4PMZA

Crystal structure of gh10 endo-b-1,4-xylanase (xynb) from xanthomonas axonopodis pv citri complexed with xylobiose
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
303
structure length
303
Chain Sequence
b'APLAATASKFLGCAYGAQQAPGFAQYWNKLTPENGGKWGSVEAVRDQMDWSTLDAAYRFAQANQMPFQMHVMVWGNQQPEWIKTLRPAEQRREIEQWFAAVAQRYPDIALLEVVNEPLNDPPSKADTGGGNYLQALGGNGDSGWEWVLQSFRLARRHFPHTKLMINDYSITSSAQATQKYLQIVRLLQRENLVDAIGVQEHAFETTPEVAVSVHRDNLDALAATGLPIYITEFDLDGPTDAQQLADYKRVFPVFWEHPAVHGITLWGFRPGLWRDKEAAYLIRADGTERPALTWLRDYVAAHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xylanase
publication title Molecular mechanisms associated with xylan degradation by xanthomonas plant pathogens.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Hydrolase
total genus 124
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmzA00
1LWHA 3SCVA 2WVVA 4GO8A 4AIUA 2OYMA 1V3IA 3AZTA 1IV8A 4QCFA 2YDRA 4JFUA 3L4XA 2VOTA 1DHKA 3VIIA 4AEFA 3G6LA 2VRJA 3II1A 1CENA 4RE4A 2WLZA 4P8WA 3PBGA 3CHEA 1CNVA 4JHZA 2XVLA 3K4AA 2BY1A 1JG9A 2ZUSA 3AI0A 1DWJM 2E40A 3VMNA 4HMDA 4U33A 1VAHA 2YL6A 5A6BD 1BYAA 1C8YA 1OD8A 3OZOA 3CZJA 3ARPA 4HA4A 1KXQA 4D6FA 2VI0A 1WZMA 3WNNA 1OGBA 4P7RA 4HZ7A 1Q4NX 2FGLA 5I79A 1BHGA 2JE8A 4BQ2A 3OLIA 4W7WA 3ZT6A 2VZTA 4OIFA 1HJSA 1VBUA 3VIFA 2W61A 3AHVA 3N17A 7CGTA 3PN8A 1ISXA 4PTWA 2HISA 4AD4A 1FA2A 1BG9A 1LL4A 3KL0A 3VD9A 5FD0A 3UESA 1E0XA 3VOCA 1VB9A 1W3KA 1MXGA 1W1TA 2X09A 2E8YA 4M80A 2VCCA 3LPPA 1W3LA 4CN6A 4HOXA 4BZYA 1CXFA 2VZUA 4W8LA 2VC9A 3NSMA 4W84A 3CO4A 4A3YA 2ZWYA 3IAQA 2YA1A 4TX8A 3QOKA 4PMXA 3JUGA 1CWYA 1B3VA 1Q6FA 4M8UA 1OIFA 2D3LA 3FHQA 1HJXA 2WVUA 1GOKA 3A6OA 2WMJA 1X6NA 2YLAA 1TUXA 1DWAM 2CERA 2VZSA 2XWEA 2QPUA 2J7FA 1TR1A 4ACZB 5BXRA 2A3HA 1UOKA 3RM4A 2NW0A 2XFYA 4E2OA 4LYPA 1DTUA 3M6DA 4W85A 5JBFA 5CG0A 3WMSA 1JZ2A 4QLJA 3WUGA 3DYPA 2QV4A 4NRRA 1UQYA 5D9OA 2FHCA 2ZX5A 4ZENA 1SMAA 4IISA 3WEOA 4AZHA 4X0NA 1B30A 3VIGA 1JZ8A 3PTKA 4V27A 2ZE0A 3ZJ8A 2PWHA 2V3DA 1GORA 3A4AA 4B3LA 1FFRA 3OLDA 2XIBA 3VUPA 1J0JA 4V2XA 2WLYA 3OB8A 3ARSA 3L4TA 2ZUNA 1GQKA 4UQEA 5DO8A 4EAMA 2PBGA 3LPFA 2GDVA 1HN1A 1C92A 1VFUA 1G9HA 2YDSA 1LG2A 2X8RA 1GONA 2JIEA 3PZIA 1R85A 1UR0A 2VQUA 3ZT5A 3MSDA 2J62A 1PIFA 2Y24A 1JFXA 1FP8A 2A3AA 1H11A 1CECA 3QHNA 4BQ5A 2BFGA 1CXKA 3W82A 5BCAA 1Q6DA 3TA9A 4AEEA 4XZWA 3TTSA 2RGLA 1JZ5A 3AMDA 3PTMA 3N04A 2VMFA 5A2BA 3FY1A 1KQZA 4ATWA 5GNYA 5CSUA 4PMNA 3WFLA 4U5KA 1KXTA 1OSEA 1OWQA 1DWHM 4OJYA 1RD6A 3CBWA 4Y7EA 4BQ3A 3MMDA 3TTOA 2W66A 3MUZ1 1EDTA 5ABFB 1B9ZA 1Z32X 2A3CA 3MV11 4HZ6A 2GJXA 5M5DA 1SR0A 3GH5A 2J25A 5A6AA 4W87A 1XC6A 3PZTA 1QBAA 4L4OA 3IJ9A 4H8VA 2A3EA 2BXYA 1OT1A 4TX6A 4LYRA 4ATLA 1UZ1A 1W9VA 1US3A 3LPOA 3AS3A 2VJXA 3EYPA 1BF2A 2G3MA 1E6XM 2FHFA 2V3EA 1R87A 3BLKA 3VO0A 2VT0A 3AJ7A 2XVPA 3QGVA 1L0PA 5F7UA 1UA7A 2J4GA 2JALA 1UA3A 4XX6A 2WSPA 3UR7A 3O6AA 1H0IA 1CTNA 2QMKA 3ZJKA 1OCQA 3GH4A 1EHAA 1C7TA 2VR4A 2RGMA 2WVSA 1J11A 2CXGA 1YQ2A 2O9TA 3NUKA 3WEZA 1WDPA 2GK1B 2EBNA 3CUGA 2VQTA 2DIJA 1VFFA 1JAEA 4NI3A 5EFFA 1C8XA 1ZS2A 1IZKA 4M1RA 1W1YA 3WNKA 4PCSA 2XVKA 3NDYA 1QI0A 5C8BB 2OWWA 1MQQA 1CPUA 5C70A 1NWUA 4UQAA 3ZR6A 2XPKA 5IHRA 1DWGM 1CBGA 3S2CA 1TE1A 2WK2A 4KMQA 3VMOA 1B2YA 1UH4A 4UNIA 2W5FA 3HN3A 4AZ6A 1E6SM 2PWDA 2QPSA 3VDAA 3VM5A 3W24A 4GZIA 3WF1A 4MB4A 4DWSB 5LYRA 1VBRA 4U3CA 2ZX8A 4MB3A 3A47A 1LL6A 1BYBA 5A6KA 3B9EA 1FFQA 5ABHA 3WDPP 4DM1A 3VNZA 4U2YA 1W9PA 1ECEA 2JIWA 1ZBCA 4FLQA 4AW7A 1EHNA 2PWFA 1F4HA 4W5ZA 2VCAA 4JZ5A 3BAIA 4TXEA 1OIMA 5CLTA 3THDA 1NWTA 2CEQA 4QCEA 4P7QA 3VIOA 2PC8A 3GNRA 3CUJA 3WD2A 1E73M 1XH1A 1KR0A 2WBGA 4OZOA 2J7BA 2AAAA 3WMCA 4AD0A 3ZSTA 4MNJA 3OGVA 1JI2A 1G1YA 2XSBA 1BYDA 1QI4A 1BPLB 4W5UA 3UEQA 1E3XA 1EO5A 5I3DA 3WH9A 3L4WA 3VGEA 1JD7A 4CU6A 1CLXA 4AY1A 2D0HA 2WXDM 1E5NA 4Z2LA 3VD4A 3AMKA 3WSUA 1E4LA 3SCRA 3W29A 1NOFA 1TA3B 1UR9A 1WDSA 1HJQA 2V38A 2D2OA 2XIIA 3K4DA 2VX7A 1FHDA 5E0FA 4HOWA 2J74A 3PTQA 2V3GA 1XCXA 2XGIA 4PMZA 4AISA 2E4TA 1PEZA 3UR8A 5DFAA 2O9OA 2J77A 5HPOA 1JFHA 1G94A 1V6YA 1MW1A 2BHYA 4TVUA 3BC9A 3T09A 3AYRA 2WWCA 8CGTA 3I3EA 1MVYA 3SUVA 2W91A 1E3ZA 1CGWA 1J0YA 3EMQA 3TONA 4UOQA 3VD3A 3AIEA 3VDBA 2GJRA 4UQDA 3ZIZA 1E6PA 3VIJA 1UKQA 3WUFA 4U2ZA 2W62A 1EOMA 1V6WA 4PMQA 4BA0A 3ALGA 3SUWA 1GZJA 1V0NA 3ARYA 1Q6EA 4NRSA 4JFTA 1MFUA 1NH6A 1HX0A 4MAZA 2BY0A 5D8WA 4D6CA 3BSHA 4FF5A 1L8NA 1OD0A 2ZXAA 3L4UA 3AXXA 3I3DA 2WCGA 2CBIA 3IANA 4W89A 3WBAA 1CYGA 4PSPA 1FOBA 4J3WA 3K8KA 3BAJA 2ZXQA 3WDQA 4XUYA 1Q6CA 1KWGA 4TOQA 5DMYA 3RILA 1TFVA 2WC4A 4NZCA 1HKKA 3AMLA 2OYLA 5BXPA 1H5VA 1HKIA 1SFSA 4QP0A 3UETA 3LPGA 4MPKA 3T0DA 4LX4A 3CZGA 4IM4A 3VIKA 3MS8A 3UERA 2YA0A 1BSIA 4AXNA 2DSKA 5ABEA 1BVNP 5FKYA 4C7DA 4PMVA 4CGTA 3WH7A 3VM7A 1B1YA 3AXIA 3RM9A 5KEZA 4H7VA 4GZEA 5HBFA 1UR2A 5CZKA 1UUQA 2J78A 4CD8A 1MW0A 1UR1A 4UQBA 2QHAA 1J18A 3KZSA 5AYIA 1B3ZA 5A6JA 1HJWA 1YHTA 1V3MA 4ML4A 3B9AA 3MUIA 5GNZA 4NSBA 1GQLA 3AIVA 3W4RA 3N13A 5JBEA 4WLCA 3OBAA 4YHEA 5FL1A 1CGUA 4MJ4A 2WC3A 1EQPA 2BVDA 5CSYA 4DUWA 1B0IA 1HJUA 3SUSA 1H49A 2ZUTA 3CGTA 1M7XA 4Z2IA 2OSWA 2XFRA 4JFVA 3CIVA 1PZ3A 4MB1A 2ZXBA 2E0PA 2DEPA 4PMRA 4CU8A 