4PNYA

Crystal structure of staphylococcal nuclease variant delta+phs i72h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKHEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I72H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4pnyA00
4EQNA 4G57A 2O4XA 3TMEA 5KYIA 4HMIA 2RBMA 2F0OA 2EYPA 2OEOA 1NSNS 3C1FA 1EYAA 4OL7A 4K5XA 2PW5A 5CGKA 3EJIA 5HGTA 2KHSA 4ODGA 2EYMA 4LAAA 5E1FA 3D4DA 3NQTA 5I6YA 4E6IA 4KY6A 1TR5A 5I9PA 2ENBA 2NUCA 3D4WA 1SNDA 5C4HA 2EY2A 4K5WA 2LKVA 3BDLA 4KJOA 1TQOA 3MEHA 2SOBA 5CV5A 2PQEA 4IALA 4F8MA 1JOQA 1KDBA 1JOKA 2KQ3A 5C5MA 1KAAA 5CR3A 4ZQ3A 1KDAA 1STYA 4K2KA 3P1HA 3T13A 3TP6A 2EYHA 3OMCA 4K5VA 1F2MA 4KTAA 5CC4A 3NUCA 3DHQA 3SXHA 1ENAA 2F0LA 5C6AA 5IGDA 4F7XA 1SNPA 2F3VA 1EY7A 1SYCA 5IODA 1SNMA 3NXWA 5C5LA 4DGZA 4QF4A 4MIUA 4HMJA 1STGA 2F3WA 4ME5A 2F0HA 3E5SA 2F0WA 2F0JA 2EYFA 4YIJA 2F0MA 2EY1A 4KJNA 5DEHA 3NP8A 1EY0A 4IZ8A 4QB4A 2PW7A 5ISRA 2RKSA 4DF7A 4NMZA 2SNMA 4R8NA 2EYJA 5KIXA 4EQOA 5CV7A 5F2DA 5IGGA 3DMUA 4K14A 3TP5A 3MZ5A 1EY5A 4ZUIA 3SHLA 4HTHA 4J6HA 1STHA 2PZWA 4S3SA 3S9WA 1F2YA 2OXPA 2EXZA 2F0PA 1A3TA 1SNCA 2SNSA 3C1EA 1U9RA 5CV6A 1KABA 1ENCA 3OMGA 3HEJA 4DFAA 5J39A 2F0QA 4ZUJA 2F0EA 3H6MA 3SK8A 5JAVA 2HQEA 4KV6A 2M00A 1RKNA 4PNYA 3EROA 3PMFA 4B9XA 3TP7A 1A3UA 4N9TA 1SYGA 2PYKA 3EVQA 1II3A 1A2TA 3HZXA 3ITPA 4ID6A 3TP8A 3V2TA 5IGBA 2EYOA 3MVVA 5HURA 5J22A 1IHZA 4EQPA 5I6WA 5IGEA 4NKLA 1JORA 1AEXA 5EKKA 5EKLA 1A3VA 1JOOA 1SYBA 4J1MA 3U9OA 5KGUA 4B9WA 1SNOA 2EYLA 3NHHA 4K8JA 3MXPA 2F0TA 1EY6A 4N9PA 5KRUA 3OWFA 1NUCA 4DU9A 1F2ZA 1STNA 1EYCA 4KD4A 4PMBA 3T16A 3LX0A 5IOCA 1EY9A 2QDBA 4QMGA 1SYFA 5EGTA 5K5PA 2F0KA 3D6CA 1STBA 4RKBA 4KD3A 2F0IA 3P75A 4NP5A 3SK6A 1KDCA 2F0GA 4K6DA 5CV9A 5M9OA 2OF1A 2WACA 4RKLA 4WORA 1EY8A 1EYDA 5NUCA 5CV8A 5E3FA 5IGFA 3RUZA 3R3OA 3SK4A 1SYDA 4KY7A 3D8GA 5J1ZA 1SNQA 5DAUA 3SK5A 4WRDA 3VA5A 1EY4A 1SYEA 2F0UA 3SR1A 5KEEA 2F0FA 3ERQA 5KYLA 5IIFA 3BDCA 4K8IA 2F0SA 5I9OA 3QOJA 3OSOA 1TT2A 5CV4A 4KY5A 4I65A 4H7BA 2F0VA 4KHVA 5IGCA 1A2UA 4EVOA 4NDXA 4PMCA 4IUNA 4K2LA 1EZ6A 2F0NA 3QB3A 5C3WA 4TRDA 3MHBA 1STAA 5C3XA 1EZ8A 2EY5A 2F0DA 2RDFA 3QOLA 5JOBA 3NK9A 1EQVA 2EY6A 2PZUA 5C4ZA 2PZTA
chains in the Genus database with same CATH superfamily
3SE0A 3HOXB 4YHHL 2NWGA 5FLMH 3EBEA 4ZYSA 4HJ8A 3C46A 4ODGA 2EJFC 1PHJA 4RMFA 3M4QA 4LF9L 3HOYB 1QUQA 1S5CD 1W6KA 3K5OA 1RF2D 1BCPF 3JC66 2XRQD 4PG3A 4JBWA 4JI2Q 1T5EA 1AH9A 5IYDH 3MAQA 2FFKB 1LV9A 4ZAIA 1F2MA 4KTAA 1DXMA 1ENAA 1XTDA 4KK7A 3UE0A 4A3FB 3LNNA 4BS9A 2Z4HA 3D6WA 2UXCQ 3X3NA 4A3IH 2F4IA 3STBD 3E3XA 2NVQH 4DV4L 4NXML 1LABA 1CI3M 3KBGA 4YIJA 1Y8NB 2L1BA 2R92B 1PZJD 5AJ3Q 5D14A 2ZM6Q 1SMYD 1JWUD 4BXXH 1EL0A 5IGGA 1V43A 3CCVA 2O2LD 4DV7Q 2HIXA 3K5LA 2RSOA 3J81i 1LT5D 2F0QA 4DAMA 4JI8Q 4B9XA 3NQIA 1PRTB 4HJ5A 3MEFA 2LS01 1VQJA 1D7QA 5EPJA 2EYOA 5HY6A 4JBJA 1WOCA 3RZDH 3OTOQ 5I6WA 1DOMA 1V1PB 3F2UA 4J1MA 5M5WH 1AW7A 1TIID 3NHHA 3MXPA 1GVPA 1GKHA 4N9PA 2AQ1B 2K33A 3CKIB 3E9IA 4KD4A 1IBKQ 4FP5D 1QJOA 4J15A 4MNOA 1I5FA 3I56A 5GADC 3I91A 4YWMA 2Q2HA 1AFPA 1DYQA 2PPBC 4K6DA 4RCNA 2WACA 2UXBQ 3H3VI 1E1OA 2A68C 1V8QA 4GN4B 3N6RA 1MSHA 5M3MH 1OXTA 1IKLA 3HKZB 2HIVA 4DR7L 4H7BA 4LJZC 1VMPA 4XQQA 1L1OB 5C3WA 1RJTA 2RDFA 4A3GH 3BYTB 3HOXH 3IKJA 2E8GA 2O4XA 1EOTA 3K7UC 2MHVA 1W2BA 1WYDA 1HQRD 2PW5A 5IT9c 1NR4A 1QWYA 3M7NA 1EFWA 1YHAA 3FKIH 4LF6L 2AWNA 3D4WA 2NB0A 5JVG3 1OTCA 3HKSA 2LKVA 1KLUD 3KDFA 4F8MA 3M4OB 1Z9FA 2KQ3A 4DAYA 2LXJA 1Z6HA 4Z9CB 2E2JH 4L5TA 4GOPC 3A8JE 3J7A5 1XNRQ 4C2MB 4BY1G 1S5BD 1XXGA 2CH4A 2F3WA 4ME5A 3E5SA 3E0JA 2EYFA 4YWKA 4CDEC 5A2QE 4ZKCB 2E76C 1YJ9A 2JJQA 1JE5A 2Z6KA 4ZLTF 1I4QA 3HKZG 1S5FD 4BY7G 4NMZA 4FVMA 4R8NA 1PZKD 4DV0Q 1N36L 4DV1Q 4A3EH 4FYDA 2K52A 1K0SA 1GUGA 1UE1A 4HTHA 2K7VA 1F2YA 2F0PA 4DNIA 3DXJC 3HEJA 5J39A 1B3QA 4ZUJA 2M00A 1HRJA 4PNYA 3GTJH 3CCRA 1G291 2VQEL 4JYAL 3ITPA 1EWCA 4DK3C 1M8AA 4CHTB 2LSSA 2GN5A 3A5UA 3OPOA 2FXQA 3FMCA 5A2QL 1AP0A 3VR2A 1VCIA 4JCVE 4PMBA 5DNFA 3HOWG 3T56B 4A3DH 4HCSA 3S2HH 4DR3L 1CTMA 1O80A 1STBA 1E3PA 1T9HA 5ELDA 4IQZA 1PLFA 2VW9A 1CKNA 4X65L 4OO1H 4KN7C 4IUQA 1BQQT 1XPRA 1T5XD 2UUCQ 2CWPA 1QG7A 3L7ZC 3KDFB 4HSPA 1SYEA 3ERQA 3QOJA 3OSOA 1FR3A 2A8VA 2KUMA 1Z47A 1EZ6A 3PV0A 1HUMA 2E2HH 2IY5B 2JSOA 5LMUL 2R93G 3NPPA 3CC7A 1LTID 1BBUA 2VUMH 4YCVA 2EYMA 4QL5A 3M4PA 3PUWA 4GLAC 4GNXA 1WCMB 3W5OA 2B8FA 2EY2A 3DEPA 4U673 4BY1H 2VB3X 2EE1A 4HN7A 5GROA 2JEAI 4JV5L 5CORA 2B2UA 4F7XA 2Q8RE 2GA4B 1EY7A 3S1RH 1FJGL 1FNVA 1CHQD 1U5KA 3RZDB 1HZ9A 1HR0W 1CKNB 4O1NA 1LTRD 2VUMB 3CC4A 2JA5B 5E4XA 5JVH3 3I4MH 2K4KA 1KNAA 2DY7A 1X55A 1E2ZA 1NNXA 4UAIA 4ZUIA 2K04A 4GKJL 1EFID 1FGBD 2CWAA 1I4XA 2O5JC 4FF3A 4JI1Q 3FVQA 2B2TC 1FGUA 4K6LA 3GTMH 1XMOL 1QUQB 5EBCA 4DR2Q 4GN3B 3S1QB 1JT8A 3AQQA 4KLKA 2AQ2B 5HURA 1HNZL 1JORA 1A3VA 5KGUA 1XX8A 1QE6A 1VQOA 4DR7Q 1N8RC 1QB5D 4R9WA 3CCUA 4GNXB 4IFDJ 4A4IA 1X3QA 2Y0SB 1K8MA 3GTKB 3VR6A 1MD2D 2MUYA 1BBXC 5T1GA 3D3RA 2CHBD 2I46A 2VY3A 4NP5A 1B7YB 3HGBA 3NE5B 2Q2UA 2Z6BA 3P7JA 3DWPA 3VA5A 1PH5A 1JWSD 5KEEA 2F0FA 3CU7A 3BDCA 3OIQA 4TSSA 3O13A 5FLXL 4H02A 3KBXA 1IBML 3HOVH 2JP1A 1SJHD 4WJWA 1X3EA 1N34Q 1L0YB 2PZTA 3G7LA 1QZGA 1UAPA 3D4RA 3S15H 4IPGA 1QCBD 4HMIA 2Z8LA 5EJWA 4K5XA 1JCKB 4G7HC 1IBMQ 4LAAA 5CYUA 1YJNA 2VB2X 1PH9A 1Q8IA 3MXNB 4DNTB 4A3BH 3NEMA 2UUAL 1VQKA 3DUZA 1UE7A 3DLLA 2ZXPA 1FL0A 1I50B 3CHBD 2B2YC 2SOBA 3P20A 3QG1A 1JOKA 1B9MA 5JJIA 1OXUA 4K2KA 3CAMA 3G71A 4LF7L 3PUXA 4O2DA 2JA6G 1LT6D 3A55A 4IFDH 3DHQA 1HZBA 3K81C 1JQYD 1VF7A 2XTIA 1C9OA 1HTPA 2KJXA 1M1KC 4HSVA 4RA8A 3I2ZA 1F9QA 5EPLA 1JMCA 2UXDL 5E7NA 2B63H 4DF7A 4F87A 1K8OA 4EX5A 1HUNA 1IYJB 3SHLA 1CA6A 2SEBD 2Q2TA 4B3MQ 3J80E 2WKCA 4DFAA 3TREA 2FMMA 2JA7H 3I4LA 3N52A 3Q6SA 4JVZA 1JJ2A 3H0GG 1PH2A 1MKHA 1GHJA 2KENA 1RD9D 3FKIG 3ND8A 3HZXA 4CDDC 2IWHA 4DAVA 2CW0D 1UE5A 3FP9A 1HTLD 2EYLA 3RLOA 4HIDA 5JEAG 4BBSB 2FJ2A 1X56A 3R2IA 3W2DA 2QDBA 1B8AA 2C35B 2ASBA 3HOXG 4ZRZA 1PV4A 1MI2A 1PH6A 3AEVA 2DJGC 5C3EB 1ZEQX 1EQRA 2KHJA 2VXWA 4UP8A 1Y14B 1ASZA 2K28A 3SK5A 3K7AB 4RAUC 1B3AA 3IFDA 1IYVA 1DONA 3PO3H 1IL8A 5M3FG 2JA6B 3GTLH 3KOJA 3CCEA 4EQ5A 3H3VC 4HR7B 4ZKBB 5BR8Q 1B53A 2ICIA 4HCEA 4OHJA 5IP7H 2NVYH 3QWNA 3EJIA 1F9PA 3F2BA 5LL6X 2KEDA 4B3ML 1I50H 2NUCA 3DM1A 4LNQA 2NTTA 2E5LL 4YCUA 5C0XH 1E24A 4HJAA 1HNZQ 1ASYA 2BCOA 2J7ZA 3BVMA 4CKCA 2RA4A 2B63B 4C3IH 1ML0D 4DXFA 1BCPB 4IALA 5JJLA 3PIO3 2UXDQ 3UDGA 3S15B 1CQFA 5C6AA 1BDOA 1SYCA 1ENFA 1X3PA 1X6OA 3ULJA 4YCWA 4JI8L 3I4NB 4OX9Q 4XDXA 2F0WA 2C9OA 4H13C 2NVYB 1CFMA 2PW7A 3A54A 5M5XH 3RZOB 3F8TA 2D5DA 2EYJA 4B3TL 3GTLB 4R4CA 4JI7L 2L12A 1Q86C 4HJ7A 1JWMD 2AMCB 3CP0A 3E9HA 4C3HG 3C1EA 5JPNC 1U9RA 1DD2A 1NCVA 3OMGA 3I4MG 1XPOA 1K73C 4AYBG 2F0EA 5JAVA 3S2HB 3BYYB 4P2CB 2A6HD 4N9TA 4LFAL 3EVQA 4QY7A 3RN5A 5IGBA 2WAQE 1XMQQ 3F2CA 1C8CA 2NVQB 2L4NA 1QOHA 1DOLA 1EOVA 4IPCA 3PUYA 2DUDA 2E74C 1VF5C 2VL6A 3T16A 3T53B 5FKAC 4G7OC 4DV7L 2EQSA 1F2LA 3RD4A 2A19A 2NZOA 3ND9A 3URYA 2OF1A 2B2VA 2RF4A 1LTGD 4MN3A 3J7AF 4XQNA 1EYDA 2KCMA 5CV8A 2OT2A 1VQ4A 5AJ3L 3HG9A 2ES2A 1EIFA 4XXEA 5I2XA 3I55A 3RNUA 2PNRC 3KF8B 1F9RA 3FEWX 2HDMA 3U50C 3TN2A 1TWFB 4IUNA 1E2WA 5C44H 2FHTA 4C56C 3B6YA 3J80c 4A3GG 4LF7Q 1BCPD 5DM73 4GOPA 4QIWB 3S14B 1FNUA 1HNWL 1PDQA 4RGNA 2F1MA 4LF8Q 3J81L 2R7ZB 4I7AA 1LT3D 1RODA 4JI1L 3M3YB 1ZKOA 1TQOA 2HT1A 