4PMZA

Crystal structure of gh10 endo-b-1,4-xylanase (xynb) from xanthomonas axonopodis pv citri complexed with xylobiose
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
303
structure length
303
Chain Sequence
b'APLAATASKFLGCAYGAQQAPGFAQYWNKLTPENGGKWGSVEAVRDQMDWSTLDAAYRFAQANQMPFQMHVMVWGNQQPEWIKTLRPAEQRREIEQWFAAVAQRYPDIALLEVVNEPLNDPPSKADTGGGNYLQALGGNGDSGWEWVLQSFRLARRHFPHTKLMINDYSITSSAQATQKYLQIVRLLQRENLVDAIGVQEHAFETTPEVAVSVHRDNLDALAATGLPIYITEFDLDGPTDAQQLADYKRVFPVFWEHPAVHGITLWGFRPGLWRDKEAAYLIRADGTERPALTWLRDYVAAHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xylanase
molecule tags Hydrolase
source organism Xanthomonas axonopodis pv. citri
publication title Molecular mechanisms associated with xylan degradation by xanthomonas plant pathogens.
pubmed doi rcsb
total genus 124
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmzA00
4J3WA 4ML4A 2CKSA 2DGAA 1B2YA 4MNKA 3BXWA 4AWEA 3LPGA 4C7DA 1SMAA 2VMFA 1UR2A 1CBGA 2WMFA 3O2LA 3WNKA 5JUVA 2XWEA 1UD2A 1LF1A 1EO5A 4K68A 3POCA 1DWJM 4E8CA 2OWWA 4DWSA 1W9UA 1A47A 4PTWA 1GOIA 2CBUA 4JKMA 4CVWA 1LL4A 3OG2A 3VDAA 2WVVA 5KEZA 2D20A 4GI9A 3KEHA 1XH2A 5DEZA 1UHVA 2O9TA 3AZRA 1E0XA 4RE2A 4ACZA 2WHMA 4P8WA 3ARRA 4J3XA 4PTVA 1HP5A 2PWDA 3VD5A 4TUFA 3WNNA 1NH6A 1CXHA 3AIQA 3W82A 4JHZA 1UOKA 3WD2A 1BYAA 3WNOA 1GQKA 5D9PA 2VX4A 4HA3A 3CLWA 5E9AA 4X9YA 1Q6EA 3ZMRA 3VD3A 1YQ2A 4XUYA 3TONA 4Z2LA 3MUY1 1HKMA 3AIEA 1CXEA 4BF7A 5GQBA 1PZ2A 3UCQA 1V3MA 1B3XA 4HOZA 5JIPA 4PMXA 3S2CA 7TAAA 1VFOA 1QI5A 1JD7A 2WMHA 3B8SA 4W93A 1EHNA 2J75A 3BLKA 4U33A 2ZUNA 3AMKA 4MTVA 4J28A 1C7SA 3N9KA 3RJYA 2J7CA 1JZ6A 2GK1B 1IT0A 4PUEA 1QHOA 3AJ7A 1VJZA 3CZJA 1B3VA 5A8OA 4PTXA 1CZ1A 3THCA 3VDBA 2VC9A 1ITCA 1KXVA 3A3HA 4JFUA 2XVNA 3PZNA 4XX6A 2YDQA 1ZL1A 2FGZA 1EIBA 2VO5A 3AHXA 5AC5A 4S3KA 1V02E 4R27A 1CLVA 1ZBKA 2VTFA 1H0IA 5E6YA 2E8ZA 4NRRA 1PIFA 4YHGA 2NSXA 5KZ6A 1M7XA 1BYDA 2W63A 1OB0A 4HZ8A 3SUSA 2FH8A 3N1AA 1BGGA 1C90A 2WCGA 2YDRA 5HPCA 2BHYA 3OLDA 3AICA 2EPNA 3B9EA 2ZE0A 3DYPA 2XIBA 1JZ8A 3DHUA 3VO0A 4UQAA 3ARWA 4MAVA 4W86A 5GNYA 1BYCA 2V5CA 1JYXA 2YLLA 1PBGA 3AHZA 1E6QM 1K6AA 1ZBWA 3WDQA 4PRWA 4BS0A 1E56A 2DSWA 3ECQA 2D3LA 3TP4A 1WB0A 2CBIA 2X2YA 4W7VA 4QLJA 4NSBA 3MMUA 2V38A 3WN6A 2DDXA 1EOMA 2Y24A 3CZEA 5IDIA 3TA9A 2DH3A 2EPOA 3ALFA 1JIBA 4MADA 1JXJA 2CHNA 4UFIA 3L2LA 1HJWA 1E71M 3CHEA 4L4OA 2A3BA 2GJXB 2EO7A 3RO8A 1TFVA 1NM9A 3EMZA 5M3WA 2DEPA 1EXPA 3CH9A 3ZJ7A 2QPUA 3VIKA 5BRQA 1R8LA 1GOOA 1Q6CA 1NOUA 2JF6A 2QMKA 3FNDA 3SCUA 2RGMA 4MDOA 1CECA 3PN8A 3NJ3A 2XVLA 3WD1A 1UYQA 2PWEA 3F5JA 3BC9A 1HKIA 1E6ZA 4AD4A 3WDJA 2JIWA 3GTNA 2XVKA 1J0HA 1GW1A 2ZXQA 2J77A 1TZ7A 3VMPA 2WVTA 3ZJ6A 3PZUA 5C8BB 2WKGA 2XYLA 1KBBA 1XH1A 4LGXA 4DUVA 3D3AA 3EMQA 4PEEA 5JBFA 1B3ZA 3BSGA 4JAWA 4AD5A 1BVNP 5CLWA 4CKQA 3NDZA 4GZJA 4TXEA 1TR1A 1BLIA 3DECA 1OIMA 1CGYA 5I6SA 4BQ5A 4EK7A 5CQ1A 1GOWA 2XJ7A 3WF1A 2CETA 3L4TA 2WWDA 3VIPA 3SCVA 1JFHA 4P7QA 2D24A 2NW0A 1V3IA 4UQ9A 1X1NA 2VZUA 3W29A 5E09A 2D0FA 3WEZA 1J18A 2DSVA 2WVSA 2X0HA 2UWFA 2DSZA 2ZIDA 5CSYA 1OT1A 1BVZA 1W3KA 2D0HA 1LQ0A 1BAGA 4WKAA 2CHOA 1G1YA 2FDMA 2VRKA 3ZT7A 2BV9A 1HL9A 4U2YA 3RDKA 4ACYA 1ISZA 1VB9A 1FP8A 3OZPA 4UQDA 1HJVA 1XD0A 1B30A 1XHGA 4AC1X 4CUCA 5E0CA 1HKJA 3TTOA 1US3A 3N12A 1AQMA 3SUUA 1XSIA 3MO4A 2WHJA 4F66A 1AQ0A 2WC4A 1M01A 3ARPA 1JL8A 3UR8A 2VURA 2J78A 1G01A 1JF6A 4UQEA 1W91A 4W89A 5F7UA 4HMEA 2V3GA 2PI6A 1KXHA 4OUEA 1FOBA 1CGWA 2VI0A 3AIWA 3SCOA 2C0HA 3VINA 1JZ3A 3OBAA 2DT2A 3MV01 4DWSD 1D7FA 2WLZA 4AZHA 3GDBA 1EH9A 3EDKA 4NI3A 4J3UA 4JZ5A 1UA3A 1HJXA 4J3TA 3U7VA 4W84A 5BXPA 1KWGA 2CERA 3SUTA 5A6AA 3WDPP 2EQDA 3DC0A 3A4AA 3VIGA 3F4VA 3MU7A 3KL3A 2PB1A 1HVQA 1EHAA 2UY3A 5IHSA 4V27A 1TG7A 5LA1A 3WENA 4UNIA 2GSJA 2WMIA 2D23A 3VIMA 5FL0A 2XPKA 3L4UA 4ZENA 3WH8A 2CPUA 1UZ1A 2JIEA 1XSKA 2OSXA 3PZMA 4KGJA 3VOCA 1QI4A 3CZKA 3AHVA 3B9AA 3LPPA 3T0BA 4ZE4A 5C71A 3UR7A 1BGAA 4M81A 1XC6A 3GBDA 2E9LA 1XV8A 4AD0A 2XM1A 2VNCA 1CXFA 1MW3A 1NP2A 1IZJA 3GXIA 1W32A 2B31A 4J7RA 3WIJA 4V28A 5BYWA 1JDAA 2F8QA 4LYQA 1Q6FA 2VT0A 1O7AA 5D4YA 1UWUA 1SMDA 3KL5A 1J0ZA 2XSAA 1DTUA 1GZJA 4TX8A 2CITA 3E1F1 3ZIZA 2NT0A 5BRPA 2VOTA 3ZJKA 1QNRA 4MDPA 2WW5A 1ZJAA 2AAAA 1C93A 3BAKA 4W5ZA 4BQ2A 6TAAA 2TAAA 2VR5A 2G41A 2DT3A 1UR1A 4M1RA 4M80A 2ZX5A 1C7TA 1WNOA 3VX0A 1FH7A 3CIVA 3K8MA 4NZCA 3CUHA 1SYTA 3U5UA 4AIUA 4MB5A 3AMDA 1UR0A 3EDEA 1UD5A 2FHBA 2BFGA 3N11A 7A3HA 3VMOA 2O9RA 4AD3A 5ABHA 5CJ5A 3PZIA 2WBKA 1X6LA 5ABFB 5IFTA 1PZ3A 2F61A 1GOQA 2GUYA 1V0LA 4ZXOA 3GNPA 1UD4A 3UEQA 4UCFA 4Z2JA 3AYSA 1ODUA 1VRXA 4EAMA 4MB4A 3A6OA 2JE8A 1W1YA 2E8YA 4OOUA 3ZR6A 3AIVA 1UH2A 4W87A 1JG9A 4MB1A 1QI0A 2W91A 3NCOA 4W85A 1H11A 2OLHA 4PSPA 3WDHA 2V3DA 1U33A 1CGTA 2G3NA 3RCNA 5FD0A 5A2BA 4MNJA 1GNXA 1TCMA 1ESWA 4UZSA 4ZE5A 3AI0A 4JCMA 2YL6A 3VTRA 1C8XA 4HU8A 4D6IA 3CUFA 1BQCA 1DWHM 2ZX6A 2WK2A 1GORA 3FN9A 3SCTA 1CGXA 2XG9A 3TTSA 2XWDA 1G94A 1FFRA 2JF7A 5I77A 5M03A 1JZ5A 3MMWA 2VRQA 3QOKA 2BY3A 1Q6GA 4UFKA 1WZAA 1GJWA 1IZKA 2DH2A 1D3CA 3WUFA 2FHCA 1QOXA 3U57A 1VENA 1KGWA 4CU7A 1XRVA 2CBJA 3ARSA 2J7GA 4IM4A 4JKKA 4UFJA 4JHOA 3THDA 1ZU8A 5LA0A 3ZR5A 