4PNMA

Crystal structure of human tankyrase 2 in complex with nu1025.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
199
structure length
199
Chain Sequence
DKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into the binding of PARP inhibitors to the catalytic domain of human tankyrase-2.
pubmed doi rcsb
molecule keywords Tankyrase-2
molecule tags Transferase
source organism Homo sapiens
total genus 63
structure length 199
sequence length 199
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2014-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4pnmA00
3L3LA 4L70A 4BJ9A 4PNNA 4IUEA 4UW1A 4BUSA 5LYHA 2PAXA 4HLMA 4HLKA 4BUYA 5ETYA 4PNMA 3MHJA 4UI8A 1UK0A 3P0NA 2RF5A 4BU3A 4L6SA 4BS4A 4K4FA 4LI7A 4MSGA 3CE0A 4UNDA 4HYFA 4OPXC 5AL5A 4HLFA 4L10A 4XHUA 4L09A 3U9HA 4J3LA 4UVVA 3KR7A 5AL1A 4BUIA 4N3RA 3UDDA 1WOKA 4TOSA 5FPGA 4X52A 5AL4A 4F1QA 3KJDA 4GV4A 4L7RA 4UVYA 4UVOA 4BUDA 5AL3A 4N4VA 4UHGA 1PAXA 4HMHA 4HKKA 4BU5A 3C49A 5FPFA 1A26A 3KR8A 4UVPA 3P0QA 4PMLA 4OA7A 4TKIA 4PY4A 1GS0A 4L0TA 4PNQA 3L3MA 4PNLA 4K4EA 4UI6A 4HKIA 3SE2A 4BU8A 4BU6A 5LXPA 4TJYA 4UVWA 4L6ZA 4TKGA 1EFYA 4PNSA 4HKNA 5AKWA 4N4TA 4BUVA 3GOYA 5DCZA 4L32A 4L2KA 4UX4A 4BJCA 4UFYA 4KZQA 5ADTA 4W5SA 3BLJA 4HLGA 4L33A 4F1LA 4PNTA 1UK1A 4UI4A 4AVUA 4L7NA 3C4HA 3GEYA 4U6AA 4BUXA 4TJWA 4L7PA 4BUTA 4J21A 5AEHA 4BU9A 4BUUA 4L2FA 4UVXA 4L34A 4R6EA 4UVTA 4AVWA 5ADSA 4TK0A 4R5WA 4HHZA 4GV7A 5AL2A 3PAXA 4TKFA 3U9YA 3FHBA 4PNRA 4UFUA 4ZZYA 4L7UA 3UA9A 5ADQA 3GJWA 4L7LA 4UVNA 5AKUA 4I9IA 4UI3A 5C5RA 3W51A 4J3MA 4MSKA 4BUFA 4L31A 4TJUA 4BU7A 2PAWA 4J22A 4BFPA 4ZZXA 3UH4A 4KZLA 4ZZZA 4HHYA 4UVSA 4L0BA 3KCZA 4L0IA 4TORA 4W5IA 4L0SA 2X5YA 4PAXA 4F0EA 4DVIA 5A00A 3SMIA 4UVUA 4UI7A 4UVZA 3HKVA 4HLHA 4RV6A 4BUAA 4UI5A 4LI6A 4BJBA 4LI8A 5C5PA 3P0PA 4KRSA 4GV2A 5ECEA 4L7OA 3MHKA 5C5QA 2PQFA 4HL5A 4UXBA 3UH2A 4KZUA 4BUWA 4OQBC 4OQAC 4TK5A 4BUEA 4W6EA 2RD6A 4DQYC 4UUHA 2RCWA 3GN7A 4GV0A 4J1ZA 4L0VA 5LX6A 4TVJA 4UVLA 4PJTA 5ADRA 4L2GA 4PJVA 4MT9A 4M7BA 5EBTA 3SMJA