5HPCA 1QNRA 4PUDA 3A4WA 5JIPA 5CGTA 1O6IA 3CHCA 1MWOA 2NT0A 3VDHA 1EXPA 1DWIM 1H09A 4MDPA 4PEEA 3HU7A 1JI1A 4AZGA 2CHOA 2WHLA 4PYSA 3F5KA 1VJSA 1B31A 1FH7A 5JUVA 5I5RA 5D8ZA 4OBRA 4AZCA 1M53A 2C0HA 5M17A 3BGAA 1AQ0A 4XZBA 2OYKA 4BS0A 3GXMA 2BVTA 4J7RA 1BGGA 4B9ZA 6CGTA 1E6RA 1F4AA 3B9DA 3CZKA 4M24A 1NP0A 1GOQA 3MV01 5LA0A 3MSGA 1WCGA 4CU7A 5EMYA 1V02E 3AIUA 3EMCA 2DIEA 4UR9A 4JCMA 3SCTA 1WZLA 4Q22A 4H41A 3W0KA 3UG3A 5FL0A 3VIPA 2PB1A 1GQJA 1PBGA 3W6MA 4BQ4A 2DDXA 3SCSA 5A8OA 3WIJA 1H4PA 4B3KA 1UHVA 2FHBA 2EQDA 2WWDA 1VIWA 2VRQA 1JDAA 2BV9A 3SUUA 2DT1A 1UD4A 1OINA 4DUXA 2W4XA 3N11A 3VX1A 1M01A 2NT1A 1V3KA 4PBGA 4C7GA 2D0FA 4LPCA 3IJ7A 3L4VA 2Z1KA 4B9YA 1LQ0A 2NSXA 4Z2GA 1O7AA 2J8GA 1W9UA 3EBVA 1ESWA 1WB0A 5I6SA 3CHDA 1V0LA 4YPJA 2X0YA 2ZIDA 3SCNA 1X6LA 5HOSA 1EH9A 3WD1A 3UG5A 1CXIA 1DEDA 3W25A 1W2PA 2IXVA 4TUFA 5AY7A 4ZFMA 1MW2A 1K6AA 1TVNA 4JFSA 4GPNA 1U30A 3SCPA 5E6ZA 3AICA 1J0IA 2FH6A 1QI2A 5A2CA 4LGXA 5DF0A 1NOUA 2EJ1A 1W9XA 4CUCA 2X0HA 3M46A 1GOMA 1UKOA 1J12A 3VGBA 1E70M 4EE9A 2J7CA 3GNOA 4W8BA 1TCMA 1RPKA 3NSNA 4QDMA 5HXMA 2V5CA 3ARTA 2WMIB 5E09A 4AMCA 4YN5A 4J27A 1KXHA 3TOPA 1V6UA 4CN1A 1D2KA 1BVZA 2PI6A 3AS2A 3KL5A 3ZT7A 4WSJA 5DT5A 2EPLX 4HP5A 1K9TA 2CITA 4HU8A 4B15A 3MU7A 1HNYA 4D1IA 1B90A 1QHPA 2XFFA 3VDCA 3WQ5A 3AMCA 4F66A 1JNEA 2YOCA 2CBVA 4FK9A 1KXVA 3VGDA 1HKJA 2ESCA 3PZUA 1GJUA 2FGZA 1CEOA 1UKSA 1JDDA 4J3VA 1GJWA 4R5EA 3RCNA 1PAMA 2WHKA 1XD1A 4PUEA 1KB3A 1PX8A 3BCDA 4CD5A 2DSVA 4GKLA 5A3HA 1Q6GA 2VTFA 3U7BA 4OKDA 1BQCA 1JF6A 4WF7A 1CXEA 2YJQA 4D71A 4OOUA 1VFOA 3EDDA 1ZB5A 1NWSA 5A94A 4CCEA 1JYWA 3UCQA 3BLPX 3WNLA 1UG6A 3UG4A 4AD1A 2VVSA 4F9JA 4WSKA 4F8XA 1BGAA 2OSXA 3AHZA 1SYTA 2WHJA 1NWRA 1FH8A 2JF6A 2GJXB 1W9BM 3WELA 3WD0A 2QF8A 4EK7A 1WKYA 4AD3A 2GJPA 3M7SA 4UFHA 1E4MM 3EDKA 3I3BA 3QHOA 4J3UA 4J3TA 1H2JA 4MTVA 4WIWA 1UWRA 5FIPA 3FAXA 1J9YA 4GIAA 1MQPA 3OZPA 5A69A 2UY5A 3GBEA 2YL9A 3O9NA 2GSJA 4AZBA 1LJYA 2V3FA 1E9LA 3T2QA 5KZ6A 3L4YA 5EBAA 1D7FA 2V5DA 3CUHA 3VIMA 2VZOA 1NP2A 3WDJA 1MXDA 4W88A 3ZSSA 1LG1A 4LQ1A 4CCCA 1AQMA 2J7GA 2F2HA 5I78A 4W7VA 3ARRA 4P8UA 3DECA 1W3HA 2W67A 1PX3A 4JKKA 4UQ9A 4FMVA 9CGTA 2YA2A 2WMKA 3CH9A 4GINA 1H41A 4HA3A 3VU2A 4LXFA 2D20A 5EB8A 3ZQ9A 1HKMA 1ZJBA 1VEPA 3AXHA 4ZXLA 1QHOA 4Q7NA 4GXPA 2UY4A 4L4PA 3CZ8A 3VD7A 2WMGA 2QLYA 4BCEA 1GHRA 3WF0A 1HIZA 1VEMA 5CQ1A 1VF8A 2C8NA 4HMEA 4CVWA 5JBDA 3D5HA 2VX6A 2EEXA 3FAWA 5BWFA 2WM0A 2BNJA 3KE0A 4DWSA 3BAKA 1E1FA 3L2LA 3CUIA 3GTNA 1US2A 4U3AA 3RJXA 5A8PA 1JNDA 3T08A 4JL1A 4U5IA 4E8CA 2DPEA 2YL8A 5A8MA 3GNPA 4MAVA 4NF7A 3POCA 3T2OA 1QW9A 4S3KA 1V0MA 4PMDA 1GCYA 3VGHA 5IFTA 3DC0A 1ODZA 3J7HA 2XVNA 3PZNA 3VGGA 2X1IA 2WC7A 1ISZA 2JEQA 3APGA 2J79A 3U5UA 1R7AA 1LL7A 1V0KA 3BXWA 3MUAA 2WB5A 3GM8A 1H3GA 3W26A 2WHMA 4D6JA 2E9LA 3AZRA 4KWUA 2YKKA 2OLHA 3L4ZA 2DGAA 5FCZA 1QNOA 2ZUMA 2CYGA 1N82A 3ZJ6A 3TTQA 2CPUA 4AZ7A 2Z1SA 2ZXDA 4FLSA 1VENA 4OOZA 3ZJ7A 1JZ6A 1XH0A 2CCRA 3NJ3A 4UCFA 5CLWA 1ZU8A 3AYSA 2DT0A 3WMBA 3WY1A 4R27A 4PTMA 2JFEX 2D24A 1OBAA 1NM9A 1GUVA 3WD3A 1J0HA 4AZIA 1DWFM 4CVUA 3EDJA 5E70A 3CHFA 3GBDA 7TAAA 3W38A 1J0ZA 2WZIA 1D3CA 1GOWA 1U33A 1I75A 3CLWA 4H2CA 3AFBA 3AIQA 4P7NA 2VURA 3VVGA 2OWCA 2XWDA 3SIMA 3SEPA 3K46A 4PRWA 4S3JA 1GVYA 4P8VA 3WNOA 5BRQA 3BMVA 1P6WA 3WENA 2J7DA 1BFNA 1SMDA 4Z2KA 3GXDA 4QLKA 3ZMRA 3G6MA 2D0GA 1WAWA 4MNKA 4UOZA 4H8UA 4JKMA 1RP8A 4CD4A 4Z2JA 4IPLA 3WBEA 3NCOA 1MQRA 5A8QA 4FLRA 3VD5A 4XB3A 4WK9A 3U5YA 1MFVA 2BHUA 2BS9A 3NDZA 3PZOA 1QNQA 1HP4A 1TMQA 3AIBA 5A6SA 2WW5A 2WVTA 1HL9A 1GNXA 1KQYA 4OBSA 2YDQA 1UQZA 1KBKA 1JZ7A 2ZOXA 1EIBA 5M3WA 3F5LA 4KRTA 3VMPA 3GH7A 1K9DA 1J10A 5I23A 1HL8A 1JIBA 5D9PA 5CJ5A 3B8SA 3W27A 3S6TA 3N9KA 1IZJA 2GVYA 1K9FA 5DT7A 1G5AA 3DYOA 2EO7A 1CXLA 5GQBA 2VO5A 3VX0A 5I0DA 2BY3A 1KCLA 3HJEA 4CCDA 4P8XA 5GNXA 2DH2A 1UWQA 3SCUA 4GI9A 2WAGA 5AC4A 1E0VA 1QI5A 1UD3A 2D22A 5A6LA 2WMHA 5CGMA 1BG4A 1S46A 1VFMA 2J75A 5E9AA 2FH8A 5CPSA 3T0AA 1E1EA 3ZO9A 1V08A 2D3NA 1GW1A 1JYVA 1E5JA 2XVGA 3K8MA 1QVBA 2ZX6A 3AHXA 3GXIA 2XSAA 3NYDA 4M82A 2DQXA 1W2VA 5IDIA 3OGSA 4A3HA 3M07A 3WL0A 4KGLA 5BXSA 4AD2A 3GDBA 1CDGA 2WVVB 1GQIA 2VNCA 1XYZA 2WCAA 2ZUVA 4K68A 1OGGA 4A4AA 1XSJA 4W7UA 3DHPA 4IPNB 1UD5A 3WDIA 2Y4SA 3WUEA 5A6BA 2F8QA 2YLLA 3RM8A 1G01A 1UWSA 4JL2A 4D1JA 4WKFA 2D1ZA 3CMJA 4HOZA 2XG9A 2ZWZA 4JCLA 3WNPA 1CIUA 1JGIA 3RJYA 3RMEA 1UWTA 2DT2A 3WQ8A 5IFPA 5A95A 2E3ZA 4JAWA 2DSZA 1XYFA 3WDHA 1JZ4A 3SCQA 2WCSA 3THCA 1W1VA 3EDFA 4EKJA 3N12A 2J7EA 3A4XA 6TAAA 4W93A 4KRUA 4AZCB 3AS1A 2G3JA 1B3WA 2Q8XA 2O9PA 3BAWA 1JAKA 1W9DM 1BYCA 1UH3A 3CZEA 4TTUA 2WPGA 4W8AA 3KWXA 1QBBA 2G3IA 4PCTA 1TVPA 3MMWA 3F5JA 2WBKA 3FHAA 3MANA 4J3XA 1LWJA 1R8LA 2YL5A 4P7OA 2E8ZA 1XD0A 4DUVA 3T2PA 4UZSA 3RPMA 1GOOA 2CKSA 2ZX9A 1CZ1A 4J28A 3A3HA 3WL1A 1W32A 2BY2A 4ACZA 5DEZA 1E71M 1QOXA 4PTVA 2PWEA 2VX4A 3ARWA 1WE5A 4WKHA 1V3JA 4JFWA 3WEMA 1E55A 1ZBWA 1W1PA 1XGZA 4MNMA 4D6DA 3W28A 3ARUA 2Y5EA 2BVYA 2YBUA 3RO8A 3L2MA 1V02A 4PN2A 4DM2A 1UR8A 2VZVA 3ZM8A 2AMGA 1MW3A 4TVCA 2EPOA 4D6GA 2E9MA 4MADA 4X9YA 1C91A 3OIHA 4UZUA 1AVAA 2J8FA 1C7SA 4RE2A 2XJ7A 4UFKA 1XSKA 5A1AA 5JIWA 4KH2A 