2RGLA 2YL9A 4UFHA 2ESCA 2BHZA 4H2CA 5BXTA 3BGAA 3VD4A 3WFZA 2XIIA 5AY7A 1GQLA 3CGTA 8A3HA 3WEMA 2J7DA 4PCTA 4UTFA 4UOQA 1ECEA 4YHEA 3VNZA 1JZ7A 4PMNA 4CCEA 1JDDA 5EFDA 1GQJA 3AROA 1W2PA 1GCYA 1PX4A 1E73M 4JCLA 4W8BA 4P8VA 1B3YA 2DIEA 4ATLA 4AZCB 2OYMA 1N82A 1CTNA 1FFQA 1K9EA 2Y8KA 1QBAA 4U3CA 5D9OA 3IJ7A 3W81A 1E55A 2CYGA 3W37A 1C92A 4WJXA 1MW1A 5C70A 2BXYA 1QI3A 3DYMA 4X0VA 1KXQA 5M17A 1JAKA 3GH5A 3APGA 1XYZA 3OGRA 2J7HA 2WVVB 3AHYA 4KGLA 1VBRA 3NDYA 3SURA 1NWRA 1W9BM 1IV8A 3PZQA 2BS9A 2BY0A 3WELA 4D6DA 2OWXA 4XZBA 2F2HA 3QGVA 3UG4A 5BROA 2EPKX 2ZX9A 3PTKA 1JXKA 2HVMA 3GM8A 3EDJA 1C3FA 5GNZA 3VIOA 1UUQA 5A6LA 4AZCA 2GJRA 1KCKA 1R86A 3K46A 3EDDA 2FGLA 4B16A 4AYSA 4HU0A 3T2OA 3WUBA 4P7LA 3GXMA 2WNWA 1H41A 1MFVA 3QHOA 2ZUMA 4UFLA 5A2AA 3BCFA 1W9DM 3UESA 3N04A 5FCZA 1QNOA 1LWHA 2J79A 4KRUA 1W1TA 2J25A 2EXOA 3W28A 1JF5A 1VBUA 3AMGA 2OSYA 1JD9A 3ZM8A 2J4GA 3DYOA 2Z1SA 1LWJA 3BCDA 3HMCA 4QAWA 5ABFA 1E4MM 3OIHA 5A8MA 3T08A 4H8HA 4QCEA 5CSUA 3VX1A 1M03A 3AS3A 1ODZA 1NOFA 1RP8A 3VM7A 3SCPA 4WKHA 1W3LA 3AMLA 4GO9A 1EDGA 4Z2HA 3VU2A 1GJUA 1VEOA 3ZJ8A 4E4PA 1J0YA 3L4XA 3EDFA 5FKYA 3GBEA 4ZFMA 3WH7A 3GH7A 3UG5A 2XGIA 3QHMA 3TTYA 3WMBA 3OLGA 4QCFA 3WNLA 1WDRA 2V3EA 3IJ8A 4PBGA 3KL0A 4HOXA 2WSPA 2QLYA 1E4IA 1CNVA 5HXMA 3MUAA 1WKYA 4B3KA 4Z2KA 1NARA 1OINA 3NIYA 4XV0A 1TUXA 4E2OA 3BLPX 3MUIA 1H0GA 1AVAA 4IISA 3UETA 5FIPA 5CGMA 2VJXA 1P6WA 1OIFA 1TMQA 4W8LA 2AOSA 1SFSA 4HP5A 2W61A 1E6PA 3GH4A 3RM8A 4LX4A 1OSEA 3AS2A 4N42A 2E4TA 3CZLA 3A47A 3NSXA 1HT6A 4JKLA 1UKQA 4GINA 4D6CA 1WPCA 3WDIA 5IFPA 4AZ5A 5EFFA 2E40A 3GXDA 4DWSB 4UQCA 2C8NA 3SCRA 5DMYA 1W1VA 2GJXA 4Q7NA 1E15A 1HF6A 1LG1A 5A6SA 2Q8XA 1E6RA 1WDQA 2ZUUA 1XCXA 3G6LA 1ZBCA 3WQ5A 4DM1A 1BG9A 5LYRA 1UD8A 3FW6A 4AEEA 1OCQA 1ITXA 2G4FA 1NP0A 3A4WA 4OKDA 1EDQA 5DO8A 4AD1A 2WC3A 1JGIA 1MYRA 2BVTA 3WQVA 3CZ8A 2BNJA 3VGEA 4B9YA 5GPRA 1E0WA 3K4AA 4BZYA 2ZWYA 3IAQA 2BVDA 4LXFA 2NT1A 6CGTA 4U5IA 3BAXA 3WSUA 3W0KA 3WNMA 4QDMA 3MUZ1 1E3XA 1WZMA 3PHAA 1KGXA 3T0DA 3FAXA 1Y7VA 4JL1A 1HKKA 4NRSA 2OSWA 2GFTA 4AZIA 2X1IA 3D5HA 3AXXA 3CUJA 4B3LA 1R7OA 3WEOA 1EOKA 1QNQA 1EGZA 5A6JA 1J9YA 4HPHA 2GVYA 1CXLA 4AZBA 2O92A 4HMDA 2Y4SA 3VDHA 4AISA 3WH9A 4KH2A 1BSIA 1EO7A 2CBVA 3W25A 5AC4A 3LPOA 1CENA 4FLOA 1WP6A 5HDRA 1V02A 3WD0A 4AXNA 3VIIA 1V6XA 1E0VA 1BFNA 4FMVA 4IUGA 3W6MA 5CPTA 2WHLA 1LJYA 1ZS2A 3KE0A 4ATWA 4AIEA 1E9LA 1WE5A 2J74A 3VDCA 1ISYA 5EBAA 2WZEA 4L4PA 2J7BA 1B9ZA 4F79A 3AIUA 1CGUA 1FHLA 4OBSA 5CZKA 2XFFA 1I75A 1ISVA 4D1IA 3AQUA 1WZKA 4B9ZA 3SIMA 4EE9A 2VCCA 3I3BA 2YKKA 3ALGA 3OA5A 2ZUWA 1L8NA 4W88A 9CGTA 1QVBA 4UOJA 3VD9A 1MQQA 2OYKA 1GVIA 1ZJBA 3CHCA 5I5RA 3OZOA 3BAJA 3AXHA 5CXPA 3N15A 2DT0A 1QPKA 3WD3A 1UKSA 2XVGA 5HPOA 1OWQA 1CIUA 4QLLA 4OZOA 2CCRA 1JI2A 2IXUA 1XSJA 4TTUA 1CEOA 1Z32X 3N17A 3WMSA 2A3CA 3WNPA 2J7EA 1E43A 1GQIA 2CXGA 2D22A 4AZGA 5HOSA 4JFVA 4M82A 1UH4A 2CESA 1AMYA 2AMGA 1KGUA 2EEXA 1GVYA 3T2PA 1V0MA 3ZT6A 5A6MA 3WQ6A 1EDTA 4JL2A 4CD5A 3AZTA 3W6LA 4GIAA 2VZVA 5E6ZA 1RPKA 3MSGA 1GONA 4PSRA 1HL8A 2HISA 2VL4A 4RE3A 4BQ4A 3SCWA 1SR0A 1E5JA 2V5DA 3EBVA 3WQ4A 3M07A 3HU7A 2J62A 3GNOA 3WDRA 1FH9A 3M7SA 4PMZA 5BCAA 1H49A 2PBOA 2MANA 3A4XA 2ZXBA 4HOWA 4GQQA 5CGTA 4EKJA 4A3YA 4PMOA 2DQXA 4QP0A 4W7WA 4CD8A 4CGTA 4PMYA 3N18A 3MSDA 1UH3A 2XUCA 4AEFA 4ACZB 3NSMA 3MMDA 1FA2A 2EJ1A 3CMJA 1KXTA 1E4LA 4OJYA 3AS1A 1E6NA 3VIJA 1H2JA 2YA1A 2WLYA 3VNYA 3T09A 1UD3A 5A1AA 3GZAA 4P8XA 1UD6A 2Z1KA 1UWQA 7CGTA 1HNYA 1QHPA 4H7VA 2ZUTA 2J8FA 4KMQA 3WF3A 2VX6A 2GDVA 1MW2A 3T2QA 2VR4A 3OGVA 1H1NA 2ZX8A 4RE4A 2VCBA 3KZSA 1UR8A 3ARYA 2PF0A 3RM4A 3SCNA 3GYCA 4GZIA 4AW7A 1E1EA 1HX0A 2EBNA 2DPEA 1JYNA 1JNEA 1HJSA 1W3HA 4C7FA 3AYRA 3WL0A 1E1FA 4MJ4A 2D0GA 3O9NA 3OLIA 4F8XA 3VM5A 4PYSA 2EPLX 1JYWA 3L4YA 1OT2A 2WMGA 4D6JA 3PZ9A 2Y2WA 1RP9A 2YIHA 2ZX7A 1MXDA 3ZOAA 4AMCA 5D9NA 2BY2A 4AD2A 5GNXA 4N0RA 1JZ4A 2E9BA 1UKPA 3W26A 4UR9A 5AYIA 1OD0A 3F5KA 1K9TA 4CN1A 3BAYA 1JYVA 3ARTA 3AMCA 5HNNA 2C7FA 1G9HA 3AXIA 4LYPA 5A6BA 3L4WA 2WMIB 4FLRA 3JUGA 4Z2GA 1UA7A 3ARZA 2O9OA 3K8KA 5A8NA 2WWCA 4R5EA 4PTMA 1B31A 1UWTA 1PJ9A 5BXRA 3SCSA 2WKLA 4U3AA 1EQPA 2IUZA 1BHGA 1PX3A 5AYBA 2WMJA 1V3LA 1MQRA 2CNCA 3GXFA 5DT7A 4CN4A 1NWUA 5IHRA 2A3EA 4AZ6A 4TVDA 3OGSA 3IAPA 1VFMA 3SCQA 1VEPA 2PC8A 1CYGA 4FLQA 1KWKA 3PTQA 1G5AA 4V2XA 2QMJA 4H8UA 4QLKA 1F4HA 2A3AA 4TVUA 2X05A 3VIFA 3WD4A 4H41A 2D2OA 2VX7A 1V3HA 1HJUA 1BPLB 1C8YA 1PEZA 5FOOA 1UWRA 4DUWA 4DM2A 1U2YA 4YN5A 1XGZA 1KBKA 1U30A 1GOMA 4LYRA 3SEPA 4CCDA 1H09A 1HN1A 2WM0A 2YL5A 4QFUA 1V08A 1TA3B 1B3WA 2D1ZA 3K1DA 1DHKA 1S46A 1EQCA 1J0IA 2FH6A 5A3HA 3VVGA 1W9VA 1R87A 5I3DA 2WC7A 4W5UA 4J3VA 4P8UA 3FHAA 2XSBA 3BSHA 5CLTA 1V6UA 1J0KA 3L4VA 3CZGA 2YL8A 3ARVA 2VVSA 2QHAA 4LQ1A 3RMEA 3ARXA 4GPNA 2G3MA 5ABGA 3UERA 2WB5A 1V6YA 3RJXA 3IJ9A 2GDUA 2QF8A 4CCCA 2OWCA 4H8VA 5A8QA 4KWUA 3WQWA 3LMYA 4XB3A 2UY2A 3WF2A 1KB3A 2VZSA 2GJPA 3RM9A 2YA0A 4HA1A 1PAMA 4IPLA 5I24A 1GUVA 4KRTA 4W8AA 4WK9A 3PZVA 1UKTA 5E0FA 4HZ7A 3PZTA 3ZO9A 3N13A 3FXYA 3L2MA 3CHDA 3HN3A 4MAZA 1UWIA 4X0NA 1PIGA 4PMUA 3TOPA 2V3FA 2XFRA 2VZOA 1W2VA 3WH5A 5CPQA 1DWGM 3PZGA 1UR4A 2PWGA 1Q4NX 