chains in the Genus database with same CATH superfamily
4WPVA 3L3LA 4L70A 1NHXA 1KHGA 4IUEA 1YLHA 4PNNA 4UW1A 2PAXA 2QF2A 4GMMA 4HLMA 4HLKA 4WOUA 4WL8A 4PNMA 5ETYA 3MHJA 4BUYA 4WIEA 4UI8A 1UK0A 4BJ9A 3P0NA 2RF5A 4BU3A 4GMZA 5FH5A 2ZCIA 4L6SA 4K4FA 4BS4A 4LI7A 4MSGA 3CE0A 4UNDA 4HYFA 4OPXC 5AL5A 5FH3A 2RKEA 4HLFA 4L10A 2RKDA 4L09A 4XHUA 3U9HA 4J3LA 4RCGA 4UVVA 3KR7A 5AL1A 4BUIA 2GMVA 4N3RA 3UDDA 1WOKA 4TOSA 5FPGA 4X52A 5FH0A 5I67A 1KHEA 2PXZX 5AL4A 4F1QA 5FH1A 3KJDA 4GV4A 4L7RA 2FAHA 4BUSA 4UVYA 4UVOA 4BUDA 4WPUA 4WPTA 4N4VA 5AL3A 4UHGA 4R43A 1PAXA 4HMHA 4HKKA 4BU5A 3C49A 5FPFA 1A26A 3KR8A 4UVPA 1YGGA 3P0QA 4PMLA 4OA7A 4TKIA 1J3BA 1GS0A 4L0TA 4PNQA 3L3MA 4PNLA 4K4EA 4PY4A 4UI6A 4HKIA 3SE2A 4BU8A 1KHFA 4BU6A 4TJYA 5LXPA 4GNLA 4UVWA 2QEYA 4L6ZA 4TKGA 1EFYA 4PNSA 4HKNA 1OENA 2PY7X 4N4TA 3GOYA 5AKWA 4L32A 4L2KA 5DCZA 4BUVA 4YW9A 4UX4A 4BJCA 1AQ2A 4UFYA 5FH4A 4KZQA 3DT7A 5ADTA 4W5SA 3BLJA 4HLGA 4L33A 4F1LA 2RK8A 4PNTA 1UK1A 2OLRA 4UI4A 1II2A 4AVUA 4L7NA 1AYLA 3C4HA 3GEYA 4U6AA 4BUXA 4TJWA 4L7PA 4YWBA 4BUTA 4J21A 5AEHA 4BU9A 4BUUA 4L2FA 4UVXA 4L34A 2QF1A 1XKVA 2QEWA 4R6EA 4UVTA 4AVWA 5ADSA 4TK0A 5FH2A 4R5WA 4GNOA 4HHZA 4GV7A 5AL2A 3PAXA 4TKFA 3U9YA 2RK7A 4GMUA 4GNQA 3FHBA 1YVYA 4PNRA 4UFUA 1OS1A 4ZZYA 4L7UA 4OX2A 3UA9A 5ADQA 3GJWA 4L7LA 4UVNA 5AKUA 4GNMA 4I9IA 4UI3A 5C5RA 3W51A 4J3MA 4MSKA 4BUFA 2PC9A 4L31A 4TJUA 1KHBA 4BU7A 2PAWA 5LYHA 4J22A 4BFPA 4ZZXA 3UH4A 4KZLA 4ZZZA 4HHYA 4UVSA 3KCZA 4L0BA 4L0IA 4TORA 1K3CA 4W5IA 4GMWA 1YTMA 4L0SA 2X5YA 4PAXA 3MOEA 4F0EA 3DT4A 4DVIA 5A00A 1K3DA 2RKAA 3DTBA 2OLQA 4UVUA 2QZYA 3SMIA 4UI7A 4GNPA 4UVZA 3HKVA 4HLHA 4RV6A 4BUAA 2FAFA 4UI5A 4LI6A 4BJBA 4LI8A 5C5PA 3P0PA 1M51A 4GV2A 4KRSA 4L7OA 3MHKA 5ECEA 2PQFA 4HL5A 4UXBA 3MOHA 4KZUA 5C5QA 3UH2A 4BUWA 4TK5A 4BUEA 4OQBC 4OQAC 3DT2A 4W6EA 2RD6A 4DQYC 4UUHA 2RCWA 3GN7A 4GV0A 4J1ZA 4L0VA 5LX6A 4YW8A 4TVJA 4UVLA 4PJTA 5ADRA 4L2GA 4PJVA 4MT9A 3MOFA 4M7BA 5EBTA 4YWDA 3SMJA 4WIUA