4A3KG 4GKJQ 2EZVA 2UUCL 1R4QB 3HKZE 2L55A 2UU9L 4G4KA 1KQSA 2N8NA 4MIUA 4ME3A 4IPDA 2R7DA 4RH6A 1K3BC 1D6EC 1TWCH 4F88A 3JAME 1Q7YC 2JA8G 2K1BA 3CF5A 2VS1A 1GUTA 3MTSA 1I6HB 3PGZA 5ISRA 1HCZA 4C3IB 2Q8IB 3STBC 4KHPQ 1BF4A 2BDOA 5IT9E 3KJOA 3NWSA 3MZ5A 1LTLA 1H9JA 3S9WA 4JI3L 2OXPA 2SNSA 2K01A 4LFBQ 3A7LA 3EROA 4DN4M 2JEBI 5HGQA 2VQFL 5LHY1 4AQYQ 4LF5L 1II3A 1G6PA 1GXDC 5M5WB 1AEXA 3AB9A 3GTOH 1R9TH 2ZM6L 1E0BA 3VR3A 2F0TA 2K03A 3V05A 3WDNA 1EWHA 5FLMG 4DV4Q 3J80L 4NXMQ 1CM9A 1VQFA 4OX9L 1Y1VB 3NWTA 5G3LF 2F0KA 2PI2A 1G91A 3HOVB 1ZYRC 5BR8L 1XNRL 3RLFA 2HHHL 4ALPA 1KDCA 1VQAA 2G5DA 3PIOA 1SFOH 3J7ZC 1XWEA 1WTWA 1IBLL 2RHSB 4LUVA 2Q8TA 1SBBB 3R3OA 3RUZA 3EQLC 5JJZA 1ICFB 2EVBA 4A3MB 5LMNQ 1TT2A 2LY7A 3A56A 1X32A 4HAEA 3CC2A 3MA2B 4CJ2C 4NDXA 4OONA 3UE1A 2PI2E 4A3FG 3I4NG 5C3XA 4HIMA 4MZ9A 3CRLC 3K5NA 4JV5Q 4IUTA 4RWSC 4G57A 3GTQH 4ZCKA 2J0TD 1CT1D 2EYPA 2G9DA 1GHKA 1MBYA 2L9HA 2AHOB 1H9MA 1VQ7A 2JA5H 2UUAQ 3GDEA 4ABNA 2QW7A 4KY6A 3QO2A 4FDBA 1SNDA 2R61A 4LFBL 4OO1I 2KVMA 1C4QA 1AE3A 1J9OA 4DV2L 3TQYA 5GAEC 3ERSX 2MO0A 1YNND 1HH2P 3TDQA 5A35A 1GO3E 4JBKA 4A3JG 3DM3A 1SNPA 3M4YA 2XVSA 1CZGA 2RSNA 2LFNA 3W1BA 1OXVA 1KLGD 3BG3A 3HS0C 2HD3A 2E75C 2XGTA 2F4VL 1AZQA 1VQ6A 1GUOA 4DAYB 1BOSA 4A3DG 1VQ9A 4X3KA 1D1IA 2HHHQ 2JA8B 1FYCA 4KKUA 1VQMA 1KRTA 4S3SA 4CJ0B 2CW0C 1TS2A 1BXTA 2BA0A 1L0WA 2C5CA 1KRSA 3L9AX 1LM0A 1EIGA 1P16A 1AE2A 1HFGA 4BA1I 1WD0A 2E2IH 3PMFA 3SVMA 2WINB 1A2TA 3J81c 1YJWA 1CQVA 2MNAA 3ER0A 5EKKA 2DY8A 2WIIB 5CBEE 3KK7A 1KAWA 1FVIA 3I4MB 4IN3A 4K8JA 2R93B 1EY6A 1Y1VH 1PYWD 1NUCA 4X6AH 1V1QA 1HXYD 3LX0A 1N33L 1EY9A 4IURA 5EGTA 1GD7A 5K5PA 1ESRA 2XWJB 2SDFA 3SK6A 4YY3Q 1B9NA 1KC8C 1EU4A 4KHPL 1PYBA 3GTGB 1I4GA 1TS5A 2QDLA 5IT9L 2CKZB 1O7LA 2YTYA 1JB7A 5KYIA 2LXKA 5C0XI 1NMGA 1CSQA 3VYTA 2I07B 4I65A 3J81j 2CCZA 1A2UA 3RMHA 2KCCA 4KI0A 1NTGA 3AMUA 3G6EA 4C3JB 1CUKA 1VQDA 3I7FA 1I3QB 2RCNA 1E2VA 2JA7B 3OWEB 3HOUG 3A8KE 2JN4A 4BWGB 4I7ZC 1TWCB 1VMCA 5HGTA 1BNZA 5IY0A 1XYIA 2EPBA 4M1UB 4IFDI 4K5WA 3BS1A 1QZHA 1HNWQ 4OWWB 1A6XA 2DGYA 2QEXA 5D65A 1JR0D 4JW0A 5GQOA 4ZK9B 1MJEA 1KD1C 3BZDB 4AYBB 2Z4IA 5IODA 5JJKA 4DGZA 1U4RA 5GAGC 5FOBB 4UP7A 1Q1EA 3CRKC 3M85A 1LTTD 2Z6KC 3GD7A 2WFWA 3UDFA 1R9TB 4M8AA 3A5ZB 3G4SA 1SROA 4BY1B 4OXPA 5KIXA 4QUCA 4NXNQ 1UE6A 3F2DA 2ZT9C 4J6HA 2HQLA 1LUZA 2YU9B 4LF9Q 4P75A 3ULPA 2K05A 1XMOQ 3K80C 2KHIA 3H6MA 1TY0A 4OO1G 1RKNA 3I3CA 4KKTA 4XT3B 4X64Q 3D31A 3ZYYX 1A15A 2P5ZX 4NKLA 4R4TA 1E22A 1JICA 1JOOA 1XNQL 1Q90A 4O0AA 2BDNA 1K8AC 1SNOA 3R8BA 1A8VA 1MSGA 4GS3A 4MTKA 3KF8A 2D0OA 4RGMA 2BE5D 3H3VH 1XNQQ 4A93B 2NVXB 5FO9B 3S1MB 1HJPA 2XIWA 3K59A 4NPSA 5M3FB 1WCMH 3RR5A 2A73B 5KYLA 4X3SA 4K8IA 1YHBA 2K5WA 4KHVA 3GV6A 4PMCA 4K2LA 2R3ZA 4WJ3M 3QOLA 3EIVA 1TWHB 4BBSH 4C1NI 1WFQA 4EQNA 2E2JB 1U4MA 1IBLQ 2RBMA 1I94L 1I4RA 2JK8A 4IOCA 2KA7A 5CGKA 1SFOB 4IJHA 5E1FA 5M3MB 3VA7A 1EU3A 2ENBA 4LF6Q 3S2DB 2JA7G 2IX0A 5ELEA 4YHHQ 1RL2A 2OWOA 1SAPA 1EQTA 4FO2A 5CV5A 4LF5Q 1MIUA 3S17B 1EEFD 4A3CH 1D2BA 3PIPA 4BY7B 1SXTA 2Z1CA 3CCQA 1SNMA 3Q8DA 2B39A 2KBNA 1SE4A 4A3BB 2F0HA 1PYSB 2F0MA 1YEZA 4XQJA 4O42A 4A3MG 4H44C 3NP8A 1PTOC 1X65A 4B08A 1PVOA 5ELCA 5K36H 5CV7A 2F03A 3DMUA 1EY5A 1STHA 4DV2Q 1IW7D 4CKBA 2EXDA 2G9HD 2WV6D 4DUZL 1B2TA 1HZAA 1SN8A 4MHEA 4LF4Q 4FNFA 2PYKA 2ZJQA 1KNEA 1HA5A 2OQKA 4DK1A 1LTSD 4YWLA 1J8IA 3GV3A 3RZOH 1GOZA 5IWAL 1PTOB 5D3IB 1ESFA 4JK1C 1C7YA 4X66L 4A93H 2DNEA 2F0IA 1WD1A 2R7ZH 4NXNL 2HCCA 3VYSA 1S40A 2VUMG 1GM5A 1LO5D 4KY7A 3D8GA 1R4PB 1PH4A 1YNNC 4AYBE 5J22A 2YYZA 2A6EC 3TS2A 4V0BA 2QA4A 2WAQB 4A3KH 2UXCL 4FF4A 3QIAA 4XYOA 1AZPA 1H9SA 1STAA 2F0DA 4KKSA 4L5RC 1WCMG 2A1AA 2YU9H 2EY6A 1PH8A 4BBSG 1YITA 4JI2L 3CW2C 4GOPB 4IOAA 3CPFA 3C1FA 2OEOA 1NSNS 2MP1A 1PH7A 3E6ZX 4OIJA 1Q82C 1OXSC 1BCPC 4L6TB 2RQXA 4IJLA 4MTNA 5C4HA 2R7ZG 2A6HC 1BKBA 1O7ZA 4TKOB 3S2DH 3MEHA 1OXXK 5C5MA 5CR3A 4GN5A 4UPAA 3TRZA 3TP6A 2EYHA 5BN5A 1PRTF 1U4LA 2L5TA 1Q81C 1RHPA 2F0LA 1HFNA 1ILQA 2EIFA 4A3GB 2E2DC 4JI0L 1JC7A 3LWEA 1A63A 2F0JA 3IFTA 4GKKQ 1EY0A 5M5YH 1Q1BA 2NVXH 2RKSA 4XTCS 3ONAB 5FK9C 5KNCA 3EN2A 2ZJRA 1PXUA 2PMZE 5TSSA 2JA5G 3HOWB 1RDPD 3WOFA 4DV3Q 2PZWA 2IW3A 1I3QH 5IYCH 1KABA 1ENCA 1EIYB 3NBHA 3SK8A 3HOUH 1YNJC 4P73A 1J5EQ 2B2YA 1SYGA 4DV6Q 1V1PA 1JB3A 4ID6A 1G8ZD 5JEAJ 1DOKA 1YHQA 3K0XA 1S4ZA 5IP9H 3U9SA 3U9OA 2R93H 4OWXB 5KRUA 1WTPA 3E0EA 5FJ8H 1LTBD 1F2ZA 1Z7TA 1B4OA 5IOCA 5KNDA 1S3OA 1RTNA 1W6JA 2NYZD 1NE3A 3CQZB 4POGA 1N32L 2L11A 4BBRG 1SR3A 2K32A 5M9OA 1K0RA 4YY3L 1N9WA 4Y7NH 1MHWC 4DR5L 5IYCG 3K5MA 1SYDA 2TSSA 3OOCA 4XYQA 5DAUA 1STEA 1EY4A 4OWTB 4X65Q 2F4VQ 3Q23A 3AYHB 4LW1A 4DR3Q 1KTKA 3T1HL 5C44B 3A7AB 1H9RA 1SMYC 4EVOA 1B1ZA 3I70A 1O78A 2EJMA 3KFUA 3M4OH 4KMUC 1EZ8A 4A3FH 4FF1A 5C4ZA 2EDGA 1CKMA 2F0OA 2QILA 4LFAQ 1WTRA 5C4XH 2N3SA 1TR5A 4IUUA 2Y0SE 1XPUA 1I4PA 4XIGS 4PZ7A 2N55A 2V4DA 3IL8A 2XWBB 1L1OC 2ZXOA 3CCSA 3M7GA 2F3IA 2WAQG 4GKKL 2B2TA 4KHZA 4JI5Q 3C3LA 3DEOA 4A76A 3HOZB 5C0XG 2WB1B 1MGSA 3MWYW 4TVAB 5C5LA 1TWGH 4Y7NB 1IXRA 3GTQB 1Y1WG 4LF8L 4UP9A 1GUSA 1HPCA 1TS3A 3CPWA 1I94Q 1HNXL 4AIMA 3J80i 4KJNA 4KN4C 3ZJYC 2OTLA 1HA6A 4PZ8A 1U0LA 3BJUA 5LMNW 4FXGC 1VS0A 1HQMC 2KOLA 1SSOA 1VQCA 2PQAB 1QNKA 3MFYA 3BU2A 3TS0A 2KCTA 1VQ8A 2QF7A 2ZTDA 1S72A 4Q0FA 4R4IA 2E2HB 1BUVT 1WJJA 1QVGA 2A74C 1A62A 1YZ6A 3PSIA 4BY7H 2NZ1D 2IHEA 3CD6A 3UDIA 2A69D 4PZ6A 3PUVA 1F9SA 2Z0SA 2K5NA 4Y52H 1PFSA 3KLSX 1BR9A 4RHSA 5IYDG 3H0GB 3OWFA 1AN8A 4C3HB 4V190 1E1TA 4IUPA 1X54A 2UUBL 3NTIA 1EUJA 2R6GA 4DV1L 2O5IC 5C44G 3MXUA 2R92H 2J4XA 3S1MH 5JEAH 3GTOB 2IX1A 3CCJA 2QEJC 1HR0Q 5GAHC 1CSPA 2D2CC 5IIFA 3C2PA 5I9OA 5K36G 1H9KA 3J7YW 1PRTD 4KY5A 3SEBA 5IGCA 1K83H 3PF4A 5KNBA 2BE5C 1NY4A 5COYA 4DV5Q 1EQVA 2X6GA 1WI5A 2PZUA 5EBDA 5DEHA 4CGYB 1QVFA 2B63G 5M3MG 3HOYG 4HIKA 4R8IA 1GJXA 3HRZC 3MXGA 2H1EA 3D4DA 4B3SL 1ONLA 3T1YQ 2H4OA 2KECA 4K0KL 1QVCA 3BDLA 3GTKH 2X6LA 2N49A 1G51A 3TZDA 3NTHA 2JA8H 3KUPA 1PH3A 4LFCL 1UWVA 1CK1A 1VQEA 2E5LQ 4A3DB 5IGDA 1VDZA 2CQAA 2BH8A 4OELB 2NVTH 4C3IG 4TQUS 2IPKD 2AWOA 4JI3Q 3UI2A 1GUWA 3L2PA 1C0AA 2ALYB 4EQOA 5F2DA 1LACA 4A3BG 5C0XJ 2OQ0A 4JI4Q 1IBKL 4PMWA 4QUFA 1L2FA 1XTCD 1CZWA 3NELA 3VYRA 4OIKA 4G7ZC 1VQLA 2ZJPA 1NAPA 3RLNA 2XRSD 3FDTA 3V2TA 3OTOL 3ICEA 1JJGA 3S1QH 3L0OA 3S1NH 4EQPA 3CMAA 4PQXA 2CH4W 1CA5A 2RVLA 3T51B 4JI6L 2LMCB 1EYGA 1D8LA 1EYCA 4R4OA 1JJCB 1DM0B 2WP8J 5FO7B 3D6CA 5ELBA 5IE8A 4JI7Q 4RKLA 4B3TQ 4X3UA 1A0IA 1K9MC 4UDUC 2KCNA 4WRDA 1Y8OB 2K5VA 2F0UA 3I73A 3U4VA 1SEBD 2F0VA 1B44D 2R7FA 2D9UA 1EEID 1UUPA 4LMQD 1ET9A 1XMQL 3NK9A 1KHIA 3WWVA 4POFA 5DM63 4A3JB 4P74A 4C2MH 2B8GA 4OL7A 5JPMC 3RN2A 2E2IB 4A3LG 3HP3A 1DZ1A 5M5XB 4E6IA 2NZHA 3SGIA 4BA2I 4NB3A 3SDZA 1VQ5A 4RCOA 1FD7D 3OIPA 3Q24A 4P72A 1PRTC 1JOQA 4Q5VA 2F52A 1KDBA 4JYAQ 1KAAA 3I8ZA 1ICWA 4X62Q 3AFQA 1STYA 4P71A 2B29A 3OMCA 4K5VA 3V96A 4L8JA 2ZTCA 2K5QA 2CFMA 3DWAA 3FPUB 2I5MX 4LF4L 1LTAD 1SE2A 4FXDA 4HMJA 1STGA 1HHVA 4OEMB 3TSSA 4CDFC 1YI2A 2BOSA 5EPKA 2ZTEA 1UNSA 4X3TA 1FJGQ 4EGVA 2SNMA 3JAMc 2I5LX 1TU2B 3H0GH 2JE6I 2PNHA 1S5DD 1WTOA 2Z9HA 4DV0L 1I4HA 5FLXc 1Y1WH 4DUYQ 3GTPB 4BBRB 4DK0A 4A3KB 4GLXA 1ZXTA 4X66Q 1SNCA 1SE8A 5LMNL 2DJFC 4C3JH 4RGOS 2I5HA 1G6ZA 2IHFA 4JI5L 1TXYA 3OW7A 5DLQE 1A3UA 2GVBA 3DWQA 1NR2A 4B3RL 3H91A 2H5XA 2JQOA 2L0CA 2RCFA 5IGEA 1B50A 5EKLA 1K8GA 1E7ZA 4FXKC 