3WBEA 4AIOA 1VAHA 3RPMA 3VGBA 1CDGA 1TA3A 4GI6A 2XGBA 2J47A 1Q6DA 3TTQA 3M6DA 1MWOA 4Q22A 1PPIA 3S6TA 3OB8A 4F9DA 4P7RA 4DWSC 3FAWA 1KQYA 5JBEA 3O6AA 3CPUA 1GOKA 4MPKA 2WYSA 1E6SM 2D3NA 2JEQA 1BYBA 1CWYA 4ZXLA 3CUGA 1WZLA 5E70A 4F9JA 1V6VA 1E5NA 4HMCA 1VEMA 1JI1A 2PWFA 3VGDA 3EMCA 1HP4A 1UKOA 5I0DA 4PUDA 4UOZA 1WAWA 1W9XA 3AIRA 4BA0A 3PZOA 1RH9A 3ZSTA 2CKRA 1B0IA 3WUGA 4GI8A 3CTTA 1LL6A 1JDCA 2GK1A 3VD7A 1VF8A 2JFEX 4D1JA 4WIWA 2O9PA 4BQ3A 1VFUA 5A8PA 3NSNA 2UY4A 2WZIA 3VPLA 4H04A 5A95A 1JAEA 3KWXA 1D2KA 5I79A 4D6FA 2W62A 3AZSA 4M56A 5LA2A 4M29A 1G0CA 4ATDA 1QBBA 1R7AA 3HJEA 4BCEA 1HVXA 1MW0A 4PMVA 1X6NA 4TX6A 1J01A 4CD6A 3FHQA 4S3JA 3MV11 4U5KA 3U5YA 3OLEA 3CUIA 1WO2A 4WLCA 3SUWA 3NYDA 4P7OA 4CD7A 2EPMX 4GO8A 2VX5A 2WVUA 4JFWA 1VJSA 1MXGA 2G3IA 3U7BA 1DEDA 2FHFA 1OGSA 2WSKA 3M46A 3QHNA 1E40A 2YDSA 4DUXA 2ZUVA 3CO4A 5A69A 3W24A 5IXEA 4HA4A 1UQYA 3AOFA 1UR9A 1US2A 5A2CA 1DP0A 1ZBVA 1M04A 2WMKA 4MB3A 1V0NA 4UQBA 4PN2A 4GXPA 1KQZA 2YA2A 4UFMA 1H5VA 4UZUA 3QR3A 2YOCA 3DHPA 1B1YA 1NOWA 2VCAA 4TOQA 5BXSA 1C8QA 1E3ZA 2QV4A 2VQTA 1V3KA 3VMNA 4RL3A 3G6MA 5CG0A 2Y8VA 2G3JA 5DFAA 3VILA 4D6EA 2DT1A 4C7GA 4Y7EA 1UZ4A 2CEQA 4OOZA 4W7UA 5A6BD 1V0KA 3PTMA 3WBAA 2X0YA 2DSKA 1OM0A 1TVNA 4HTYA 2ZUSA 4J3SA 1H3GA 4CU8A 5EMYA 4TVCA 2ZWZA 1QW9A 2WXDM 4D71A 1ISXA 1NWTA 4GZEA 2W92A 4YPJA 3CHFA 2VQUA 3AFBA 1DWIM 3VGHA 5D8WA 1DWFM 1ISWA 3VKKA 4B15A 3FY1A 1B90A 2BHUA 4MNMA 3BMWA 2ZXAA 3SUVA 4WF7A 4JIEA 2WCSA 1O6IA 1XD1A 4M8UA 3WQ8A 1GHRA 1HJQA 2VZTA 3WKZA 4E8DA 3J7HA 3B9DA 2W66A 1LG2A 4CVUA 3LPFA 4U31A 1V6WA 3W4RA 5DF0A 1LLOA 4FLSA 4WSKA 5A6KA 2A3HA 2G8ZA 2XTKA 2PBGA 1KFWA 2X09A 1FHDA 1KR1A 1QNSA 4MNLA 4EANA 2YLAA 2X8RA 1GHSA 3AS0A 1FH8A 1JNDA 3MS8A 3ZQ9A 1QHZA 1L0PA 3II1A 1MFUA 4AY1A 1TVPA 3F5LA 5JBDA 1AQHA 4A4AA 2YBUA 1XH0A 5I23A 1V03A 3WF0A 1XCWA 4IPNB 3PBGA 3UG3A 3WF4A 1J10A 4M24A 3RIKA 5JIWA 1H4PA 4AZ7A 4D6HA 4CU6A 1V3JA 3VIHA 2W67A 5DT5A 1OD8A 1J0JA 4CN6A 1CLXA 1KR0A 2XHYA 2XM2A 4HPGA 3IANA 4MJ2A 2OYLA 2Y5EA 3WUEA 3ARUA 1NQ6A 1CPUA 2UY5A 4LPCA 2YBTA 3W53A 8CGTA 1W9PA 3BAIA 4PMDA 4JFSA 3NUKA 2CIPA 1JFXA 5ECUA 4CD4A 3AHTA 3CBWA 1FP9A 3ZT5A 3POHA 4OIFA 1JZ2A 2J8GA 2WPGA 2XFYA 2ZXDA 1W3JA 3I3EA 3MKKA 1RD6A 1OBAA 5EB8A 1QW8A 1EA9C 4A3HA 4PMQA 1NWSA 1HXJA 2VVNA 5A94A 3L4ZA 3IK2A 2E3ZA 4JFTA 1WDSA 2XVPA 5M5DA 1QI2A 5HBFA 1XYFA 2WBGA 4D6GA 4FF5A 4WKFA 2J7FA 1UQZA 2WAGA 4PMRA 1CXKA 2BVYA 1UWSA 1R85A 2WCAA 1E70M 1E4NA 1I1XA 1CGVA 4J27A 3K8LA 4P7NA 4TTGA 3I3DA 1WCGA 1VFFA 2JALA 1OGGA 2WANA 1ZB5A 3WY1A 3WL1A 3ZSSA 1MVYA 3W38A 1W1PA 2E9MA 1DWAM 3BMVA 5D9MA 2VUYA 3CMGA 2JEPA 3VGFA 1I1WA 3VGGA 1VIWA 3EYPA 1MQPA 3GNRA 5D8ZA 2BY1A 2DSUA 5TD4A 2VRJA 2WHKA 5CPSA 1KCLA 2WZHA 3MANA 3AIBA 5I78A 4URIA 3VUPA 1WDPA 2YJQA 2IXVA 1J11A 4GKLA 6A3HA 2QPSA 4D72A 4OBRA 3WMCA 1HIZA 2W4XA 5I2UA 1BTCA 1C91A 4WSJA 4ZEPA 4PCSA 1A3HA 1M53A 4XZWA 1BF2A 2BXZA 3K4DA 4GQRA 4NF7A 4Z2IA 2DIJA 2E0PA 5ABEA 1GPFA 4U2ZA 2PWHA 1LL7A 1CXIA 4HZ6A 1PX8A 1QNPA 3BAWA 2ZOXA 1E6XM 1K9DA 3QOMA 3T0AA 5FL1A 5BWFA 1F4AA 1TE1A 3ARQA 2W5FA 3WFLA 3WH6A 3AISA 1YHTA 1K9FA 1UG6A 1J12A 1E72M 3W27A 4FK9A 3RILA 1OGBA 3BH4A 1BG4A 2ZICA
chains in the Genus database with same CATH superfamily
4FI4A 2E5CA 4ML4A 2DGAA 2O55A 1B2YA 4GYJA 1GG0A 2F9RA 3FVDA 1I8JA 1SMAA 5AHIA 3C0QA 2VMFA 1UR2A 2QUMA 2WMFA 4LRTA 3OBEA 4LF1A 3ANVA 1LF1A 1EO5A 2R1MA 2ISWA 4TU1A 1VYSX 2OWWA 4PCFA 4WZHA 3OO2A 3NPWA 4NNBA 1QO5A 2CBUA 4JKMA 2LLEA 4XO7A 3VDAA 2WVVA 1Z6KA 4Q8UA 1UP3A 4GI9A 5DXXA 3KVJA 2B81A 3ITLA 2ISDA 3AZRA 4GVHA 3SFKA 3CYVA 1O1ZA 3THUA 3BGGA 2FMNA 3TN5A 1OFDA 1RCXB 4I7WA 5TBOA 3RCMA 2I14A 4A21A 2OKOA 1RA0A 3TQPA 3VNIA 3W7OA 2NV9A 1SFLA 4R7WA 3MKCA 1BYAA 3WNOA 4DZ5A 3IJDA 1TV7A 4V1YA 1SPQA 4DYEA 3OVPA 3VD3A 5H2ZA 1OY0A 4XUYA 1X8CA 4Z2LA 1XRSA 1Q65A 1YEYA 3QY7A 5GQBA 1PZ2A 1THFD 3V4BA 1B3XA 3EGJA 4BWLA 2PTYA 2AL2B 1VFOA 3W1LA 2FZ9A 4L64A 3R6IA 1UR3M 3EAUA 3STPA 3UPMA 2C6QA 4J28A 1C7SA 3I6TA 3BW2A 3WBYA 4WX2A 3GTHA 1ZNNA 1E0TA 4HNVA 2ZC8A 1UW9A 3H7UA 1HG3A 5A8OA 1CZ1A 1LLZA 1ITCA 3DFOA 1KXVA 2XVNA 3PZNA 5CPMA 1MEIA 1ZL1A 3AHXA 5AC5A 2PUZA 2Y6ZA 1M5WA 1ZBKA 1PIFA 1VPQA 4YHGA 1V7YA 1J8VA 1OB0A 1UP0A 3V18A 4HZ8A 5K3VA 2YDRA 1A5NC 3E6EA 1ICSA 3XIMA 4LS2A 3B9EA 3GIQA 4NZ4A 5AZ0A 1ZAIA 3DYPA 1EJVC 3S1UA 4NNCA 3VO0A 4W86A 4M6PA 4NYUA 1BYCA 2VD8A 2PTWA 2SFPA 1MUCA 4GUFA 1E6QM 4J2PA 4PRWA 3SY1A 4R9XA 4ZB0A 1WB0A 2X2YA 4HNTA 5HINA 2IPJA 4NSBA 2DDXA 1K8CA 2OOGA 1JIBA 2QR6A 4UFIA 3L2LA 2QCEA 3TQKA 3UJEA 5CBIA 4NAFB 5C54A 3RO8A 3D3FA 3WZ0E 4UTMA 2FZBA 3EX1A 4DELA 3M44A 5M3WA 5M2FX 2DEPA 3CH9A 1TPFA 3VK5A 3W1TA 5FF4A 1GOOA 4L9ZA 1GJPA 1R9YA 2QZRA 4H19A 2QMKA 3MSRA 4EPEC 3XISA 4ADTA 2FTYA 1QDSA 1S2AA 3EB2A 1UYQA 4O53A 4DZHA 4OUIA 2XIOA 3TZFA 1F9CA 5AC6A 3BC9A 1HKIA 4AD4A 3GUWA 3GTNA 1AQFA 1GW1A 1KBJA 1TZ7A 3GTFA 3ZJ6A 3PULA 1RVGA 4CLMA 4QISA 3DUGA 1A5UA 1FWCC 4IGSA 5EMLA 1Q7MA 4GYPC 2I57A 1RCOB 3DIPA 3RHGA 4CNOA 4LV9A 4PUJA 4PEEA 4JEJA 1Q6OA 3H24A 4L4LA 5FSEC 4JAWA 4AD5A 4IJBA 1XDJA 5CLWA 3G1SA 4CKQA 1VIZA 3MUCA 2R9RA 2PDUA 3LBCA 2FPVA 4JEQA 1GOWA 3W7CA 4IP5A 1TTJA 2XJ7A 2PGEA 4ERGA 5AECA 