4M56A 3N1AA 2VCBA 2D23A 2CHNA 3VINA 2DT3A 2WMIA 1BLIA 3PZVA 2BXZA 1EO7A 1HF6A 2BHZA 4JHOA 3WNMA 1B3YA 1MYRA 3IK2A 1ZBVA 4ZE5A 5C71A 5CPQA 3W6LA 4PMYA 2YBTA 4TVDA 3SURA 1VJZA 1CGVA 3VPLA 4OUEA 2WMFA 1J01A 4FLOA 4YHGA 3ALFA 3ECQA 3OA5A 1OB0A 3CZLA 1E43A 2DH3A 1UD2A 2WSKA 1KGWA 6A3HA 1V3HA 5D4YA 4ACYA 1AMYA 1PX4A 4GO9A 3AOFA 2X05A 3BAXA 3FW6A 1UZ4A 2WANA 4GI6A 4AZ5A 1FH9A 1QW8A 3SCOA 1Y7VA 1UR4A 3BCFA 2PF0A 1QI3A 2GUYA 3DHUA 4PMUA 2PBOA 1WDRA 3MMUA 3D3AA 3WH5A 3VILA 2AOSA 1H1NA 5D9NA 1V3LA 2WZEA 1ISYA 4UFLA 5TD4A 3SUTA 2EPMX 3WF4A 3FN9A 5ABFA 1V6VA 2XM1A 2VR5A 3U57A 2WNWA 3MUY1 4MB5A 3OG2A 2Y2WA 1R7OA 2ZUUA 1K9EA 1WZAA 4AC1X 1JDCA 1ZBKA 3WH6A 1IT0A 3POHA 4M81A 2XUCA 3WQ6A 3PZQA 3FXYA 1UKTA 1LLOA 3W53A 1U2YA 5ABGA 1E6QM 4MJ2A 1VEOA 4KGJA 4Z2HA 1W91A 4W86A 3WF2A 2CBUA 4BF7A 3WUBA 1UYQA 4H04A 3WH8A 1AQHA 1C8QA 3GXFA 3KEHA 1JXKA 1XRVA 4H8HA 3VNYA 1OM0A 1I1WA 4UOJA 1E6ZA 2G3NA 3K8LA 4CD7A 1KWKA 1E15A 1QHZA 2EXOA 1NQ6A 1ITCA 2C7FA 5M03A 1XH2A 1E4NA 2GK1A 1WO2A 3BAYA 4V28A 3NIYA 3BMWA 2XHYA 3WFZA 4E8DA 3AISA 4JKLA 4GZJA 4QAWA 2G8ZA 4E4PA 2CKRA 3MO4A 3WQWA 1B3XA 4GI8A 1PZ2A 1W3JA 2UY3A 3SCWA 3F4VA 5E6YA 1M03A 3CUFA 3OGRA 3RDKA 3PZ9A 1GOIA 4HPGA 2GDUA 4UFIA 4WJXA 1UD8A 3AMGA 3FNDA 2WZHA 4AYSA 4ATDA 2OSYA 3WQVA 4D6EA 5BRPA 3OLGA 1EOKA 1DP0A 1UWIA 1HJVA 1CLVA 4UFJA 5BROA 2J47A 2ZUWA 1TG7A 3AHTA 2UWFA 3K1DA 5E0CA 4ZXOA 3DYMA 4B16A 4F79A 2A3BA 4HZ8A 3BSGA 3WF3A 3EDEA 1UD6A 5FOOA 1LF1A 4D6IA 1JD9A 1M04A 4RL3A 5I24A 5BYWA 2CIPA 2EPKX 1WNOA 4HTYA 3NSXA 1JF5A 1KCKA 1GPFA 2TAAA 1XHGA 2PWGA 3O2LA 5LA1A 3TP4A 2QMJA 2EPNA 4DWSC 3AZSA 4URIA 4DWSD 5HDRA 1KR1A 7A3HA 2G4FA 4HMCA 5IXEA 2CETA 2WKGA 3VTRA 2VL4A 3PZMA 1WZKA 3AROA 4IUGA 1PIGA 1XV8A 3AHYA 1JXJA 1J0KA 1EA9C 2Y8VA 1E6NA 1OT2A 5EFDA 4QFUA 1NOWA 1E0WA 2GFTA 1XSIA 4XV0A 4AIOA 1FHLA 1NARA 1HT6A 1R86A 1UH2A 1CXHA 3T0BA 3IJ8A 1A47A 2X2YA 5IHSA 1CGYA 5A8NA 1EDQA 1KGUA 1X1NA 4TTGA 4CD6A 1XCWA 3ARQA 3AQUA 1C93A 1E56A 1E72M 1CGTA 2VRKA 5ECUA 4LYQA 1JYNA 2XYLA 3BH4A 1TA3A 3VGFA 1WPCA 1EDGA 4MDOA 4PSRA 1KBBA 1ZL1A 3GYCA 3ARVA 2ZX7A 3PZGA 2WYSA 2UY2A 3GZAA 2XTKA 3N15A 1EGZA 1ODUA 1CGXA 2DSUA 4X0VA 3VIHA 2XM2A 4GQQA 1UWUA 4PMOA 2O92A 1KGXA 5I77A 2W92A 3LMYA 1E40A 4UTFA 2WKLA 3CMGA 4F9DA 5GPRA 1H0GA 1G0CA 1ITXA 5AC5A 3CTTA 2OWXA 2MANA 3WD4A 4HA1A 3OLEA 3ARXA 5AYBA 2IUZA 3ZOAA 2E9BA 4ZEPA 3AIWA 3IAPA 2VUYA 2ZICA 3KL3A 1EQCA 4CN4A 1JL8A 3VKKA 3W81A 2W63A 1HVXA 2VX5A 1HP5A 2XGBA 5CPTA 4N0RA 4N42A 5A2AA 3MKKA 1QPKA 3N18A 1A3HA 4D72A 3TTYA 2YIHA 4GQRA 2FDMA 3QOMA 2CESA 4AIEA 5LA2A 5D9MA 3AIRA 1E4IA 4UQCA 2CBJA 3U7VA 1RP9A 3WQ4A 1QNPA 2Y8KA 1JZ3A 4EANA 4UFMA 3QHMA 8A3HA 2B31A 4U31A 2HVMA 5CXPA 4AD5A 4JIEA 2CNCA 1KFWA 3W37A 4P7LA 4AWEA 4HU0A 5I2UA 1WDQA 3AS0A 5A6MA 2JF7A 1PPIA 1C3FA 1UKPA 2O9RA 3ARZA 1OGSA 1QNSA 1ZJAA 2G41A 2IXUA 1WP6A 1BAGA 2JEPA 3PHAA 2F61A 1ISVA 1FP9A 3ZR5A 1RH9A 4C7FA 3HMCA 2DSWA 3CPUA 3EMZA 1V6XA 4RE3A 4QLLA 5HNNA 3WDRA 2VVNA 4PTXA 3WKZA 4D6HA 4ZE4A 5BXTA 3WN6A 1JYXA 1BTCA 1I1XA 1HXJA 1V03A 2J7HA 4M29A 1ISWA 1TZ7A 3QR3A 1C90A 4CKQA 1GVIA 3E1F1 3RIKA 4MNLA 1GHSA 1VRXA 4WKAA 1HVQA 4HPHA 4J3SA 1PJ9A
chains in the Genus database with same CATH superfamily
3LYEA 1W3TA 1GQNA 4GO8A 3HA1A 2PC4A 3B06A 1IV8A 3ORWA 1TV4A 3L4XA 3KS5A 2VOTA 2J66A 1VHCA 3LNPA 5G2IA 3II1A 1CENA 2WLZA 3O07A 3O63A 1XLKA 3S46A 1QPQA 3PBGA 5C0QA 4ZMGA 3NAVA 1QCWA 1XRFA 2QF7A 3T07A 3AI0A 2BVWA 3QV7A 2E40A 4C6DA 5H8PA 1U5HA 1E1CB 3HPXA 1C8YA 1I2PA 2PSNA 5BOFA 3CZJA 4LEFA 3NZRA 1WZMA 4GHRA 4Y8EA 4HZ7A 4ZSTA 4IGNA 2FGLA 2JE8A 4BQ2A 4HNTA 4GJJA 4W7WA 1HJSA 1ZFJA 4MKVA 3V5FA 4QX4A 2Q09A 3VIFA 7CGTA 3PN8A 4ZA0A 3EX1A 4Q4QA 3OTRA 2C18A 3LA4A 5CAHA 3QF0A 4MWAA 3RU6A 1SJAA 1E0XA 1OCNA 4U4MA 3LSBA 1MXGA 8XIMA 2NSOA 1NSJA 2X7VA 1GYNA 1UOZA 3LPPA 1A5LC 3LI0A 4BZYA 2QCHA 2PDLA 1CXFA 3CLMA 2WZMA 2I17A 3CQIA 2CZDA 2VC9A 4W84A 5IM51 2ZWYA 4AXKA 4TX8A 2HSAA 3QOKA 3JUGA 2ZVRA 4DJDA 3UGRA 1MNSA 2E68A 1S3TC 3R58A 3H24A 2WVUA 1GOKA 2YLAA 3TJLA 1DWAM 3N2MA 2XWEA 3FOKA 4WQ6A 3RM4A 4PULA 1V7AA 4QROA 2XFYA 4W85A 3B8TA 1JUBA 2ALDA 1RLDA 3DYPA 2QV4A 5D9OA 2FHCA 4A35A 1Z8AA 4B4HA 3WEOA 5AYXA 3ZJ8A 4H00A 2AKMA 1D7KA 1FFRA 4JX4A 1KV5A 5BU6A 5LIUX 3EZ4A 4IIDA 3ARSA 5A6TC 3NZ1A 4E3VA 3S1UA 5DO8A 2Q8LA 2NZLA 5K4ZA 1VQTA 3WBXA 3LDVA 4YTUA 4FOJA 1LG2A 2PEVA 3FYOA 2X8RA 2GSEA 2JIEA 3PZIA 3N6HA 3TC7A 1B9BA 2ZZ4A 2E7FA 4HYRA 3MSDA 3TK7A 2JQXA 4J3ZA 1FP8A 1LROA 1H11A 1Q85A 4BQ5A 1C8VA 5BCAA 4AEEA 3UPMA 1PUDA 2CZEA 2YCEA 4BY3A 5HNTA 2VMFA 3SQMA 3FY1A 1EWDA 3QGKC 3CWNA 1XL9A 1UJPA 5HUPA 1OWQA 1RD6A 4I7UA 3PB0A 4M1BA 3CBWA 4ICNA 3QRHA 3MMDA 4K1WA 1X38A 1KRCC 3MUZ1 3UQNA 3GHRA 3ID7A 4FP1A 5HWNA 4ZOEA 1Z32X 3MJMA 1BXBA 5M5DA 1SR0A 3A9IA 2POZA 1NDVA 4DLMA 2P3EA 2G0WA 5AHFA 3IJ9A 3P6LA 1GOXA 1OT1A 4TX6A 3B4UA 5H6HA 4ATLA 4MIMA 1SJDA 1M9HA 3AS3A 4IQEA 4EWND 1WV2A 1TV8A 1UIOA 3HGOA 3LCGA 2ACQA 2V3EA 1R87A 3WQEA 3CWHA 3VO0A 4DO7A 3QGVA 4IF2A 2BSLA 5F7UA 2Z4GA 5KZMA 3ITOA 4PGLA 2PF8A 4XX6A 2TPSA 2Z7KA 3ICJA 1CTNA 4C60A 3BOXA 4S3EA 1ENUA 4DJFC 3ZLGA 1C7TA 3E96A 1XKYA 3T8LA 2WVSA 3B4YA 1J11A 1TZ9A 3SM0A 4Z17A 2QDHA 5FJOA 