W6MA 2ZRYA 4GXMA 2DZWA 4BWLA 2E5CA 1LOQA 4E8GA 2QJGA 1DWIM 1RVGA 1OZQA 3E9AA 3TH6A 4QSHA 2V3FA 3ZO9A 2VRKA 3CIVA 1KTNA 3QY8A 4LAKA 3RLVA 4AF0B 2BOEX 5A6BA 1QATA 4IFKB 1P0KA 5GJNA 5D03A 5C2GA 1I60A 1HJXA 3KX6A 4IM4A 1LLZA 3BAIA 4U33A 4Q7BA 3P14A 1BWLA 1E70M 2NX3A 3ANVA 3U5UA 1SZFA 4JHZA 1O66A 5LIYX 4Z0SA 2PWHA 3LLFA 5AC4A 3RLGA 1T8QA 2XVPA 1FP8A 5H8MA 1W1VA 1GOWA 4WDUA 4LV9A 1U33A 2GLKA 1L2UA 3WH5A 4MZYA 3CMGA 3S5ZA 1D7FA 2E7FA 4H8VA 1XLIA 4GH1A 3W1UA 2DQWA 2XSAA 3OZYA 5DF0A 3DX5A 4UB9A 1HN1A 2X0YA 4QP0A 1KCKA 3WIJA 4MNJA 4KCUA 4EANA 1P6BA 4AF0A 5JH1A 5CGMA 4IFKA 3TA9A 1RA0A 2FYMA 3LSCA 2G5WA 3VOCA 3M6DA 3P8IA 4ZZ9A 1LORA 1CXLA 3NWRA 1SZNA 3NCOA 1E43A 1XLJA 1OFQA 1FUYA 3MB9A 2AQVA 1J0IA 1NOWA 3W7DA 2BG5A 4O4VA 5LIXX 2X41A 1CTNA 2Y7DA 3WKZA 3LXAA 1JPIA 3LQGA 1ZP3A 2ZUNA 3MZ2A 3TN3A 4AC1X 3GLCA 5CPLA 2NQLA 2HSAA 2PDCA 2GDVA 1VS1A 1NDZA 3I3DA 4UMCA 4A8IA 4MB5A 2VC9A 2XINA 3H24A 4BEUA 4BQ2A 3GBEA 1BYCA 2C7FA 4DO4A 3AYSA 3BAKA 4BQ3A 3BJTA 2PDPA 1HKMA 1AQHA 1O60A 3WQCA 3R6IA 2QUTA 3WFZA 3B4YA 3LCXA 1JQVA 3P5YA 1B3VA 4Z2LA 1KRCC 2D24A 4PEKA 2KZHA 2CZ5A 4JIEA 1OY0A 2DW6A 1GOIA 3MVIA 3RHGA 2QQ6A 5CLWA 5I06A 1LUCB 1WNOA 1H5YA 1TMLA 2D2OA 4CNSA 1UUQA 4MOZA 3W25A 1PCKA 3CASA 4CD6A 4NHVA 2OSWA 2ZRXA 1GYNA 2OOFA 3QFEA 3PUEA 4AY7A 1Q63A 3WQ6A 2R82A 3V5CA 2CCRA 3MMWA 5D05A 5FF0A 1ODZA 2GGGA 2Q6ZA 4CUCA 3THDA 4O1BA 3CZJA 3NGJA 1B3XA 3V0TA 2VGFA 3G1HA 1UR9A 1JCMP 3SGUA 2J7CA 3MSRA 3N34A 2HS8A 4H8UA 1ZRQA 4UOQA 2EG6A 3LV5A 3VGHA 3W88A 5ABFB 3O1NA 3IVUA 3S2JA 3IJQA 1KFCA 2WCGA 1K70A 4URIA 4B15A 3E96A 4D6CA 5DCDA 1SR9A 3LYEA 3DYOA 3O3RA 4RW3A 3W7HA 4ECLA 1VBGA 3CQKA 1R38A 1V93A 4GJJA 4R27A 2VI0A 1LUCA 3AZRA 3BPWA 3DC8A 4D72A 4UR9A 3PSWA 3UYCA 