3TBIB 2JYOA 3H09A 5I4DA 3I4OA 5IP7G 1YIJA 3PO3B 1STNA 2BA1A 2A69C 2NTSA 3HOUB 1KIXA 1IKMA 2D0PA 2K5DA 2IJ0A 3K0YA 2AUJD 4HEDA 3ULLA 1PFBA 1FNWA 5M3FH 4DKAC 3A8IE 3W3AA 5C3EH 3M3YH 3KLSA 4ILWA 3CXCA 1SJED 1SNQA 5H1SE 1Q46A 1DGSA 3BVZA 3HOYH 4N8X1 2F0SA 2NN6H 2RDHA 1IL2A 1O7IA 2B2UC 3PO3G 1ZYRD 3MC0B 3F1ZA 2M9VA 3K57A 1L1OA 2MJ8A 1KL9A 2JA9A 3H94A 5G3LD 2XSCA 5ELNA 5T1IA 1NJIC 4GNXC 5FJ8G 5EQ0A 1QILA 2AQ3B 2KHSA 2VQEQ 1PMRA 1RTOA 2K6AA 1DJRD 5I6YA 2GVAA 5I9PA 4A3LH 4OGQC 2UU9Q 4CJ1B 4A3EG 5BN3A 1WTVA 1YNJD 4PV1C 1PFNA 4L5SA 3S17H 4B3RQ 1BBWA 3KJPA 1YNXA 2D62A 5D3DA 4ZQ3A 1WVLA 2ID0A 1N34L 1W3SA 1IW7C 3T13A 4A3JH 1SMXA 1L0XB 1Y69U 3NTKA 3MXNA 1U4PA 3NXWA 3GTGH 4R1JA 5ELFA 1RIPA 3GP7A 4QJFA 4WJ4A 4DNRB 1VQBA 2L15A 4AH6A 1LLRD 2DN8A 4DR1Q 3JAMi 3J81E 3I4NH 4LUOA 4IZ8A 4HJ9A 4IUVA 5LMUQ 1Q8KA 1C48A 2TMPA 2IL8A 1WTHA 4JOIC 4DR1L 3LWUA 1JE4A 1V9PA 2ZXRA 3GO5A 5CV6A 4QGUA 2VQFQ 1CHPD 4AQYL 3LGJA 3PO2H 3S14H 1M90C 4JI0Q 5I2YA 1TWGB 1VQGA 2HQEA 4KV6A 3K8AA 4H0LC 5CMDA 4RG1A 2MQHA 5L37A 4A3MH 5FO8B 4DR6L 1SLJA 2WB1E 1PTOF 2B2WA 2DNCA 1WTXA 3CCLA 4UHVA 3JAML 1HZCA 3NENA 3PF5A 4FF2A 2RHQB 2VZAA 4N8FA 1TKWB 2EJGC 1X9NA 4NW2A 1TS4A 2ATWA 4KD3A 3A74A 4IFDG 2YTVA 3S24A 2F0GA 2UXBL 4WORA 1EY8A 1X3GA 5NUCA 2IT1A 3OYYA 2HCIA 2Q2IA 5C3EG 1N33Q 2K50A 2QCPX 1HNXQ 4QIWE 1EQQA 1NBWA 1UEBA 4LUZA 1TWAH 3A0JA 3MHBA 5EKIA 2Y0SG 4LFCQ 4IPHA 2PMZB 3TMEA 3J7AV 3QJYA 4RHRA 2ICEC 3CQZH 3KF6B 2XNAC 3UDXA 1Y1VG 3FKIB 5CBAE 4DV6L 4CKEA 1PA6A 3VYUA 1VQIA 3NQTA 2OCEA 4B3SQ 1IYUA 2NN6I 1TVXA 1I6VC 4KJOA 4LWCA 4QCLA 2PQEA 2N78A 4DV3L 2XN9C 2A6ED 1SDFA 1KDAA 2B3GA 2A68D 3QR8A 1IZ6A 4DV5L 3KLRA 5IYBH 3TZUA 3GTMB 5CC4A 3NUCA 2AUKA 4RGTA 3SXHA 3H15A 3PO2B 2NVTB 2OTJA 1TWHH 2X69A 3VR5A 5C4JH 3FRPB 5IP9G 3EA6A 4QF4A 2MGSA 2FMCA 1SE3A 3S16B 4LK1C 4C1NK 1D5XC 2EY1A 2PQAA 3L3OC 1HR0L 3G48A 4QB4A 2QGQA 2N88A 1VQNA 1I6HH 3U58A 2A5HA 3FPPA 3TP5A 4IO9A 1G2TA 1M4VA 1OO9B 4DPGA 1K83B 3VDYA 4A93G 3PO2G 2M2LA 1MJCA 4RFBA 1H9SB 1Y8PB 1ILPA 4DA2A 1XJVA 1ET6A 3TP7A 4A3IB 1B70B 3TP8A 3MVVA 3U4ZA 4CDCC 4A75A 1IHZA 4DR6Q 3OHXC 4A3EB 4K0KQ 2YTXA 3S1NB 3T1YL 1D1KA 3IAYA 3CCMA 4J8QA 1YBYA 4DU9A 4JPBW 2PO4A 2QKIC 3KF6A 2CVRA 1PTOD 3GTPH 4QMGA 3HOZH 1TWAB 5EAYA 2NN6G 4DR4Q 1TY2A 1P8LA 5BN4A 1WTQA 3KLWA 3P75A 4GLVB 5CV9A 3AFPA 4XT1B 4GZYC 1CKOA 3PUZA 5E3FA 5IGFA 2R92G 4DXGA 2HDLA 3K6OA 3SR1A 3MFGA 3I72A 1LYLA 1S5ED 3D0FA 2IX3A 1PFMA 1O7YA 4DUYL 4QQBX 2VNUD 2F0NA 2CQOA 3QB3A 3HOWH 1J6QA 4ULLA 4JC0A 1Q3LA 2JA6H 2EY5A 3HOVG 4L63B 5JOBA 4C3HH 3FHWA 3AU7A 2K75A 2UUBQ 1NMFA 3NBIA 3S1RB 1F77A 5C4JB 3NBHB 1EYAA 1D5ZC 1G2SA 3K7AH 3W1GA 3GTJB 4JI6Q 2B2WC 1VQPA 4DUZQ 4HIOA 4JG2A 4R4QA 4X62L 3PIP3 1N36Q 4JI4L 2AKWB 3P1HA 1BO0A 4UY8C 4BXXG 5IYBG 4C3JG 5M5YB 1D5MC 2F3VA 1UEAB 3PCOB 3T1HQ 3X3MA 4JOIA 4U68A 3R93A 2I0QA 4CBVA 3OW2A 2BH2A 1RCVD 2HUGA 3Q0AA 3HOZG 3BZKA 4WFN3 3PQIA 1X3FA 2PCFB 4APVA 4BBRH 5E4WC 4K14A 1QNUA 3Q22A 4X64L 3BZCA 1K3RA 1SRUA 2KEEA 2RDGA 3IRBA 1KXLA 2EXZA 1A3TA 3G6JB 3BDOA 3I90A 5FLXE 2K5HA 1YVCA 3R2TA 5AFWA 1VQHA 4DAPA 5IWAQ 1PZID 3TEHB 1DCZA 5J3BA 3K58A 5C4XG 4JBMA 3BVGA 2JXMB 3GQBA 1GUNA 2MO1A 1EIHA 5C4XB 1SYBA 2MFIA 1H95A 4B9WA 4A3IG 1J5EL 3T4AC 3EFXD 2YV5A 4L5QA 1TWFH 5LL6S 1PH1A 1PTOH 1SYFA 1EWIA 4RKBA 2MPMA 3M9BA 1V1OA 1BVSA 4DR2L 3WOEA 3HFZB 3KYHC 2FINB 3SK4A 3S16H 5J1ZA 2NBFA 3NSWA 4A3CG 4DR4L 1K28A 5CV4A 2K14A 1LT4D 2B2VC 3CMEA 4DR5Q 5ELOA 4TRDA 2EOTA 1Y1WB 1Q12A 2V1CC 4DK6C 2WB1G 2WKDA 1N32Q 3VR4A
chains in the Genus database with same CATH topology
3SE0A 3HOXB 2NWGA 4ZYSA 3C46A 4ODGA 2EJFC 3HOYB 3K5OA 1S5CD 1W6KA 1RF2D 1BCPF 2XRQD 4JBWA 1T5EA 3MAQA 2FFKB 1LV9A 4ZAIA 1F2MA 4KTAA 1DXMA 1ENAA 4KK7A 4A3FB 3LNNA 4BS9A 2Z4HA 3D6WA 3X3NA 2F4IA 1LABA 1CI3M 3KBGA 4YIJA 1Y8NB 2L1BA 2R92B 1PZJD 5D14A 1SMYD 1JWUD 1EL0A 5IGGA 1V43A 2O2LD 3K5LA 2RSOA 1LT5D 2F0QA 4B9XA 3NQIA 1PRTB 2LS01 5EPJA 2EYOA 5I6WA 1DOMA 1V1PB 3F2UA 4J1MA 1AW7A 1TIID 3NHHA 3MXPA 4N9PA 2AQ1B 2K33A 3CKIB 4KD4A 4FP5D 1QJOA 3I91A 1AFPA 1DYQA 2PPBC 4K6DA 4RCNA 2WACA 2A68C 1V8QA 3N6RA 1MSHA 1OXTA 1IKLA 3HKZB 4H7BA 4LJZC 1VMPA 4XQQA 5C3WA 1RJTA 2RDFA 3BYTB 3IKJA 2O4XA 1EOTA 2MHVA 3M7NA 1HQRD 2PW5A 1NR4A 1QWYA 2AWNA 3D4WA 2NB0A 5JVG3 2LKVA 1KLUD 4F8MA 3M4OB 2KQ3A 4DAYA 1Z6HA 4Z9CB 3A8JE 4C2MB 1S5BD 1XXGA 2F3WA 4ME5A 3E5SA 3E0JA 2EYFA 5A2QE 4ZKCB 2E76C 4ZLTF 1I4QA 1S5FD 4NMZA 4FVMA 4R8NA 1PZKD 4FYDA 1GUGA 4HTHA 2K7VA 1F2YA 2F0PA 3DXJC 3HEJA 5J39A 4ZUJA 2M00A 1HRJA 4PNYA 1G291 3ITPA 1EWCA 1M8AA 4CHTB 3OPOA 3FMCA 5A2QL 1AP0A 3VR2A 1VCIA 4PMBA 5DNFA 3T56B 4HCSA 1CTMA 1O80A 1STBA 5ELDA 4IQZA 1PLFA 4OO1H 4KN7C 4IUQA 1BQQT 1T5XD 1QG7A 3L7ZC 4HSPA 1SYEA 3ERQA 3QOJA 3OSOA 1FR3A 2KUMA 1Z47A 1EZ6A 3PV0A 1HUMA 2JSOA 3NPPA 1LTID 2EYMA 3PUWA 1WCMB 2B8FA 2EY2A 3DEPA 4U673 2VB3X 2EE1A 4HN7A 2JEAI 5CORA 2B2UA 4F7XA 2Q8RE 2GA4B 1EY7A 1FNVA 1CHQD 3RZDB 1LTRD 4O1NA 2VUMB 2JA5B 5E4XA 5JVH3 1KNAA 2DY7A 1E2ZA 4UAIA 4ZUIA 2K04A 1EFID 1FGBD 1I4XA 2O5JC 4FF3A 3FVQA 2B2TC 4K6LA 5EBCA 3S1QB 2AQ2B 5HURA 1JORA 1A3VA 5KGUA 1XX8A 1QE6A 1QB5D 4R9WA 4IFDJ 1X3QA 2Y0SB 1K8MA 3GTKB 3VR6A 1MD2D 2MUYA 1BBXC 5T1GA 2CHBD 2I46A 3D3RA 4NP5A 3HGBA 3NE5B 3P7JA 3DWPA 3VA5A 1JWSD 5KEEA 2F0FA 3CU7A 3BDCA 3OIQA 4TSSA 3O13A 5FLXL 3KBXA 2JP1A 1SJHD 4WJWA 1L0YB 2PZTA 3G7LA 1UAPA 3D4RA 1QCBD 4HMIA 2Z8LA 5EJWA 4K5XA 1JCKB 4G7HC 4LAAA 5CYUA 2VB2X 1Q8IA 4DNTB 3DUZA 2ZXPA 1I50B 3CHBD 2B2YC 2SOBA 3P20A 3QG1A 1JOKA 1B9MA 1OXUA 4K2KA 3PUXA 1LT6D 3A55A 4IFDH 3DHQA 1JQYD 1VF7A 1HTPA 2KJXA 4HSVA 4RA8A 1F9QA 5EPLA 4DF7A 4F87A 1K8OA 1HUNA 3SHLA 1CA6A 2SEBD 3J80E 2WKCA 4DFAA 2FMMA 3I4LA 3N52A 3Q6SA 1GHJA 1RD9D 3ND8A 3HZXA 2IWHA 4DAVA 2CW0D 1HTLD 2EYLA 5JEAG 4BBSB 2FJ2A 3R2IA 3W2DA 2QDBA 4ZRZA 1MI2A 5C3EB 1ZEQX 2VXWA 2K28A 3SK5A 3K7AB 4RAUC 1B3AA 3IFDA 1IYVA 1DONA 1IL8A 2JA6B 3H3VC 4HR7B 4ZKBB 1B53A 2ICIA 4HCEA 4OHJA 3QWNA 3EJIA 1F9PA 5LL6X 2KEDA 2NUCA 3DM1A 2NTTA 5C0XH 2BCOA 2J7ZA 3BVMA 4CKCA 2RA4A 2B63B 1ML0D 4DXFA 1BCPB 4IALA 3PIO3 3S15B 1CQFA 5C6AA 1BDOA 1SYCA 1ENFA 1X3PA 3I4NB 4XDXA 2F0WA 2C9OA 4H13C 2NVYB 1CFMA 2PW7A 3A54A 3RZOB 2D5DA 2EYJA 3GTLB 2L12A 1JWMD 4C3HG 3C1EA 5JPNC 1U9RA 1DD2A 1NCVA 3OMGA 2F0EA 5JAVA 3S2HB 3BYYB 4P2CB 2A6HD 4N9TA 3EVQA 5IGBA 1C8CA 2NVQB 2L4NA 1QOHA 1DOLA 3PUYA 2E74C 1VF5C 3T16A 3T53B 5FKAC 4G7OC 1F2LA 3RD4A 3ND9A 3URYA 2OF1A 2B2VA 4MN3A 1LTGD 3J7AF 4XQNA 1EYDA 5CV8A 2OT2A 3HG9A 4XXEA 5I2XA 2PNRC 1F9RA 3FEWX 2HDMA 3TN2A 1TWFB 4IUNA 1E2WA 2FHTA 4C56C 1BCPD 5DM73 4QIWB 3S14B 1FNUA 1PDQA 4RGNA 2F1MA 3J81L 2R7ZB 1LT3D 1RODA 3M3YB 1ZKOA 1TQOA 2EZVA 1R4QB 2L55A 4G4KA 4MIUA 4RH6A 1D6EC 3JAME 4F88A 2K1BA 3MTSA 1GUTA 1I6HB 5ISRA 1HCZA 4C3IB 2Q8IB 1BF4A 2BDOA 5IT9E 3NWSA 3MZ5A 1H9JA 3S9WA 2OXPA 2SNSA 2K01A 3A7LA 3EROA 4DN4M 2JEBI 5LHY1 1II3A 1GXDC 5M5WB 1AEXA 3AB9A 1E0BA 3VR3A 2F0TA 2K03A 3V05A 3WDNA 1EWHA 3J80L 1CM9A 1Y1VB 3NWTA 5G3LF 2F0KA 1G91A 3HOVB 1ZYRC 3RLFA 1KDCA 1WTWA 1XWEA 2Q8TA 1SBBB 3R3OA 3RUZA 3EQLC 5JJZA 2EVBA 4A3MB 1TT2A 2LY7A 3A56A 1X32A 4HAEA 3MA2B 4CJ2C 4NDXA 5C3XA 3CRLC 3K5NA 4IUTA 4RWSC 4G57A 2J0TD 1CT1D 2EYPA 2G9DA 1GHKA 1MBYA 2L9HA 1H9MA 4ABNA 4KY6A 3QO2A 1SNDA 2R61A 4OO1I 2KVMA 1C4QA 1J9OA 1YNND 3TDQA 5A35A 1SNPA 3M4YA 2XVSA 1CZGA 2RSNA 2LFNA 1OXVA 1KLGD 3BG3A 3HS0C 2E75C 1AZQA 1GUOA 1BOSA 4X3KA 1D1IA 2JA8B 