4PNQA

Crystal structure of human tankyrase 2 in complex with 5aiq.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
202
structure length
202
Chain Sequence
PDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into the binding of PARP inhibitors to the catalytic domain of human tankyrase-2.
pubmed doi rcsb
molecule keywords Tankyrase-2
molecule tags Transferase
source organism Homo sapiens
total genus 65
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2014-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4pnqA00
4TVJA 4TK5A 4BUYA 4GV0A 4L0VA 1EFYA 4L7NA 4TKGA 4F0EA 4OQBC 4LI7A 4L10A 2PAWA 5FPFA 3HKVA 4UVZA 3KJDA 4OPXC 4PNQA 4L7LA 4M7BA 4L7UA 4R6EA 2RCWA 5AEHA 4OA7A 4R5WA 4UI3A 4MSGA 3UDDA 4TJUA 4MT9A 5ECEA 1GS0A 1WOKA 4W5SA 4BU3A 4BJCA 4UI8A 4UVTA 4UVWA 4UI6A 4HLHA 4KRSA 4L6ZA 5DCZA 4UX4A 4HYFA 4KZLA 4PY4A 3C4HA 4PNLA 4TKFA 3PAXA 4KZQA 4L70A 3KCZA 4BUEA 4HKNA 4BUVA 4PNNA 4BFPA 4BUSA 5AL4A 4L34A 5LX6A 4DVIA 4UVYA 3MHJA 4L0IA 4L0BA 4ZZYA 4BUUA 1A26A 4J3LA 4TKIA 4UFUA 5C5PA 4L2FA 4J1ZA 4UFYA 5AL3A 4BJ9A 2PAXA 4HL5A 4RV6A 4L7RA 3C49A 4BUDA 4J22A 5ETYA 4UXBA 5ADRA 5LYHA 4UW1A 4L0TA 4L7PA 4HLGA 4HMHA 4HKIA 1UK1A 4BUTA 4ZZZA 5FPGA 4N4VA 4L7OA 4BUAA 3KR8A 4XHUA 4J3MA 4AVWA 3UH4A 3FHBA 4K4FA 4HHYA 5AL1A 4W6EA 4UVNA 4HLFA 4UVVA 4BUFA 2PQFA 4L32A 3L3LA 4N4TA 5C5RA 4UVUA 4F1QA 3GJWA 5LXPA 4IUEA 4L09A 4PAXA 4BU9A 4UVPA 4UVSA 3SMIA 4DQYC 3P0QA 4PNTA 3UA9A 3P0PA 4OQAC 4PNRA 3U9HA 3SE2A 4TJWA 4BUXA 4HLMA 4GV7A 2RD6A 4HKKA 3UH2A 3GEYA 4TJYA 4UVXA 3GN7A 5A00A 5ADSA 4UVOA 5ADTA 1PAXA 3CE0A 4UHGA 4ZZXA 4L31A 4PJTA 4U6AA 3BLJA 4BJBA 4X52A 3KR7A 4K4EA 4MSKA 4I9IA 4BU7A 4KZUA 4HLKA 3L3MA 4BU5A 4L0SA 5AL5A 4PNMA 4HHZA 4LI6A 4PMLA 4N3RA 4W5IA 5EBTA 3SMJA 2X5YA 3U9YA 3MHKA 5ADQA 4UVLA 5AKWA 3GOYA 4BS4A 3W51A 4L2GA 4BU8A 4L33A 4PNSA 4TORA 5AL2A 4UI7A 4AVUA 4BUWA 4TK0A 4BU6A 4UI5A 5C5QA 4BUIA 4UNDA 4F1LA 2RF5A 4GV4A 4PJVA 5AKUA 1UK0A 3P0NA 4L2KA 4L6SA 4UUHA 4J21A 4GV2A 4UI4A 4TOSA 4LI8A