3UNTA 4C90A 2BTMA 3FA3A 4QLLA 3LMYA 2YDAA 1JZ6A 4AEOA 3RAOA 1KLYA 2FH6A 4GJIA 4EWJA 3S47A 3M0MA 4X0VA 4C6MA 3MHGA 1K7XA 4ZVJA 2EHHA 3EWCA 3C56A 2WVTA 3MANA 1OADA 2Z1WA 3FYYA 3R7MA 3W2MA 1XC6A 4Q8VA 4DYKA 2E8ZA 1EGZA 2SFPA 3OPSA 2PSNA 3NYDA 3PZGA 3SY5A 5ABFA 1LWJA 1OYCA 1CB2A 3H2CA 4U31A 1CXKA 4U2YA 4M56A 3VGEA 1OIMA 3EOEA 2OB3A 1NFGA 4OJYA 1TMHA 2EXOA 3WDIA 2UWFA 1HQTA 4MY9A 2J7FA 4DVOA 2Y88A 5U4NA 1QASA 4BF5A 4AHOA 4A05A 5EKYA 3VCCA 4FA3A 3QR3A 3INPA 3KOXA 4UTIA 4GYPC 4UFJA 4HHLA 3M5XA 4FO4A 1TTQA 4W8AA 4BI6A 4ROQA 3WCZA 3BMWA 4HNCA 2DORA 3A22A 3WBXA 2OEMA 1PZ0A 3TLLA 1US3A 3DCPA 4GI9A 2GVJA 1VBUA 4Q4KA 3VO0A 3U3HA 3TTOA 2V5LA 2CLKA 3EPNA 3ORWA 4AIOA 3WY1A 3IARA 1WXJA 2D0GA 2QNEA 4PTMA 3K2GA 1EZWA 3IV8A 2GYIA 2YBTA 4JN8A 3UWVA 1VJSA 4MGGA 4UQDA 4E2OA 1G4EA 2ZWYA 3B8UA 1JDAA 3S83A 5DXXA 4DJED 1Z48A 1PZ1A 2PDXA 4ICNA 2OEJA 3PTMA 2D23A 3RX4A 5IFTA 2CBJA 2P0OA 1TCMA 4FHAA 2G0WA 1Z8AA 4JBRA 2FHCA 2WOQA 3GXFA 1ZP4A 2WZEA 1Y65A 1JCNA 2H8ZA 5BOFA 2C3ZA 2E6YA 2JGYA 3G8EA 7TIMA 3S1UA 2C1GA 3O0KA 3RLUA 2V9DA 3NUKA 1TWIA 2A5HA 3NSXA 4S3FA 1FBAA 2J79A 1JXJA 5CEWA 1DQWA 3TV8A 3AWNA 5SWUA 1KRAC 2ZUVA 2Y7EA 3KRUA 3BGGA 4NP7A 3ANYA 3CAQA 4F2TA 2HE5A 5I3FA 4IT1A 1HO4A 2AQWA 2Y85A 3OG3A 3DFYA 3P82A 2QIIA 4IUOA 3VNZA 3SY1A 3LENA 5EBUA 4EPDC 3I7SA 3DFOA 3P80A 2GOUA 3L0KA 2XFRA 4GYPA 1OM0A 4AVNA 3TQ0A 3AS3A 3E3HA 2VRJA 1WKEA 1ECEA 2VX7A 1TTJA 1XBVA 4H7VA 1KCZA 2J27A 4PODA 4NYYA 1GTHA 4PZVA 1H1NA 1M65A 2DPEA 5CC7A 3TEVA 1GK8A 3OBKA 1Q7QA 1A47A 4L4LA 4GG9A 1TPUA 3ZJ8A 3AHXA 3T8QA 1KM6A 3CHCA 2B31A 2AL1A 1J9YA 2ZADA 1RALA 2VM8A 1H7OA 1KTCA 1O5XA 4XD3A 2VC7A 4QEHA 1OFBA 1E40A 3KVMA 4UTMA 5FJJA 1KGWA 3CUZA 1B1YA 1F3EA 2AOSA 5C71A 4CEXC 3WMLA 4JKLA 