1FYCA 4KKUA 4S3SA 4CJ0B 2CW0C 1TS2A 1BXTA 2BA0A 2C5CA 3L9AX 1EIGA 1HFGA 4BA1I 1WD0A 3PMFA 3SVMA 2WINB 1A2TA 1CQVA 5EKKA 2DY8A 2WIIB 5CBEE 3KK7A 3I4MB 4IN3A 4K8JA 2R93B 1EY6A 1PYWD 1NUCA 1HXYD 3LX0A 1EY9A 4IURA 5EGTA 5K5PA 1ESRA 2XWJB 2SDFA 3SK6A 1B9NA 1EU4A 3GTGB 1I4GA 1TS5A 5IT9L 1O7LA 5KYIA 5C0XI 3VYTA 2I07B 4I65A 1A2UA 3RMHA 2KCCA 4KI0A 3AMUA 4C3JB 1I3QB 1E2VA 2JA7B 3OWEB 3A8KE 4BWGB 4I7ZC 1TWCB 1VMCA 5HGTA 1BNZA 1XYIA 2EPBA 4M1UB 4IFDI 4K5WA 3BS1A 1A6XA 5D65A 1JR0D 4ZK9B 3BZDB 4AYBB 2Z4IA 5IODA 4DGZA 1U4RA 5FOBB 1Q1EA 3CRKC 3M85A 1LTTD 3GD7A 1R9TB 4M8AA 4BY1B 5KIXA 4QUCA 2ZT9C 4J6HA 2YU9B 2K05A 3H6MA 1TY0A 4OO1G 1RKNA 3I3CA 4KKTA 4XT3B 3D31A 3ZYYX 1A15A 4NKLA 1JICA 1JOOA 1Q90A 2BDNA 1SNOA 3R8BA 1MSGA 3KF8A 4RGMA 2BE5D 4A93B 5FO9B 3S1MB 2XIWA 3K59A 5M3FB 2A73B 5KYLA 4X3SA 4K8IA 2K5WA 4KHVA 3GV6A 4PMCA 4K2LA 2R3ZA 3QOLA 1TWHB 4C1NI 4EQNA 2E2JB 1U4MA 2RBMA 1I4RA 2KA7A 5CGKA 1SFOB 5E1FA 5M3MB 3VA7A 1EU3A 2ENBA 3S2DB 2IX0A 5ELEA 1SAPA 1EQTA 4FO2A 5CV5A 3S17B 1EEFD 1D2BA 4BY7B 1SXTA 2Z1CA 1SNMA 2B39A 1SE4A 4A3BB 2F0HA 2F0MA 4XQJA 4O42A 4H44C 3NP8A 1PTOC 4B08A 5ELCA 5K36H 5CV7A 2F03A 3DMUA 1EY5A 1STHA 1IW7D 4CKBA 2G9HD 2WV6D 1B2TA 4MHEA 4FNFA 2PYKA 1KNEA 1HA5A 4DK1A 1LTSD 1J8IA 3GV3A 1GOZA 1PTOB 5D3IB 1ESFA 4JK1C 2DNEA 2F0IA 1WD1A 2HCCA 3VYSA 1LO5D 4KY7A 3D8GA 1R4PB 1YNNC 5J22A 2YYZA 2A6EC 4V0BA 2WAQB 4FF4A 3QIAA 4XYOA 1AZPA 1H9SA 1STAA 2F0DA 4KKSA 2EY6A 3C1FA 2OEOA 1NSNS 2MP1A 3E6ZX 4OIJA 1OXSC 1BCPC 4L6TB 2RQXA 5C4HA 2A6HC 1O7ZA 4TKOB 3MEHA 1OXXK 5C5MA 5CR3A 3TP6A 2EYHA 5BN5A 1PRTF 1U4LA 2L5TA 1RHPA 2F0LA 1HFNA 1ILQA 4A3GB 2E2DC 1JC7A 3LWEA 2F0JA 3IFTA 1EY0A 1Q1BA 2RKSA 4XTCS 3ONAB 5FK9C 5KNCA 1PXUA 5TSSA 3HOWB 1RDPD 3WOFA 2PZWA 2IW3A 1KABA 1ENCA 3NBHA 3SK8A 1YNJC 2B2YA 1SYGA 1V1PA 1JB3A 4ID6A 1G8ZD 5JEAJ 1DOKA 1S4ZA 3U9SA 3U9OA 5KRUA 1WTPA 1LTBD 1F2ZA 1Z7TA 1B4OA 5IOCA 5KNDA 1RTNA 1W6JA 2NYZD 3CQZB 2L11A 2K32A 5M9OA 3K5MA 1SYDA 2TSSA 3OOCA 4XYQA 5DAUA 1STEA 1EY4A 3Q23A 1KTKA 5C44B 3A7AB 1H9RA 1SMYC 4EVOA 1B1ZA 3I70A 1O78A 2EJMA 4KMUC 1EZ8A 4FF1A 5C4ZA 2EDGA 2F0OA 2QILA 1WTRA 1TR5A 4IUUA 1I4PA 4XIGS 2N55A 2V4DA 3IL8A 2XWBB 2ZXOA 3M7GA 2B2TA 4KHZA 3C3LA 3DEOA 3HOZB 5C0XG 2WB1B 1MGSA 3MWYW 5C5LA 4Y7NB 3GTQB 1GUSA 1HPCA 1TS3A 1HA6A 4KJNA 4KN4C 4FXGC 1HQMC 2KOLA 1SSOA 2NVXB 5M5YB 1QNKA 3MFYA 2QF7A 2E2HB 4Q0FA 1BUVT 2A74C 2NZ1D 2A69D 3PUVA 1F9SA 3KLSX 1BR9A 4RHSA 3H0GB 3OWFA 1AN8A 4C3HB 4V190 4IUPA 3NTIA 2R6GA 2O5IC 3MXUA 2J4XA 5JEAH 3GTOB 2IX1A 2QEJC 2D2CC 5IIFA 3C2PA 5I9OA 5K36G 1H9KA 3J7YW 1PRTD 4KY5A 3SEBA 5IGCA 5KNBA 2BE5C 5COYA 1EQVA 2X6GA 2PZUA 5EBDA 5DEHA 4CGYB 4R8IA 1GJXA 3HRZC 3MXGA 2H1EA 3D4DA 1ONLA 2H4OA 2KECA 3BDLA 2X6LA 3TZDA 3NTHA 3KUPA 1CK1A 4A3DB 5IGDA 1VDZA 2CQAA 4C3IG 4TQUS 2IPKD 2AWOA 3UI2A 1GUWA 4EQOA 5F2DA 1LACA 5C0XJ 4PMWA 4QUFA 1XTCD 1CZWA 3VYRA 4OIKA 4G7ZC 1NAPA 2XRSD 3FDTA 3V2TA 4EQPA 4PQXA 1CA5A 2RVLA 3T51B 2LMCB 1EYCA 1DM0B 2WP8J 5FO7B 3D6CA 5ELBA 4RKLA 4X3UA 4UDUC 2KCNA 4WRDA 1Y8OB 2F0UA 3I73A 1SEBD 2F0VA 1B44D 2D9UA 1EEID 1UUPA 4LMQD 1ET9A 3NK9A 5DM63 4A3JB 2B8GA 4OL7A 5JPMC 2E2IB 1DZ1A 3HP3A 5M5XB 4E6IA 4BA2I 3SDZA 4RCOA 1FD7D 3OIPA 3Q24A 1PRTC 1JOQA 4Q5VA 1KDBA 1KAAA 3I8ZA 1ICWA 1STYA 3OMCA 4K5VA 3V96A 4L8JA 2K5QA 3DWAA 3FPUB 1LTAD 1SE2A 4FXDA 4HMJA 1STGA 1HHVA 3TSSA 2BOSA 5EPKA 1UNSA 4X3TA 4EGVA 2SNMA 1TU2B 2JE6I 1S5DD 1WTOA 1I4HA 3GTPB 4BBRB 4DK0A 4A3KB 1ZXTA 1SNCA 4RGOS 1G6ZA 3OW7A 1A3UA 3DWQA 1NR2A 3H91A 2L0CA 5IGEA 1B50A 5EKLA 4FXKC 3TBIB 2JYOA 3H09A 5I4DA 3PO3B 1STNA 2BA1A 2A69C 2NTSA 3HOUB 1IKMA 2K5DA 2IJ0A 3K0YA 2AUJD 4HEDA 1PFBA 1FNWA 3A8IE 3W3AA 3KLSA 4ILWA 1SJED 1SNQA 3BVZA 2F0SA 2NN6H 2RDHA 2B2UC 1ZYRD 3MC0B 2M9VA 3K57A 2MJ8A 3H94A 5G3LD 2XSCA 5T1IA 5EQ0A 1QILA 2AQ3B 2KHSA 1PMRA 1RTOA 2K6AA 1DJRD 5I6YA 5I9PA 4OGQC 4CJ1B 5BN3A 1WTVA 1YNJD 4PV1C 1PFNA 2D62A 5D3DA 4ZQ3A 1WVLA 2ID0A 1IW7C 3T13A 1L0XB 1Y69U 3NTKA 3MXNA 1U4PA 3NXWA 5ELFA 3GP7A 4DNRB 1LLRD 2DN8A 3J81E 4IZ8A 4IUVA 1C48A 2TMPA 2IL8A 3LWUA 1JE4A 2ZXRA 3GO5A 5CV6A 1CHPD 5I2YA 1TWGB 2HQEA 4KV6A 4H0LC 5CMDA 5FO8B 1PTOF 2B2WA 2DNCA 1WTXA 3JAML 4FF2A 1TKWB 2EJGC 4NW2A 1TS4A 4KD3A 4IFDG 2F0GA 4WORA 1EY8A 5NUCA 2IT1A 2HCIA 2QCPX 3MHBA 5EKIA 2PMZB 3TMEA 3J7AV 3QJYA 4RHRA 2ICEC 2XNAC 3FKIB 5CBAE 4CKEA 3VYUA 3NQTA 1IYUA 2NN6I 1TVXA 1I6VC 4KJOA 4QCLA 2PQEA 2XN9C 2A6ED 1SDFA 1KDAA 2A68D 3KLRA 3TZUA 3GTMB 5CC4A 3NUCA 2AUKA 4RGTA 3SXHA 3PO2B 2NVTB 3VR5A 2X69A 3FRPB 3EA6A 4QF4A 2MGSA 2FMCA 1SE3A 3S16B 4LK1C 4C1NK 1D5XC 2EY1A 3L3OC 4QB4A 2N88A 2A5HA 3FPPA 3TP5A 1G2TA 1M4VA 1OO9B 1K83B 2M2LA 4RFBA 1H9SB 1Y8PB 1ILPA 4DA2A 1ET6A 3TP7A 4A3IB 3TP8A 3MVVA 1IHZA 3OHXC 4A3EB 3S1NB 1D1KA 3IAYA 4J8QA 4DU9A 2PO4A 2QKIC 2CVRA 1PTOD 4QMGA 1TWAB 2NN6G 1TY2A 5BN4A 1WTQA 3P75A 5CV9A 4XT1B 4GZYC 3PUZA 5E3FA 5IGFA 4DXGA 2HDLA 3K6OA 3SR1A 3MFGA 3I72A 1S5ED 2IX3A 1PFMA 1O7YA 2VNUD 2F0NA 3QB3A 4ULLA 1Q3LA 2EY5A 4L63B 5JOBA 3AU7A 3NBIA 3S1RB 1F77A 5C4JB 1EYAA 1D5ZC 1G2SA 3GTJB 2B2WC 3PIP3 3P1HA 1BO0A 4C3JG 1D5MC 2F3VA 1UEAB 3X3MA 4U68A 3R93A 4CBVA 1RCVD 2HUGA 3Q0AA 4WFN3 2PCFB 5E4WC 4K14A 1QNUA 3Q22A 2KEEA 2RDGA 2EXZA 1A3TA 3G6JB 3BDOA 3I90A 5FLXE 3R2TA 5AFWA 4DAPA 1PZID 1DCZA 3K58A 3BVGA 2JXMB 3GQBA 1GUNA 1EIHA 5C4XB 1SYBA 4B9WA 3T4AC 3EFXD 5LL6S 1PTOH 1SYFA 4RKBA 2MPMA 1V1OA 3WOEA 2FINB 3SK4A 5J1ZA 2NBFA 3NSWA 5CV4A 1LT4D 2B2VC 4TRDA 2EOTA 1Y1WB 1Q12A 2WKDA 3VR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQN A;  4G57 A;  2O4X A;  3TME A;  5KYI A;  4HMI A;  2RBM A;  2F0O A;  2EYP A;  2OEO A;  1NSN S;  3C1F A;  1EYA A;  4OL7 A;  4K5X A;  2PW5 A;  5CGK A;  3EJI A;  5HGT A;  2KHS A;  4ODG A;  2EYM A;  4LAA A;  5E1F A;  3D4D A;  3NQT A;  5I6Y A;  4E6I A;  4KY6 A;  1TR5 A;  5I9P A;  2ENB A;  2NUC A;  3D4W A;  1SND A;  5C4H A;  2EY2 A;  4K5W A;  2LKV A;  3BDL A;  4KJO A;  1TQO A;  3MEH A;  2SOB A;  5CV5 A;  2PQE A;  4IAL A;  4F8M A;  1JOQ A;  1KDB A;  1JOK A;  2KQ3 A;  5C5M A;  1KAA A;  5CR3 A;  4ZQ3 A;  1KDA A;  1STY A;  4K2K A;  3P1H A;  3T13 A;  3TP6 A;  2EYH A;  3OMC A;  4K5V A;  1F2M A;  4KTA A;  5CC4 A;  3NUC A;  3DHQ A;  3SXH A;  1ENA A;  2F0L A;  5C6A A;  5IGD A;  4F7X A;  1SNP A;  2F3V A;  1EY7 A;  1SYC A;  5IOD A;  1SNM A;  3NXW A;  5C5L A;  4DGZ A;  4QF4 A;  4MIU A;  4HMJ A;  1STG A;  2F3W A;  4ME5 A;  2F0H A;  3E5S A;  2F0W A;  2F0J A;  2EYF A;  4YIJ A;  2F0M A;  2EY1 A;  4KJN A;  5DEH A;  3NP8 A;  1EY0 A;  4IZ8 A;  4QB4 A;  2PW7 A;  5ISR A;  2RKS A;  4DF7 A;  4NMZ A;  2SNM A;  4R8N A;  2EYJ A;  5KIX A;  4EQO A;  5CV7 A;  5F2D A;  5IGG A;  3DMU A;  4K14 A;  3TP5 A;  3MZ5 A;  1EY5 A;  4ZUI A;  3SHL A;  4HTH A;  4J6H A;  1STH A;  2PZW A;  4S3S A;  3S9W A;  1F2Y A;  2OXP A;  2EXZ A;  2F0P A;  1A3T A;  1SNC A;  2SNS A;  3C1E A;  1U9R A;  5CV6 A;  1KAB A;  1ENC A;  3OMG A;  3HEJ A;  4DFA A;  5J39 A;  2F0Q A;  4ZUJ A;  2F0E A;  3H6M A;  3SK8 A;  5JAV A;  2HQE A;  4KV6 A;  2M00 A;  1RKN A;  4PNY A;  3ERO A;  3PMF A;  4B9X A;  3TP7 A;  1A3U A;  4N9T A;  1SYG A;  2PYK A;  3EVQ A;  1II3 A;  1A2T A;  3HZX A;  3ITP A;  4ID6 A;  3TP8 A;  3V2T A;  5IGB A;  2EYO A;  3MVV A;  5HUR A;  5J22 A;  1IHZ A;  4EQP A;  5I6W A;  5IGE A;  4NKL A;  1JOR A;  1AEX A;  5EKK A;  5EKL A;  1A3V A;  1JOO A;  1SYB A;  4J1M A;  3U9O A;  5KGU A;  4B9W A;  1SNO A;  2EYL A;  3NHH A;  4K8J A;  3MXP A;  2F0T A;  1EY6 A;  4N9P A;  5KRU A;  3OWF A;  1NUC A;  4DU9 A;  1F2Z A;  1STN A;  1EYC A;  4KD4 A;  4PMB A;  3T16 A;  3LX0 A;  5IOC A;  1EY9 A;  2QDB A;  4QMG A;  1SYF A;  5EGT A;  5K5P A;  2F0K A;  3D6C A;  1STB A;  4RKB A;  4KD3 A;  2F0I A;  3P75 A;  4NP5 A;  3SK6 A;  1KDC A;  2F0G A;  4K6D A;  5CV9 A;  5M9O A;  2OF1 A;  2WAC A;  4RKL A;  4WOR A;  1EY8 A;  1EYD A;  5NUC A;  5CV8 A;  5E3F A;  5IGF A;  3RUZ A;  3R3O A;  3SK4 A;  1SYD A;  4KY7 A;  3D8G A;  5J1Z A;  1SNQ A;  5DAU A;  3SK5 A;  4WRD A;  3VA5 A;  1EY4 A;  1SYE A;  2F0U A;  3SR1 A;  5KEE A;  2F0F A;  3ERQ A;  5KYL A;  5IIF A;  3BDC A;  4K8I A;  2F0S A;  5I9O A;  3QOJ A;  3OSO A;  1TT2 A;  5CV4 A;  4KY5 A;  4I65 A;  4H7B A;  2F0V A;  4KHV A;  5IGC A;  1A2U A;  4EVO A;  4NDX A;  4PMC A;  4IUN A;  4K2L A;  1EZ6 A;  2F0N A;  3QB3 A;  5C3W A;  4TRD A;  3MHB A;  1STA A;  5C3X A;  1EZ8 A;  2EY5 A;  2F0D A;  2RDF A;  3QOL A;  5JOB A;  3NK9 A;  1EQV A;  2EY6 A;  2PZU A;  5C4Z A;  2PZT A; 