chains in the Genus database with same CATH topology
4WPVA 3L3LA 4L70A 1NHXA 1KHGA 4IUEA 1YLHA 4PNNA 4UW1A 2PAXA 2QF2A 4GMMA 4HLMA 4HLKA 4WOUA 4WL8A 4PNMA 5ETYA 3MHJA 4BUYA 4WIEA 4UI8A 1UK0A 4BJ9A 3P0NA 2RF5A 4BU3A 4GMZA 5FH5A 2ZCIA 4L6SA 4K4FA 4BS4A 4LI7A 4MSGA 3CE0A 4UNDA 4HYFA 4OPXC 5AL5A 5FH3A 2RKEA 4HLFA 4L10A 2RKDA 4L09A 4XHUA 3U9HA 4J3LA 4RCGA 4UVVA 3KR7A 5AL1A 4BUIA 2GMVA 4N3RA 3UDDA 1WOKA 4TOSA 5FPGA 4X52A 5FH0A 5I67A 1KHEA 2PXZX 5AL4A 4F1QA 5FH1A 3KJDA 4GV4A 4L7RA 2FAHA 4BUSA 4UVYA 4UVOA 4BUDA 4WPUA 4WPTA 4N4VA 5AL3A 4UHGA 4R43A 1PAXA 4HMHA 4HKKA 4BU5A 3C49A 5FPFA 1A26A 3KR8A 4UVPA 1YGGA 3P0QA 4PMLA 4OA7A 4TKIA 1J3BA 1GS0A 4L0TA 4PNQA 3L3MA 4PNLA 4K4EA 4PY4A 4UI6A 4HKIA 3SE2A 4BU8A 1KHFA 4BU6A 4TJYA 5LXPA 4GNLA 4UVWA 2QEYA 4L6ZA 4TKGA 1EFYA 4PNSA 4HKNA 1OENA 2PY7X 4N4TA 3GOYA 5AKWA 4L32A 4L2KA 5DCZA 4BUVA 4YW9A 4UX4A 4BJCA 1AQ2A 4UFYA 5FH4A 4KZQA 3DT7A 5ADTA 4W5SA 3BLJA 4HLGA 4L33A 4F1LA 2RK8A 4PNTA 1UK1A 2OLRA 4UI4A 1II2A 4AVUA 4L7NA 1AYLA 3C4HA 3GEYA 4U6AA 4BUXA 4TJWA 4L7PA 4YWBA 4BUTA 4J21A 5AEHA 4BU9A 4BUUA 4L2FA 4UVXA 4L34A 2QF1A 1XKVA 2QEWA 4R6EA 4UVTA 4AVWA 5ADSA 4TK0A 5FH2A 4R5WA 4GNOA 4HHZA 4GV7A 5AL2A 3PAXA 4TKFA 3U9YA 2RK7A 4GMUA 4GNQA 3FHBA 1YVYA 4PNRA 4UFUA 1OS1A 4ZZYA 4L7UA 4OX2A 3UA9A 5ADQA 3GJWA 4L7LA 4UVNA 5AKUA 4GNMA 4I9IA 4UI3A 5C5RA 3W51A 4J3MA 4MSKA 4BUFA 2PC9A 4L31A 4TJUA 1KHBA 4BU7A 2PAWA 5LYHA 4J22A 4BFPA 4ZZXA 3UH4A 4KZLA 4ZZZA 4HHYA 4UVSA 3KCZA 4L0BA 4L0IA 4TORA 1K3CA 4W5IA 4GMWA 1YTMA 4L0SA 2X5YA 4PAXA 3MOEA 4F0EA 3DT4A 4DVIA 5A00A 1K3DA 2RKAA 3DTBA 2OLQA 4UVUA 2QZYA 3SMIA 4UI7A 4GNPA 4UVZA 3HKVA 4HLHA 4RV6A 4BUAA 2FAFA 4UI5A 4LI6A 4BJBA 4LI8A 5C5PA 3P0PA 1M51A 4GV2A 4KRSA 4L7OA 3MHKA 5ECEA 2PQFA 4HL5A 4UXBA 3MOHA 4KZUA 5C5QA 3UH2A 4BUWA 4TK5A 4BUEA 4OQBC 4OQAC 3DT2A 4W6EA 2RD6A 4DQYC 4UUHA 2RCWA 3GN7A 4GV0A 4J1ZA 4L0VA 5LX6A 4YW8A 4TVJA 4UVLA 4PJTA 5ADRA 4L2GA 4PJVA 4MT9A 3MOFA 4M7BA 5EBTA 4YWDA 3SMJA 4WIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L3L A;  