chains in the Genus database with same CATH superfamily
4TVJA 4TK5A 4BUYA 4GV0A 4L0VA 1EFYA 2OLQA 4L7NA 4TKGA 5FH1A 4F0EA 4OQBC 4LI7A 4GNPA 2PAWA 4L10A 4WIEA 5FPFA 3HKVA 4UVZA 3KJDA 4OPXC 4PNQA 4L7LA 4M7BA 4WPUA 5FH2A 4L7UA 1KHFA 3MOFA 4R6EA 2RCWA 5AEHA 2GMVA 5FH3A 4WL8A 4OA7A 1OS1A 1YLHA 2QZYA 4R5WA 4UI3A 4MSGA 3UDDA 2RKAA 4TJUA 4MT9A 5ECEA 3MOEA 1GS0A 1II2A 1WOKA 2QEYA 4W5SA 4GNQA 4BU3A 4BJCA 4UI8A 4UVTA 4UVWA 3DT4A 4UI6A 5FH5A 2OLRA 4HLHA 2PXZX 4WOUA 4KRSA 4L6ZA 5DCZA 4UX4A 4HYFA 4KZLA 4PY4A 3C4HA 4PNLA 4TKFA 3PAXA 4KZQA 4L70A 3KCZA 1M51A 4HKNA 4BUVA 2RKDA 4PNNA 4BFPA 5AL4A 4L34A 4BUSA 5LX6A 4DVIA 1AYLA 4UVYA 3MHJA 4L0IA 4GMUA 5FH0A 4L0BA 4ZZYA 4BUUA 1AQ2A 4OX2A 1A26A 3DT2A 4J3LA 4TKIA 1KHGA 4UFUA 4L2FA 4J1ZA 4UFYA 5C5PA 5AL3A 2FAHA 4BJ9A 2PAXA 4HL5A 4RV6A 4L7RA 3C49A 4BUDA 4J22A 2RK8A 4UXBA 5ETYA 5ADRA 5LYHA 2QF1A 4UW1A 4L0TA 2QEWA 4L7PA 4HLGA 5I67A 4HMHA 4HKIA 1UK1A 4BUTA 4ZZZA 5FPGA 4N4VA 1K3DA 4L7OA 4BUAA 3KR8A 4XHUA 4J3MA 4AVWA 2PC9A 3UH4A 3FHBA 4K4FA 4HHYA 3DT7A 5AL1A 1NHXA 4W6EA 4UVNA 4HLFA 4UVVA 4BUFA 2PQFA 4L32A 3L3LA 4N4TA 5C5RA 4UVUA 4F1QA 3GJWA 5LXPA 2RKEA 4IUEA 4R43A 4L09A 4PAXA 4BU9A 4YW8A 4GNOA 2RK7A 4UVPA 4UVSA 3SMIA 4DQYC 3P0QA 4PNTA 1OENA 4GMMA 3UA9A 3P0PA 4OQAC 4PNRA 3U9HA 4WPVA 3SE2A 1YVYA 4TJWA 4BUXA 4HLMA 4GNLA 4GV7A 2RD6A 1YGGA 4HKKA 3GEYA 4TJYA 4UVXA 3GN7A 5A00A 3UH2A 5ADSA 4UVOA 5ADTA 1PAXA 4GMZA 3CE0A 4UHGA 4ZZXA 4L31A 4WIUA 2PY7X 3MOHA 4PJTA 4U6AA 4YWDA 3BLJA 4BJBA 4X52A 2QF2A 4GMWA 3KR7A 4GNMA 4K4EA 4MSKA 4I9IA 1XKVA 4YWBA 4BU7A 2FAFA 4HLKA 3L3MA 4KZUA 4L0SA 4BU5A 5AL5A 4PNMA 4HHZA 4LI6A 4PMLA 4N3RA 4W5IA 5EBTA 3SMJA 2X5YA 3U9YA 3MHKA 5ADQA 4UVLA 2ZCIA 5AKWA 3GOYA 4BS4A 1KHEA 3W51A 4L2GA 1KHBA 4BU8A 4L33A 4PNSA 4TORA 5AL2A 4UI7A 4AVUA 4BUWA 4TK0A 1J3BA 4BU6A 4UI5A 5C5QA 4BUIA 1YTMA 4UNDA 4F1LA 4WPTA 4BUEA 2RF5A 4GV4A 4PJVA 5AKUA 1UK0A 4YW9A 5FH4A 3P0NA 4L2KA 4L6SA 4UUHA 4J21A 4GV2A 4UI4A 4TOSA 3DTBA 1K3CA 4LI8A 4RCGA
chains in the Genus database with same CATH topology