4O1AA 5D2VA 5XIAA 3QSTA 2EBNA 3CUGA 3KM8A 1RQEA 3NM1A 3PSWA 1JAEA 1R46A 4ONVA 1UPMB 1Z9AA 3KRUA 1DXFA 1V6TA 2XVKA 2OZ0A 3NDYA 2ZRZA 2AKZA 2C0AA 4LAKA 4UTUA 3L5AA 1QI0A 1PXGA 3VNMA 2OWWA 2NQZA 2PDUA 1MQQA 2IMRA 3T8QA 1M6JA 3WQGA 3PJXA 1FDYA 5CKSA 1QPNA 4CNNA 6PTDA 1RBAA 4YCOA 3KBVA 3MBDA 2Z6IA 2BG5A 4GIYA 3LI1A 3TN6A 3SBFA 1E6SM 3H55A 3VM5A 3W24A 4MB4A 4DF0A 4R7OA 1VBRA 4U3CA 4M6QA 4PBFA 2ZX8A 4MB3A 1K4HA 1EF2A 2V82A 1BYBA 2CWNA 4RW5A 3WDPP 1V51A 3R11A 1XBXA 2HZGA 1TWSA 1W9PA 3TQ0A 2ATMA 4N9CA 2ZZ1A 4AW7A 1EHNA 2PWFA 3BAIA 1OIMA 2A2IA 1RCOB 1RA5A 1PWMA 2EGZA 3R0DA 5LHFA 3AXKA 3MJYA 4DNHA 1UJQA 2IS7A 4MNJA 1G1YA 1RALA 1OF8A 2XSBA 1BYDA 4W5UA 1F74A 3N34A 4CU6A 1CLXA 3C2YA 3KOFA 3AMKA 3SCRA 1NOFA 4UCGA 4GVGA 3V16A 1WDSA 2XGZA 5CC7A 3CTLA 2XIIA 3DBNA 1FHDA 4KQNA 1RUSA 4OV9A 1QPOA 2E4TA 2DZAA 2RUSA 3BJSA 3M5VA 2O9OA 2FYMA 5HPOA 1JGMA 4IFKB 4WOQA 2BHYA 2IW0A 3QZEA 3LLFA 4TVUA 5TBOA 5HMSA 3T09A 4RE0A 1MVYA 1CGWA 1J0YA 2H3BA 4DXXA 2ZA1A 3ZIZA 2VGBA 1E6PA 4AY7A 3VIJA 1UKQA 2H6RA 3WUFA 4U2ZA 1UZHA 3FYYA 2GVLA 3C2VA 4MZYA 4LB4A 4DBUA 2XH4A 1Z7AA 3STFA 1AQFA 3M5ZA 3EAUA 4HSNA 4MAZA 1GVOA 4GMEA 2ZXAA 5JH2A 2WCGA 2CBIA 4Y9AA 2FPYA 3ITLA 3LMZA 2NXGA 2DVUA 3T78A 3BAJA 2ZXQA 4XWUA 1Q6CA 2YZ5A 3TZFA 5DMYA 2WC4A 4NZCA 4WUIA 1JJKA 2OYLA 3UWQA 2FZNA 3UY8A 3UETA 1Q2RA 3CZGA 4IM4A 2POTA 2XH0A 3MT1A 1EGVA 3HV8A 3QKEA 3G0SA 1BVNP 4PMVA 3WH7A 3O6YX 3RM9A 4H7VA 4Q8UA 5HJXA 3AU6A 2E6DA 2J78A 3MP4A 2GVGA 4CD8A 3GO2A 2PZ0A 1CT5A 2QHAA 1S2TA 1EC8A 3OU8A 3KZSA 2WNNA 1PKYA 1YHTA 3GZ3A 5GNZA 3DIPA 3O1NA 3M0MA 2X40A 1WDWA 1GQLA 5FF2A 1RVKA 3NZQA 4WLCA 2OKTA 3H70A 4YHEA 4H3DA 1D9EA 1MZRA 3LM3A 4MJ4A 5EMUA 1EQPA 1XYLA 4GI4A 1B0IA 5LNVA 3BLDA 3UCCA 1H49A 5KITA 4JFVA 3ME3A 1GWJA 3M0KA 2V5BA 4J40A 4QG9A 3TXVA 2QUMA 3E6EA 4DZHA 1E1CA 4ZB2A 3AJXA 3IV8A 2FB2A 2PE4A 3UWZA 5CGTA 3SN1A 1T7LA 3VDHA 2R14A 1H09A 4KT2A 1SZFA 4MDPA 3HU7A 1EPVA 3BG3A 3KAOA 1B31A 5JUVA 5I5RA 4FX7A 2D2HA 1XIHA 5M17A 1WAUA 3BGAA 4E6MA 1XRSA 4J7RA 3GDRA 2PU0A 1UCWA 5SWUA 4M24A 1F3WA 1SUXA 1NP0A 1RR2A 4PFMA 3MV01 5LA0A 4LAUA 3BICA 3AIUA 5JU6A 2PDHA 4JCMA 2DZPA 3F4NA 4K3ZA 1U1HA 3PB2A 3CV1A 1GQJA 3UNTA 3OO2A 4L9XA 3W6MA 4BQ4A 3EKLA 4AMAA 3GDMA 2DDXA 1HGYA 1TE6A 3V1PA 4E2DA 3O3RA 3QN3A 1UUMA 2FHBA 4IQLA 4Y6GA 1OINA 3LCXA 2XZ7A 3IARA 4PBGA 4C7GA 3MY9A 2D0FA 1EKOA 2P8CA 1SFJA 3GAKA 1EP1A 2NSXA 2YB1A 3PVFA 2ZRWA 3RRXA 3G24A 5KZDA 4JBRA 4NAFA 3QY6A 5E1QA 1S3HA 4LW7A 2X0YA 2ZIDA 3RR4A 3LOTA 4FNSA 3RX4A 1CXIA 2XFWA 4JXCA 3W25A 4TUFA 2IXVA 4IXXA 1PKNA 4C1NB 2NV9A 3Q45A 4C6FA 2WJEA 4C6MA 2FH6A 3WLIA 1I45A 1QI2A 3FSUA 5A2CA 3V0SA 1W9XA 1SVDA 1P7TB 2E5BA 3DU0A 3MKVA 1JCTA 1E70M 1K4GA 2P88A 4A05A 3KFTA 3UJFA 4W8BA 1XLEA 2PPGA 1CW2A 3S2NA 3CWOX 1ELSA 4A8LA 2OU4A 3IEBA 2DUZA 3TOPA 3NPVA 3KTCA 1JPMA 1D2KA 1BVZA 1YE4A 3ZT7A 1EJUC 1OYBA 4I7WA 3FJNA 3L0GA 2H9AB 2EPLX 3DERA 4GWEA 4L64A 4D1IA 1W1A1 3AMCA 1JNEA 3DAQA 2CBVA 3KBSA 4GOAA 1HKJA 2ESCA 4RXGA 1UKSA 1RA0A 4J3VA 1KV8A 5DBUA 4DBEA 3DZ1A 1QOPA 4BWLC 2E25A 2Q8ZA 2Z2UA 2DSVA 3IUIA 5A3HA 3IGUA 4JY8A 1JDFA 1K02A 4IT1A 4N7QA 1Q6GA 4Z08A 4QE4A 1BQCA 2OZTA 3LTSA 5HNRA 3ENLA 2F9RA 1JYWA 3B8IA 1UG6A 1EFZA 4WSKA 3FFSA 4CCZA 4GABA 1SSDA 1NWRA 1FH8A 3L0NA 1VHNA 2JF6A 3HGSA 1KTNA 1TREA 1F8IA 2Y7FA 5DY3A 1E4MM 2YR1A 1EL3A 3I3BA 4J3UA 3LS9A 1TPUA 3V35A 1UWRA 1XWYA 2QKFA 3DXIA 5FIPA 1J9YA 1PCWA 5A69A 2NV1A 3ZZ1A 3GBEA 1J5SA 2GSJA 3T2QA 2NLYA 4PCPA 4NASA 3ATYA 3GW0A 4YVVA 4YTQA 3WDJA 3TJIA 4W88A 4LCRA 2PDIA 2I56A 4CCCA 4L65A 2J27A 5FJIA 5I3GA 2R94A 2W67A 1PX3A 4UQ9A 2J9ZA 9CGTA 3S2MA 3G8EA 4MYXA 3RUBL 1T5AA 3EWDA 2D20A 5EB8A 5AHNA 3ZQ9A 5CSRA 3G22A 4GVFA 4ZXLA 1QUMA 4GXPA 3CQ0A 2EF9A 1VR6A 1J6PA 3ZVHB 3CMFA 1N8WA 1GG0A 1HIZA 4A2RA 4E2VA 1KFEA 5CQ1A 4HMEA 4CVWA 4GACA 3L5LA 2VX6A 2PWVA 3APTA 3FAWA 1OC6A 4C5YA 2VDGA 2VC7A 1D8WA 5D2TA 1LYXA 4LF1A 3BAKA 1TV7A 2PDWA 4NF7A 1A4MA 3PP7A 3BSMA 4H01A 4RK8A 3CQKA 3ABXA 4PMDA 4IIHA 5AOUA 3VDGA 4PE8A 3QM3A 3DC0A 1ZNNA 2XVNA 2X1IA 3PJWA 5CSSA 1O12A 2HE5A 1R7AA 1LL7A 1TJ0A 2WB5A 3DI0A 2GUBA 1XS2A 3R0KA 2YKKA 1RK5A 3L4ZA 4ZOBA 3VCCA 2E77A 2ACSA 5FCZA 2VGFA 4O14A 3I4EA 2Q02A 5I00A 1GGOA 3NQDA 2ZXDA 1SJCA 3QMRA 4FLSA 1VENA 4FX8A 3S5OA 5I3IA 1JZ6A 1FWRA 3W1TA 1H50A 2CCRA 3NJ3A 3QY8A 1WQ5A 3WMBA 3I7QA 1OBAA 3W86A 1IT8A 3NZGA 2OEJA 4GCAA 4Q8VA 4CVUA 3UPWA 3EDJA 3GBDA 2WM1A 3WLPA 1J0ZA 3UR5A 1UMLA 2WZIA 1K8XA 1U33A 4WDTA 3CLWA 2GQAA 5DMLA 3LHYA 3N4FA 4KCUA 1ZUAX 4HNLA 3SEPA 3BLOA 4WJ8A 1X96A 2AL2B 4P8VA 3WNOA 3TR9A 1H63A 2O0TA 3GXNA 4DELA 4BI7A 4JTRA 3E0WA 2J7DA 3PC0A 2Q3OA 3T40A 1IHIA 3GX9A 2O7QA 3MA8A 3SJNA 3KCJA 3GFZA 4EF8A 4XSMA 4HCLA 4CD4A 4QG8A 3N73A 2ISWA 2V2DA 1ZPTA 3WBEA 1PVNA 3BV4A 4QQ3A 5A8QA 3C8NA 1NQKA 3CNYA 1H1YA 1W1B1 2BHUA 2BS9A 3CEUA 1R3RA 1UPPA 2QIIA 5A6SA 2WVTA 1HL9A 1I0DA 3N2TA 1UQZA 3GTIA 4MFDA 2ZOXA 1TWWA 3FJ6A 5M3WA 1R2TA 4B5TA 5CBBA 4C1KA 4ZL1A 4UTJA 3VMPA 1J10A 4Q8QA 4LJ3A 5CJ5A 3B8SA 4G1KA 4S3DA 3W27A 4NY2A 3S6TA 4UTKA 3GVWA 2VEFA 4ROQA 1G5AA 3DYOA 4FZIA 4LV4A 3TWAA 3UP8A 3GR7A 4IICA 3PUOA 5H2ZA 2BY3A 4NILA 4DNMA 5GNXA 3FJLA 3M0HA 3SCUA 2WAGA 4GI9A 5AC4A 1QI5A 1UD3A 5A6LA 