4L70 A;  4BJ9 A;  4PNN A;  4IUE A;  4UW1 A;  4BUS A;  5LYH A;  2PAX A;  4HLM A;  4HLK A;  4BUY A;  5ETY A;  4PNM A;  3MHJ A;  4UI8 A;  1UK0 A;  3P0N A;  2RF5 A;  4BU3 A;  4L6S A;  4BS4 A;  4K4F A;  4LI7 A;  4MSG A;  3CE0 A;  4UND A;  4HYF A;  4OPX C;  5AL5 A;  4HLF A;  4L10 A;  4XHU A;  4L09 A;  3U9H A;  4J3L A;  4UVV A;  3KR7 A;  5AL1 A;  4BUI A;  4N3R A;  3UDD A;  1WOK A;  4TOS A;  5FPG A;  4X52 A;  5AL4 A;  4F1Q A;  3KJD A;  4GV4 A;  4L7R A;  4UVY A;  4UVO A;  4BUD A;  5AL3 A;  4N4V A;  4UHG A;  1PAX A;  4HMH A;  4HKK A;  4BU5 A;  3C49 A;  5FPF A;  1A26 A;  3KR8 A;  4UVP A;  3P0Q A;  4PML A;  4OA7 A;  4TKI A;  4PY4 A;  1GS0 A;  4L0T A;  4PNQ A;  3L3M A;  4PNL A;  4K4E A;  4UI6 A;  4HKI A;  3SE2 A;  4BU8 A;  4BU6 A;  5LXP A;  4TJY A;  4UVW A;  4L6Z A;  4TKG A;  1EFY A;  4PNS A;  4HKN A;  5AKW A;  4N4T A;  4BUV A;  3GOY A;  5DCZ A;  4L32 A;  4L2K A;  4UX4 A;  4BJC A;  4UFY A;  4KZQ A;  5ADT A;  4W5S A;  3BLJ A;  4HLG A;  4L33 A;  4F1L A;  4PNT A;  1UK1 A;  4UI4 A;  4AVU A;  4L7N A;  3C4H A;  3GEY A;  4U6A A;  4BUX A;  4TJW A;  4L7P A;  4BUT A;  4J21 A;  5AEH A;  4BU9 A;  4BUU A;  4L2F A;  4UVX A;  4L34 A;  4R6E A;  4UVT A;  4AVW A;  5ADS A;  4TK0 A;  4R5W A;  4HHZ A;  4GV7 A;  5AL2 A;  3PAX A;  4TKF A;  3U9Y A;  3FHB A;  4PNR A;  4UFU A;  4ZZY A;  4L7U A;  3UA9 A;  5ADQ A;  3GJW A;  4L7L A;  4UVN A;  5AKU A;  4I9I A;  4UI3 A;  5C5R A;  3W51 A;  4J3M A;  4MSK A;  4BUF A;  4L31 A;  4TJU A;  4BU7 A;  2PAW A;  4J22 A;  4BFP A;  4ZZX A;  3UH4 A;  4KZL A;  4ZZZ A;  4HHY A;  4UVS A;  4L0B A;  3KCZ A;  4L0I A;  4TOR A;  4W5I A;  4L0S A;  2X5Y A;  4PAX A;  4F0E A;  4DVI A;  5A00 A;  3SMI A;  4UVU A;  4UI7 A;  4UVZ A;  3HKV A;  4HLH A;  4RV6 A;  4BUA A;  4UI5 A;  4LI6 A;  4BJB A;  4LI8 A;  5C5P A;  3P0P A;  4KRS A;  4GV2 A;  5ECE A;  4L7O A;  3MHK A;  5C5Q A;  2PQF A;  4HL5 A;  4UXB A;  3UH2 A;  4KZU A;  4BUW A;  4OQB C;  4OQA C;  4TK5 A;  4BUE A;  4W6E A;  2RD6 A;  4DQY C;  4UUH A;  2RCW A;  3GN7 A;  4GV0 A;  4J1Z A;  4L0V A;  5LX6 A;  4TVJ A;  4UVL A;  4PJT A;  5ADR A;  4L2G A;  4PJV A;  4MT9 A;  4M7B A;  5EBT A;  3SMJ A; 