4D6FA 3ZMRA 1LJYA 2AMXA 1IGSA 4OBTA 5FOOA 3TAKA 3N3MA 1H50A 3CV2A 3IJIA 4O28A 4O1FA 1V0KA 2BGNE 2OR2A 1FWFC 3TLQA 3EGJA 1NP2A 1E4LA 1GJPA 1RQEA 1FH8A 5AC8A 4S3EA 2YYUA 2PURA 3WD2A 1XLAA 3BLDA 2QPSA 3DH7A 4GXWA 2QJJA 4ACYA 4AX7A 1XD1A 1FXQA 2QCMA 1Z41A 2FZ9A 4LYPA 2OKTA 4XTDA 3FSUA 2OEKA 3L5AA 3I6RA 4FNQA 4KIEA 1I0DA 5CAHA 2NT0A 3NPWA 1C29A 4MPQA 5A6JA 1EPXA 3I6TA 4HSOA 1K8YA 2GQ9A 1ISXA 1H51A 4Z1DA 3TIMA 4R88A 5A8NA 2ZZ2A 4ZTYA 1YDOA 2QJHA 3TN5A 3H6OA 2TPSA 5E70A 1I2OA 3O6AA 1MWOA 4NQ1A 4HCLA 5I09A 5HPOA 5C9UA 4UTKA 1YEYA 1BEUA 4C91A 1PAMA 3JVAA 1QNPA 4ENLA 4M7TA 1TRIA 2CLMA 3ONBA 1JVNA 3F4VA 3BCDA 3REQB 2OO6A 3SM0A 3F2BA 3QEZA 2PGRA 2VGIA 3RU6A 4DJDD 2PLMA 3SIMA 4YPJA 1QNOA 3HQ1A 4J1OA 5FF2A 4W5UA 1CXEA 2YCJA 3EA3A 2I5GA 3GZ3A 1P6WA 3EDDA 5TBOA 4DJEA 4LEFA 4EF8A 3H2FA 1F9CA 1LBFA 1POJA 3EX3A 4I90A 2V2DA 2RH9A 5HWMA 4DAIA 4JIRA 3OIXA 3GR8A 4PCFA 1JYNA 3OYZA 2DT3A 1E6ZA 2WVSA 4S23A 3KL3A 2A0NA 2Z00A 3M0KA 1XLGA 3HG5A 1LRQA 2WCAA 1SPQA 2OLHA 2X40A 1UD3A 1KXVA 1D7KA 3H2NA 3LHYA 1SU5A 2ZXBA 4NZ4A 1BVWA 3F4NA 3AFBA 1W8SA 3RN6A 4FNTA 4UCFA 3SIZA 1LQAA 3LXBA 3REQA 3W2JA 5HMDA 5FA5A 1TPWA 3U2CA 2HPMA 4XISA 2GDUA 5JBDA 1QI5A 1PIGA 4O1AA 2H9AB 2WSRA 2ISWA 1NARA 1HKVA 3SBFA 3CH9A 2E9BA 3IS4A 2FTWA 3K8MA 3LY0A 1RAKA 5I3JA 3SURA 1UQYA 4XTIA 5HANA 2DZPA 4JN6A 2DV0A 5JVLA 1HTIA 3SAZA 4XUGA 1LBLA 2CHOA 1W3KA 3NG3A 2CITA 1S2TA 4PMRA 3BZJA 1XH2A 2XZ7A 1QPQA 1O95A 4RR4A 4H6RA 2Z2AA 1DIEA 1FTXA 4IP5A 3UA3A 3G1DA 2VENA 2R1PA 1EHNA 1TO3A 1XCFA 4ALDA 1MEHA 2YB1A 5E9AA 2I9EA 4C6EA 2DZXA 1ZJHA 1K7EA 3NFUA 3DKJA 1J0HA 5B80A 4N4QA 1LWIA 1ITXA 4GQBA 2XG9A 2DIJA 2QT3A 3QTPA 3AHTA 5EU9A 3W1MA 1EO7A 3LNPA 1H60A 3S1VA 3RK8A 4LPCA 3L2IA 1J01A 4NNBA 1Q2SA 