4V33A 5CGMA 1S46A 1V79A 2J75A 2QUVA 5E9AA 1Q5MA 3PS7A 4YTTA 2FJUB 3OVQA 1XCFA 4ILSA 2NQJA 4YVPA 3W76A 1AL7A 1ONXA 1QVBA 4MKNA 2V67A 3GXIA 4MVAA 4JTIA 1EA0A 4XSLA 3OP2A 1A5UA 4S3CA 1W2VA 2DUAA 3EA1A 1K1DA 4YWSA 1G4EA 1XLHA 4AD2A 2WVVB 2VNCA 1XYZA 4K68A 1OGGA 4W7UA 1J2WA 2IPJA 4IPNB 1R6WA 3M6YA 4GQBA 4DZAA 1ZLPA 3AUJA 3GS6A 3QLDA 4N9BA 4LAMA 5BOOA 1XG4A 3K4WA 2OPJA 2ZQ0A 2D1ZA 4KERA 3CMJA 4HOZA 2ZWZA 3WNPA 1F3TA 4HSOA 2DT2A 3BLIA 3P3BA 5IFPA 2PLMA 3LXAA 3RCMA 3N14A 1GG1A 2W0UA 4JAWA 1XIJA 2QAFA 1VPXA 3G1VA 1JZ4A 2ASHA 3KLLA 4J9JA 2WCSA 3THCA 1W1VA 1LUCA 1RJPA 2NX9A 1Q45A 4QIUA 2GQ3A 6TAAA 4W93A 5C55A 2G3JA 4IMEA 1AUSL 2O9PA 4JPGA 1BYCA 1UH3A 3JW7A 1P48A 2WPGA 3LCLA 4HN4A 3U4FA 1QBBA 4BKNA 2E67A 1TVPA 4LSBA 2Z00A 3LQLA 1UBPC 1LWJA 1AODA 1XD0A 4DUVA 1MEWA 2PFHA 3T2PA 2BB0A 2PDKA 1GOOA 2ZX9A 5AKQA 4IL0A 4J28A 4ACZA 3QFEA 3A21A 2PDPA 4F0SA 1E55A 3P81A 1NJJA 3BGJA 1BD0A 4MNMA 4P61A 3TYDA 7TIMA 1QR7A 4O12A 4HNUA 4D6DA 3R10A 2BGSA 3W28A 3ARUA 3BZGA 2BVYA 1QJWA 4PN2A 1RJQA 3P74A 5LNUA 2FTYA 1TQJA 3RLVA 3ITTA 1GT8A 2XU2A 3D46A 4D6GA 4MADA 4XKMA 3KP0A 3OIHA 3T9PA 1AVAA 1X8CA 2J8FA 1C7SA 2Y89A 1OFQA 1P7TA 1PSCA 1P1MA 4JY9A 4Q32A 4KH2A 4M56A 3N1AA 4L1GA 2VCBA 1KM1A 4X3ZA 3UZ5A 3IJIA 3PZVA 2V5KA 1P43A 2BHZA 4H6QA 4C6BA 4JTAA 1DQUA 4LUIA 1ZBVA 3G1DA 5CPQA 1QRQA 2RDXA 3LX9A 2V8ZA 3E0IA 4P5UA 1Z48A 3VPLA 2WMFA 3ALFA 3ECQA 4YVXA 4PTNA 1EUNA 3LLDA 3MZNA 4JNMA 6A3HA 2FIQA 5D4YA 3S2LA 1PX4A 4ACYA 3FW6A 1UZ4A 3BG9A 1FH9A 4I8DA 2A4AA 1Y5WA 1H5YA 1VZWA 1VP5A 1Y7VA 3BCFA 3ZLFA 3PBMA 2PBOA 3VILA 3T55A 1ISYA 5KINA 4UFLA 4HKPA 5ABFA 4DO4A 3RFAA 4OGZA 1TPDA 2ZZ5A 3MUY1 3OG2A 3VFLA 2DVXA 3ABRA 3S47A 3BARA 1IT0A 4PZVA 4PUWA 2VD9A 4XAPA 2TRSA 3G0UA 1UKTA 4JN8A 1U2YA 5ABGA 1O5QA 1AK5A 1HQTA 4ZO8A 5XINA 5LNRA 1VEOA 2JKPA 3L5MA 2QNEA 1XW8A 2H90A 1JDEA 3UG8A 1W91A 1AH0A 3WF2A 3WJSA 3P67A 4KEVA 4X60A 1JPHA 1O66A 3WH8A 1TJ1A 3GXFA 1GK8A 4H8HA 3VNYA 3WK3A 4CD7A 3TH6A 3RU8X 1FY6A 1SZEA 4M7TA 2WZTA 2GK1A 1WO2A 4XD3A 5C7VA 3BMWA 2FTPA 3WFZA 1VYSX 3VAVA 1JPKA 1GTEA 4GZJA 4IIBA 2YCLB 5FAJA 1B3XA 1GVRA 3STEA 2UY3A 1UBSA 3SY1A 5E6YA 3CUFA 3HTWA 5HQLA 4RW3A 3PZ9A 1GOIA 4HPGA 3HPZA 4UFIA 4Y90A 3H2MA 3DFQA 1UD8A 3VZXA 3C52A 3FNDA 3ZWTA 5BRPA 3OLGA 1K7EA 4QSHA 1HJVA 1ZALA 5BROA 1R9ZA 1TTPA 2UWFA 3K1DA 4ZR8A 2VFDA 4LAOA 2ONEA 4N4QA 4OWGA 2QCDB 2CIPA 4ZO6A 3O16A 1JF5A 4UTHA 1XHGA 3RLUA 3EOLA 3QKZA 1VBGA 2QMJA 2CLEA 4Y8FA 4OFCA 1SPQA 4DWSD 4GBDA 3O8AA 3HOJA 1Z42A 4H9UA 4HMCA 5IXEA 3AO0A 3EEGA 3WJYA 4D9PA 2VL4A 2QULA 4JDYA 1JXJA 1J0KA 3IV3A 3LHWA 3DHDA 3AXMA 1DOSA 1XSIA 5I07A 3N2OA 2FPVA 2VUNA 3LERA 4AUBA 1A47A 5IHSA 3ANYA 5I3KA 2DW7A 1OFPA 3W01A 3T6CA 5JH1A 3AQUA 3VKBA 1S5TA 1E72M 2VRKA 1IWBA 5ECUA 4ADUA 3HMJG 1B5TA 3HGRA 1WPCA 4I9TA 4FO4A 1OFRA 3C8FA 4F2TA 3TN5A 1KFKA 1M3UA 3PWGA 1ODUA 1H7PA 1BF6A 3SRFA 2O7SA 3W22A 4H9MA 4GCXA 4Z1DA 2O92A 1L9WA 2CLFA 1PZ0A 2OG9A 1YPFA 3RXZA 1I2RA 1Q7MA 3OBKA 3WYZA 1S2WA 1Z6KA 2B7OA 4F9DA 3PUDA 4UTLA 3GD6A 4S2BA 4L4LA 4OBTA 1TWDA 4LUTB 4B3ZA 5AC5A 2MANA 3WD4A 3OLEA 4KKXA 2INEA 2I9UA 3AU2A 2AL2A 1LBFA 2PCEA 2V5JA 3VKKA 4L1WA 1W1IE 2W63A 7REQA 1QK2A 4QISA 5A2AA 5MKGA 3MKKA 3TAKA 1A3HA 4DAFA 4S39A 3TTYA 2YIHA 4QDWA 2FDMA 2QV5A 4TV6A 4EIVA 2UZ9A 5I03A 4UQCA 4F2BA 3LCIA 3U7VA 1F6KA 1RP9A 2DZVA 1DBTA 4EANA 1U22A 1OX5A 3FDGA 4HJFA 3GU9A 1C9DA 4K37A 5CXPA 3R8HA 3Q94A 2CNCA 4P7LA 4AWEA 1R3SA 3AS0A 3BLFA 2HXUA 2QVHA 1PPIA 2NWRA 1AFSA 1C3FA 3IVUA 3ARZA 4MM1A 4AF0B 4OU1A 4O11A 1ZJAA 4FR1A 4Q6XA 2G41A 4RNHA 1BAGA 1PTAA 2F61A 1ISVA 1OJXA 3EMZA 4DPPA 1V6XA 5LIXX 5GJMA 4QLLA 3W7KA 4DXVA 3W7IA 4PTXA 3WKZA 1XLCA 5D05A 4ZE4A 5BXTA 1JYXA 3KRZA 4ZOAA 4HHLA 3F4CA 4AYGA 3SJ3A 1XLMA 2J7HA 4FXFA 4M29A 1W3NA 4R7WA 2V2CA 1ISWA 1TZ7A 1VFHA 1GVEA 2RAGA 2GLKA 3E1F1 3RIKA 3CYVA 5H1WA 4MNLA 1VRXA 2WSQA 2QJMA 1XQLA 2ZZ3A 3SCVA 1JUEA 1UP0A 2WVVA 4Q4MA 2YCKX 3KP1A 1EEPA 3B3DA 4AEFA 2E6YA 2VRJA 3FCPA 4C6PA 2GVEA 5I7GA 5D2XA 3I4KA 1Q8AA 3M16A 5C6MA 1EZ2A 1JR1A 3K4AA 1JG9A 1QNVA 4WXYA 3HPSA 1DWJM 1WX0A 3TQPA 1IZCA 5AVNA 2A21A 4KRZA 3LLXA 2DU2A 2FVMA 1XG3A 2CW6A 1KXQA 3M0YA 4D6FA 2VEPA 1X6UA 3URBA 4AFYA 3B0UX 3P0XA 3GVQA 1XF0A 2Z29A 5IBXC 2WQDA 1VBJA 2QDGA 4OIFA 3AHVA 1M5WA 4PTWA 2HISA 2F7FA 1BG9A 3OZYA 3KL0A 3VD9A 3APYA 1W0MA 9RUBA 3R89A 2CFFA 2PZNA 9XIMA 1WXYA 4Q4OA 2E8YA 3G2GA 3LK6A 3TTEA 3EB3A 4CN6A 4HOXA 2X1TA 3CAKA 4RZBA 2PP1A 4XG1A 3CO4A 6ALDA 3IAQA 1ZY9A 2YA1A 3A4JA 3AWOA 2PDQA 4PMXA 1NTHA 5DRCA 4XZ9A 2OKOA 1U83A 3IGSA 3W70A 4UTIA 2WMJA 1X6NA 3NQAA 1N8FA 5BXRA 1TZZA 4LUYA 1F2JA 2A3HA 3L67A 3PJUA 5EMMA 4H4IA 2JGYA 4LYPA 2VWTA 4M19A 1DTUA 4GYPC 4WJEA 2B7NA 5CG0A 2GGEA 3LCFA 4NRRA 4JR5A 4OVXA 4ZENA 4NKCA 4IISA 2X1SA 4AZHA 2HDJA 1JZ8A 3PTKA 2GQ9A 2X1UA 2Z6JA 1WYIA 4JTJA 1ONWA 1E9YB 3OLDA 4O8AA 4Y9MA 2XIBA 2PUZA 3VUPA 4V2XA 4F3HA 1RY0A 3L4TA 3QEZA 2ZUNA 3EPNA 2YZRA 4AIBA 1LQ2A 4QBXA 2DUXA 2FGBA 1HFBA 3LPFA 1YW1A 1C92A 4NI8A 2YDSA 5T91A 4BJHA 3WLHA 1REQA 4MY8A 3NL3A 1UR0A 1H60A 2OO0A 1XDMA 1KW1A 4C90A 2J62A 3UA3A 1C29A 1PIFA 2BGQA 3A9BA 1CECA 5F1VA 4DEFA 3ZXWA 1FKXA 3TTSA 2RGLA 4UR8A 3C2OA 3PTMA 3N04A 5A2BA 3UFYA 4ATWA 