#chains in the Genus database with same CATH topology
 3SE0 A;  3HOX B;  4YHH L;  2NWG A;  5FLM H;  3EBE A;  4ZYS A;  4HJ8 A;  3C46 A;  4ODG A;  2EJF C;  1PHJ A;  4RMF A;  3M4Q A;  4LF9 L;  3HOY B;  1QUQ A;  1S5C D;  1W6K A;  3K5O A;  1RF2 D;  1BCP F;  3JC6 6;  2XRQ D;  4PG3 A;  4JBW A;  4JI2 Q;  1T5E A;  1AH9 A;  5IYD H;  3MAQ A;  2FFK B;  1LV9 A;  4ZAI A;  1F2M A;  4KTA A;  1DXM A;  1ENA A;  1XTD A;  4KK7 A;  3UE0 A;  4A3F B;  3LNN A;  4BS9 A;  2Z4H A;  3D6W A;  2UXC Q;  3X3N A;  4A3I H;  2F4I A;  3STB D;  3E3X A;  2NVQ H;  4DV4 L;  4NXM L;  1LAB A;  1CI3 M;  3KBG A;  4YIJ A;  1Y8N B;  2L1B A;  2R92 B;  1PZJ D;  5AJ3 Q;  5D14 A;  2ZM6 Q;  1SMY D;  1JWU D;  4BXX H;  1EL0 A;  5IGG A;  1V43 A;  3CCV A;  2O2L D;  4DV7 Q;  2HIX A;  3K5L A;  2RSO A;  3J81 i;  1LT5 D;  2F0Q A;  4DAM A;  4JI8 Q;  4B9X A;  3NQI A;  1PRT B;  4HJ5 A;  3MEF A;  2LS0 1;  1VQJ A;  1D7Q A;  5EPJ A;  2EYO A;  5HY6 A;  4JBJ A;  1WOC A;  3RZD H;  3OTO Q;  5I6W A;  1DOM A;  1V1P B;  3F2U A;  4J1M A;  5M5W H;  1AW7 A;  1TII D;  3NHH A;  3MXP A;  1GVP A;  1GKH A;  4N9P A;  2AQ1 B;  2K33 A;  3CKI B;  3E9I A;  4KD4 A;  1IBK Q;  4FP5 D;  1QJO A;  4J15 A;  4MNO A;  1I5F A;  3I56 A;  5GAD C;  3I91 A;  4YWM A;  2Q2H A;  1AFP A;  1DYQ A;  2PPB C;  4K6D A;  4RCN A;  2WAC A;  2UXB Q;  3H3V I;  1E1O A;  2A68 C;  1V8Q A;  4GN4 B;  3N6R A;  1MSH A;  5M3M H;  1OXT A;  1IKL A;  3HKZ B;  2HIV A;  4DR7 L;  4H7B A;  4LJZ C;  1VMP A;  4XQQ A;  1L1O B;  5C3W A;  1RJT A;  2RDF A;  4A3G H;  3BYT B;  3HOX H;  3IKJ A;  2E8G A;  2O4X A;  1EOT A;  3K7U C;  2MHV A;  1W2B A;  1WYD A;  1HQR D;  2PW5 A;  5IT9 c;  1NR4 A;  1QWY A;  3M7N A;  1EFW A;  1YHA A;  3FKI H;  4LF6 L;  2AWN A;  3D4W A;  2NB0 A;  5JVG 3;  1OTC A;  3HKS A;  2LKV A;  1KLU D;  3KDF A;  4F8M A;  3M4O B;  1Z9F A;  2KQ3 A;  4DAY A;  2LXJ A;  1Z6H A;  4Z9C B;  2E2J H;  4L5T A;  4GOP C;  3A8J E;  3J7A 5;  1XNR Q;  4C2M B;  4BY1 G;  1S5B D;  1XXG A;  2CH4 A;  2F3W A;  4ME5 A;  3E5S A;  3E0J A;  2EYF A;  4YWK A;  4CDE C;  5A2Q E;  4ZKC B;  2E76 C;  1YJ9 A;  2JJQ A;  1JE5 A;  2Z6K A;  4ZLT F;  1I4Q A;  3HKZ G;  1S5F D;  4BY7 G;  4NMZ A;  4FVM A;  4R8N A;  1PZK D;  4DV0 Q;  1N36 L;  4DV1 Q;  4A3E H;  4FYD A;  2K52 A;  1K0S A;  1GUG A;  1UE1 A;  4HTH A;  2K7V A;  1F2Y A;  2F0P A;  4DNI A;  3DXJ C;  3HEJ A;  5J39 A;  1B3Q A;  4ZUJ A;  2M00 A;  1HRJ A;  4PNY A;  3GTJ H;  3CCR A;  1G29 1;  2VQE L;  4JYA L;  3ITP A;  1EWC A;  4DK3 C;  1M8A A;  4CHT B;  2LSS A;  2GN5 A;  3A5U A;  3OPO A;  2FXQ A;  3FMC A;  5A2Q L;  1AP0 A;  3VR2 A;  1VCI A;  4JCV E;  4PMB A;  5DNF A;  3HOW G;  3T56 B;  4A3D H;  4HCS A;  3S2H H;  4DR3 L;  1CTM A;  1O80 A;  1STB A;  1E3P A;  1T9H A;  5ELD A;  4IQZ A;  1PLF A;  2VW9 A;  1CKN A;  4X65 L;  4OO1 H;  4KN7 C;  4IUQ A;  1BQQ T;  1XPR A;  1T5X D;  2UUC Q;  2CWP A;  1QG7 A;  3L7Z C;  3KDF B;  4HSP A;  1SYE A;  3ERQ A;  3QOJ A;  3OSO A;  1FR3 A;  2A8V A;  2KUM A;  1Z47 A;  1EZ6 A;  3PV0 A;  1HUM A;  2E2H H;  2IY5 B;  2JSO A;  5LMU L;  2R93 G;  3NPP A;  3CC7 A;  1LTI D;  1BBU A;  2VUM H;  4YCV A;  2EYM A;  4QL5 A;  3M4P A;  3PUW A;  4GLA C;  4GNX A;  1WCM B;  3W5O A;  2B8F A;  2EY2 A;  3DEP A;  4U67 3;  4BY1 H;  2VB3 X;  2EE1 A;  4HN7 A;  5GRO A;  2JEA I;  4JV5 L;  5COR A;  2B2U A;  4F7X A;  2Q8R E;  2GA4 B;  1EY7 A;  3S1R H;  1FJG L;  1FNV A;  1CHQ D;  1U5K A;  3RZD B;  1HZ9 A;  1HR0 W;  1CKN B;  4O1N A;  1LTR D;  2VUM B;  3CC4 A;  2JA5 B;  5E4X A;  5JVH 3;  3I4M H;  2K4K A;  1KNA A;  2DY7 A;  1X55 A;  1E2Z A;  1NNX A;  4UAI A;  4ZUI A;  2K04 A;  4GKJ L;  1EFI D;  1FGB D;  2CWA A;  1I4X A;  2O5J C;  4FF3 A;  4JI1 Q;  3FVQ A;  2B2T C;  1FGU A;  4K6L A;  3GTM H;  1XMO L;  1QUQ B;  5EBC A;  4DR2 Q;  4GN3 B;  3S1Q B;  1JT8 A;  3AQQ A;  4KLK A;  2AQ2 B;  5HUR A;  1HNZ L;  1JOR A;  1A3V A;  5KGU A;  1XX8 A;  1QE6 A;  1VQO A;  4DR7 Q;  1N8R C;  1QB5 D;  4R9W A;  3CCU A;  4GNX B;  4IFD J;  4A4I A;  1X3Q A;  2Y0S B;  1K8M A;  3GTK B;  3VR6 A;  1MD2 D;  2MUY A;  1BBX C;  5T1G A;  3D3R A;  2CHB D;  2I46 A;  2VY3 A;  4NP5 A;  1B7Y B;  3HGB A;  3NE5 B;  2Q2U A;  2Z6B A;  3P7J A;  3DWP A;  3VA5 A;  1PH5 A;  1JWS D;  5KEE A;  2F0F A;  3CU7 A;  3BDC A;  3OIQ A;  4TSS A;  3O13 A;  5FLX L;  4H02 A;  3KBX A;  1IBM L;  3HOV H;  2JP1 A;  1SJH D;  4WJW A;  1X3E A;  1N34 Q;  1L0Y B;  2PZT A;  3G7L A;  1QZG A;  1UAP A;  3D4R A;  3S15 H;  4IPG A;  1QCB D;  4HMI A;  2Z8L A;  5EJW A;  4K5X A;  1JCK B;  4G7H C;  1IBM Q;  4LAA A;  5CYU A;  1YJN A;  2VB2 X;  1PH9 A;  1Q8I A;  3MXN B;  4DNT B;  4A3B H;  3NEM A;  2UUA L;  1VQK A;  3DUZ A;  1UE7 A;  3DLL A;  2ZXP A;  1FL0 A;  1I50 B;  3CHB D;  2B2Y C;  2SOB A;  3P20 A;  3QG1 A;  1JOK A;  1B9M A;  5JJI A;  1OXU A;  4K2K A;  3CAM A;  3G71 A;  4LF7 L;  3PUX A;  4O2D A;  2JA6 G;  1LT6 D;  3A55 A;  4IFD H;  3DHQ A;  1HZB A;  3K81 C;  1JQY D;  1VF7 A;  2XTI A;  1C9O A;  1HTP A;  2KJX A;  1M1K C;  4HSV A;  4RA8 A;  3I2Z A;  1F9Q A;  5EPL A;  1JMC A;  2UXD L;  5E7N A;  2B63 H;  4DF7 A;  4F87 A;  1K8O A;  4EX5 A;  1HUN A;  1IYJ B;  3SHL A;  1CA6 A;  2SEB D;  2Q2T A;  4B3M Q;  3J80 E;  2WKC A;  4DFA A;  3TRE A;  2FMM A;  2JA7 H;  3I4L A;  3N52 A;  3Q6S A;  4JVZ A;  1JJ2 A;  3H0G G;  1PH2 A;  1MKH A;  1GHJ A;  2KEN A;  1RD9 D;  3FKI G;  3ND8 A;  3HZX A;  4CDD C;  2IWH A;  4DAV A;  2CW0 D;  1UE5 A;  3FP9 A;  1HTL D;  2EYL A;  3RLO A;  4HID A;  5JEA G;  4BBS B;  2FJ2 A;  1X56 A;  3R2I A;  3W2D A;  2QDB A;  1B8A A;  2C35 B;  2ASB A;  3HOX G;  4ZRZ A;  1PV4 A;  1MI2 A;  1PH6 A;  3AEV A;  2DJG C;  5C3E B;  1ZEQ X;  1EQR A;  2KHJ A;  2VXW A;  4UP8 A;  1Y14 B;  1ASZ A;  2K28 A;  3SK5 A;  3K7A B;  4RAU C;  1B3A A;  3IFD A;  1IYV A;  1DON A;  3PO3 H;  1IL8 A;  5M3F G;  2JA6 B;  3GTL H;  3KOJ A;  3CCE A;  4EQ5 A;  3H3V C;  4HR7 B;  4ZKB B;  5BR8 Q;  1B53 A;  2ICI A;  4HCE A;  4OHJ A;  5IP7 H;  2NVY H;  3QWN A;  3EJI A;  1F9P A;  3F2B A;  5LL6 X;  2KED A;  4B3M L;  1I50 H;  2NUC A;  3DM1 A;  4LNQ A;  2NTT A;  2E5L L;  4YCU A;  5C0X H;  1E24 A;  4HJA A;  1HNZ Q;  1ASY A;  2BCO A;  2J7Z A;  3BVM A;  4CKC A;  2RA4 A;  2B63 B;  4C3I H;  1ML0 D;  4DXF A;  1BCP B;  4IAL A;  5JJL A;  3PIO 3;  2UXD Q;  3UDG