4JTCA 4XZLX 4ICMA 2H9AA 2EPOA 3UGVA 3QC3A 1DHKA 3CB8A 4Y9OA 4BEQA 2Y8VA 1JGMA 4Z1BA 1PKMA 3BARA 3S0CA 2FGLA 3P5ZA 4PEEA 2HQAA 3C2YA 4AHPA 4ZTXA 3UPMA 1JCXA 4EIVA 1AH0A 1DWHM 3KOZA 3WLSA 4A29A 4ORIA 4DPPA 1NOUA 2QJMA 1MQQA 3ARPA 5D2WA 3B3DA 2E6FA 1AQ0A 1ECQA 4I8YA 3DGRA 4HJFA 4AG0A 4S3BA 5HMSA 3SW6A 4X2RA 4UCGA 3SGZA 4KT2A 2WHJA 1H11A 1IZKA 1IEVA 1IE7C 1NF7A 3ARTA 3QXBA 4HA1A 1I6NA 1H0IA 3DU0A 4UMAA 1VGAA 1JEZA 4N02A 1I2QA 1A49A 2JQXA 2PWEA 4UFMA 3QR1A 2OYMA 2DSUA 4KWSA 2GQAA 4PTVA 1X1OA 2GGEA 1ONRA 1MZHA 3P0WA 4AD5A 4DYJA 3AXIA 1J4EA 1VIZA 5CBJA 3USBA 1FWIC 2TRSA 4NI3A 1NY1A 2Q71A 3VNMA 1V03A 4Z1YA 1OC6A 1WBHA 4L80A 1P7TB 3RX2A 3W7KA 3R58A 4E38A 2VEIA 4YTTA 3S1GA 4BI7A 3U0HA 3CPUA 5HNNA 4LT9A 1B0IA 6PTDA 1MO0A 2OSYA 3CQJA 4KESA 3CQ0A 3D3FA 4M51A 1J6OA 2DSKA 3QMTA 1TV4A 3N15A 3R10A 3U2OA 2WMIB 3C0JA 2ZA3A 1VFTA 1O94A 2A2IA 4O16A 3KRSA 1RJQA 3AWOA 3HO8A 4YN5A 1G1YA 2D2HA 3AMKA 1XLKA 1EJSC 1JI2A 3A5VA 1V6YA 4J3SA 2YGYA 3N12A 3B97A 3RGTA 2F84A 3UNDA 2J78A 4Y8EA 5E0CA 4AWTA 1FWCC 1FWBC 3QMSA 2E1DA 1KBBA 3B0YA 4AU0A 4Q6XA 4XZHA 1HG3A 5G2IA 5ABGA 2VUNA 4HSHA 1SO5A 2OWXA 5I6SA 3ARVA 2PAJA 5C8BB 4I7WA 2VR2A 1CGXA 2JGQA 3FAWA 4CNTA 1P7TA 1RSCA 2BLEA 1JZ4A 1QAPA 4DIAA 1VKFA 4MB4A 1WOBA 2O9TA 3W1PA 3WD4A 5HNRA 2XHYA 4C5YA 1EGMA 2ICSA 3E38A 2GSEA 3S2CA 1ONWA 3K46A 1X6UA 1SW0A 3LPGA 3O6YX 1FWDC 3BG9A 4O11A 1HFBA 4GY0A 4LB4A 4MADA 1G6CA 4YIWA 2WMIA 5DXYA 5BROA 4D9PA 3OJGA 2EPMX 5A94A 1S46A 2BNJA 1HL8A 1TKKA 2R8WA 1RY0A 3I3BA 1PTDA 2DIEA 4OT7A 2BY0A 4WSJA 1I0BA 4D1IA 2ZVRA 3RUBL 3VVGA 3LI1A 4M81A 5EB8A 1GCYA 1K1DA 4H9MA 2NXIA 4AH7A 1AL8A 3AO0A 3RYSA 3VOFA 4PUKA 3GTFA 4MNLA 1CXFA 5EMLA 3VOHA 3LK6A 4WRHA 4O1CA 4ZQOA 3ABXA 4QJ5B 4W7VA 2DIKA 3R0UA 