3GO2A 3M64A 4KWVA 5I3FA 1TMLA 3QZAA 1JFHA 3JS3A 2D24A 1Z9AA 4UQ9A 1VFTA 3VC6A 1X1NA 2GGGA 4AWUA 4B5SA 2WVSA 2X0HA 1HKVA 5CSYA 1BVZA 5CJMA 1S2TA 3CU2A 5FJPA 1IEXA 2DW6A 3U4AA 3B04A 4LVDA 4MUPA 2BV9A 2VGBA 3DCPA 3RDKA 3W7IA 4ACYA 2WM1A 1ISZA 1GPWA 3CQKA 4JTUA 3CT2A 4Z42C 3FLUA 4AC1X 1JPDX 3TNOA 3SBFA 3PBMA 4YU1A 3ZLHA 4MOZA 1AQ0A 1M01A 4IHCA 4A05A 1S3TC 1JF6A 1W91A 3AXMA 4AY7A 4L1XA 1KXHA 4QE5A 4OUEA 1FOBA 1EJWC 1O68A 4IUOA 3SCOA 3NEHA 1IXOA 2P1FA 3VINA 1JZ3A 3GW3A 2DT2A 1W3TA 3LOTA 1AK5A 1D7FA 1ONRA 3LB0A 3TW7A 4AZHA 2Q09A 3MI2A 4J3UA 1H5YA 3UZYA 4J3TA 4LCRA 3SQSA 2XN1A 3WJZA 5AVNA 4LVBA 1NDZA 1UUMA 3SUTA 4O0KA 2B4GA 1LWIA 4O13A 1XRTA 3A4AA 4UXDA 2AKMA 4DBSA 2PE4A 3OTRA 3KL3A 3GDMA 3JR2A 1Q4WA 4V27A 4C1KA 1A0EA 1FXPA 1J2BA 2G37A 1VJIA 4ZENA 1FWJC 3R43A 3CQJA 2OSXA 4KGJA 3KBVA 3ITTA 3AHVA 3LPPA 5C0QA 1BGAA 4M81A 1XC6A 1MDLA 3JRKA 1XV8A 4AD0A 1Q6QA 1MW3A 2ZE3A 2BMBA 3GXIA 3R0UA 4DUOA 3EOOA 4L80A 1XYAA 2VT0A 4LBSA 4J1OA 3B97A 4V15A 3PUDA 2NT0A 4PGLA 4DX3A 3MC5A 1LT7A 3KRBA 2WW5A 4QX4A 1G67A 3LBMA 4LC8A 2AGKA 1UP2A 2TAAA 3RX4A 2VR5A 2G41A 3QV9A 5HWNA 4M1RA 2ZZ2A 4JQ2A 1FH7A 3CIVA 3ITCA 4I6VA 3NPVA 4MZ1A 3U5UA 4AIUA 4MB5A 2FHBA 7A3HA 3HGOA 5A8GA 2O9RA 4AD3A 5ABHA 1EC9A 4OV4A 3N3TA 1AH0A 4Y2WA 1V0LA 2DJXA 2RH9A 4UCFA 1KTCA 3L12A 3AYSA 1SW0A 1VRXA 2Q01A 3THAA 3IWPA 4EAMA 3QZEA 1PKLA 2HJPA 3G0UA 1W1YA 2HCVA 1WUEA 4O50A 1EP2A 4W85A 2QDEA 2OLHA 4PSPA 2ZZ1A 1W6TA 2V3DA 1U33A 1XQLA 1A4MA 5FD0A 3H2EA 3TSDA 5BOEA 4LS1A 1EJTC 4JCMA 3USZA 3FCPA 2AQVA 4YYCA 1KRBC 3TDFA 3Q2DA 4QNEA 4ICNA 3QR0A 3CUFA 3S5NA 3E2VA 2XG9A 5M03A 2XIMA 5DY2A 3LCFA 3TFCA 4O18A 3E0WA 4CNNA 1HGWA 3W00A 4QQ3A 3HV9A 5HQMA 2FHCA 1QOXA 2ZA2A 3U3HA 3U57A 4FNQA 4CU7A 1ADDA 2J7GA 4IM4A 4JKKA 3THDA 3P80A 1ZU8A 5LA0A 1XLKA 1FUYA 2YL9A 2ESCA 2BHZA 3BGAA 2XIIA 3PG9A 5AY7A 3BL3A 1GQNA 2FVKA 4PCTA 2QJGA 4UOQA 1JUKA 3WLIA 4AQLA 5BW6A 2OQLA 2ZRWA 4PMNA 4L6OA 1PHWA 3KRSA 1JDDA 3WX7A 4I90A 1W2PA 4W8BA 1DJIA 4L9YA 1B3YA 4AZCB 2OYMA 5CPOA 3UGVA 3W75A 2VR2A 4AY8A 1QBAA 3STCA 3G1RA 1C92A 4WJXA 1G4PA 1H1ZA 2BXYA 9XIAA 4JTKA 1HL2A 2TYSA 3W87A 3GDLA 4C5ZA 2FLIA 2WVVB 1AJ0A 3SURA 1A5SA 3T4WA 4EXAA 5H8PA 1ZSXA 4C6DA 4HSNA 2BS9A 3W71A 3WELA 1KM0A 3MMTA 5T26A 4FXRA 4DXXA 3WBXA 2EPKX 2ZX9A 3PTKA 3LYEA 3AXKA 1MNZA 4GCAA 1VPYA 3WK2A 1YXDA 2XU2A 2HVMA 4C90A 3PUOA 1EEXA 2WPBA 1VHCA 1UUQA 4IL2A 3DH7A 3SECA 2BB0A 2GJRA 1KCKA 4RDVA 5D2WA 2P76A 3QBUA 2O4QA 4KIEA 3W2NA 2VDHA 4GVIA 1B57A 3PNZA 3TCSA 3HTWA 3N73A 3W7KA 3TJXA 3TCEA 1OADA 3IVTA 3DBPA 4OBTA 3KP1A 5E93A 3GX9A 3QMSA 1LWHA 2J79A 4CQ8A 1W1TA 3LY0A 2J25A 2EXOA 5KTLA 1WOBA 1VBUA 4LV4A 2INEA 3AMGA 1FWNA 4LY8A 4GRSA 2Z1SA 3BCDA 1F5ZA 5AC8A 2RJGA 1EYWA 1LRTA 5A8MA 4AF0A 3VX1A 1Q2RA 4Q8WA 2QJMA 5C9RA 1YE4A 4NZ1A 1UMYA 1VEOA 1J0YA 1XIIA 4OT7A 5FKYA 5LNWA 3VKJA 1WYIA 3MJYA 4RX0A 3TTYA 3WMBA 4PCNA 3OLGA 2CWXA 2V3EA 3UG8A 3KL0A 3NGJA 1CNVA 5HXMA 4ZCWA 3GHSA 1M7PA 5AOUA 4ZBCA 3TEVA 1BRLA 4E2OA 5HMSA 3BLPX 2BTMA 5AYXA 2D2HA 1AVAA 1ICPA 3GXPA 1CX9A 4RNIA 3BUVA 4BHYA 2AGTA 4YNGA 2D2JA 1OSEA 3HFYA 2H8XA 3S5SA 3LUTA 1UKQA 3EXTA 2PGFA 4DO7A 1M6JA 3C2VA 1YDNA 3KZPA 4EAYA 4WHBA 4NJJA 5DMYA 1W1VA 3LLDA 1XLFA 5A6SA 2Q8XA 4I5UA 1DKWA 4AHQA 1XG3A 2NXHA 3TZNA 2V2HA 2ZUUA 2DV0A 2C0AA 3G6LA 3DFNA 2XH0A 4MYXA 4AEEA 2YSWA 1R9XA 4LUTA 1EDQA 3KOZA 2A7NA 3GTIA 1Z89A 1H7XA 2BNJA 1P0BA 4XK2A 2ALDA 3NQ6A 4U5IA 3BAXA 4G7EA 4RZBA 4QDMA 1HFBA 1U1HA 3M0YA 3T0DA 1Y7VA 4DO4A 4HNUA 5CC6A 1R30A 1HKKA 2X1IA 1SJCA 3DERA 3KHJA 2PDHA 3ZLGA 3WEOA 3NM3A 4C6LA 3R25A 5AFDA 5A6JA 4HPHA 2PDIA 3PUEA 1IIHA 4FO4A 5JMUA 4HMDA 1EO7A 1GZGA 5AC4A 3M1ZA 1JCYA 1RK5A 4YTQA 3H2FA 1WP6A 5HDRA 4AXNA 4ORMA 1V6XA 6PTDA 1BFNA 5H8MA 4XVEA 5CPTA 2WHLA 1KM1A 3S9YA 4AB4A 3PPGA 4AIEA 3PVFA 3VDCA 5EY5A 5EBAA 1K7XA 5DRCA 3AIUA 2PDMA 3W85A 1FHLA 4OBSA 4LRSA 3SSZA 3AQUA 1WZKA 3G1HA 4LVGA 3EA2A 2P0IA 1RVKA 1JVNA 3A5FA 3CT7A 4WEVX 3U48A 4KFPA 3S2JA 3VD9A 3A12A 1MQQA 4N9DA 3AU6A 4FOUA 1ZJBA 3CHCA 4QJ1A 3OZOA 3AXHA 3WK3A 3HZ3A 1JPIA 2REQA 3N15A 1AH3A 3M9YA 2XVGA 4IJCA 5HPOA 2HE5A 4QLLA 2PURA 3N3MA 3PK7A 3PWAA 1AUSL 1DOSA 1RY8A 2C13A 4GLEA 1O5XA 2Y61A 3GSMA 3SRKA 3GD6A 3PY2A 3WJWA 4PUWA 2Y88A 3WLNA 1F61A 3B0VC 1AMYA 4ZA0A 1GVYA 2OU4A 1V93A 5CC3A 1SW3A 1OG0A 4NP7A 4JTHA 1EDTA 4F2UA 3UR5A 3UNTA 2DZAA 4BI7A 1YXCA 3V75A 5E6ZA 1RPKA 3B05A 4PSRA 2HISA 4GIYA 4BQ4A 1SR0A 4NX5A 4JQAA 4A35A 3HU7A 4ZO6A 4JX4A 3GNOA 4I9AA 4AH7A 2MANA 3A4XA 4FR6A 4V33A 2ZXBA 2JKEA 4LBUA 4AYGA 1TJPA 1SJBA 1T5AA 4CGTA 3R10A 3N18A 4AEFA 1JEZA 4ACZB 3MMDA 1HGYA 1OX4A 4A22A 4OJYA 1E6NA 4BF5A 1H2JA 3T09A 4M7SA 4Q3MA 3GZAA 3R4IA 3NVDA 4GG9A 1UD6A 1UWQA 7CGTA 3Q67A 1QHPA 5C2CA 4UTHA 4FXFA 3IACA 3GUGA 1K7EA 4UCGA 3F4NA 2A4AA 2GDVA 3SB0A 2NZLA 3BG9A 1A5AA 2DVUA 3GG7A 4RE4A 3VABA 3ZVHB 3KZSA 3N2OA 3ARYA 4GKTA 4PB4A 3B06A 4NKCA 2A2IA 3HG5A 2EBNA 4G7EB 3D46A 3VNJA 3SI9A 1J6PA 4M3PA 4MJ4A 2DZBA 4WDWA 4F8XA 2E25A 3MP4A 3RU6A 1NF0A 3VM5A 2PCEA 4PYSA 3WJXA 1OT2A 1PKMA 3F2CA 3PZ9A 1RP9A 2GPTA 2ZX7A 5D9NA 4Q8TA 3JZEA 5BMWA 4AD2A 3TROA 3W73A 1WXYA 4E6MA 1K9TA 1JYVA 1IEIA 4DWDA 3LCGA 1G9HA 2OEMA 4S38A 3AXIA 4MGGA 4EF9A 3PP7A 