A;  3S15 B;  1CQF A;  5C6A A;  1BDO A;  1SYC A;  1ENF A;  1X3P A;  1X6O A;  3ULJ A;  4YCW A;  4JI8 L;  3I4N B;  4OX9 Q;  4XDX A;  2F0W A;  2C9O A;  4H13 C;  2NVY B;  1CFM A;  2PW7 A;  3A54 A;  5M5X H;  3RZO B;  3F8T A;  2D5D A;  2EYJ A;  4B3T L;  3GTL B;  4R4C A;  4JI7 L;  2L12 A;  1Q86 C;  4HJ7 A;  1JWM D;  2AMC B;  3CP0 A;  3E9H A;  4C3H G;  3C1E A;  5JPN C;  1U9R A;  1DD2 A;  1NCV A;  3OMG A;  3I4M G;  1XPO A;  1K73 C;  4AYB G;  2F0E A;  5JAV A;  3S2H B;  3BYY B;  4P2C B;  2A6H D;  4N9T A;  4LFA L;  3EVQ A;  4QY7 A;  3RN5 A;  5IGB A;  2WAQ E;  1XMQ Q;  3F2C A;  1C8C A;  2NVQ B;  2L4N A;  1QOH A;  1DOL A;  1EOV A;  4IPC A;  3PUY A;  2DUD A;  2E74 C;  1VF5 C;  2VL6 A;  3T16 A;  3T53 B;  5FKA C;  4G7O C;  4DV7 L;  2EQS A;  1F2L A;  3RD4 A;  2A19 A;  2NZO A;  3ND9 A;  3URY A;  2OF1 A;  2B2V A;  2RF4 A;  1LTG D;  4MN3 A;  3J7A F;  4XQN A;  1EYD A;  2KCM A;  5CV8 A;  2OT2 A;  1VQ4 A;  5AJ3 L;  3HG9 A;  2ES2 A;  1EIF A;  4XXE A;  5I2X A;  3I55 A;  3RNU A;  2PNR C;  3KF8 B;  1F9R A;  3FEW X;  2HDM A;  3U50 C;  3TN2 A;  1TWF B;  4IUN A;  1E2W A;  5C44 H;  2FHT A;  4C56 C;  3B6Y A;  3J80 c;  4A3G G;  4LF7 Q;  1BCP D;  5DM7 3;  4GOP A;  4QIW B;  3S14 B;  1FNU A;  1HNW L;  1PDQ A;  4RGN A;  2F1M A;  4LF8 Q;  3J81 L;  2R7Z B;  4I7A A;  1LT3 D;  1ROD A;  4JI1 L;  3M3Y B;  1ZKO A;  1TQO A;  2HT1 A;  4A3K G;  4GKJ Q;  2EZV A;  2UUC L;  1R4Q B;  3HKZ E;  2L55 A;  2UU9 L;  4G4K A;  1KQS A;  2N8N A;  4MIU A;  4ME3 A;  4IPD A;  2R7D A;  4RH6 A;  1K3B C;  1D6E C;  1TWC H;  4F88 A;  3JAM E;  1Q7Y C;  2JA8 G;  2K1B A;  3CF5 A;  2VS1 A;  1GUT A;  3MTS A;  1I6H B;  3PGZ A;  5ISR A;  1HCZ A;  4C3I B;  2Q8I B;  3STB C;  4KHP Q;  1BF4 A;  2BDO A;  5IT9 E;  3KJO A;  3NWS A;  3MZ5 A;  1LTL A;  1H9J A;  3S9W A;  4JI3 L;  2OXP A;  2SNS A;  2K01 A;  4LFB Q;  3A7L A;  3ERO A;  4DN4 M;  2JEB I;  5HGQ A;  2VQF L;  5LHY 1;  4AQY Q;  4LF5 L;  1II3 A;  1G6P A;  1GXD C;  5M5W B;  1AEX A;  3AB9 A;  3GTO H;  1R9T H;  2ZM6 L;  1E0B A;  3VR3 A;  2F0T A;  2K03 A;  3V05 A;  3WDN A;  1EWH A;  5FLM G;  4DV4 Q;  3J80 L;  4NXM Q;  1CM9 A;  1VQF A;  4OX9 L;  1Y1V B;  3NWT A;  5G3L F;  2F0K A;  2PI2 A;  1G91 A;  3HOV B;  1ZYR C;  5BR8 L;  1XNR L;  3RLF A;  2HHH L;  4ALP A;  1KDC A;  1VQA A;  2G5D A;  3PIO A;  1SFO H;  3J7Z C;  1XWE A;  1WTW A;  1IBL L;  2RHS B;  4LUV A;  2Q8T A;  1SBB B;  3R3O A;  3RUZ A;  3EQL C;  5JJZ A;  1ICF B;  2EVB A;  4A3M B;  5LMN Q;  1TT2 A;  2LY7 A;  3A56 A;  1X32 A;  4HAE A;  3CC2 A;  3MA2 B;  4CJ2 C;  4NDX A;  4OON A;  3UE1 A;  2PI2 E;  4A3F G;  3I4N G;  5C3X A;  4HIM A;  4MZ9 A;  3CRL C;  3K5N A;  4JV5 Q;  4IUT A;  4RWS C;  4G57 A;  3GTQ H;  4ZCK A;  2J0T D;  1CT1 D;  2EYP A;  2G9D A;  1GHK A;  1MBY A;  2L9H A;  2AHO B;  1H9M A;  1VQ7 A;  2JA5 H;  2UUA Q;  3GDE A;  4ABN A;  2QW7 A;  4KY6 A;  3QO2 A;  4FDB A;  1SND A;  2R61 A;  4LFB L;  4OO1 I;  2KVM A;  1C4Q A;  1AE3 A;  1J9O A;  4DV2 L;  3TQY A;  5GAE C;  3ERS X;  2MO0 A;  1YNN D;  1HH2 P;  3TDQ A;  5A35 A;  1GO3 E;  4JBK A;  4A3J G;  3DM3 A;  1SNP A;  3M4Y A;  2XVS A;  1CZG A;  2RSN A;  2LFN A;  3W1B A;  1OXV A;  1KLG D;  3BG3 A;  3HS0 C;  2HD3 A;  2E75 C;  2XGT A;  2F4V L;  1AZQ A;  1VQ6 A;  1GUO A;  4DAY B;  1BOS A;  4A3D G;  1VQ9 A;  4X3K A;  1D1I A;  2HHH Q;  2JA8 B;  1FYC A;  4KKU A;  1VQM A;  1KRT A;  4S3S A;  4CJ0 B;  2CW0 C;  1TS2 A;  1BXT A;  2BA0 A;  1L0W A;  2C5C A;  1KRS A;  3L9A X;  1LM0 A;  1EIG A;  1P16 A;  1AE2 A;  1HFG A;  4BA1 I;  1WD0 A;  2E2I H;  3PMF A;  3SVM A;  2WIN B;  1A2T A;  3J81 c;  1YJW A;  1CQV A;  2MNA A;  3ER0 A;  5EKK A;  2DY8 A;  2WII B;  5CBE E;  3KK7 A;  1KAW A;  1FVI A;  3I4M B;  4IN3 A;  4K8J A;  2R93 B;  1EY6 A;  1Y1V H;  1PYW D;  1NUC A;  4X6A H;  1V1Q A;  1HXY D;  3LX0 A;  1N33 L;  1EY9 A;  4IUR A;  5EGT A;  1GD7 A;  5K5P A;  1ESR A;  2XWJ B;  2SDF A;  3SK6 A;  4YY3 Q;  1B9N A;  1KC8 C;  1EU4 A;  4KHP L;  1PYB A;  3GTG B;  1I4G A;  1TS5 A;  2QDL A;  5IT9 L;  2CKZ B;  1O7L A;  2YTY A;  1JB7 A;  5KYI A;  2LXK A;  5C0X I;  1NMG A;  1CSQ A;  3VYT A;  2I07 B;  4I65 A;  3J81 j;  2CCZ A;  1A2U A;  3RMH A;  2KCC A;  4KI0 A;  1NTG A;  3AMU A;  3G6E A;  4C3J B;  1CUK A;  1VQD A;  3I7F A;  1I3Q B;  2RCN A;  1E2V A;  2JA7 B;  3OWE B;  3HOU G;  3A8K E;  2JN4 A;  4BWG B;  4I7Z C;  1TWC B;  1VMC A;  5HGT A;  1BNZ A;  5IY0 A;  1XYI A;  2EPB A;  4M1U B;  4IFD I;  4K5W A;  3BS1 A;  1QZH A;  1HNW Q;  4OWW B;  1A6X A;  2DGY A;  2QEX A;  5D65 A;  1JR0 D;  4JW0 A;  5GQO A;  4ZK9 B;  1MJE A;  1KD1 C;  3BZD B;  4AYB B;  2Z4I A;  5IOD A;  5JJK A;  4DGZ A;  1U4R A;  5GAG C;  5FOB B;  4UP7 A;  1Q1E A;  3CRK C;  3M85 A;  1LTT D;  2Z6K C;  3GD7 A;  2WFW A;  3UDF A;  1R9T B;  4M8A A;  3A5Z B;  3G4S A;  1SRO A;  4BY1 B;  4OXP A;  5KIX A;  4QUC A;  4NXN Q;  1UE6 A;  3F2D A;  2ZT9 C;  4J6H A;  2HQL A;  1LUZ A;  2YU9 B;  4LF9 Q;  4P75 A;  3ULP A;  2K05 A;  1XMO Q;  3K80 C;  2KHI A;  3H6M A;  1TY0 A;  4OO1 G;  1RKN A;  3I3C A;  4KKT A;  4XT3 B;  4X64 Q;  3D31 A;  3ZYY X;  1A15 A;  2P5Z X;  4NKL A;  4R4T A;  1E22 A;  1JIC A;  1JOO A;  1XNQ L;  1Q90 A;  4O0A A;  2BDN A;  1K8A C;  1SNO A;  3R8B A;  1A8V A;  1MSG A;  4GS3 A;  4MTK A;  3KF8 A;  2D0O A;  4RGM A;  2BE5 D;  3H3V H;  1XNQ Q;  4A93 B;  2NVX B;  5FO9 B;  3S1M B;  1HJP A;  2XIW A;  3K59 A;  4NPS A;  5M3F B;  1WCM H;  3RR5 A;  2A73 B;  5KYL A;  4X3S A;  4K8I A;  1YHB A;  2K5W A;  4KHV A;  3GV6 A;  4PMC A;  4K2L A;  2R3Z A;  4WJ3 M;  3QOL A;  3EIV A;  1TWH B;  4BBS H;  4C1N I;  1WFQ A;  4EQN A;  2E2J B;  1U4M A;  1IBL Q;  2RBM A;  1I94 L;  1I4R A;  2JK8 A;  4IOC A;  2KA7 A;  5CGK A;  1SFO B;  4IJH A;  5E1F A;  5M3M B;  3VA7 A;  1EU3 A;  2ENB A;  4LF6 Q;  3S2D B;  2JA7 G;  2IX0 A;  5ELE A;  4YHH Q;  1RL2 A;  2OWO A;  1SAP A;  1EQT A;  4FO2 A;  5CV5 A;  4LF5 Q;  1MIU A;  3S17 B;  1EEF D;  4A3C H;  1D2B A;  3PIP A;  4BY7 B;  1SXT A;  2Z1C A;  3CCQ A;  1SNM A;  3Q8D A;  2B39 A;  2KBN A;  1SE4 A;  4A3B B;  2F0H A;  1PYS B;  2F0M A;  1YEZ A;  4XQJ A;  4O42 A;  4A3M G;  4H44 C;  3NP8 A;  1PTO C;  1X65 A;  4B08 A;  1PVO A;  5ELC A;  5K36 H;  5CV7 A;  2F03 A;  3DMU A;  1EY5 A;  1STH A;  4DV2 Q;  1IW7 D;  4CKB A;  2EXD A;  2G9H D;  2WV6 D;  4DUZ L;  1B2T A;  1HZA A;  1SN8 A;  4MHE A;  4LF4 Q;  4FNF A;  2PYK A;  2ZJQ A;  1KNE A;  1HA5 A;  2OQK A;  4DK1 A;  1LTS D;  4YWL A;  1J8I A;  3GV3 A;  3RZO H;  1GOZ A;  5IWA L;  1PTO B;  5D3I B;  1ESF A;  4JK1 C;  1C7Y A;  4X66 L;  4A93 H;  2DNE A;  2F0I A;  1WD1 A;  2R7Z H;  4NXN L;  2HCC A;  3VYS A;  1S40 A;  2VUM G;  1GM5 A;  1LO5 D;  4KY7 A;  3D8G A;  1R4P B;  1PH4 A;  1YNN C;  4AYB E;  5J22 A;  2YYZ A;  2A6E C;  3TS2 A;  4V0B A;  2QA4 A;  2WAQ B;  4A3K H;  2UXC L;  4FF4 A;  3QIA A;  4XYO A;  1AZP A;  1H9S A;  1STA A;  2F0D A;  4KKS A;  4L5R C;  1WCM G;  2A1A A;  2YU9 H;  2EY6 A;  1PH8 A;  4BBS G;  1YIT A;  4JI2 L;  3CW2 C;  4GOP B;  4IOA A;  3CPF A;  3C1F A;  2OEO A;  1NSN S;  2MP1 A;  1PH7 A;  3E6Z X;  4OIJ A;  1Q82 C;  1OXS C;  1BCP C;  4L6T B;  2RQX A;  4IJL A;  4MTN A;  5C4H A;  2R7Z G;  2A6H C;  1BKB A;  1O7Z A;  4TKO B;  3S2D H;  3MEH A;  1OXX K;  5C5M A;  5CR3 A;  4GN5 A;  4UPA A;  3TRZ A;  3TP6 A;  2EYH A;  5BN5 A;  1PRT F;  1U4L A;  2L5T A;  1Q81 C;  1RHP