4TVJA 4TK5A 4BUYA 4GV0A 4L0VA 1EFYA 2OLQA 4L7NA 4TKGA 5FH1A 4F0EA 4OQBC 4LI7A 4GNPA 2PAWA 4L10A 4WIEA 5FPFA 3HKVA 4UVZA 3KJDA 4OPXC 4PNQA 4L7LA 4M7BA 4WPUA 5FH2A 4L7UA 1KHFA 3MOFA 4R6EA 2RCWA 5AEHA 2GMVA 5FH3A 4WL8A 4OA7A 1OS1A 1YLHA 2QZYA 4R5WA 4UI3A 4MSGA 3UDDA 2RKAA 4TJUA 4MT9A 5ECEA 3MOEA 1GS0A 1II2A 1WOKA 2QEYA 4W5SA 4GNQA 4BU3A 4BJCA 4UI8A 4UVTA 4UVWA 3DT4A 4UI6A 5FH5A 2OLRA 4HLHA 2PXZX 4WOUA 4KRSA 4L6ZA 5DCZA 4UX4A 4HYFA 4KZLA 4PY4A 3C4HA 4PNLA 4TKFA 3PAXA 4KZQA 4L70A 3KCZA 1M51A 4HKNA 4BUVA 2RKDA 4PNNA 4BFPA 5AL4A 4L34A 4BUSA 5LX6A 4DVIA 1AYLA 4UVYA 3MHJA 4L0IA 4GMUA 5FH0A 4L0BA 4ZZYA 4BUUA 1AQ2A 4OX2A 1A26A 3DT2A 4J3LA 4TKIA 1KHGA 4UFUA 4L2FA 4J1ZA 4UFYA 5C5PA 5AL3A 2FAHA 4BJ9A 2PAXA 4HL5A 4RV6A 4L7RA 3C49A 4BUDA 4J22A 2RK8A 4UXBA 5ETYA 5ADRA 5LYHA 2QF1A 4UW1A 4L0TA 2QEWA 4L7PA 4HLGA 5I67A 4HMHA 4HKIA 1UK1A 4BUTA 4ZZZA 5FPGA 4N4VA 1K3DA 4L7OA 4BUAA 3KR8A 4XHUA 4J3MA 4AVWA 2PC9A 3UH4A 3FHBA 4K4FA 4HHYA 3DT7A 5AL1A 1NHXA 4W6EA 4UVNA 4HLFA 4UVVA 4BUFA 2PQFA 4L32A 3L3LA 4N4TA 5C5RA 4UVUA 4F1QA 3GJWA 5LXPA 2RKEA 4IUEA 4R43A 4L09A 4PAXA 4BU9A 4YW8A 4GNOA 2RK7A 4UVPA 4UVSA 3SMIA 4DQYC 3P0QA 4PNTA 1OENA 4GMMA 3UA9A 3P0PA 4OQAC 4PNRA 3U9HA 4WPVA 3SE2A 1YVYA 4TJWA 4BUXA 4HLMA 4GNLA 4GV7A 2RD6A 1YGGA 4HKKA 3GEYA 4TJYA 4UVXA 3GN7A 5A00A 3UH2A 5ADSA 4UVOA 5ADTA 1PAXA 4GMZA 3CE0A 4UHGA 4ZZXA 4L31A 4WIUA 2PY7X 3MOHA 4PJTA 4U6AA 4YWDA 3BLJA 4BJBA 4X52A 2QF2A 4GMWA 3KR7A 4GNMA 4K4EA 4MSKA 4I9IA 1XKVA 4YWBA 4BU7A 2FAFA 4HLKA 3L3MA 4KZUA 4L0SA 4BU5A 5AL5A 4PNMA 4HHZA 4LI6A 4PMLA 4N3RA 4W5IA 5EBTA 3SMJA 2X5YA 3U9YA 3MHKA 5ADQA 4UVLA 2ZCIA 5AKWA 3GOYA 4BS4A 1KHEA 3W51A 4L2GA 1KHBA 4BU8A 4L33A 4PNSA 4TORA 5AL2A 4UI7A 4AVUA 4BUWA 4TK0A 1J3BA 4BU6A 4UI5A 5C5QA 4BUIA 1YTMA 4UNDA 4F1LA 4WPTA 4BUEA 2RF5A 4GV4A 4PJVA 5AKUA 1UK0A 4YW9A 5FH4A 3P0NA 4L2KA 4L6SA 4UUHA 4J21A 4GV2A 4UI4A 4TOSA 3DTBA 1K3CA 4LI8A 4RCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TVJ A;  4TK5 A;  4BUY A;  4GV0 