4Z2GA 1DQWA 5A8NA 3THQA 2YGYA 1EF3A 1UWTA 2EHHA 2TSYA 2HDJA 5BXRA 3BWWA 3GIPA 1MQRA 2HTMA 3UXIA 4CN4A 3EWBX 3CWHA 1RBOB 1UZHA 1VFMA 3SCQA 3RLVA 3C8NA 4FLQA 1G5AA 8XIAA 4Z17A 1F4HA 3LZ3A 4TVUA 1JGMA 1TWSA 3GYEA 3WD4A 3TYCA 4PZVA 3BANA 1HJUA 3OU8A 4MFEA 5PTDA 3H23A 3V36A 3H53A 1HZYA 1J93A 3BQ5A 2E7FA 1XGZA 1ITQA 1U30A 4LYRA 4A2SA 5I09A 3N25A 2WM0A 1KM3A 4QFUA 1OJXA 1V08A 1V8EA 1XYBA 3P74A 1B3WA 4FNRA 5CGQA 5AC7A 3NR0A 1WDWA 3GC4A 1S46A 4LUJA 4GY7A 1FDJA 1MEHA 4EPDC 5A3HA 3VVGA 2WC7A 4ML9A 5HATA 4J3VA 4JIIX 1J0KA 5JH2A 3ARVA 4QJ5B 4LQ1A 3RO6A 4HPNA 4HPJA 2G3MA 2WB5A 4HN4A 4XTIA 3IJ9A 4RJEA 4XAGA 5JH1A 1OABA 3KVLA 1SGJA 2Y5JA 3KOWA 4ZTYA 2GJPA 4HA1A 4EXBA 2PU0A 3LGDA 3TSMA 4C91A 1OX6A 3C52A 4RNFA 3O16A 3PZVA 3L2MA 4WOQA 2PDKA 3LQGA 1UWIA 4G1KA 5DCBA 1PZ0A 2Z00A 4JYFA 5BWAA 1PIGA 3TOPA 4ZVJA 4RDYA 4QSFA 1DWGM 4IWWA 3DU0A 3W1PA 3PG8A 4AIOA 2PP3A 4X9SA 1ITUA 3RPMA 2XGBA 1MWOA 1GT8A 4HNNA 3H21A 3STGA 6ENLA 3S6TA 4F9DA 1KTNA 3CQIA 4YXGA 3MHFA 1ZPTA 4QITA 2J9ZA 3O6AA 4IX2A 4PB3A 4B5NA 2F6XA 4MPKA 2WYSA 4HNOA 2BWGA 5F4XA 4FAMA 2D3NA 1M7OA 4I9MA 4XBSA 5BRBA 1WZLA 4F9JA 3LXAA 3GDTA 4QG6A 1JI1A 3CB8A 5AYZA 1JUEA 1HP4A 1K1DA 1GVRA 1UBPC 1Q66A 1WAWA 3AIRA 2KAUC 1RH9A 2FYMA 2CKRA 3PC0A 1LOLA 3NQ7A 1B0IA 3PJXA 1V79A 1IYXA 4BQ3A 3PUGA 5K7JA 3PAJA 3GFYA 4DRSA 3AU2A 3AWOA 3VKCA 4H04A 5A95A 3KWXA 1D2KA 2W62A 4M56A 1G0CA 3KM8A 4BCEA 1CLKA 4H9MA 2OEJA 1MDRA 2Z6IA 2WNNA 3CQHA 2R8WA 3L0NA 3RPDA 4ES4A 3BARA 1XG4A 4U5KA 3CUIA 1WO2A 4P7OA 3KOYA 1EJXC 2EPMX 4GD0A 4GO8A 3O6CA 1WOAA 1YDYA 2H3DA 1RK6A 4DIAA 2WSKA 5FJUA 3Q45A 5BOFA 4BR1A 3DFSA 2NVAA 5K9DA 4KFNA 3W24A 5IXEA 4HA4A 4HHHA 4L7ZA 3GG1A 1YLVA 4YTTA 1W3NA 1US2A 5A2CA 1DP0A 4YTRA 4DB7A 2WMKA 4MB3A 4GBUA 3ATYA 1I2QA 1PKYA 2EG8A 2R6OA 5AHFA 2PSNA 5CZJA 4AVNA 3FEMA 1KQZA 1W17A 4UFMA 1H5VA 4FEZA 5HJXA 1SFTA 4WSHA 3LX9A 1B1YA 5BXSA 1V3KA 4F0SA 4HSOA 2G3JA 3WLLA 1XC4A 3SIZA 4IMFA 5DN1A 1GTEA 1UZ4A 2CEQA 4OOZA 4W7UA 2CHRA 1SM9A 3UWVA 3WK1A 1D8WA 1BWKA 2DSKA 3UZWA 2ZRXA 1K77A 4J3SA 1QO2A 3EPMA 3BQ6A 1FWWA 2ZWZA 4D71A 1VYPX 3W1XA 1LOQA 1NWTA 2YW4A 3TW6A 1I0DA 1XUUA 3U2CA 1TWWA 3HG3A 3BSMA 4IL0A 1DWFM 5D33A 3SUVA 4WF7A 5FJOA 2V5LA 4RW5A 4X61A 4XQ6A 1GVOA 3ISIX 2RDXA 4POCA 4O1BA 1HJQA 4PRTA 2QEZA 4L1GA 2ZA1A 3WLHA 2NLYA 3T4CA 3L5LA 2HS6A 3M0JA 5DMMA 4EXQA 2C3ZA 4ZO7A 3W4RA 4JTGA 1XLLA 4WSKA 5A6KA 2XTKA 1DXEA 4UTKA 1KFWA 2X09A 1FHDA 2YZ5A 2YLAA 2P0OA 1GHSA 1YNYA 2X8RA 4F0KA 3WQEA 3UFYA 2AMXA 3SJNA 1QHZA 2O4MA 1MFUA 2PA6A 1TVPA 4D2JA 3F5LA 1AQHA 4A4AA 4G7FA 1DJHA 5I23A 5IM51 4O1CA 3UG3A 1QPNA 5GVJA 3WF4A 4LNCA 4BF9A 5JIWA 3R1ZA 4D6HA 4PH6A 1EJRC 4QSHA 1J0JA 1RXOB 3DFQA 3K13A 4GUHA 3ABQA 1I45A 4HPGA 4MJ2A 2OYLA 3M0XA 3QYSA 1O60A 3W53A 3ABXA 3L0KA 3IARA 4LEQA 4PTDA 3DDMA 4JFSA 3QW3A 4GC4A 1FP9A 1RLCL 3POHA 1OFBA 5K9XA 4J2MA 4RZ6A 2J8GA 3W72A 3SRFA 3I3EA 1V6TA 3S2NA 4JIPA 3N2CA 2QGHA 3NVTA 3A5VA 4AVFA 1HXJA 3U4FA 3IK2A 4XVDA 3FV9A 1JRCA 1ZRQA 3ZS4A 2IQTA 3GHUA 1XIGA 4FF5A 1CXKA 4PMRA 1R85A 1E70M 1VKFA 2Y62A 1J2WA 3BV7A 4TTGA 2PPGA 3W7PA 1JCNA 3L7RA 1WCGA 3QY6A 1TWIA 4JTRA 3QVQA 5C9WA 4XWUA 3SW6A 3WY1A 3WL1A 3ZSSA 1ADSA 1XCFA 3I7RA 1MVYA 5MKGA 3W38A 3BJSA 2BLEA 3PFMA 3BMVA 3U2ZA 2EAWA 3TH6A 4B5TA 2JEPA 1ZP4A 4OV9A 1CCWB 2UV8G 3VGFA 1TJ0A 3H6OA 2WJDA 5D8ZA 2EKCA 5TD4A 2DZXA 4GK8A 2QPXA 5CPSA 1TJ2A 3T1GA 3PBUA 3RG6A 4XIMA 2CU0A 4RZ5A 4GKLA 6A3HA 3QMRA 3WMCA 4BWLC 4LY4A 4OE7A 4H9VA 4F2TA 4WSJA 4ZEPA 4DBWA 4JQ3A 1BF2A 1UPPA 3ZR4A 3K4DA 3WCZA 2E0PA 2PWHA 3V0TA 1PCWA 1JQVA 3CB3A 3BAWA 2ZOXA 1X39A 3RLHA 1T0OA 4DAFA 3W1NA 2ZC1A 3QY8A 1W37A 3BTNA 3LU2A 4Q8VA 1OZMA 3HPXA 3ARQA 4YWSA 2W5FA 4OHQA 3TWBA 3KLKA 4H3DA 3W74A 5G2WA 2Y0FA 1RJRA 1NDWA 4R3UA 4XD5A 2J9XA 5FEPA 1J12A 3W2JA 4FK9A 4XAPA 4ZSUA 2OR2A 1OGBA 4MLJA 1Q8JA 3LERA 2C18A 4IXHA 1TZ9A 4K3ZA 2CKSA 1FWRA 1EPVA 3BXWA 3OPSA 4AWEA 1WKDA 1TJRA 1KW1A 1LBMA 4ZB5A 2A6NA 5KITA 3QN3A 3P82A 3UJFA 1YXYA 4C1LA 4HQVA 4NAEB 3WNKA 1S38A 4Y9MA 1IR2A 3BCJA 4K68A 3FJ6A 3POCA 1MXSA 1QXLA 4BY3A 4E8CA 2W3ZA 4DWSA 1W9UA 1A47A 4PTWA 4LUSB 3TV8A 2V63A 1LL4A 3LCHA 5KEZA 2D20A 4NXSA 4N9CA 2CLOA 1Q3NA 3MHGA 3QPEA 2XH4A 4DYKA 3PF3A 1XH2A 3VZYA 4E38A 1UHVA 3ZWSA 1E0XA 3GVRA 4RE2A 1XF0A 6TIMA 3TTEA 3F4CA 5FAGA 2C91A 1FY6A 1TTIA 1CT5A 1HP5A 4PTVA 1IQ8A 5FF2A 2PWDA 4ZQMA 4TUFA 1RPXA 2D69A 3WJSA 5CPLA 1S3HA 4F48A 4JHZA 3C2OA 4CQDA 4FSAA 1G7VA 2VX4A 4B2DD 1MRQA 3ZMRA 1ZTVA 1LZOA 2QUUA 4IQEA 4QG8A 5CAHA 3TONA 4R7OA 3F7JA 2VD9A 2XZ7A 3MUY1 4GY0A 1WX0A 2JQXA 1CXEA 4BF7A 4MWAD 3UCQA 5DMLA 2V2DA 4HJFA 2VELA 4PMXA 3B8SA 4TV5A 1RSCA 3BLKA 4WY0A 4ZGYA 5KMYA 1S2VA 5FEWA 3AMKA 3GNDA 3R5EA 1EF2A 2UBPC 1CB2A 1IT0A 4QQUA 3CZJA 4FXJA 4C6NA 1R3QA 2B7PA 3G0SA 3THCA 4S3EA 2VC9A 5IBXA 1XLHA 1E0UA 3N2MA 1XYMA 4XX6A 3K4WA 1AA1B 2VO5A 4GH1A 3V1HA 2Y70A 1XXXA 5E6YA 1H0IA 2E8ZA 1ZAJA 1M3UA 3A9IA 4RNJA 2PD9A 4C6MA 1TRDA 4IIEA 1UB3A 3W23A 2FH8A 3NXFA 1BGGA 1BD0A 3EWUA 5HPCA 3OLDA 3FA3A 4HNCA 4XISA 4N6EA 2ZE0A 3LRKA 1DBTA 3WJYA 3ARWA 1XKJA 4MAVA 5JQ9A 5M1TA 1PBGA 4LYKA 2YR1A 3KLLA 2GLKA 2D3LA 2GUUA 2NVCA 4W7VA 3GRIA 1VCFA 4IT1A 3MMUA 2V38A 4DI9A 3APYA 3CAWA 1TR9A 1T99A 2EPOA 