1WKDA 5CSUA 1Q2SA 1K8CA 3TSDA 4J2MA 5BZAA 1FUYA 3LY0A 1M7OA 1NAL1 1DWHM 1MDLA 4FNQA 3HPAA 2W66A 3GXTA 1TRDA 4IG2B 3DGRA 2GJXA 3GH5A 3DKLA 5HWJA 5A6AA 1Q8JA 4HGXA 2NUXA 3E0VA 2Y85A 2EG7A 4W87A 3PZTA 1QBAA 4L4OA 2RDWA 4HYVA 3SQSA 3G5EA 1UZ1A 4UMAA 5HR7A 5EMKA 3W1MA 1BWKA 2QGHA 5AVHA 5CH9A 2VJXA 3EYPA 1LORA 4DYEA 1E6XM 5C2XA 2FHFA 4JYDA 3BLKA 4WXZA 3AJ7A 2XVPA 4XAFA 4JYFA 2OCZA 4N02A 3T1GA 4B5XA 2J4GA 1DIDA 5CC5A 1I60A 1UA3A 3C0QA 2I5IA 5DXYA 1H0IA 4HK7A 3MCOA 2PLKA 1O60A 3TSMA 4C6QA 2FVKA 2VR4A 5F1UA 2RGMA 2R1MA 2V63A 5I02A 3M7WA 2Y61A 2O9TA 4ROPA 3NUKA 3WEZA 5L6UA 3B8DA 2VQTA 1K7XA 3WLOA 3T42A 3LCWA 4YJ5A 5EFFA 1T8XA 3OW1A 3U8GA 2ISSA 3S5NA 1IZKA 3UXDA 4M1RA 5LIYX 3LHUA 3WNKA 4PCSA 4PL1A 1HTIA 4QGCA 3NOEA 1JPDX 2RFGA 4N9DA 4HBKA 4LU0A 1D8CA 2WKJA 4IX2A 3M1ZA 4ASTA 4YCPA 2NQLA 5C70A 1NWUA 2XPKA 1DWGM 3S2CA 1RLCL 1FWNA 1PTGA 4KMQA 2R1KA 3EOEA 3VMOA 3N4EA 4H9TA 2WO5A 3U2EA 1OCJA 4AZ6A 4MYAA 3KOXA 2PWDA 4YWIA 4DWSB 4F0MA 5HULA 5LYRA 5HA7A 3KVKA 3QXBA 3MWCA 1OYAA 3G3MA 1EP2A 5HQEA 4ZCWA 1W37A 3S9ZA 1ECEA 5C9ZA 4NXKA 1EBHA 4FLQA 1F4HA 4W5ZA 4O1BA 5CLTA 2ZA2A 3H54A 3GNRA 4G56A 3CUJA 1SZRA 1JQVA 3BVJA 1DL3A 2BP1A 2C71A 1RCXB 2R91A 4OZOA 1XLJA 3ZSTA 1JI2A 1SZNA 3H23A 2A7NA 3UEQA 1DV7A 2VFIA 1EO5A 3NPXA 5I3DA 3HO8A 1WA3A 3L4WA 4IJCA 3SFKA 4D8AA 1E5NA 4R88A 3V3WA 3CL6A 2VOMA 1TA3B 2OMAA 1HJQA 2HRWA 1YYAA 4JN7A 3VKAA 1BSLA 1POJA 2J74A 3PTQA 2QUNA 4FIRA 2ZDSA 2DZBA 2DV0A 1GJPA 1PEZA 3UR8A 2Z2BA 5DFAA 2J6VA 2ZBTA 5L9FA 4GXMA 3H4WA 4IOTA 5EGRA 1JFHA 1ICPA 3KOZA 5TNVA 5AN7A 3L65A 3W83A 3F7JA 8CGTA 3AYRA 3UVAA 1Q13A 1KD0A 3TIMA 3SRKA 3FK4A 1W54A 3AIEA 1LP6A 5C7HA 4UQDA 1EUAA 3S0CA 1EOMA 4PMQA 3G1YA 4BA0A 4UC5A 2PU1A 1GZJA 1V0NA 2JGQA 3KBJA 3ARYA 1R3VA 5FF0A 2NUWA 3LSCA 1FWDC 1NFPA 5CCZA 4UNLA 1G67A 1TPC1 3L4UA 4AVNA 1TTIA 3IANA 3SAZA 1CYGA 1PYFA 4PSPA 1FOBA 3DFPA 3NWRA 4J3WA 2H3DA 3F2CA 4XUYA 4C6KA 4HNCA 3A13A 1KWGA 4TOQA 3RILA 1TFVA 1Q6OA 1XGDA 1H5VA 4ALDA 3GHUA 4MPKA 1JRCA 3VNKA 3MS8A 4DVOA 3BDKA 3EWCA 3JZEA 3UERA 1BSIA 4AXNA 2DSKA 4KEZA 5FKYA 3TSBA 4CGTA 2KAUC 4O1EA 2TYSA 1IT7A 5CZKA 5HQMA 1GVFA 4G1NA 1KRMA 3RF9A 4FF7A 4UQBA 4EX4A 1J18A 1W1ZA 1B3ZA 5A6JA 1HJWA 3ZS4A 3E5BA 1R47A 1GZ1A 1V3MA 4KW2A 4FPSA 3MUIA 3MUXA 2INFA 4YS1A 3AIVA 3W1XA 3N13A 5JBEA 3BQ6A 3MW7A 2BVDA 5CSYA 4DUWA 1EZWA 3LU2A 5KMYA 3PF3A 3NXFA 3DUGA 3PR2A 5E93A 4NUWA 2ZUTA 3UW6A 1M7XA 4Z2IA 2OSWA 2OZ8A 2XFRA 5BW6A 3M4HA 4CU8A 4FXJA 3NQ8A 1VCGA 5K3VA 3IJQA 4WX2A 1QNRA 4PUDA 4PODA 3IGHX 2Y0FA 4HYWA 3A4WA 1FXQA 2PDMA 3CHCA 2XDFA 4C6NA 3E38A 4YL2A 1FHVA 2RDTA 1XINA 3M0JA 3UA4A 3IWPA 1R3QA 1JI1A 3TEVA 4ZODA 2ZRXA 5D8ZA 3T0TA 3VNDA 2P76A 3LN3A 4AZCA 1M53A 2C0HA 4ZTYA 4RXFA 4XZBA 1AQ0A 4BS0A 2E5DA 4IHCA 1W5QA 4C6IA 5LHEA 5D02A 4LNCA 3KRBA 3ZR4A 3CZKA 3SIZA 3W1LA 1ZP4A 4LTSA 3MSYA 3MSGA 4CU7A 3EMCA 2ZZ2A 3IS4A 4LANA 4UR9A 1IR2A 3O7UA 2Z7GA 1WZLA 3VNLA 2PRLA 3HIJA 1FCQA 1H1ZA 3IJDA 2V9DA 4NU7A 3UG3A 3W0KA 4HPJA 5FL0A 3VIPA 1OF6A 4QEEA 4MWAB 2HK1A 4DAIA 3V75A 2VFGA 3LTPA 2Y5JA 5KZEA 3GYEA 3TKFA 3CPGA 2VRQA 1JDAA 3H7UA 4J4KA 1UD4A 4DUXA 3NURA 2OO6A 3N11A 3B8VA 3GIQA 4WCJA 3IIVA 3L4VA 1LQ0A 5FEZA 2Y88A 3GVVA 1NF7A 1W9UA 6XIAA 1ESWA 1V93A 3QBUA 1EXBA 1HKVA 3CHDA 1XBVA 1V0LA 3H21A 4V1XA 5RUBA 4O52A 3MYOA 3SCNA 4FHAA 5HOSA 1EH9A 3WD1A 3STGA 3UG5A 1RQHA 4YMZA 1F8MA 4NNAA 4JFSA 4K1GA 5DY2A 3MZ2A 3WLNA 1U30A 2VXNA 1S1PA 3AICA 4TO8A 1NOUA 4IIFA 4D2JA 4I5UA 1QTWA 3H2CA 4BF5A 1IXOA 4CUCA 3M46A 1GOMA 1UKOA 2GYIA 7ODCA 1SZGA 1B3OA 2AL1A 5AHEA 2WOQA 3K30A 4D8ZA 3GNOA 1TCMA 3NSNA 1IYXA 4JIPA 4FOUA 5HXMA 2V5CA 2WMIB 1DORA 3WQDA 4NVTA 3M47A 5E09A 1N55A 4J27A 4FXRA 4GA8A 1FWTA 4RZ5A 3TU9A 3KL5A 3LEPA 4H6EA 1XLBA 3LD5A 2ZZ7A 4JTUA 1X98A 2CITA 1HNYA 3ERPA 4ZQOA 3VDCA 2YOCA 4FK9A 2OODA 3VGDA 1GJUA 1CEOA 2J9YA 4EWJA 2OELA 1GJWA 3UWYA 4O19A 1QO2A 2FVLA 3TYEA 1KM6A 1DXIA 1R3YA 1PX8A 4GKLA 1FCUA 3TW7A 4FX6M 3M41A 3GG1A 4JDBA 2Y1HA 2PDYA 4WF7A 3HG4A 1VFOA 1XBZA 3P7YA 1ZB5A 4CCEA 2V68A 3P8JA 4EPKA 3UG4A 3JS3A 4ZTXA 1EP3A 4F8XA 1BGAA 2FPTA 3Q37A 3FIGA 4GISA 3WELA 4PTDA 4B2DD 3WD0A 4DHGA 2GJPA 3M9YA 3VA8A 3MBFA 1A5MC 2DQWA 4I9AA 5EL1A 3EDKA 4IMGA 5C2CA 4MTVA 1AD4A 4GIAA 5FEWA 4M3PA 2UY5A 3BJTA 2YL9A 3O9NA 3THUA 1XDLA 1K3UA 1TPFA 4AZBA 5KZ6A 3L4YA 4L6DA 2V5DA 2Z2AA 4UXDA 1OX4A 3GKAA 2VDIA 3F1QA 1IR1A 3OVRA 5AYZA 5D2WA 3V1HA 5K9CA 3ARRA 4JX6A 1SW3A 2Y7GA 1R0MA 4P8UA 3RG6A 2B4GA 4IX0A 3H7RA 3WQPA 1H41A 3ABZA 3GHSA 2EPHA 4IMDA 3AWNA 1KBLA 1Y8BA 1ZJBA 3NR0A 4JIHA 1QHOA 1WXZA 5DCBA 3VD7A 3IVSA 3SN4A 4BCEA 4ZO7A 1GHRA 3WF0A 1VEMA 4GXWA 1PTDA 3VOJA 1Q7ZA 4QITA 1P4CA 2EEXA 5BWFA 2WM0A 2BNJA 4DWSA 4CQCA 4JS3A 4AX6A 4U3AA 3QTGA 1US2A 4AY8A 5HAOA 1FDZA 4OQVA 1JNDA 3T08A 4A3RA 5A8MA 2YX0A 4JTHA 3M44A 3TDFA 2CZVA 2DIKA 4K38A 3VYLA 4S3KA 3BTNA 4RZ4A 5I3FA 3ABQA 4DN1A 1G69A 3GSMA 3IK4A 2F2KA 5IFTA 5H8MA 3PZNA 3TVAA 2WC7A 4XBJA 3MTWA 3EA3A 4H19A 3U5UA 5EA9A 1VKFA 3W7PA 2YGYA 4RX0A 3GM8A 4QDPA 3FGCA 3W26A 4JD4A 3NPUA 4IH3A 3AZRA 2PGRA 4PCNA 1CB7B 2ALRA 4P2VA 3PTDA 4EPDC 4GNJA 2CYGA 4O18A 3C4UA 4XD5A 5BWAA 1N82A 3ZJ6A 2YW3A 2OR2A 4QJ4B 3TTQA 3FKKA 4AZ7A 5JVLA 4QJ5B 4QM1A 