#chains in the Genus database with same CATH topology
 4WPV A;  3L3L A;  4L70 A;  1NHX A;  1KHG A;  4IUE A;  1YLH A;  4PNN A;  4UW1 A;  2PAX A;  2QF2 A;  4GMM A;  4HLM A;  4HLK A;  4WOU A;  4WL8 A;  4PNM A;  5ETY A;  3MHJ A;  4BUY A;  4WIE A;  4UI8 A;  1UK0 A;  4BJ9 A;  3P0N A;  2RF5 A;  4BU3 A;  4GMZ A;  5FH5 A;  2ZCI A;  4L6S A;  4K4F A;  4BS4 A;  4LI7 A;  4MSG A;  3CE0 A;  4UND A;  4HYF A;  4OPX C;  5AL5 A;  5FH3 A;  2RKE A;  4HLF A;  4L10 A;  2RKD A;  4L09 A;  4XHU A;  3U9H A;  4J3L A;  4RCG A;  4UVV A;  3KR7 A;  5AL1 A;  4BUI A;  2GMV A;  4N3R A;  3UDD A;  1WOK A;  4TOS A;  5FPG A;  4X52 A;  5FH0 A;  5I67 A;  1KHE A;  2PXZ X;  5AL4 A;  4F1Q A;  5FH1 A;  3KJD A;  4GV4 A;  4L7R A;  2FAH A;  4BUS A;  4UVY A;  4UVO A;  4BUD A;  4WPU A;  4WPT A;  4N4V A;  5AL3 A;  4UHG A;  4R43 A;  1PAX A;  4HMH A;  4HKK A;  4BU5 A;  3C49 A;  5FPF A;  1A26 A;  3KR8 A;  4UVP A;  1YGG A;  3P0Q A;  4PML A;  4OA7 A;  4TKI A;  1J3B A;  1GS0 A;  4L0T A;  4PNQ A;  3L3M A;  4PNL A;  4K4E A;  4PY4 A;  4UI6 A;  4HKI A;  3SE2 A;  4BU8 A;  1KHF A;  4BU6 A;  4TJY A;  5LXP A;  4GNL A;  4UVW A;  2QEY A;  4L6Z A;  4TKG A;  1EFY A;  4PNS A;  4HKN A;  1OEN A;  2PY7 X;  4N4T A;  3GOY A;  5AKW A;  4L32 A;  4L2K A;  5DCZ A;  4BUV A;  4YW9 A;  4UX4 A;  4BJC A;  1AQ2 A;  4UFY A;  5FH4 A;  4KZQ A;  3DT7 A;  5ADT A;  4W5S A;  3BLJ A;  4HLG A;  4L33 A;  4F1L A;  2RK8 A;  4PNT A;  1UK1 A;  2OLR A;  4UI4 A;  1II2 A;  4AVU A;  4L7N A;  1AYL A;  3C4H A;  3GEY A;  4U6A A;  4BUX A;  4TJW A;  4L7P A;  4YWB A;  4BUT A;  4J21 A;  5AEH A;  4BU9 A;  4BUU A;  4L2F A;  4UVX A;  4L34 A;  2QF1 A;  1XKV A;  2QEW A;  4R6E A;  4UVT A;  4AVW A;  5ADS A;  4TK0 A;  5FH2 A;  4R5W A;  4GNO A;  4HHZ A;  4GV7 A;  5AL2 A;  3PAX A;  4TKF A;  3U9Y A;  2RK7 A;  4GMU A;  4GNQ A;  3FHB A;  1YVY A;  4PNR A;  4UFU A;  1OS1 A;  4ZZY