5LHEA 4MADA 2IKGA 4JTFA 3DX5A 1HJWA 1XICA 1E71M 3CHEA 4L4OA 2A3BA 5DCDA 3ZZ1A 1QK2A 1TFVA 2QDGA 1EL3A 2QT3A 3WQDA 3CV2A 3CV7A 1A3WA 4GOAA 1KCZA 1QRQA 3W7EA 2CLIA 2WQPA 3PN8A 2XVLA 3CS2A 3NURA 4KWOA 3COTA 1UMLA 5C2GA 3F5JA 1HO4A 2H9AB 3S5YA 3TN6A 2GZXA 3WDJA 3NWRA 2ZXQA 1W8GA 1SQ7A 2J77A 2NQ5A 5C8BB 3MWCA 3LTSA 1KBBA 1WAUA 1F05A 3TYZA 1XH1A 4DUVA 3EMQA 3FJNA 4C65A 5JBFA 3C5QA 1H7PA 4UMBA 2QF7A 4F0HA 1BVNP 2VHLA 4ROPA 3GVVA 3NDZA 4TXEA 3GG8A 2X42A 2Z4GA 4DXVA 3I4KA 1LRNA 2ZZ4A 4XUGA 4U4MA 5I6SA 5G2IA 2OJPA 4DJFD 3KOFA 4O1AA 4NXKA 3WF1A 4FIQA 9RUBA 4E3TA 3L4TA 3YPIA 3VIPA 3G18A 3RLGA 2YX0A 3CUZA 1V3IA 5GJNA 1NTHA 2OG9A 2VZUA 2D0FA 3O63A 2IQDA 2IKIA 3UA3A 2ASHA 2FFCA 2DSZA 3NO3A 2ZIDA 3LNMA 1W3KA 2CFFA 1LQ0A 1BAGA 3B40A 3M16A 1TWZA 3IS4A 3HMJG 2F6UA 3B4UA 3S5OA 1ZFJA 3WFAA 4ZSTA 3HG4A 3CEUA 3G1AA 4CUCA 3GLCA 3RMJA 4FR1A 3TTOA 1US3A 3CAVA 4DF1A 3BURA 2GJNA 1KFEA 1XSIA 4F66A 1I0BA 1RBAA 2WC4A 4J3ZA 3UR8A 1A3XA 2J78A 3FX4A 3S3GA 1G01A 5F7UA 2V3GA 4MWAE 2GVEA 2PI6A 2PDLA 3LV6A 4XAFA 1PCKA 4G8TA 3P5ZA 1BXCA 3MV01 4NI3A 2VEMA 4JZ5A 4IGHA 1UA3A 4IIFA 5FI8A 5BXPA 2OZ3A 3CEPA 3DC0A 1K70A 1TWDA 4DLFA 3NQMA 3VIGA 3F4VA 2GOKA 1HVQA 3G22A 3N14A 3BE7A 3EZ4A 3I68A 4IPPA 3INPA 5LA1A 3WENA 2WMIA 5FJJA 3KOXA 4H6QA 1F3EA 2G96A 1XINA 5FL0A 2XPKA 5CH9A 3VFLA 2JIEA 1UZ1A 1M7JA 1XSKA 5BZAA 3VOCA 2X7WA 1XDLA 4ZE4A 5C71A 3UR7A 1R3TA 3S5ZA 4Z1YA 3V5CA 1BWVA 1EWEA 4YCPA 3NNTA 4B5WA 1NP2A 4NX0A 2ALRA 1W32A 9XIMA 4V28A 2VUNA 1O7AA 5GJMA 5D4YA 1UWUA 1VFHA 1Z7AA 1R0MA 4TO8A 3TC3A 1RCQA 4KBXA 1I9CB 4O10A 4N7QA 2W6RA 4RXGA 4MDPA 3V0UA 1YMYA 4GJIA 2AAAA 3NAVA 4N4PA 5CBJA 3BAKA 2ZKMX 4W5ZA 1SJAA 2DT3A 4JQ1A 4B91A 2ZX5A 1C7TA 1X7FA 1YNQA 4K8EA 1DIOA 3UYIA 3K8MA 3CUHA 3EOSA 1JCJA 3AMDA 5AHEA 3EDEA 3N11A 4ZQCA 3BLOA 3S9ZA 2VFFA 3NZGA 3AO0A 5CJ5A 3PZIA 1X6LA 4C6JA 1PZ3A 2L5HA 2GUYA 4MJMA 2OO0A 3UEQA 3APTA 4Z2JA 4HT3A 1ODUA 1FTXA 4MB4A 2WSRA 3C2FA 2AQWA 3EWYA 3A6OA 2JE8A 3ZR6A 1UH2A 4W87A 2Z6JA 5MF5A 4LALA 1JG9A 4PL2A 1QI0A 2W91A 1EUNA 4ZO9A 3PAOA 1HKWA 3WDHA 1TX2A 4RNHA 3GNNA 3RR1A 3QQ1A 2G3NA 3TSBA 3ABZA 1GVSA 5A2BA 2Q6ZA 4UZSA 1OFEA 4KWWA 4ZE5A 3SR7A 3VTRA 3P81A 1YDOA 4HU8A 1DQXA 3Q4DA 3HPSA 1BQCA 1DWHM 3BLLA 3BLEA 2WK2A 2XWDA 1FFRA 3LCIA 1QUMA 3EX2A 3EPNA 5I77A 3MMWA 3BJFA 1ZAHA 2C79A 2JBMA 2VRQA 4DJFC 3UD6A 4NZFA 1NF7A 4DO6A 1QR7A 3QOKA 4ADUA 1C9WA 2BY3A 1Q6GA 4UFKA 1PIIA 3S1VA 3W84A 5LIXX 2DH2A 2QUTA 3WUFA 4GUJA 3QGKC 2G4JA 3VNKA 1VENA 3ARSA 4UFJA 3C0SA 4JHOA 4OTKA 1EX5A 3G3MA 2PDXA 4UFHA 4H2CA 5A5WA 3VKDA 3WFZA 2Q3OA 8A3HA 1B9BA 4REQA 4DI8A 4YHEA 3GDRA 3EKZA 5BNKA 4CCEA 4UTJA 3IJLA 3JVAA 3C3UA 5EFDA 1GQJA 3T40A 2GGHA 5EU9A 2WNQA 1PYMA 2ZADA 1N82A 1FFQA 3LGEA 3G1FA 3W1AA 5LNUA 1E51A 3P93A 2Y8KA 1LLWA 4QM1A 4U3CA 3UVAA 5D9OA 2E6FA 5L6UA 4F0LA 3DYMA 3WLPA 1OZQA 3TK7A 1KXQA 1JAKA 3HM7A 1T41A 1XYZA 2FVMA 1VBRA 4KS0A 4MKSA 3NQVA 4GNVA 3RX2A 1OFRA 1VD6A 3TLQA 1TPVA 3PZQA 1OX4B 4Y6GA 2X40A 2IKHA 4XBKA 2F2HA 1A4LA 1ONXA 4ZQOA 1W31A 5BROA 3N19B 3CL6A 5CC5A 1BKSA 3SN0A 3EDJA 1DYSA 3E74A 1AL7A 1Y0EA 3EDDA 2FGLA 1TMHA 2CZDA 3NQEA 3B8TA 4AYSA 2BDQA 3CASA 5A2AA 2FB2A 2PP1A 4NJGA 5T8GA 3UJRA 2RHGA 1ML1A 4R9OA 1CW2A 3NQBA 1T7LA 4GVFA 2QAFA 1JF5A 4Q6JA 5FF3A 2PTDA 1BXBA 4MIMA 2DFAA 4AX6A 1JD9A 1OYAA 3DYOA 3I10A 5T9BG 1E4MM 3T08A 4H8HA 1SO5A 3LHWA 5CSUA 3OQ8A 1DIDA 1L6SA 1M03A 1X1OA 3GC2A 2PGRA 2ZCGA 3SCPA 4WKHA 4GO9A 4Z2HA 1F2JA 1GJUA 1YKWA 4E4PA 2VDGA 3L4XA 2CC0A 4LUYA 4PUUA 3S6OA 5LSMA 3LSBA 3WH7A 4GE8A 2OGJA 2XGIA 1R38A 3QHMA 4PBGA 4HOXA 3DC8A 3T0TA 4I6KA 3G5EA 3U8GA 1BF6A 4LJ3A 1WKYA 1RQEA 3HA1A 3ABSA 2HXUA 2J6VA 4Y9AA 1TUXA 4AMAA 3NQDA 4K7YA 2P5NA 1L6GA 3UETA 2VJXA 1P6WA 5J5RA 4BKNA 1OC7A 2AOSA 1MUMA 4GQ0A 3ZXWA 2Y1HA 1IF2A 1TPC1 2CZFA 1TIMA 4OWGA 2W61A 3RM8A 3L23A 3UZXA 3CZLA 3T05A 4JKLA 4D6CA 1DV7A 4B5XA 1UBSA 5EBUA 5HWJA 1O94A 5FA5A 2E40A 4P2VA 3SCRA 1AJZA 3O06A 4Q7NA 1E15A 4DNMA 4K8GA 1F6PA 1LG1A 3DN5A 1G69A 1RQBA 4FXSA 2YB4A 1XCXA 1ZBCA 3KW3A 4QDPA 2WQDA 3DI0A 2NV1A 1OCQA 4Z1CA 3NQ2A 1NP0A 4AD1A 5DO8A 1E9YB 4HCLA 1LT8A 4XZMX 4C6IA 4GQBA 1JGIA 1MYRA 4JTCA 2BVTA 4Q8OA 3SRHA 3FIGA 4B9YA 1OK6A 1W3IA 3K4AA 4BZYA 3B8IA 1VCVA 1J5SA 3NEVA 2PDFA 2NT1A 2OB3A 6CGTA 3UWUA 3WSUA 3CXOA 3W0KA 3HOJA 2J6XA 3WNMA 1TSIA 2P50A 3MUZ1 4RDWA 4P5UA 3FAXA 1TQJA 1NVMA 4AZIA 2GFTA 4ROQA 4Q8QA 3CUJA 3ICJA 4B3LA 3G1XA 4ERIA 3O0KA 4PEKA 3NPXA 1Z44A 4JYEA 3EXRA 2I17A 4DBDA 1QNQA 3B3DA 3HQNA 1EGZA 1J9YA 4JTJA 1SR9A 1OCBA 4NZ5A 4DBUA 1CXLA 1OFOA 3BJTA 4AISA 3VDHA 3R7MA 1RBLA 2CBVA 2Y7GA 3NFUA 4O19A 3PSWA 3LPOA 2CLEA 2X41A 5J04A 1CENA 4F40A 4LC6A 5I7GA 4XAYA 4FMVA 5ENLA 2Z2AA 1KKRA 1RQHA 4JTIA 3OHMB 5KZEA 3BLFA 4JY8A 1K8XA 1B9ZA 2J66A 1XW8A 1F6KA 8XIMA 1KBLA 2YCJA 4B9ZA 2PLKA 2Z7GA 3HBLA 1N2VA 3KFTA 3KBSA 4WQ6A 3RRXA 3KS5A 3SIMA 4EE9A 3I3BA 3ALGA 3H7VA 4W88A 1QVBA 1OFAA 4MZ8A 3BAJA 4BK9A 3NZRA 2QNEA 4PULA 4DAIA 3W1UA 1QPKA 1B4EA 3LRMA 3M6YA 1EA0A 3MA8A 2CCRA 3CWOX 4QE1A 3VFCA 1JCMP 3HF3A 4H01A 1XSJA 2E09A 4MZYA 2GSHA 1Z32X 3N17A 3WNPA 2J7EA 3E0FA 3SAZA 4RV3A 2CESA 1W1IE 3BLDA 3MZ2A 4Q4SA 2WO5A 2QULA 6XIMA 2EEXA 3R13A 1KLZA 2GQ9A 4PCPA 5K4ZA 2E5BA 