A;  4L0V A;  1EFY A;  4L7N A;  4TKG A;  4F0E A;  4OQB C;  4LI7 A;  4L10 A;  2PAW A;  5FPF A;  3HKV A;  4UVZ A;  3KJD A;  4OPX C;  4PNQ A;  4L7L A;  4M7B A;  4L7U A;  4R6E A;  2RCW A;  5AEH A;  4OA7 A;  4R5W A;  4UI3 A;  4MSG A;  3UDD A;  4TJU A;  4MT9 A;  5ECE A;  1GS0 A;  1WOK A;  4W5S A;  4BU3 A;  4BJC A;  4UI8 A;  4UVT A;  4UVW A;  4UI6 A;  4HLH A;  4KRS A;  4L6Z A;  5DCZ A;  4UX4 A;  4HYF A;  4KZL A;  4PY4 A;  3C4H A;  4PNL A;  4TKF A;  3PAX A;  4KZQ A;  4L70 A;  3KCZ A;  4BUE A;  4HKN A;  4BUV A;  4PNN A;  4BFP A;  4BUS A;  5AL4 A;  4L34 A;  5LX6 A;  4DVI A;  4UVY A;  3MHJ A;  4L0I A;  4L0B A;  4ZZY A;  4BUU A;  1A26 A;  4J3L A;  4TKI A;  4UFU A;  5C5P A;  4L2F A;  4J1Z A;  4UFY A;  5AL3 A;  4BJ9 A;  2PAX A;  4HL5 A;  4RV6 A;  4L7R A;  3C49 A;  4BUD A;  4J22 A;  5ETY A;  4UXB A;  5ADR A;  5LYH A;  4UW1 A;  4L0T A;  4L7P A;  4HLG A;  4HMH A;  4HKI A;  1UK1 A;  4BUT A;  4ZZZ A;  5FPG A;  4N4V A;  4L7O A;  4BUA A;  3KR8 A;  4XHU A;  4J3M A;  4AVW A;  3UH4 A;  3FHB A;  4K4F A;  4HHY A;  5AL1 A;  4W6E A;  4UVN A;  4HLF A;  4UVV A;  4BUF A;  2PQF A;  4L32 A;  3L3L A;  4N4T A;  5C5R A;  4UVU A;  4F1Q A;  3GJW A;  5LXP A;  4IUE A;  4L09 A;  4PAX A;  4BU9 A;  4UVP A;  4UVS A;  3SMI A;  4DQY C;  3P0Q A;  4PNT A;  3UA9 A;  3P0P A;  4OQA C;  4PNR A;  3U9H A;  3SE2 A;  4TJW A;  4BUX A;  4HLM A;  4GV7 A;  2RD6 A;  4HKK A;  3UH2 A;  3GEY A;  4TJY A;  4UVX A;  3GN7 A;  5A00 A;  5ADS A;  4UVO A;  5ADT A;  1PAX A;  3CE0 A;  4UHG A;  4ZZX A;  4L31 A;  4PJT A;  4U6A A;  3BLJ A;  4BJB A;  4X52 A;  3KR7 A;  4K4E A;  4MSK A;  4I9I A;  4BU7 A;  4KZU A;  4HLK A;  3L3M A;  4BU5 A;  4L0S A;  5AL5 A;  4PNM A;  4HHZ A;  4LI6 A;  4PML A;  4N3R A;  4W5I A;  5EBT A;  3SMJ A;  2X5Y A;  3U9Y A;  3MHK A;  5ADQ A;  4UVL A;  5AKW A;  3GOY A;  4BS4 A;  3W51 A;  4L2G A;  4BU8 A;  4L33 A;  4PNS A;  4TOR A;  5AL2 A;  4UI7 A;  4AVU A;  4BUW A;  4TK0 A;  4BU6 A;  4UI5 A;  5C5Q A;  4BUI A;  4UND A;  4F1L A;  2RF5 A;  4GV4 A;  4PJV A;  5AKU A;  1UK0 A;  3P0N A;  4L2K A;  4L6S A;  4UUH A;  4J21 A;  4GV2 A;  4UI4 A;  4TOS A;  4LI8 A; 