A;  4L7U A;  4OX2 A;  3UA9 A;  5ADQ A;  3GJW A;  4L7L A;  4UVN A;  5AKU A;  4GNM A;  4I9I A;  4UI3 A;  5C5R A;  3W51 A;  4J3M A;  4MSK A;  4BUF A;  2PC9 A;  4L31 A;  4TJU A;  1KHB A;  4BU7 A;  2PAW A;  5LYH A;  4J22 A;  4BFP A;  4ZZX A;  3UH4 A;  4KZL A;  4ZZZ A;  4HHY A;  4UVS A;  3KCZ A;  4L0B A;  4L0I A;  4TOR A;  1K3C A;  4W5I A;  4GMW A;  1YTM A;  4L0S A;  2X5Y A;  4PAX A;  3MOE A;  4F0E A;  3DT4 A;  4DVI A;  5A00 A;  1K3D A;  2RKA A;  3DTB A;  2OLQ A;  4UVU A;  2QZY A;  3SMI A;  4UI7 A;  4GNP A;  4UVZ A;  3HKV A;  4HLH A;  4RV6 A;  4BUA A;  2FAF A;  4UI5 A;  4LI6 A;  4BJB A;  4LI8 A;  5C5P A;  3P0P A;  1M51 A;  4GV2 A;  4KRS A;  4L7O A;  3MHK A;  5ECE A;  2PQF A;  4HL5 A;  4UXB A;  3MOH A;  4KZU A;  5C5Q A;  3UH2 A;  4BUW A;  4TK5 A;  4BUE A;  4OQB C;  4OQA C;  3DT2 A;  4W6E A;  2RD6 A;  4DQY C;  4UUH A;  2RCW A;  3GN7 A;  4GV0 A;  4J1Z A;  4L0V A;  5LX6 A;  4YW8 A;  4TVJ A;  4UVL A;  4PJT A;  5ADR A;  4L2G A;  4PJV A;  4MT9 A;  3MOF A;  4M7B A;  5EBT A;  4YWD A;  3SMJ A;  4WIU A; 
#chains in the Genus database with same CATH homology
 4WPV A;  3L3L A;  4L70 A;  1NHX A;  1KHG A;  4IUE A;  1YLH A;  4PNN A;  4UW1 A;  2PAX A;  2QF2 A;  4GMM A;  4HLM A;  4HLK A;  4WOU A;  4WL8 A;  4PNM A;  5ETY A;  3MHJ A;  4BUY A;  4WIE A;  4UI8 A;  1UK0 A;  4BJ9 A;  3P0N A;  2RF5 A;  4BU3 A;  4GMZ A;  5FH5 A;  2ZCI A;  4L6S A;  4K4F A;  4BS4 A;  4LI7 A;  4MSG A;  3CE0 A;  4UND A;  4HYF A;  4OPX C;  5AL5 A;  5FH3 A;  2RKE A;  4HLF A;  4L10 A;  2RKD A;  4L09 A;  4XHU A;  3U9H A;  4J3L A;  4RCG A;  4UVV A;  3KR7 A;  5AL1 A;  4BUI A;  2GMV A;  4N3R A;  3UDD A;  1WOK A;  4TOS A;  5FPG A;  4X52 A;  5FH0 A;  5I67 A;  1KHE A;  2PXZ X;  5AL4 A;  4F1Q A;  5FH1 A;  3KJD A;  4GV4 A;  4L7R A;  2FAH A;  4BUS A;  4UVY A;  4UVO A;  4BUD A;  4WPU A;  4WPT A;  4N4V A;  5AL3 A;  4UHG A;  4R43 A;  1PAX A;  4HMH A;  4HKK A;  4BU5 A;  3C49 A;  5FPF A;  1A26 A;  3KR8 A;  4UVP A;  1YGG A;  3P0Q A;  4PML A;  4OA7 A;  4TKI A;  