1Q5MA 4F0RA 4JTAA 3WQ6A 3MT1A 1KRAC 4JN8A 4JL2A 4CD5A 3AZTA 3W6LA 4UTTC 3N34A 1J6OA 2ZFAA 3QYQA 1L6FA 3RPTA 3O6YX 1TPB1 1LQ2A 4Q4RA 1NDVA 4JNMA 2Z1BA 2HVOA 3USBA 2PDBA 4LS0A 3A4JA 3CMFA 3QRHA 1A0DA 3PBYA 1PWMA 1HO1A 1FH9A 4PMZA 4KCWA 5BCAA 5EMUA 4GQQA 1MZHA 4EKJA 3W7RA 4PMOA 2DQXA 4QP0A 4W7WA 2A5HA 1JPMA 2P3EA 4CD8A 4PBFA 4PMYA 4JX6A 1UH3A 4DPPA 3NSMA 4QIUA 4WUIA 3UZJA 4GIRA 2FZ8A 1E4LA 5J5DA 3AS1A 2YA1A 4Z1AA 3SY5A 3VNYA 1UJPA 4HYWA 1IEQA 4IICA 4P8XA 3V5FA 3S4TA 1GTHA 1XQKA 3BPWA 4UNKA 4XO6A 3MJMA 3RN6A 4KMQA 1MW2A 3T2QA 2OQYA 3WLSA 3ANUA 4L56A 1H1NA 4EWJA 4ZZ9A 3KVKA 3NOYA 3SCNA 4TV6A 4TQTA 1E1EA 2IW0A 3UWQA 4B90A 4KERA 3BLIA 2DPEA 1JNEA 2QJHA 1W5NA 5EMJA 1S1PA 4ICMA 1MI3A 4C7FA 3AYRA 2D0GA 3M0MA 3O9NA 3OLIA 1VH7A 2FGBA 2WMGA 2OQHA 3D0CA 1GKPA 4LAOA 2E9BA 1UKPA 1RD5A 4UR9A 5AYIA 2V0TA 3AMCA 3KCLA 5HNNA 4LYPA 2WMIB 1J79A 3JUGA 4GFIA 4FOKA 4R5EA 4O12A 3ITOA 2YW3A 4J4KA 4UUIA 1PJ9A 4U3AA 1XLIA 1EQPA 3BZGA 4Q32A 1V3LA 2WMJA 2P53A 1MEWA 4XIAA 4WDTA 4L65A 3B0PA 1A5KC 4O4WA 3W7LA 1CYGA 1KWKA 1IGSA 4V2XA 1FQ0A 3VIFA 1YX1A 4H41A 2FJUB 2QCDB 3R8HA 1OK4A 2G50A 1OFQA 1V3HA 1PEZA 4KCUA 5EPDA 1UWRA 4DUWA 2Z1WA 2ODOA 3UWEA 4HK7A 2GL5A 4CCDA 1GOMA 4LWWA 4FX8A 5CCZA 3EOUA 3I65A 4XD3A 2YL5A 3LM7A 1QT1A 2OVLA 5XIMA 1XIJA 3C61A 1EQCA 1Z8AA 2QV5A 3QKEA 2V81A 1AW2A 2I5IA 5I3DA 4W5UA 1QPQA 2DZTA 3N2TA 3FHAA 2XSBA 3BSHA 2QAPA 4MG4A 3L4VA 4HB7A 3L21A 2DZWA 3ITVA 4CCZA 2Y89A 4GPNA 3SQLA 1F8IA 1FCUA 3H2CA 2QVHA 3KDNA 2FDSA 3VZXA 5D2VA 2P8BA 3LMYA 4LOCA 4XB3A 4GWEA 3WF2A 5G4HC 3RM9A 2YA0A 3FEQA 2JK2A 4IPLA 3O0FA 4WK9A 1FWFC 1UKTA 3T8QA 1TE6A 4HZ7A 3N13A 3FXYA 3FYPA 3BMXA 3HN3A 4X0NA 4A3QA 4Q8NA 2VZOA 4B4FA 3WH5A 3PZGA 1M68A 3MVIA 3WBEA 1POKA 1PSCA 4KEUA 3W70A 4TMCA 5D38A 4CEUC 2J47A 2VEPA 5FJRA 3CAKA 3W7MA 3ES7A 3I4EA 5F2IA 4DWSC 1F76A 1C29A 3HB9A 1KQYA 4RZ4A 1CWYA 3HGSA 4ZXLA 1MZRA 1KRMA 1E5NA 1FWAC 3W7DA 2A7RA 3CLMA 4HMCA 4BI5A 1WQ5A 1NDYA 1GWJA 1WBHA 2YCLB 3VGDA 1O66A 1UKOA 2EPHA 3SGZA 1RZMA 4UTWC 2HVNA 1KD0A 4PRRA 2Z26A 1L2UA 3CTTA 2GK1A 3RFAA 3R11A 4S1FA 2I1OA 2O9PA 2VGGA 2UY4A 4PBEA 3W88A 1R3RA 1F8MA 4C6CA 5I79A 4D6FA 4P61A 3AZSA 5LA2A 5DXYA 4O0ZA 1XBXA 3TWAA 4ATDA 2DZVA 5FESA 5I06A 1HVXA 4Q4PA 4PMVA 1YPIA 4TX6A 4ORIA 3MSYA 3HG2A 4S3JA 3MV11 3G1YA 3QKZA 2P10A 7TIMA 3LXCA 1A5CA 4WLCA 1SSDA 3NYDA 4CD7A 3DG7A 4JFWA 1TPWA 3GVWA 3EB4A 3LI1A 3ENLA 3U7BA 1DEDA 3V35A 3HGRA 4BFAA 1OGSA 2ACRA 3FOKA 4NNAA 4HK5A 4NYYA 1LQAA 1E40A 4DUXA 4R34A 2ZUVA 3L68A 3GU2A 2AAMA 4DNHA 5IDZA 3S46A 3GNXA 1G6CA 1E9IA 1Y5WA 4S39A 4XZIA 2R24A 4H6KA 3FDGA 3QPZA 4DJED 1JPHA 2O56A 1U5HA 4KT2A 1FWDC 2CZEA 3DHPA 1DJYA 2VCAA 4TOQA 1E3ZA 1L6WA 3VMNA 4RL3A 1MMFA 5D32A 3G6MA 5CG0A 5DFAA 3HFTA 3QC0A 3VILA 4D6EA 5LIWX 1L9WA 1X96A 4AC7C 5DX7A 4S3AA 3OP2A 1V0KA 3GR4A 3PTMA 1NQKA 2X0YA 4XSLA 3LQLA 4HTYA 4MFDA 4ERAA 1H3GA 3MTWA 4CU8A 4TVCA 2F2KA 1DJZA 2ON3A 1ISXA 1C8VA 4YPJA 3AFBA 5DMNA 1DWIM 2POZA 4RUBA 4IX0A 3UXLA 3VGHA 5D8WA 3VKKA 4MWAB 2BHUA 3BMWA 2ZXAA 1ZCOA 4ZO8A 1TIWA 2WCSA 2A0NA 4I3GA 4A8IA 3RYSA 3PJTA 1XD1A 1OC6A 3WQ8A 2ZVRA 5D30A 4NASA 1TV8A 4E8DA 2W66A 4CVUA 4FF7A 5A6TC 1V6WA 4YVXA 5DF0A 2PDWA 1Y65A 3R0KA 2PBGA 1A49A 2YCLA 1OCNA 1XFBA 3VCNA 1QNSA 4MNLA 4LBRA 1KFKA 2HNHA 4JTLA 2O0TA 3GB6A 1XX1A 1JNDA 4GNKB 3MS8A 1KC7A 3ZQ9A 4ENLA 4A6GA 3II1A 3E2QA 3TJIA 4CQ9A 3C4UA 3PJUA 1AL8A 2YBUA 2E5DA 3LHUA 1XCWA 3CPRA 4O8RA 1H4PA 4AZ7A 2I5QA 3QW4B 5DT5A 3TYEA 4M6QA 3JU2A 4NL1A 4DY1A 2XZ9A 1IWAA 3T81A 3ARUA 5C9ZA 1M65A 1K3UA 5HAOA 1EB3A 2Q3RA 3LI0A 1R3WA 3VOFA 8CGTA 3OW1A 4PMDA 2RDTA 1U1UA 1P0KA 3MVTA 1QMLA 5DLCA 3NUKA 5ECUA 2FTWA 3UJSA 3LV5A 3CBWA 3A9BA 1XLJA 1QW7A 2FB3A 1SVDA 2Y7DA 4Q4QA 2XFYA 5G1YA 2ZXDA 3E0LA 3CM4A 5G4EA 4DEFA 3SGUA 1OBAA 2QYGA 4LAUA 5EB8A 1FDZA 2I5GA 4A3HA 1B5TA 2VVNA 5A94A 1I4NA 1TPUA 3EWDA 3GQYA 3IPWA 2XVPA 3GXNA 1QI2A 1SZNA 3IIVA 2GOUA 2J7FA 1UWSA 5JU6A 1XKYA 1E4NA 1I1XA 4PUMA 1G7UA 1CGVA 4GUIA 3I3DA 3VDGA 2HK0A 3LTYA 4E0CA 2FZMA 4JXCA 1AZ1A 1DE5A 4J5NA 1REQA 3FXGA 1YTEA 5D9MA 5EYWA 4US5D 3QR1A 1VIWA 2QDHA 1L2QA 1US0A 2ONEA 3EYPA 4GBDA 4HHMA 4LUTB 3UCCA 3GVGA 2BSLA 5G2HA 3LN3A 5I78A 3MKVA 5H91A 4LAZA 3VAVA 1IHIA 4LVFA 5I2UA 4PCSA 5D2YA 2Q8ZA 2DIJA 5ABEA 1UIOA 4AFYA 3LDVA 2WNZA 2G97A 3L5MA 4HZ6A 1PX8A 2C1IA 2PDYA 1A80A 4EACA 3T0AA 3IGUA 5BWFA 1CB7B 4U10A 1TE1A 5RUBA 2ATSA 2OCZA 3WFLA 3WH6A 1ZJHA 3AISA 4JNZA 2ZBTA 3CYJA 1YHTA 3E12A 5LHFA 3UXKA 1PXGA 1ZCCA 4Q4OA 6XIAA 4QR6A 3IRSA 3W27A 3DFTA 3BH4A 1BG4A 4FP1A 2NUXA 2AKZA 1TB3A 2PLMA 2R1LA 4HVXA 4ZR8A 3EKLA 3G1VA 3O2LA 3TYBA 1H50A 3E02A 2ICSA 4QROA 5HUOA 2GVLA 1OFPA 1UD2A 2XWEA 4I8DA 3T9PA 3RK8A 1H7RA 3M0VA 3CAQA 3DG6A 4DJEA 4CVWA 2J24A 4EPBC 3WQCA 4GH3A 2Z27A 3KP0A 4AXKA 5FEZA 3KBJA 2DVXA 2NXIA 3W01A 2EJAA 2WHMA 1XLMA 4UTUA 3VD5A 1YYAA 3SN4A 3P0WA 1DJGA 3WNNA 3F4DA 3AIQA 3SRDA 2R1PA 2RDWA 3WD2A 1X38A 5DY3A 5KZMA 2QJNA 1GQKA 5D9PA 2OLAA 4HA3A 5KETA 1QU4A 4KEVA 5LKYA 1TTPA 1P7TB 1VBGA 4YJ5A 1YQ2A 1LTDA 3QFWA 1WBJA 1R6WA 2J27A 1HKMA 1B54A 4E4FA 2GSEA 3KDOA 3EEGA 4ASTA 2OZTA 3TUUA 4HOZA 5JIPA 4QG9A 3S2CA 1GVFA 1JD7A 3E5PA 4W93A 1EHNA 1VR6A 4JGDA 2ZUNA 4MTVA 3N9KA 1MSSA 