#chains in the Genus database with same CATH topology
 4TVJ A;  4TK5 A;  4BUY A;  4GV0 A;  4L0V A;  1EFY A;  2OLQ A;  4L7N A;  4TKG A;  5FH1 A;  4F0E A;  4OQB C;  4LI7 A;  4GNP A;  2PAW A;  4L10 A;  4WIE A;  5FPF A;  3HKV A;  4UVZ A;  3KJD A;  4OPX C;  4PNQ A;  4L7L A;  4M7B A;  4WPU A;  5FH2 A;  4L7U A;  1KHF A;  3MOF A;  4R6E A;  2RCW A;  5AEH A;  2GMV A;  5FH3 A;  4WL8 A;  4OA7 A;  1OS1 A;  1YLH A;  2QZY A;  4R5W A;  4UI3 A;  4MSG A;  3UDD A;  2RKA A;  4TJU A;  4MT9 A;  5ECE A;  3MOE A;  1GS0 A;  1II2 A;  1WOK A;  2QEY A;  4W5S A;  4GNQ A;  4BU3 A;  4BJC A;  4UI8 A;  4UVT A;  4UVW A;  3DT4 A;  4UI6 A;  5FH5 A;  2OLR A;  4HLH A;  2PXZ X;  4WOU A;  4KRS A;  4L6Z A;  5DCZ A;  4UX4 A;  4HYF A;  4KZL A;  4PY4 A;  3C4H A;  4PNL A;  4TKF A;  3PAX A;  4KZQ A;  4L70 A;  3KCZ A;  1M51 A;  4HKN A;  4BUV A;  2RKD A;  4PNN A;  4BFP A;  5AL4 A;  4L34 A;  4BUS A;  5LX6 A;  4DVI A;  1AYL A;  4UVY A;  3MHJ A;  4L0I A;  4GMU A;  5FH0 A;  4L0B A;  4ZZY A;  4BUU A;  1AQ2 A;  4OX2 A;  1A26 A;  3DT2 A;  4J3L A;  4TKI A;  1KHG A;  4UFU A;  4L2F A;  4J1Z A;  4UFY A;  5C5P A;  5AL3 A;  2FAH A;  4BJ9 A;  2PAX A;  4HL5 A;  4RV6 A;  4L7R A;  3C49 A;  4BUD A;  4J22 A;  2RK8 A;  4UXB A;  5ETY A;  5ADR A;  5LYH A;  2QF1 A;  4UW1 A;  4L0T A;  2QEW A;  4L7P A;  4HLG A;  5I67 A;  4HMH A;  4HKI A;  1UK1 A;  4BUT A;  4ZZZ A;  5FPG A;  4N4V A;  1K3D A;  4L7O A;  4BUA A;  3KR8 A;  4XHU A;  4J3M A;  4AVW A;  2PC9 A;  3UH4 A;  3FHB A;  4K4F A;  4HHY A;  3DT7 A;  5AL1 A;  1NHX A;  4W6E A;  4UVN A;  4HLF A;  4UVV A;  4BUF A;  2PQF A;  4L32 A;  3L3L A;  4N4T A;  5C5R A;  4UVU A;  4F1Q A;  3GJW A;  5LXP A;  2RKE A;  4IUE A;  4R43 A;  4L09 A;  4PAX A;  4BU9 A;  4YW8 A;  4GNO A;  2RK7 A;  4UVP A;  4UVS A;  3SMI A;  4DQY C;  3P0Q A;  4PNT A;  1OEN A;  4GMM A;  3UA9 A;  3P0P A;  4OQA C;  4PNR A;  3U9H A;  4WPV A;  