3LTYA 3DFTA 1X97A 3A22A 1XH0A 4M5PA 3K13A 2YXXA 4LWWA 5CLWA 1ZU8A 3FDKA 4MLRA 4S38A 3GHTA 1Q6RA 4R27A 2ISVA 2D24A 1NM9A 1AA1B 1G6CA 3LENA 4AZIA 1DWFM 1TX2A 3NVDA 3KOYA 1DTNA 3PPGA 3W38A 4E2BA 2C6QA 4HD5A 3AIQA 4NT0A 1IWPA 2J9XA 3EOUA 3VVGA 3QZ6A 4B90A 3PNUA 1DJIA 2X2GA 1GVYA 2DJLA 1WBHA 3VUSA 3CS2A 3H53A 1P6WA 3CC1A 5F2MA 1BFNA 5DMNA 4Z2KA 1LLWA 1HUVA 2AQOA 4QLKA 2RJHA 1GPWA 4GBUA 4FNRA 1XLIA 4L9YA 4JKMA 4KFOA 4GY1A 4XVEA 3CUZA 3MQTA 1MQRA 3MKCA 4O0KA 5LGXA 3VD5A 1PV8A 3U5YA 3NDOA 1XR2A 3H6OA 3S42A 3GRIA 1QNQA 3UWVA 1UUOA 1HP4A 1MEIA 1XQKA 1TMQA 4GX8A 1JCXA 4ZSUA 3HBLA 1GNXA 4KBXA 5C5YA 2YDQA 1B54A 1KBKA 1U1UA 1UR3M 4AB4A 2ZZ6A 3F5LA 5F2GA 1F5ZA 2OQYA 1US0A 4PUUA 3KVJA 3P84A 4ZQMA 5D9PA 3OPSA 3O6CA 1IZJA 4LOCA 1K9FA 4IPJA 3R2GA 1FHUA 1YIXA 4S2CA 4RUBA 1P1XA 1TMLA 3GG7A 2OJPA 4JTSA 1KCLA 2DH2A 1UWQA 3TNOA 3FEMA 3E2RA 4CNPA 2WMHA 1BG4A 3UBPC 1M7PA 2C13A 3B9NA 5D32A 3T0AA 1E0UA 3QW4B 3ZO9A 2PTZA 2D3NA 2Z24A 1GW1A 2XVGA 1TELA 3K8MA 3AHXA 3GTHA 2XSAA 4M82A 3NQ6A 5CG7A 4QSFA 1XICA 1DIKA 5BXSA 1ICSA 4MWAE 2ZA3A 1LRTA 2BMBA 2G95A 2YLLA 2FZDA 5I3HA 1G01A 3QYQA 3JVAA 1XM3A 2C3ZA 2ISFA 4JL2A 1VFSA 4D1JA 4FB7A 4WKFA 2NVAA 1JCNA 3WBYA 4WGXA 2VENA 3MPGA 2YPIA 4UUIA 2DSZA 1GYMA 2PDJA 3S1XA 3PUEA 3N12A 4NJJA 1B57A 1AJZA 4KRUA 2F6UA 2NQ5A 2ABAA 3AS1A 5CAKA 1B3WA 2Q8XA 3MMTA 4TTUA 1KCXA 2Z28A 1J96A 3LZ5A 3F5JA 2WBKA 3TOYA 3FHAA 2ZFAA 3KW3A 3MANA 3RCYA 2XIMA 3KVMA 3VOHA 2YL5A 1K70A 4IJRA 4DLFA 4UZSA 4GVHA 2CKSA 1XYAA 4RNJA 3S2JA 2BY2A 3TX9A 1E71M 1QOXA 2PWEA 5CZJA 2VX4A 3GFXA 1E51A 3ARWA 3WEMA 3NZPA 2A1YA 3C61A 1ZBWA 3A3WA 3FV9A 1MO0A 3GAYA 3E5PA 1Z89A 2Z1WA 2Y5EA 3P62A 3QH2A 2YBUA 3RO8A 3GNNA 1V02A 1KFCA 1UR8A 3LBOA 1XLLA 3HFYA 3ZM8A 1MW3A 1FCBA 4I3GA 2D73A 4AHPA 5DLCA 2E9MA 1MSSA 4NAFB 4X9YA 3URNA 4Y96A 4NX0A 4UFKA 1J2BA 4HT3A 4OTKA 2PTWA 3LCHA 1A3XA 3EEZA 3FA3A 3RGTA 2DT3A 2WMIA 4MY1A 2BXZA 3V36A 1HF6A 4PMYA 2YBTA 5GVJA 3CV6A 2G97A 1VJZA 1EJWC 1CGVA 1AJ2A 3Q67A 1FWJC 2OT1A 3OA5A 4GFSA 2VKZG 3PBYA 8XIAA 1CB2A 3CZLA 3MCNA 2DH3A 2NV2A 2WSKA 1KM3A 4IFRA 1Q63A 3NNTA 1VC4A 3S4TA 4EACA 3S5ZA 4XK2A 3A5FA 2PF0A 3DHUA 2YXGA 3GVRA 4PMUA 3MMUA 3CQJA 4C65A 2WZEA 1DJYA 3W00A 5G4EA 3WF4A 3FN9A 1YBQA 4XIAA 1W31A 3E2QA 3U57A 1MZHA 4M6PA 1OQFA 2ZKMX 4FR6A 4AC1X 2X30A 5KSWA 3COTA 4K6AA 3MSRA 3W53A 3K2GA 3R8RA 4JTFA 3QQ1A 3SI9A 2OQLA 3L12A 4MJ2A 4KCWA 1IIGA 2GQ8A 3SSJA 4A22A 4IL2A 2GPTA 4W86A 1A49A 2CBUA 1AQHA 3KEHA 4KIRA 2UV8G 1QASA 4F0KA 1E6ZA 2G3NA 1IWAA 1KWKA 1E15A 1QHZA 4HIBA 4GVIA 5KTLA 1ITCA 2PLJA 1S39A 2WNZA 4GNKB 1E4NA 2WPBA 4ERAA 4LUSB 3CXOA 1DKWA 4E8DA 4J5NA 1QPRA 5KETA 1D3GA 1KNWA 2CKRA 3MO4A 4GI8A 1DIOA 5D30A 1P0EA 3F4VA 1NY1A 4H9XA 3GG8A 3UXIA 1AD1A 2VP8A 3B05A 3C3NA 3AMGA 2VD8A 1GVSA 1KLZA 2Z26A 3W7RA 1EOKA 1UC5A 4UBPC 1CLVA 1I8JA 4MJMA 4ES4A 3AHTA 3EKZA 4LUJA 3W2NA 1TIWA 2C1HA 4HZ8A 3GB6A 4DWDA 2HQAA 2XINA 1FWWA 4RV8A 3NQBA 1M04A 1TX0A 4PBEA 4BI5A 3N2XA 3NPWA 3CHVA 4WSHA 4X2RA 4KWVA 3BANA 4FNPA 1W5PA 3EB4A 3O2LA 1E9IA 2VWSA 2EPNA 4DWSC 4URIA 3ONBA 4MMWA 4CNSA 1RD5A 3KCLA 1A0EA 2EKCA 1XV8A 3AHYA 4CLMA 3GK0A 5EFDA 1NOWA 1K03A 4I8YA 3BLLA 3MC5A 1MRQA 2ZRUA 4ML9A 4U10A 1UH2A 3ZLHA 1CXHA 4M6UA 2WQPA 3SR7A 2X2YA 1XIGA 5A8NA 1EDQA 2FZ9A 2CLHA 4CD6A 3STPA 3ARQA 1E56A 3UPBA 4PMJA 1TB3A 1X7IA 3IUHA 1PL9A 4LYQA 1JYNA 2XYLA 3DG6A 5I09A 3VGFA 4GC3A 4O4WA 1TV2A 3ABSA 1G4PA 1ZL1A 4TV5A 2ZX7A 3V0UA 5DX7A 4EAYA 3N15A 1M68A 1EGZA 3R94A 4HNOA 1CGXA 2W9MA 2DSUA 1ZAJA 3VIHA 1O68A 2JK2A 1UWUA 1ZZMA 4PMOA 1KGXA 4NYYA 3CQHA 2W92A 1SO6A 3CT7A 2PRMA 5GPRA 2QQ6A 4FSAA 1AMKA 1G0CA 2R9RA 3QMTA 4HA1A 3ARXA 4MLJA 2ZYFA 3H2AA 5AYBA 2IUZA 1FWIC 3QJAA 2E9BA 3AIWA 3IAPA 1WKEA 1JL8A 4BEQA 4U28A 3BURA 3C2FA 2C15A 4B91A 1XUZA 1UP2A 4IGHA 1HP5A 4UTWA 2QYGA 2C19A 1PKMA 3N18A 2JKAA 3P60A 4D72A 3B04A 4GQRA 3PBVA 4NJGA 2NQ9A 2J6XA 3QOMA 4REQB 4EPEC 2YSWA 3BW2A 3SY8A 5D9MA 1X8FA 4QQUA 2CBJA 5FJRA 1QNPA 2Y8KA 2R1PA 1JZ3A 3QHMA 4B4FA 5IRPA 2ON3A 1A0DA 3MDWA 1DIEA 1Y0EA 3B0PA 3NTYA 2B0MA 2NXHA 3FA5A 3UZJA 5I2UA 2DW6A 5A6MA 5ABTA 2AGKA 3LGGA 4MY9A 4S3AA 2IXUA 1V77A 3ZR5A 1F73A 3TJXA 5FF7A 4D6HA 2A3LA 3IIPA 5CJMA 3NQFA 1HXJA 1FWBC 4G9PA 1EF3A 4O28A 3UT0A 2AQWA 1GVIA 1EC7A 1UC4A 4Y2WA 2CXEA 1IEXA 3VXGA 2F38A 1HVQA 7ENLA 3OIXA 4J3SA 1PJ9A 2YYTA 3NL6A 1LWHA 4DO6A 3DN5A 4AIUA 1U1JA 5FF4A 1V3IA 3AZTA 2YDRA 4JFUA 3SGZA 3VIIA 3IRSA 4C6CA 1FTXA 4RE4A 1T96A 1VS1A 4K36A 1FWAC 3TV8A 4P8WA 3CHEA 1CNVA 2Q71A 1EGMA 4HMDA 1R2SA 5A6BD 2YL6A 5F4WA 4G7FA 2I5QA 4K7VA 4UB9A 3HG5A 1OD8A 3ARPA 4HA4A 4MUPA 3RLHA 2B7QA 4IQJA 3UU0A 2FDSA 1EJ7L 2QCLA 3DDMA 4CNTA 3ITCA 1Q4NX 1W5MA 1BHGA 5DELA 3EX6A 1DE5A 3OLIA 1FWEC 3LM7A 3VOIA 3ZT6A 3NL2A 1HW6A 5DBTA 1F05A 2ZRYA 2OT0A 1ISXA 4LB3A 1O1HA 5AYYA 3ITGA 1LUCB 1J5TA 1W3KA 1THFD 3MHFA 5T9CE 4EPBC 3SO7A 4MWAC 2VCCA 2VGIA 2PD9A 4MFEA 2PODA 3KVLA 5AHMA 5FEXA 3TQKA 3W1QA 4F40A 3NSMA 4A3YA 2GOUA 1OFBA 3IIXA 3N29A 1B3VA 4M8UA 2GOKA 2O4QA 1JCMP 4JTQA 1HJXA 2ZDRA 2VYOA 3G0XA 3RN6A 4DJDC 1JUKA 2NX1A 1ONEA 3ATZA 2QPUA 2J7FA 1TR1A 4ACZB 1VLWA 1KLYA 1TYGA 5G4HC 3SQLA 1UOKA 4E2OA 3M6DA 5M2FX 3WUGA 4CQDA 3FVMA 3OODA 3ANVA 2ZX5A 1SMAA 