1Q6OA 1CLXA 3CUHA 3L4XA 4PMJA 4RLIA 3QLLA 4EOUA 2OZ0A 4FSAA 1JXKA 3SN0A 4H83A 3W1QA 4ZL1A 1W6TA 2IPGA 3NXLA 2DW7A 3IIXA 3GNNA 1IQ8A 3EAUA 4NXSA 2PP1A 2JKEA 1HIZA 1M7PA 4YNGA 3WNNA 4RK8A 4AYSA 5U7SA 3BG5A 1GUVA 2PDIA 2HNHA 3NZPA 3SCNA 4QHRA 1DOSA 2NQJA 3BAYA 3S8HA 3N29A 3A4JA 2ZX5A 3S2NA 1PKLA 2E5BA 4D6IA 4UQAA 4TVDA 4AEFA 4E3TA 3DBNA 4QNWA 1NWRA 4S2BA 3N17A 3P60A 4QNEA 3GW0A 4WSKA 4HMCA 1E5NA 4F2BA 5EPDA 4L56A 2L5HA 2F6KA 3A4AA 1EYEA 4Q4OA 1U5VA 4AISA 3O9NA 1JYWA 3KHJA 4AZ7A 3VCNA 3B9AA 3CZKA 3RMJA 1EJVC 3IGSA 1KV8A 4DF2A 2GJXB 3P0XA 2XM1A 5PTDA 1A0EA 3RNDA 3RO6A 3PVFA 1PXGA 1JI1A 1TTPA 4IIFA 3WH9A 4LBUA 3ZR4A 4GZIA 3EB2A 4UNLA 3G6MA 2V3GA 3N25A 3K4AA 3GR4A 3CAVA 2CXEA 1QMLA 1QO2A 5LIUX 1PZ2A 2WKGA 5C9WA 4XD4A 2ZYFA 1V4YA 3W2LA 1Y8BA 2HTMA 1EFZA 3O07A 4JIIX 3ZLGA 2PWGA 4DO6A 3R8GA 1Q6QA 1JJKA 1SM9A 2C79A 4M3PA 4UFLA 3W7NA 3EWXA 5IFPA 4FLOA 5C9RA 2NUYA 3N73A 4OE7A 4C1NB 2QGYA 4OUIA 4TIMA 4YL2A 3H54A 3FSTA 5E6ZA 5AHEA 2WNZA 4H9UA 2WLYA 4XAPA 1ZU8A 3LDVA 4CNPA 3CZ8A 3KBWA 4KH2A 4M80A 1LM1A 4U3CA 2GJXA 3UXAA 4LAMA 3PPFA 4U5IA 3QSTA 4WOQA 3OEXA 5IBXC 1J0YA 2XGZA 1D3HA 2F2HA 2OELA 2PU0A 2Q8ZA 2XTKA 3G1YA 3FV9A 1X7FA 2OSXA 1ZGDA 4HP5A 3CZGA 3GHSA 5AZ0A 3RJXA 4UTJA 3KRZA 3N9KA 3IVSA 1QPKA 1XH0A 4PBEA 2VCCA 2XWEA 4KERA 3VIKA 3PY2A 3W7IA 4KWWA 3UF9A 4B3ZA 3XIMA 4HYRA 4Z2GA 4HB7A 1KRMA 1KFLA 4HOWA 1BHGA 2ACUA 4O13A 1ZAJA 4LWWA 1GPWA 4JTSA 4LCQA 1CECA 3IUIA 2BY3A 3GK0A 4N9CA 3N3TA 1EUNA 1YMYA 1JD7A 1HKJA 1ICPA 3CYJA 6ALDA 1NJJA 4INFA 1OG0A 4UWMA 4WXYA 1BYAA 1H4PA 4C1NA 3CEUA 5D37A 3GNRA 1SW7A 3SEPA 4HYWA 5D9NA 2GGIA 2V38A 4TVUA 3L21A 3MWAA 2Y62A 4Q8OA 2V5DA 4OOZA 4LC6A 3GDRA 3K1DA 3L4UA 1YYAA 4AVFA 1WKFA 1DJIA 1W54A 2FFIA 4JCLA 5DY2A 