3SE2 A;  1YVY A;  4TJW A;  4BUX A;  4HLM A;  4GNL A;  4GV7 A;  2RD6 A;  1YGG A;  4HKK A;  3GEY A;  4TJY A;  4UVX A;  3GN7 A;  5A00 A;  3UH2 A;  5ADS A;  4UVO A;  5ADT A;  1PAX A;  4GMZ A;  3CE0 A;  4UHG A;  4ZZX A;  4L31 A;  4WIU A;  2PY7 X;  3MOH A;  4PJT A;  4U6A A;  4YWD A;  3BLJ A;  4BJB A;  4X52 A;  2QF2 A;  4GMW A;  3KR7 A;  4GNM A;  4K4E A;  4MSK A;  4I9I A;  1XKV A;  4YWB A;  4BU7 A;  2FAF A;  4HLK A;  3L3M A;  4KZU A;  4L0S A;  4BU5 A;  5AL5 A;  4PNM A;  4HHZ A;  4LI6 A;  4PML A;  4N3R A;  4W5I A;  5EBT A;  3SMJ A;  2X5Y A;  3U9Y A;  3MHK A;  5ADQ A;  4UVL A;  2ZCI A;  5AKW A;  3GOY A;  4BS4 A;  1KHE A;  3W51 A;  4L2G A;  1KHB A;  4BU8 A;  4L33 A;  4PNS A;  4TOR A;  5AL2 A;  4UI7 A;  4AVU A;  4BUW A;  4TK0 A;  1J3B A;  4BU6 A;  4UI5 A;  5C5Q A;  4BUI A;  1YTM A;  4UND A;  4F1L A;  4WPT A;  4BUE A;  2RF5 A;  4GV4 A;  4PJV A;  5AKU A;  1UK0 A;  4YW9 A;  5FH4 A;  3P0N A;  4L2K A;  4L6S A;  4UUH A;  4J21 A;  4GV2 A;  4UI4 A;  4TOS A;  3DTB A;  1K3C A;  4LI8 A;  4RCG A; 
#chains in the Genus database with same CATH homology
 4TVJ A;  4TK5 A;  4BUY A;  4GV0 A;  4L0V A;  1EFY A;  2OLQ A;  4L7N A;  4TKG A;  5FH1 A;  4F0E A;  4OQB C;  4LI7 A;  4GNP A;  2PAW A;  4L10 A;  4WIE A;  5FPF A;  3HKV A;  4UVZ A;  3KJD A;  4OPX C;  4PNQ A;  4L7L A;  4M7B A;  4WPU A;  5FH2 A;  4L7U A;  1KHF A;  3MOF A;  4R6E A;  2RCW A;  5AEH A;  2GMV A;  5FH3 A;  4WL8 A;  4OA7 A;  1OS1 A;  1YLH A;  2QZY A;  4R5W A;  4UI3 A;  4MSG A;  3UDD A;  2RKA A;  4TJU A;  4MT9 A;  5ECE A;  3MOE A;  1GS0 A;  1II2 A;  1WOK A;  2QEY A;  4W5S A;  4GNQ A;  4BU3 A;  4BJC A;  4UI8 A;  4UVT A;  4UVW A;  3DT4 A;  4UI6 A;  5FH5 A;  2OLR A;  4HLH A;  2PXZ X;  4WOU A;  4KRS A;  4L6Z A;  5DCZ A;  4UX4 A;  4HYF A;  4KZL A;  4PY4 A;  3C4H A;  4PNL A;  4TKF A;  3PAX A;  4KZQ A;  4L70 A;  3KCZ A;  1M51 A;  4HKN A;  4BUV A;  2RKD A;  4PNN A;  4BFP A;  5AL4 A;  4L34 A;  4BUS A;  5LX6 A;  4DVI A;  1AYL A;  4UVY A;  3MHJ A;  4L0I A;  4GMU