3GIPA 4IQDA 3M5YA 1O4UA 3WX7A 2X1RA 2ZE0A 2PWHA 1XYBA 3GIYA 4B3LA 3GUWA 5LNSA 2RKXA 2Y62A 4RNFA 1J0JA 3I65A 4LY4A 1PYMA 4LS2A 5TF0A 1GQKA 2GDVA 1HN1A 4JQ2A 3GNDA 2HEJA 1G9HA 1XFCA 3LG3A 1GONA 3D47A 3N25A 3AYTA 3HQOA 2VQUA 4AG0A 2F84A 3S3GA 2A3AA 4OV4A 4O4VA 1Z69A 3RX3A 4R9XA 1Q6DA 3SFWA 1FBAA 1VPYA 1J93A 1Q66A 3KWSA 3W7OA 3AMDA 3W73A 3CL8A 2CLIA 5K2ZA 4Q8OA 4A8IA 3RITA 4PMNA 4U5KA 1KXTA 3GR8A 4XZIA 4OJYA 4Y7EA 3WFAA 1L2UA 4BQ3A 4OHQA 3VNJA 3JRKA 7PTDA 4RR4A 5ABFB 4H9VA 3N2BA 4QAIA 1KO0A 3MV11 2CZ5A 2J25A 3WJWA 1XC6A 4B2DA 1MI3A 2A3EA 2BXYA 2XIOA 4O15A 4LT9A 3TMQA 3PJTA 4XD6A 2OOGA 3NOYA 1LWIA 4KESA 2TSYA 3UWEA 3WLTA 3LPOA 1HGWA 4CQBA 2ZTKA 2FQIA 2PD5A 1VCFA 3NQVA 4H2HA 2RHGA 4O1DA 2E6FA 3O6DA 4XKYA 4J35A 2JALA 2ATSA 3TYUA 2WSPA 1AW5A 4LUSA 3UR7A 2ZC8A 3T4CA 3O6AA 5BMWA 2QMKA 1WBJA 1OCQA 3UCDA 5LXXA 1EHAA 1F6PA 2CXGA 3EB2A 1YQ2A 1OEPA 4RDVA 2G4JA 2VC6A 1IEQA 3HG2A 3EWUA 3VNIA 3TLQA 2GK1B 2QJGA 1ZAHA 4ZQCA 1DQWA 4NAEA 3K1GA 2BOEX 2DIJA 1VFFA 1P0KA 3MUCA 1S2VA 4ADTA 1XYMA 3EWYA 3R12A 4NI3A 3CK5A 3RAOA 1KM0A 1JCJA 1T6MA 1C8XA 4KWWA 3VE7A 3S1GA 2XN0A 6XIMA 1X1ZA 3TAOA 1FWGC 4ICMA 4NXSA 2PTDA 3H4GA 4UTTA 5C8BB 4WHBA 2Z27A 1CPUA 3A12A 5J04A 1TWZA 3THQA 5IHRA 3ZR6A 1CBGA 1TE1A 2WK2A 1YNYA 4TX9A 1B2YA 1UH4A 2PCQA 3HN3A 4DB7A 2GWNA 4NJHA 2QPSA 3VDAA 5F2LA 1A4LA 4FI4A 4Q7IA 3ABOA 4Y9OA 3A47A 5A6KA 3B9EA 1FFQA 4DF1A 2XH7A 3OHIA 5ABHA 2XN2A 4DM1A 2PA6A 1NVMA 4ZQNA 3P2VA 5EPDA 1YTKA 2JIWA 1ZBCA 1MDRA 2VCAA 4JZ5A 4O16A 3UD6A 5REQB 1NWTA 1HG3A 2CEQA 1AH3A 4P7QA 3CM4A 4RPPA 4O1FA 3F2BA 1EYWA 2WBGA 3MVIA 3OVGA 1TV5A 3TUUA 1TTQA 2J7BA 3E0FA 3OGVA 3R0UA 3N19B 4N6EA 3SN0A 1QI4A 3GC5A 4HNNA 1E3XA 4C5ZA 3WH9A 1N7KA 3P93A 2P3ZA 3W07A 4RDYA 2HS8A 2WV8A 3VD4A 5FEPA 4DI8A 1RQBA 1VFLA 2D2OA 1ADSA 2VX7A 1VD6A 2O4MA 5FJTA 2XGIA 4N6FA 4PMZA 3UY7A 4DI9A 4NYUA 2OVLA 5CPNA 5G4WA 2J77A 3MHGA 1V6YA 3GDTA 4H7CA 1MW1A 4BF9A 1ME7A 2OTDA 3BC9A 5CPMA 4ZVJA 3WQOA 2WWCA 3I3EA 4BHYA 2W91A 1E3ZA 4RNIA 3TONA 1TKKA 3GR4A 3VDBA 2OXNA 4LVGA 1L6YA 1G7VA 3DGBA 4IIEA 4REQA 2FMOA 1V6WA 4UTWC 1VRDA 3ALGA 1TQXA 3SUWA 3PSVA 1Q6EA 3AC0A 4NRSA 4JFTA 1MFUA 1NH6A 7REQB 1GKRA 1DYSA 5M1TA 5JMUA 5MKGB 3BSHA 3UVIA 2WSRA 5D37A 3I3DA 4KWSA 4LBSA 1TO3A 4W89A 4FNTA 3WBAA 4GIRA 2BXVA 2TODA 3K8KA 3B03A 5FSDC 1M41A 4LAZA 3NM3A 2CZFA 1HKKA 3AMLA 3AAMA 4WY0F 1HKIA 1SFSA 3WLMA 3T0DA 3IACA 1QFEA 5CZ0A 1DPMA 1YXDA 4HQVA 4A3QA 3VIKA 5LKYA 5ABEA 4H8NA 5K9XA 3PNZA 3N6JA 1DJXA 3VM7A 3AXIA 3G1HA 4GZEA 1UR2A 2G50A 1HZYA 3Q65A 1MW0A 1UR1A 4PL2A 3NQ2A 4YIWA 4M51A 4IIGA 3CUXA 4OT7A 2QZRA 2VFFA 1ZAIA 1EJVC 4ML4A 3B9AA 4NSBA 3QPYA 3OBAA 4PUJA 1RHCA 5FL1A 2WC3A 4POCA 3W7MA 2V69A 3WQCA 5AZ1A 1HJUA 4NNBA 2CLLA 3SUSA 1Q4WA 3CGTA 1PWLA 2QCGA 3CIVA 4MB1A 2ZXBA 2E0PA 2DEPA 2G3FA 4JQ3A 3AYVA 5HPCA 5DN1A 5JIPA 5DCEA 1O6IA 4R85A 1KKOA 2NT0A 1OCBA 2QS8A 4UTMA 4YU1A 1DWIM 1A80A 4YXGA 1A5OC 4E3TA 1G7UA 4DIAA 2CHOA 3W1AA 3UZWA 3VABA 4S23A 4NX5A 3F5KA 1VJSA 3L2IA 4W9TA 4OBRA 3Q2DA 1V4YA 1O1ZA 2OGJA 2NQHA 2Z25A 4HJWA 3P8IA 2OYKA 3GXMA 5ECVA 1OABA 3OBEA 4B9ZA 6CGTA 1P5BA 4PR4A 3B9DA 4HHMA 1GVQA 3FYPA 4HN8A 4XISA 1GOQA 4N9EA 4PH6A 4F48A 4X9SA 2J88A 5G1YA 3SCTA 2A6NA 4FS9A 4Q22A 4H41A 2PB1A 3F4WA 2H8XA 3H26A 3HQ1A 4R9OA 1H4PA 1T40A 4B3KA 4RJEA 2WWDA 4HPNA 1VIWA 2GJLA 2DT1A 3SUUA 3W7JA 5F2IA 4QS5A 2X16A 3DFSA 3PFMA 4LPCA 3E9AA 2A79A 2Z1KA 4B9YA 4JNZA 2O56A 4Z2GA 1O7AA 3R8GA 2EAWA 3MO7A 1IXQA 2J8GA 3UF9A 2YYUA 1WOAA 1XFBA 5K7JA 3ES7A 3ZYZA 3QC3A 1U5VA 1X6LA 1LRNA 1DEDA 1XIMA 2AQVA 3RLGA 2PGEA 1K6AA 4YYCA 3SCPA 5E6ZA 5BNKA 4LGXA 3QV6A 5LIWX 3TQVA 3W1RA 4S3BA 2E6AA 1DXEA 1RBLA 1O5KA 5AB3A 4KS0A 2WJFA 2QAPA 4EE9A 5CBJA 4KWOA 3N3MA 2J7CA 4ZOCA 4AX7A 4CEXC 1RPKA 3LQGA 4G7EB 1BWVA 5CZTA 5H8UA 4YN5A 3TW6A 3DKJA 1KXHA 4KEMA 2VHLA 1TSIA 4CN1A 2CLPA 2PI6A 3AS2A 1XDJA 3VOFA 4QR6A 4XZHA 2BLEA 4HP5A 4HU8A 3MU7A 1REQB 1B90A 2XFFA 3WQ5A 4F66A 1FWHC 4BWLA 3PZUA 3WLLA 4PRTA 1JDDA 4GYJA 3WJXA 4UR7A 4AU0A 3RCNA 2CC0A 1A3WA 2R6OA 1PAMA 1NDYA 2PTYA 2WHKA 3LRMA 3R6IA 4PUEA 1SSGA 1KB3A 3BCDA 2QCNA 1ADOA 3F4DA 5FESA 3F2DA 1GZGA 2YFOA 3DESA 3U7BA 3HURA 2YJQA 4D71A 3O05A 4L80A 1Q7QA 2R24A 3A23A 3EDDA 5EMJA 4JHMA 1R5YA 5A94A 4YTSA 1KM4A 2QXWA 3UCQA 5EU9A 3REQB 4AD1A 4F9JA 3M0VA 2OSXA 1AZ2A 1SYTA 3C6CA 1BVWA 2C79A 4I6KA 2GJXB 1W9BM 4LRTA 2QF8A 4EK7A 1WKYA 4DBWA 3FKRA 1QATA 2DZXA 2HBVA 1IIHA 1PO9A 2IKHA 2WJDA 4J3TA 3P14A 1TPWA 2YXOA 1H2JA 4WIWA 4BEUA 3FAXA 3EX3A 1UASA 1MQPA 1UWAA 1HO1A 5AZ0A 2X41A 3I6TA 5CGQA 2V3FA 1E9LA 3CL7A 4HB7A 5EBAA 1D7FA 3BZJA 2GGJA 3VIMA 4Q8WA 3RK8A 1MXDA 3ZSSA 4LQ1A 4RV3A 4HCDA 1AQMA 1SM9A 2J7GA 3HG3A 2F2HA 5I78A 3WK1A 4W7VA 1F9CA 4O54A 1W3HA 3BW4A 4FMVA 3HM7A 2WMKA 3D3FA 1OC7A 2QJJA 3CH9A 4I9MA 3THAA 1JCLA 4O53A 1VEPA 4Q7NA 3ELFA 3CZ8A 2WMGA 5AFDA 4GNVA 4UTTC 1J6OA 3W1NA 5HK4A 2H8ZA 1VF8A 2QJHA 3OHMB 1QDSA 5HATA 4ICCX 3D5HA 3N4AA 3S6DA 3OYZA 4Q8NA 2P10A 1KM2A 1HL2A 3L2LA 3GTNA 5A8PA 3H2NA 1XXXA 2QUUA 1SFLA 3KDOA 4U5IA 4GLEA 2DPEA 4O0ZA 3GNPA 3POCA 1OG0A 5D2YA 1QW9A 4EVZA 1LBMA 1V0MA 5REQA 4H83A 3I6RA 1DJGA 1GCYA 2RJGA 3VGHA 1ODZA 3TC3A 3VGGA 4IJBA 4Q8TA 1ISZA 2JEQA 1BQGA