A;  2F0L A;  1HFN A;  1ILQ A;  2EIF A;  4A3G B;  2E2D C;  4JI0 L;  1JC7 A;  3LWE A;  1A63 A;  2F0J A;  3IFT A;  4GKK Q;  1EY0 A;  5M5Y H;  1Q1B A;  2NVX H;  2RKS A;  4XTC S;  3ONA B;  5FK9 C;  5KNC A;  3EN2 A;  2ZJR A;  1PXU A;  2PMZ E;  5TSS A;  2JA5 G;  3HOW B;  1RDP D;  3WOF A;  4DV3 Q;  2PZW A;  2IW3 A;  1I3Q H;  5IYC H;  1KAB A;  1ENC A;  1EIY B;  3NBH A;  3SK8 A;  3HOU H;  1YNJ C;  4P73 A;  1J5E Q;  2B2Y A;  1SYG A;  4DV6 Q;  1V1P A;  1JB3 A;  4ID6 A;  1G8Z D;  5JEA J;  1DOK A;  1YHQ A;  3K0X A;  1S4Z A;  5IP9 H;  3U9S A;  3U9O A;  2R93 H;  4OWX B;  5KRU A;  1WTP A;  3E0E A;  5FJ8 H;  1LTB D;  1F2Z A;  1Z7T A;  1B4O A;  5IOC A;  5KND A;  1S3O A;  1RTN A;  1W6J A;  2NYZ D;  1NE3 A;  3CQZ B;  4POG A;  1N32 L;  2L11 A;  4BBR G;  1SR3 A;  2K32 A;  5M9O A;  1K0R A;  4YY3 L;  1N9W A;  4Y7N H;  1MHW C;  4DR5 L;  5IYC G;  3K5M A;  1SYD A;  2TSS A;  3OOC A;  4XYQ A;  5DAU A;  1STE A;  1EY4 A;  4OWT B;  4X65 Q;  2F4V Q;  3Q23 A;  3AYH B;  4LW1 A;  4DR3 Q;  1KTK A;  3T1H L;  5C44 B;  3A7A B;  1H9R A;  1SMY C;  4EVO A;  1B1Z A;  3I70 A;  1O78 A;  2EJM A;  3KFU A;  3M4O H;  4KMU C;  1EZ8 A;  4A3F H;  4FF1 A;  5C4Z A;  2EDG A;  1CKM A;  2F0O A;  2QIL A;  4LFA Q;  1WTR A;  5C4X H;  2N3S A;  1TR5 A;  4IUU A;  2Y0S E;  1XPU A;  1I4P A;  4XIG S;  4PZ7 A;  2N55 A;  2V4D A;  3IL8 A;  2XWB B;  1L1O C;  2ZXO A;  3CCS A;  3M7G A;  2F3I A;  2WAQ G;  4GKK L;  2B2T A;  4KHZ A;  4JI5 Q;  3C3L A;  3DEO A;  4A76 A;  3HOZ B;  5C0X G;  2WB1 B;  1MGS A;  3MWY W;  4TVA B;  5C5L A;  1TWG H;  4Y7N B;  1IXR A;  3GTQ B;  1Y1W G;  4LF8 L;  4UP9 A;  1GUS A;  1HPC A;  1TS3 A;  3CPW A;  1I94 Q;  1HNX L;  4AIM A;  3J80 i;  4KJN A;  4KN4 C;  3ZJY C;  2OTL A;  1HA6 A;  4PZ8 A;  1U0L A;  3BJU A;  5LMN W;  4FXG C;  1VS0 A;  1HQM C;  2KOL A;  1SSO A;  1VQC A;  2PQA B;  1QNK A;  3MFY A;  3BU2 A;  3TS0 A;  2KCT A;  1VQ8 A;  2QF7 A;  2ZTD A;  1S72 A;  4Q0F A;  4R4I A;  2E2H B;  1BUV T;  1WJJ A;  1QVG A;  2A74 C;  1A62 A;  1YZ6 A;  3PSI A;  4BY7 H;  2NZ1 D;  2IHE A;  3CD6 A;  3UDI A;  2A69 D;  4PZ6 A;  3PUV A;  1F9S A;  2Z0S A;  2K5N A;  4Y52 H;  1PFS A;  3KLS X;  1BR9 A;  4RHS A;  5IYD G;  3H0G B;  3OWF A;  1AN8 A;  4C3H B;  4V19 0;  1E1T A;  4IUP A;  1X54 A;  2UUB L;  3NTI A;  1EUJ A;  2R6G A;  4DV1 L;  2O5I C;  5C44 G;  3MXU A;  2R92 H;  2J4X A;  3S1M H;  5JEA H;  3GTO B;  2IX1 A;  3CCJ A;  2QEJ C;  1HR0 Q;  5GAH C;  1CSP A;  2D2C C;  5IIF A;  3C2P A;  5I9O A;  5K36 G;  1H9K A;  3J7Y W;  1PRT D;  4KY5 A;  3SEB A;  5IGC A;  1K83 H;  3PF4 A;  5KNB A;  2BE5 C;  1NY4 A;  5COY A;  4DV5 Q;  1EQV A;  2X6G A;  1WI5 A;  2PZU A;  5EBD A;  5DEH A;  4CGY B;  1QVF A;  2B63 G;  5M3M G;  3HOY G;  4HIK A;  4R8I A;  1GJX A;  3HRZ C;  3MXG A;  2H1E A;  3D4D A;  4B3S L;  1ONL A;  3T1Y Q;  2H4O A;  2KEC A;  4K0K L;  1QVC A;  3BDL A;  3GTK H;  2X6L A;  2N49 A;  1G51 A;  3TZD A;  3NTH A;  2JA8 H;  3KUP A;  1PH3 A;  4LFC L;  1UWV A;  1CK1 A;  1VQE A;  2E5L Q;  4A3D B;  5IGD A;  1VDZ A;  2CQA A;  2BH8 A;  4OEL B;  2NVT H;  4C3I G;  4TQU S;  2IPK D;  2AWO A;  4JI3 Q;  3UI2 A;  1GUW A;  3L2P A;  1C0A A;  2ALY B;  4EQO A;  5F2D A;  1LAC A;  4A3B G;  5C0X J;  2OQ0 A;  4JI4 Q;  1IBK L;  4PMW A;  4QUF A;  1L2F A;  1XTC D;  1CZW A;  3NEL A;  3VYR A;  4OIK A;  4G7Z C;  1VQL A;  2ZJP A;  1NAP A;  3RLN A;  2XRS D;  3FDT A;  3V2T A;  3OTO L;  3ICE A;  1JJG A;  3S1Q H;  3L0O A;  3S1N H;  4EQP A;  3CMA A;  4PQX A;  2CH4 W;  1CA5 A;  2RVL A;  3T51 B;  4JI6 L;  2LMC B;  1EYG A;  1D8L A;  1EYC A;  4R4O A;  1JJC B;  1DM0 B;  2WP8 J;  5FO7 B;  3D6C A;  5ELB A;  5IE8 A;  4JI7 Q;  4RKL A;  4B3T Q;  4X3U A;  1A0I A;  1K9M C;  4UDU C;  2KCN A;  4WRD A;  1Y8O B;  2K5V A;  2F0U A;  3I73 A;  3U4V A;  1SEB D;  2F0V A;  1B44 D;  2R7F A;  2D9U A;  1EEI D;  1UUP A;  4LMQ D;  1ET9 A;  1XMQ L;  3NK9 A;  1KHI A;  3WWV A;  4POF A;  5DM6 3;  4A3J B;  4P74 A;  4C2M H;  2B8G A;  4OL7 A;  5JPM C;  3RN2 A;  2E2I B;  4A3L G;  3HP3 A;  1DZ1 A;  5M5X B;  4E6I A;  2NZH A;  3SGI A;  4BA2 I;  4NB3 A;  3SDZ A;  1VQ5 A;  4RCO A;  1FD7 D;  3OIP A;  3Q24 A;  4P72 A;  1PRT C;  1JOQ A;  4Q5V A;  2F52 A;  1KDB A;  4JYA Q;  1KAA A;  3I8Z A;  1ICW A;  4X62 Q;  3AFQ A;  1STY A;  4P71 A;  2B29 A;  3OMC A;  4K5V A;  3V96 A;  4L8J A;  2ZTC A;  2K5Q A;  2CFM A;  3DWA A;  3FPU B;  2I5M X;  4LF4 L;  1LTA D;  1SE2 A;  4FXD A;  4HMJ A;  1STG A;  1HHV A;  4OEM B;  3TSS A;  4CDF C;  1YI2 A;  2BOS A;  5EPK A;  2ZTE A;  1UNS A;  4X3T A;  1FJG Q;  4EGV A;  2SNM A;  3JAM c;  2I5L X;  1TU2 B;  3H0G H;  2JE6 I;  2PNH A;  1S5D D;  1WTO A;  2Z9H A;  4DV0 L;  1I4H A;  5FLX c;  1Y1W H;  4DUY Q;  3GTP B;  4BBR B;  4DK0 A;  4A3K B;  4GLX A;  1ZXT A;  4X66 Q;  1SNC A;  1SE8 A;  5LMN L;  2DJF C;  4C3J H;  4RGO S;  2I5H A;  1G6Z A;  2IHF A;  4JI5 L;  1TXY A;  3OW7 A;  5DLQ E;  1A3U A;  2GVB A;  3DWQ A;  1NR2 A;  4B3R L;  3H91 A;  2H5X A;  2JQO A;  2L0C A;  2RCF A;  5IGE A;  1B50 A;  5EKL A;  1K8G A;  1E7Z A;  4FXK C;  3TBI B;  2JYO A;  3H09 A;  5I4D A;  3I4O A;  5IP7 G;  1YIJ A;  3PO3 B;  1STN A;  2BA1 A;  2A69 C;  2NTS A;  3HOU B;  1KIX A;  1IKM A;  2D0P A;  2K5D A;  2IJ0 A;  3K0Y A;  2AUJ D;  4HED A;  3ULL A;  1PFB A;  1FNW A;  5M3F H;  4DKA C;  3A8I E;  3W3A A;  5C3E H;  3M3Y H;  3KLS A;  4ILW A;  3CXC A;  1SJE D;  1SNQ A;  5H1S E;  1Q46 A;  1DGS A;  3BVZ A;  3HOY H;  4N8X 1;  2F0S A;  2NN6 H;  2RDH A;  1IL2 A;  1O7I A;  2B2U C;  3PO3 G;  1ZYR D;  3MC0 B;  3F1Z A;  2M9V A;  3K57 A;  1L1O A;  2MJ8 A;  1KL9 A;  2JA9 A;  3H94 A;  5G3L D;  2XSC A;  5ELN A;  5T1I A;  1NJI C;  4GNX C;  5FJ8 G;  5EQ0 A;  1QIL A;  2AQ3 B;  2KHS A;  2VQE Q;  1PMR A;  1RTO A;  2K6A A;  1DJR D;  5I6Y A;  2GVA A;  5I9P A;  4A3L H;  4OGQ C;  2UU9 Q;  4CJ1 B;  4A3E G;  5BN3 A;  1WTV A;  1YNJ D;  4PV1 C;  1PFN A;  4L5S A;  3S17 H;  4B3R Q;  1BBW A;  3KJP A;  1YNX A;  2D62 A;  5D3D A;  4ZQ3 A;  1WVL A;  2ID0 A;  1N34 L;  1W3S A;  1IW7 C;  3T13 A;  4A3J H;  1SMX A;  1L0X B;  1Y69 U;  3NTK A;  3MXN A;  1U4P A;  3NXW A;  3GTG H;  4R1J A;  5ELF A;  1RIP A;  3GP7 A;  4QJF A;  4WJ4 A;  4DNR B;  1VQB A;  2L15 A;  4AH6 A;  1LLR D;  2DN8 A;  4DR1 Q;  3JAM i;  3J81 E;  3I4N H;  4LUO A;  4IZ8 A;  4HJ9 A;  4IUV A;  5LMU Q;  1Q8K A;  1C48 A;  2TMP A;  2IL8 A;  1WTH A;  4JOI C;  4DR1 L;  3LWU A;  1JE4 A;  1V9P A;  2ZXR A;  3GO5 A;  5CV6 A;  4QGU A;  2VQF Q;  1CHP D;  4AQY L;  3LGJ A;  3PO2 H;  3S14 H;  1M90 C;  4JI0 Q;  5I2Y A;  1TWG B;  1VQG A;  2HQE A;  4KV6 A;  3K8A A;  4H0L C;  5CMD A;  4RG1 A;  2MQH A;  5L37 A;  4A3M H;  5FO8 B;  4DR6 L;  1SLJ A;  2WB1 E;  1PTO F;  2B2W A;  2DNC A;  1WTX A;  3CCL A;  4UHV A;  3JAM L;  1HZC A;  3NEN A;  3PF5 A;  4FF2 A;  2RHQ B;  2VZA A;  4N8F A;  1TKW B;  2EJG C;  1X9N A;  4NW2 A;  1TS4 A;  2ATW A;  4KD3 A;  3A74 A;  4IFD G;  2YTV A;  3S24 A;  2F0G A;  2UXB L;  4WOR A;  1EY8 A;  1X3G A;  5NUC A;  2IT1 A;  3OYY A;  2HCI A;  2Q2I A;  5C3E G;  1N33 Q;  2K50 A;  2QCP X;  1HNX Q;  4QIW E;  1EQQ A;  1NBW A;  1UEB A;  4LUZ A;  1TWA H;  3A0J A;  3MHB A;  5EKI A;  2Y0S G;  4LFC Q;  4IPH A;  2PMZ B;  3TME A;  3J7A V;  3QJY A;  4RHR A;  2ICE C;  3CQZ H;  3KF6 B;  2XNA C;  3UDX A;  1Y1V G;  3FKI B;  5CBA E;  4DV6 L;  4CKE A;  1PA6 A;  3VYU A;  