4L1WA 1YKWA 1E3ZA 3VOIA 4UTLA 1UZ4A 2V3DA 5H2ZA 3EMQA 2PCEA 3VDHA 1MDLA 3C4UA 3E6EA 1RR2A 3FAXA 4TX6A 4O17A 1J5TA 4W7WA 4FXJA 3AIVA 5D09A 3LX9A 2Q02A 3W2UA 1ZBKA 5FKYA 3GHTA 3AAMA 2J9ZA 2G97A 4F48A 3EKLA 4O12A 2ZZ6A 2DUAA 5T26A 1BD0A 5H6HA 3PZQA 3GG8A 3RPDA 1DWFM 3D0CA 1VFUA 1P1XA 3BZGA 1YPIA 2ZXAA 3IJ8A 5T9BG 2GVLA 4YJ5A 2Z2BA 1HXJA 3IIZA 5RUBA 3A4WA 1ZAIA 2BASA 5IBXA 3KTSA 3U2EA 1TV2A 1IHIA 1C90A 4NZ3A 5FIPA 1YTEA 4OBRA 1AH4A 3EDKA 3SQMA 4ERAA 1Q6LA 1AH3A 1R2TA 1SMDA 1U5JA 2WSKA 4Z42C 4YHEA 1OYAA 4WK9A 1XKJA 1UZHA 4NXKA 2ISFA 3VUPA 2QV4A 4S2CA 3GU1A 1JYVA 2WC3A 1HP5A 1JQXA 1U1HA 2NV1A 4MNKA 1GQLA 1O7AA 4IFOA 4N6EA 1LYXA 4NJIA 5D9PA 5BZAA 4JR5A 1XBZA 5CBBA 3SUTA 4O50A 2XIIA 3WLPA 3RITA 1GVIA 3LTPA 5CZJA 3BDKA 1X97A 1E0XA 1R0MA 3GNPA 4N9BA 4CKQA 1KCXA 2QAFA 3A9IA 2IKJA 3ES8A 3E0LA 3H23A 3S4TA 3A6OA 1B3OA 2Y5SA 4IXHA 1TVLA 1PTAA 4O8RA 1GZ1A 4E2BA 3GVWA 1VAHA 3K1GA 1GOQA 1FOBA 3B8IA 5G1MA 3LZ3A 3PJXA 1OGBA 4QDPA 3N9RA 1ME9A 3IGHX 2VEMA 3CT2A 1G4PA 5A1AA 3POHA 1UQZA 3W7QA 3PFRA 4XQ6A 5LKYA 3KM8A 3DEQA 1QVBA 1AW5A 4H8HA 2VX6A 4P7OA 4PMDA 4GA8A 4N9EA 2DT1A 2X2YA 2QV5A 4LNYA 4EVZA 4FP1A 5ECVA 1JUKA 1O12A 2NWSA 1JG9A 4QG9A 3FA5A 1XBXA 3THUA 2CHNA 3W7RA 4LXFA 4ZFCA 2VFDA 4WY0F 3WYZA 2IPWA 2YA2A 1T8XA 4DXVA 3NZ1A 3L9CA 3WNMA 1TR1A 3CV6A 4JNYA 3I3EA 4RXGA 4IGNA 1GYLA 1H7NA 1X6LA 3VTRA 1L6GA 7PTDA 1DJHA 2ZUTA 1W32A 4MLRA 2QCNA 1J0KA 3GY1A 2FMNA 3BC9A 2BHYA 4HTBA 2J6VA 5DBTA 2GJLA 4MVAA 4PH6A 1FHDA 2PWVA 1QI0A 3NA8A 2RDXA 1XX1A 4GYFA 1Z42A 3WDJA 1EJRC 3NVDA 4REQB 3WUEA 4GIYA 4HK7A 5A6AA 3NM3A 2ZE0A 5FCZA 4X3ZA 1UWIA 3H4WA 4DWSC 3W87A 1K9TA 1I2PA 3HIJA 1U1UA 1FH7A 3DHPA 3BO9A 3HN3A 4AXKA 1TWDA 1M9HA 1KWKA 1C7SA 4RZ5A 4Q4RA 4FF7A 3UA4A