A;  5FH0 A;  4L0B A;  4ZZY A;  4BUU A;  1AQ2 A;  4OX2 A;  1A26 A;  3DT2 A;  4J3L A;  4TKI A;  1KHG A;  4UFU A;  4L2F A;  4J1Z A;  4UFY A;  5C5P A;  5AL3 A;  2FAH A;  4BJ9 A;  2PAX A;  4HL5 A;  4RV6 A;  4L7R A;  3C49 A;  4BUD A;  4J22 A;  2RK8 A;  4UXB A;  5ETY A;  5ADR A;  5LYH A;  2QF1 A;  4UW1 A;  4L0T A;  2QEW A;  4L7P A;  4HLG A;  5I67 A;  4HMH A;  4HKI A;  1UK1 A;  4BUT A;  4ZZZ A;  5FPG A;  4N4V A;  1K3D A;  4L7O A;  4BUA A;  3KR8 A;  4XHU A;  4J3M A;  4AVW A;  2PC9 A;  3UH4 A;  3FHB A;  4K4F A;  4HHY A;  3DT7 A;  5AL1 A;  1NHX A;  4W6E A;  4UVN A;  4HLF A;  4UVV A;  4BUF A;  2PQF A;  4L32 A;  3L3L A;  4N4T A;  5C5R A;  4UVU A;  4F1Q A;  3GJW A;  5LXP A;  2RKE A;  4IUE A;  4R43 A;  4L09 A;  4PAX A;  4BU9 A;  4YW8 A;  4GNO A;  2RK7 A;  4UVP A;  4UVS A;  3SMI A;  4DQY C;  3P0Q A;  4PNT A;  1OEN A;  4GMM A;  3UA9 A;  3P0P A;  4OQA C;  4PNR A;  3U9H A;  4WPV A;  3SE2 A;  1YVY A;  4TJW A;  4BUX A;  4HLM A;  4GNL A;  4GV7 A;  2RD6 A;  1YGG A;  4HKK A;  3GEY A;  4TJY A;  4UVX A;  3GN7 A;  5A00 A;  3UH2 A;  5ADS A;  4UVO A;  5ADT A;  1PAX A;  4GMZ A;  3CE0 A;  4UHG A;  4ZZX A;  4L31 A;  4WIU A;  2PY7 X;  3MOH A;  4PJT A;  4U6A A;  4YWD A;  3BLJ A;  4BJB A;  4X52 A;  2QF2 A;  4GMW A;  3KR7 A;  4GNM A;  4K4E A;  4MSK A;  4I9I A;  1XKV A;  4YWB A;  4BU7 A;  2FAF A;  4HLK A;  3L3M A;  4KZU A;  4L0S A;  4BU5 A;  5AL5 A;  4PNM A;  4HHZ A;  4LI6 A;  4PML A;  4N3R A;  4W5I A;  5EBT A;  3SMJ A;  2X5Y A;  3U9Y A;  3MHK A;  5ADQ A;  4UVL A;  2ZCI A;  5AKW A;  3GOY A;  4BS4 A;  1KHE A;  3W51 A;  4L2G A;  1KHB A;  4BU8 A;  4L33 A;  4PNS A;  4TOR A;  5AL2 A;  4UI7 A;  4AVU A;  4BUW A;  4TK0 A;  1J3B A;  4BU6 A;  4UI5 A;  5C5Q A;  4BUI A;  1YTM A;  4UND A;  4F1L A;  4WPT A;  4BUE A;  2RF5 A;  4GV4 A;  4PJV A;  5AKU A;  1UK0 A;  4YW9 A;  5FH4 A;  3P0N A;  4L2K A;  4L6S A;  4UUH A;  4J21 A;  4GV2 A;  4UI4 A;  4TOS A;  3DTB A;  1K3C A;  4LI8 A;  4RCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...