1J3B A;  1GS0 A;  4L0T A;  4PNQ A;  3L3M A;  4PNL A;  4K4E A;  4PY4 A;  4UI6 A;  4HKI A;  3SE2 A;  4BU8 A;  1KHF A;  4BU6 A;  4TJY A;  5LXP A;  4GNL A;  4UVW A;  2QEY A;  4L6Z A;  4TKG A;  1EFY A;  4PNS A;  4HKN A;  1OEN A;  2PY7 X;  4N4T A;  3GOY A;  5AKW A;  4L32 A;  4L2K A;  5DCZ A;  4BUV A;  4YW9 A;  4UX4 A;  4BJC A;  1AQ2 A;  4UFY A;  5FH4 A;  4KZQ A;  3DT7 A;  5ADT A;  4W5S A;  3BLJ A;  4HLG A;  4L33 A;  4F1L A;  2RK8 A;  4PNT A;  1UK1 A;  2OLR A;  4UI4 A;  1II2 A;  4AVU A;  4L7N A;  1AYL A;  3C4H A;  3GEY A;  4U6A A;  4BUX A;  4TJW A;  4L7P A;  4YWB A;  4BUT A;  4J21 A;  5AEH A;  4BU9 A;  4BUU A;  4L2F A;  4UVX A;  4L34 A;  2QF1 A;  1XKV A;  2QEW A;  4R6E A;  4UVT A;  4AVW A;  5ADS A;  4TK0 A;  5FH2 A;  4R5W A;  4GNO A;  4HHZ A;  4GV7 A;  5AL2 A;  3PAX A;  4TKF A;  3U9Y A;  2RK7 A;  4GMU A;  4GNQ A;  3FHB A;  1YVY A;  4PNR A;  4UFU A;  1OS1 A;  4ZZY A;  4L7U A;  4OX2 A;  3UA9 A;  5ADQ A;  3GJW A;  4L7L A;  4UVN A;  5AKU A;  4GNM A;  4I9I A;  4UI3 A;  5C5R A;  3W51 A;  4J3M A;  4MSK A;  4BUF A;  2PC9 A;  4L31 A;  4TJU A;  1KHB A;  4BU7 A;  2PAW A;  5LYH A;  4J22 A;  4BFP A;  4ZZX A;  3UH4 A;  4KZL A;  4ZZZ A;  4HHY A;  4UVS A;  3KCZ A;  4L0B A;  4L0I A;  4TOR A;  1K3C A;  4W5I A;  4GMW A;  1YTM A;  4L0S A;  2X5Y A;  4PAX A;  3MOE A;  4F0E A;  3DT4 A;  4DVI A;  5A00 A;  1K3D A;  2RKA A;  3DTB A;  2OLQ A;  4UVU A;  2QZY A;  3SMI A;  4UI7 A;  4GNP A;  4UVZ A;  3HKV A;  4HLH A;  4RV6 A;  4BUA A;  2FAF A;  4UI5 A;  4LI6 A;  4BJB A;  4LI8 A;  5C5P A;  3P0P A;  1M51 A;  4GV2 A;  4KRS A;  4L7O A;  3MHK A;  5ECE A;  2PQF A;  4HL5 A;  4UXB A;  3MOH A;  4KZU A;  5C5Q A;  3UH2 A;  4BUW A;  4TK5 A;  4BUE A;  4OQB C;  4OQA C;  3DT2 A;  4W6E A;  2RD6 A;  4DQY C;  4UUH A;  2RCW A;  3GN7 A;  4GV0 A;  4J1Z A;  4L0V A;  5LX6 A;  4YW8 A;  4TVJ A;  4UVL A;  4PJT A;  5ADR A;  4L2G A;  4PJV A;  4MT9 A;  3MOF A;  4M7B A;  5EBT A;  4YWD A;  3SMJ A;  4WIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...