2GQ3A 1JZ6A 2C16A 3AJ7A 3H22A 1NEYA 1QWKA 4US6A 2A85A 1B3VA 1ALDA 2Y5SA 4IGMA 3GFXA 4DO5A 5D2XA 3UA4A 7ENLA 3VDBA 4EF8A 5G4WA 2PODA 3KCJA 4S3KA 4HK6A 1V02E 2ACUA 3DESA 4R27A 1CLVA 2NSXA 5KZ6A 1M7XA 4ICCX 4G5DA 1F73A 3DXIA 3TVAA 2WCGA 2J13A 2BHYA 3AICA 2VFIA 1PDYA 3QV6A 2XIBA 4PC8A 1XBVA 3I6RA 3FS2A 3E2RA 2HK1A 3W86A 2YLLA 1JYXA 3AHZA 1K6AA 3TU9A 3S0CA 1GVEA 3OHIA 3VOGA 3HQ1A 3BICA 1DTNA 1Z69A 1E56A 4QBXA 2DSWA 4YIWA 4HBKA 3H2AA 2HRWA 3WN6A 3CZEA 5IDIA 5G1TA 3ALFA 3GR8A 3ABRA 3W3OA 2VFEA 1JXJA 1P0DA 2PDCA 7PTDA 5DBTA 2GJXB 3QSRA 4JN7A 3CPGA 1KFJA 1H60A 1EXPA 4QNWA 3ZJ7A 1KFCA 2QPUA 1NOUA 3TMQA 2RGMA 1LYXA 5HANA 3NJ3A 2D73A 2DU2A 3GKFA 5DQPA 4HYVA 3FJ4A 4Q8MA 3TN3A 4F3HA 2DUAA 3EX6A 4ZOCA 1UOZA 2JIWA 2XVKA 4GIEA 3K5XA 3VMPA 3PZUA 4IIDA 4DBEA 3NOEA 2ZTKA 3TMLA 3MWAA 3URBA 1KKOA 3QV7A 3D3AA 3PR2A 3KBWA 3BSGA 1GEQA 2XISA 4B5VA 4IQJA 4NZ3A 4YCOA 1AMKA 4GZJA 5AHNA 4RR4A 5HMDA 1TR1A 5LNSA 3DECA 4FHAA 1OIMA 1CGYA 3DGBA 3LG3A 2ZDRA 4BQ5A 4EK7A 1BXNA 5CQ1A 2A6LA 3SFWA 2IPGA 2X7VA 2CETA 3VOJA 3SCVA 4S3DA 2NW0A 5D04C 1FWHC 3W29A 5E09A 2QDDA 5EMKA 2VC7A 2UWFA 2D0HA 3AYVA 4O17A 4WKAA 5EKYA 3TYDA 2PWVA 1W1B1 4M6VA 3BOFA 1G1YA 4L4MA 2VRKA 3ZT7A 2RUSA 4HYRA 3RRAA 4L61A 2NQZA 1S5TA 1ZHAA 3OZPA 2I16A 4UQDA 1QPRA 1XHGA 4CNTA 3W76A 3LCXA 2QXWA 1AQMA 3SUUA 3WYZA 1JL8A 1ICQA 2VURA 3I7QA 4W89A 3CIWA 4HMEA 4WD0A 2V6AA 3S9IA 4GJ1A 4FNUA 4I7VA 4OECA 2B7QA 1RR2A 3WLMA 2BBFA 2C0HA 4LW7A 3OBAA 5AHLA 4DWSD 1E1CB 2FVLA 4S3FA 2DUXA 3DFPA 4GXMA 2YYUA 1HJXA 1BTMA 3U7VA 2QCGA 3M47A 5AVHA 3R79A 4M6UA 3TN4A 5XIAA 2EQDA 4Q4KA 2WJEA 1ZGDA 4AU0A 4YTSA 3MP5A 1VZWA 4FB7A 1Q7QA 5HJLA 3SGGA 4YYFA 1XPYA 3OA3A 1EHAA 1ME9A 1U5JA 4GXWA 5IHSA 3MCOA 4UNIA 2GSJA 2D23A 3MBFA 3VIMA 3L4UA 5HNUA 2CPUA 4AVOA 1DQUA 3PZMA 3BG5A 3KVMA 4K8HA 4KESA 3A24A 1QI4A 3CZKA 3B9AA 3GBDA 1TTQA 2E9LA 3LD5A 1SZEA 2XM1A 3BG3A 2VNCA 1CXFA 3QH2A 4PE8A 2QW5A 4Z1BA 2BZNA 3WIJA 4K2SA 2F7FA 2F8QA 4LYQA 3NTYA 1KTBA 4IFKA 3KL5A 1J0ZA 2XSAA 1VBJA 2OEKA 1TV2A 2CITA 3E1F1 2CW6A 2OTDA 5F1VA 4AG0A 3SZ8A 1TCDA 4I5XA 4GUGA 1OYCA 1C93A 1XRFA 4QAIA 2W9MA 4C6OA 3DKJA 1SO6A 2P8CA 3RX3A 3REQA 3TQ0A 3M0ZA 1WNOA 4AEOA 3VX0A 3OG3A 4Y96A 1Q85A 4UC5A 1UR0A 3DKLA 4ZQRA 2HBVA 3E9AA 3SJ3A 3UP8A 3LZ5A 1HUVA 2MNRA 2WBKA 1VPXA 1K7FA 5ABFB 3GNPA 1UD4A 3LS9A 3VE7A 4UR8A 2E8YA 3AIVA 4GFSA 4DJEC 5CKSA 3ATZA 1YPXA 3Q58A 1PTDA 3LM3A 2CLKA 1KM2A 2J88A 4S2CA 2QJIA 4E2VA 4GACA 3GAKA 2HNEA 1GNXA 1TCMA 1YBQB 3S1GA 3AI0A 3ZWTA 2YL6A 4REQB 1SZRA 1TPEA 4IP7A 3MY9A 4Y8FA 3EA1A 1K4HA 5T91A 3S8HA 3FN9A 4O11A 1IXNA 1G94A 4OQVA 4A3RA 5LXXA 3UZZA 1JZ5A 2WKJA 4Z1DA 3I6EA 5F4WA 4DYJA 3U0HA 3S1XA 4KW2A 4UMCA 1FBAA 1W8SA 4A8RA 3DHFA 4F2BA 2BASA 4E2BA 2ACSA 2B0MA 1GJWA 1D3CA 2RDUA 3NXLA 1KGWA 3FSTA 1XRVA 1XWYA 2YBVA 4KIRA 5H8UA 4LVAA 5BXTA 4FX7A 5FJTA 1GQLA 4B3ZA 3CGTA 2AQOA 3WEMA 2J7DA 1ECEA 4EPKA 3VNZA 4HJWA 3AROA 4L6DA 1GCYA 4JCLA 1E73M 4P8VA 3W22A 1JRBA 1N7KA 4ATLA 2Q02A 4L9XA 1CTNA 4HCHA 3CWNA 3I7SA 3DEQA 1K9EA 3IJ7A 2BGQA 1E55A 2CYGA 3QGAC 4MYAA 4HU3A 1XIEA 1QI3A 4GYKA 2XN0A 3QM3A 1H7NA 5M17A 4D9PA 4Q4MA 1A5MC 4KGLA 4S3BA 3NDYA 5CZ0A 2V69A 2QIIA 1IV8A 1IT7A 3NGFA 2EKGA 3S1WA 2BY0A 4MM1A 4J35A 2OWXA 3UU0A 4XZBA 4NHVA 3UG4A 2F38A 1JXKA 4LU0A 3W7QA 3ERPA 4HD5A 1C3FA 4DF0A 1IEWA 5LIUX 1PKNA 1R86A 3AJXA 3OYZA 1SJDA 4B16A 1W1A1 3MBDA 4HU0A 3WUBA 4P7LA 2WNWA 1H41A 1MFVA 4IMGA 3W07A 4UFLA 3N04A 3FVMA 2Y8UA 1QNOA 4KEZA 3MUXA 3G8RA 4KRUA 1DJWA 3F2DA 2PZ0A 2HROA 2VDIA 4XD4A 3ABOA 3ZM8A 3AC0A 1LWJA 3B9OA 3HMCA 1S2UA 1Q6LA 3TC7A 1JCTA 2O7QA 2YFNA 4QCEA 3C0LA 2VFGA 1XISA 3AS3A 1ODZA 3RUBL 1NOFA 2X30A 1K8ZA 2A7PA 1XIMA 3LTPA 4IFOA 4JDYA 3VU2A 4FNSA 3ZJ8A 4JX5A 1QK0A 1T6MA 2E1WA 4AF0B 3CL7A 3HGJA 3G2GA 3UG5A 1IZCA 3WNLA 1WDRA 3STFA 1TZZA 4NIRA 2WSPA 4F4RA 3N9RA 3MUAA 4M1BA 4K38A 4Z2KA 3B03A 3NIYA 4XV0A 3GHTA 1SO4A 3NL3A 4ONVA 3UZ5A 4NZJA 3A21A 3MUIA 2R1NA 3T42A 3B8WA 2VGIA 2QUVA 4Q33A 2OO6A 3F03K 1OIFA 2H9AA 3ES8A 1TMQA 4W8LA 1K6WA 5L9FA 3C0JA 1OCJA 4E8GA 1R47A 1SFSA 4HP5A 2GQAA 3GH4A 1VGAA 4LX4A 4GQGA 3O8AA 1R2TA 2E4TA 1WXJA 3NSXA 1HT6A 3HURA 2DZUA 2TRSA 4IG2B 4GINA 2ISSA 3R12A 3WDIA 1F3XA 4AZ5A 3M5XA 3GXDA 4UQCA 4ALDA 1DIKA 1OF8A 4FIRA 3ONBA 3E38A 3PB0A 1NIUA 1WDQA 2VENA 4JBRA 3WQ5A 2PC4A 4DM1A 1BG9A 5LYRA 3FW6A 1ITXA 3A4WA 4OKDA 5HJYA 3QFEA 1Y5VA 3WQVA 2OT0A 3CZ8A 2E68A 1GG1A 3VGEA 1E0WA 4WXYA 4CNSA 1BRLB 3N29A 5G5IA 4IZGA 4A2RA 4LXFA 2GDQA 3MZNA 4Q7IA 1W5MA 3AUOA 1P0EA 3VKBA 3N6JA 1WZMA 3PHAA 2C71A 3PB2A 1CI1A 1TREA 4A8LA 2X2GA 2INZA 3P61A 3U2EA 3VI2A 4NRSA 2OSWA 2R14A 1VP5A 3AXXA 1XS2A 4C6EA 2PDPA 4D8LA 1PS9A 4XAZA 1LORA 3P8IA 4O1EA 1K03A 3IUHA 1JCXA 4QJ4B 1PTAA 1NFGA 4K1GA 2O92A 3LEPA 1BSIA 3E49A 3W25A 4V1XA 1RY0A 3BVJA 1PV8A 1K8YA 4AWTA 4LANA 4QS5A 1EPXA 1NY1A 3WD0A 1V02A 4XZNX 4IUGA 3W6MA 5TIMA 1LJYA 2HV5A 1ZS2A 2VEFA 1E9LA 4HCDA 1TO3A 1YW1A 3EWZA 1WE5A 2J74A 3A13A 1A5BA 2VFDA 1N8WA 2WZEA 4L4PA 1X8FA 4FALA 3K2GA 4F79A 1CGUA 3RITA 5CZKA 4D1IA 1GOXA 3KRZA 2C19A 1H7OA 1V5XA 2VCCA 4HTBA 1L8NA 2G0WA 1D3HA 3K30A 1O5RA 5J8LA 2OYKA 5B7YA 1GVIA 2ZZ5A 3L2IA 2Y7FA 3KBMA 4LUIA 4B4HA 2DT0A 3QZ6A 3IUIA 3TW9A 4HMNA