1VQI A;  3NQT A;  2OCE A;  4B3S Q;  1IYU A;  2NN6 I;  1TVX A;  1I6V C;  4KJO A;  4LWC A;  4QCL A;  2PQE A;  2N78 A;  4DV3 L;  2XN9 C;  2A6E D;  1SDF A;  1KDA A;  2B3G A;  2A68 D;  3QR8 A;  1IZ6 A;  4DV5 L;  3KLR A;  5IYB H;  3TZU A;  3GTM B;  5CC4 A;  3NUC A;  2AUK A;  4RGT A;  3SXH A;  3H15 A;  3PO2 B;  2NVT B;  2OTJ A;  1TWH H;  2X69 A;  3VR5 A;  5C4J H;  3FRP B;  5IP9 G;  3EA6 A;  4QF4 A;  2MGS A;  2FMC A;  1SE3 A;  3S16 B;  4LK1 C;  4C1N K;  1D5X C;  2EY1 A;  2PQA A;  3L3O C;  1HR0 L;  3G48 A;  4QB4 A;  2QGQ A;  2N88 A;  1VQN A;  1I6H H;  3U58 A;  2A5H A;  3FPP A;  3TP5 A;  4IO9 A;  1G2T A;  1M4V A;  1OO9 B;  4DPG A;  1K83 B;  3VDY A;  4A93 G;  3PO2 G;  2M2L A;  1MJC A;  4RFB A;  1H9S B;  1Y8P B;  1ILP A;  4DA2 A;  1XJV A;  1ET6 A;  3TP7 A;  4A3I B;  1B70 B;  3TP8 A;  3MVV A;  3U4Z A;  4CDC C;  4A75 A;  1IHZ A;  4DR6 Q;  3OHX C;  4A3E B;  4K0K Q;  2YTX A;  3S1N B;  3T1Y L;  1D1K A;  3IAY A;  3CCM A;  4J8Q A;  1YBY A;  4DU9 A;  4JPB W;  2PO4 A;  2QKI C;  3KF6 A;  2CVR A;  1PTO D;  3GTP H;  4QMG A;  3HOZ H;  1TWA B;  5EAY A;  2NN6 G;  4DR4 Q;  1TY2 A;  1P8L A;  5BN4 A;  1WTQ A;  3KLW A;  3P75 A;  4GLV B;  5CV9 A;  3AFP A;  4XT1 B;  4GZY C;  1CKO A;  3PUZ A;  5E3F A;  5IGF A;  2R92 G;  4DXG A;  2HDL A;  3K6O A;  3SR1 A;  3MFG A;  3I72 A;  1LYL A;  1S5E D;  3D0F A;  2IX3 A;  1PFM A;  1O7Y A;  4DUY L;  4QQB X;  2VNU D;  2F0N A;  2CQO A;  3QB3 A;  3HOW H;  1J6Q A;  4ULL A;  4JC0 A;  1Q3L A;  2JA6 H;  2EY5 A;  3HOV G;  4L63 B;  5JOB A;  4C3H H;  3FHW A;  3AU7 A;  2K75 A;  2UUB Q;  1NMF A;  3NBI A;  3S1R B;  1F77 A;  5C4J B;  3NBH B;  1EYA A;  1D5Z C;  1G2S A;  3K7A H;  3W1G A;  3GTJ B;  4JI6 Q;  2B2W C;  1VQP A;  4DUZ Q;  4HIO A;  4JG2 A;  4R4Q A;  4X62 L;  3PIP 3;  1N36 Q;  4JI4 L;  2AKW B;  3P1H A;  1BO0 A;  4UY8 C;  4BXX G;  5IYB G;  4C3J G;  5M5Y B;  1D5M C;  2F3V A;  1UEA B;  3PCO B;  3T1H Q;  3X3M A;  4JOI A;  4U68 A;  3R93 A;  2I0Q A;  4CBV A;  3OW2 A;  2BH2 A;  1RCV D;  2HUG A;  3Q0A A;  3HOZ G;  3BZK A;  4WFN 3;  3PQI A;  1X3F A;  2PCF B;  4APV A;  4BBR H;  5E4W C;  4K14 A;  1QNU A;  3Q22 A;  4X64 L;  3BZC A;  1K3R A;  1SRU A;  2KEE A;  2RDG A;  3IRB A;  1KXL A;  2EXZ A;  1A3T A;  3G6J B;  3BDO A;  3I90 A;  5FLX E;  2K5H A;  1YVC A;  3R2T A;  5AFW A;  1VQH A;  4DAP A;  5IWA Q;  1PZI D;  3TEH B;  1DCZ A;  5J3B A;  3K58 A;  5C4X G;  4JBM A;  3BVG A;  2JXM B;  3GQB A;  1GUN A;  2MO1 A;  1EIH A;  5C4X B;  1SYB A;  2MFI A;  1H95 A;  4B9W A;  4A3I G;  1J5E L;  3T4A C;  3EFX D;  2YV5 A;  4L5Q A;  1TWF H;  5LL6 S;  1PH1 A;  1PTO H;  1SYF A;  1EWI A;  4RKB A;  2MPM A;  3M9B A;  1V1O A;  1BVS A;  4DR2 L;  3WOE A;  3HFZ B;  3KYH C;  2FIN B;  3SK4 A;  3S16 H;  5J1Z A;  2NBF A;  3NSW A;  4A3C G;  4DR4 L;  1K28 A;  5CV4 A;  2K14 A;  1LT4 D;  2B2V C;  3CME A;  4DR5 Q;  5ELO A;  4TRD A;  2EOT A;  1Y1W B;  1Q12 A;  2V1C C;  4DK6 C;  2WB1 G;  2WKD A;  1N32 Q;  3VR4 A; 
#chains in the Genus database with same CATH homology
 3SE0 A;  3HOX B;  2NWG A;  4ZYS A;  3C46 A;  4ODG A;  2EJF C;  3HOY B;  3K5O A;  1S5C D;  1W6K A;  1RF2 D;  1BCP F;  2XRQ D;  4JBW A;  1T5E A;  3MAQ A;  2FFK B;  1LV9 A;  4ZAI A;  1F2M A;  4KTA A;  1DXM A;  1ENA A;  4KK7 A;  4A3F B;  3LNN A;  4BS9 A;  2Z4H A;  3D6W A;  3X3N A;  2F4I A;  1LAB A;  1CI3 M;  3KBG A;  4YIJ A;  1Y8N B;  2L1B A;  2R92 B;  1PZJ D;  5D14 A;  1SMY D;  1JWU D;  1EL0 A;  5IGG A;  1V43 A;  2O2L D;  3K5L A;  2RSO A;  1LT5 D;  2F0Q A;  4B9X A;  3NQI A;  1PRT B;  2LS0 1;  5EPJ A;  2EYO A;  5I6W A;  1DOM A;  1V1P B;  3F2U A;  4J1M A;  1AW7 A;  1TII D;  3NHH A;  3MXP A;  4N9P A;  2AQ1 B;  2K33 A;  3CKI B;  4KD4 A;  4FP5 D;  1QJO A;  3I91 A;  1AFP A;  1DYQ A;  2PPB C;  4K6D A;  4RCN A;  2WAC A;  2A68 C;  1V8Q A;  3N6R A;  1MSH A;  1OXT A;  1IKL A;  3HKZ B;  4H7B A;  4LJZ C;  1VMP A;  4XQQ A;  5C3W A;  1RJT A;  2RDF A;  3BYT B;  3IKJ A;  2O4X A;  1EOT A;  2MHV A;  3M7N A;  1HQR D;  2PW5 A;  1NR4 A;  1QWY A;  2AWN A;  3D4W A;  2NB0 A;  5JVG 3;  2LKV A;  1KLU D;  4F8M A;  3M4O B;  2KQ3 A;  4DAY A;  1Z6H A;  4Z9C B;  3A8J E;  4C2M B;  1S5B D;  1XXG A;  2F3W A;  4ME5 A;  3E5S A;  3E0J A;  2EYF A;  5A2Q E;  4ZKC B;  2E76 C;  4ZLT F;  1I4Q A;  1S5F D;  4NMZ A;  4FVM A;  4R8N A;  1PZK D;  4FYD A;  1GUG A;  4HTH A;  2K7V A;  1F2Y A;  2F0P A;  3DXJ C;  3HEJ A;  5J39 A;  4ZUJ A;  2M00 A;  1HRJ A;  4PNY A;  1G29 1;  3ITP A;  1EWC A;  1M8A A;  4CHT B;  3OPO A;  3FMC A;  5A2Q L;  1AP0 A;  3VR2 A;  1VCI A;  4PMB A;  5DNF A;  3T56 B;  4HCS A;  1CTM A;  1O80 A;  1STB A;  5ELD A;  4IQZ A;  1PLF A;  4OO1 H;  4KN7 C;  4IUQ A;  1BQQ T;  1T5X D;  1QG7 A;  3L7Z C;  4HSP A;  1SYE A;  3ERQ A;  3QOJ A;  3OSO A;  1FR3 A;  2KUM A;  1Z47 A;  1EZ6 A;  3PV0 A;  1HUM A;  2JSO A;  3NPP A;  1LTI D;  2EYM A;  3PUW A;  1WCM B;  2B8F A;  2EY2 A;  3DEP A;  4U67 3;  2VB3 X;  2EE1 A;  4HN7 A;  2JEA I;  5COR A;  2B2U A;  4F7X A;  2Q8R E;  2GA4 B;  1EY7 A;  1FNV A;  1CHQ D;  3RZD B;  1LTR D;  4O1N A;  2VUM B;  2JA5 B;  5E4X A;  5JVH 3;  1KNA A;  2DY7 A;  1E2Z A;  4UAI A;  4ZUI A;  2K04 A;  1EFI D;  1FGB D;  1I4X A;  2O5J C;  4FF3 A;  3FVQ A;  2B2T C;  4K6L A;  5EBC A;  3S1Q B;  2AQ2 B;  5HUR A;  1JOR A;  1A3V A;  5KGU A;  1XX8 A;  1QE6 A;  1QB5 D;  4R9W A;  4IFD J;  1X3Q A;  2Y0S B;  1K8M A;  3GTK B;  3VR6 A;  1MD2 D;  2MUY A;  1BBX C;  5T1G A;  2CHB D;  2I46 A;  3D3R A;  4NP5 A;  3HGB A;  3NE5 B;  3P7J A;  3DWP A;  3VA5 A;  1JWS D;  5KEE A;  2F0F A;  3CU7 A;  3BDC A;  3OIQ A;  4TSS A;  3O13 A;  5FLX L;  3KBX A;  2JP1 A;  1SJH D;  4WJW A;  1L0Y B;  2PZT A;  3G7L A;  1UAP A;  3D4R A;  1QCB D;  4HMI A;  2Z8L A;  5EJW A;  4K5X A;  1JCK B;  4G7H C;  4LAA A;  5CYU A;  2VB2 X;  1Q8I A;  4DNT B;  3DUZ A;  2ZXP A;  1I50 B;  3CHB D;  2B2Y C;  2SOB A;  3P20 A;  3QG1 A;  1JOK A;  1B9M A;  1OXU A;  4K2K A;  3PUX A;  1LT6 D;  3A55 A;  4IFD H;  3DHQ A;  1JQY D;  1VF7 A;  1HTP A;  2KJX A;  4HSV A;  4RA8 A;  1F9Q A;  5EPL A;  4DF7 A;  4F87 A;  1K8O A;  1HUN A;  3SHL A;  1CA6 A;  2SEB D;  3J80 E;  2WKC A;  4DFA A;  2FMM A;  3I4L A;  3N52 A;  3Q6S A;  1GHJ A;  1RD9 D;  3ND8 A;  3HZX A;  2IWH A;  4DAV A;  2CW0 D;  1HTL D;  2EYL A;  5JEA G;  4BBS B;  2FJ2 A;  3R2I A;  3W2D A;  2QDB A;  4ZRZ A;  1MI2 A;  5C3E B;  1ZEQ X;  2VXW A;  2K28 A;  3SK5 A;  3K7A B;  4RAU C;  1B3A A;  3IFD A;  1IYV A;  1DON A;  1IL8 A;  2JA6 B;  3H3V C;  4HR7 B;  4ZKB B;  1B53 A;  2ICI A;  4HCE A;  4OHJ A;  3QWN A;  3EJI A;  1F9P A;  5LL6 X;  2KED A;  2NUC A;  3DM1 A;  2NTT A;  5C0X H;  2BCO A;  2J7Z A;  3BVM A;  4CKC A;  2RA4 A;  2B63 B;  1ML0 D;  4DXF A;  1BCP B;  4IAL A;  3PIO 3;  3S15 B;  1CQF A;  5C6A A;  1BDO A;  1SYC A;  1ENF A;  1X3P A;  3I4N B;  4XDX A;  2F0W A;  2C9O A;  4H13 C;  2NVY B;  1CFM A;  2PW7 A;  3A54 A;  3RZO B;  2D5D A;  2EYJ A;  3GTL B;  2L12 A;  1JWM D;  4C3H G;  3C1E A;  5JPN C;  1U9R A;  1DD2 A;  1NCV A;  3OMG A;  2F0E A;  5JAV A;  3S2H B;  3BYY B;  4P2C B;  2A6H D;  4N9T A;  3EVQ A;  5IGB A;  1C8C A;  2NVQ B;  2L4N A;  1QOH A;  1DOL A;  3PUY A;  2E74 C;  1VF5 C;  3T16 A;  3T53 B;  5FKA C;  4G7O C;  1F2L A;  3RD4 A;  3ND9 A;  3URY A;  2OF1 A;  2B2V A;  4MN3 A;  1LTG D;  3J7A F;  4XQN A;  1EYD A;  5CV8 A;  2OT2 A;  3HG9 A;  4XXE A;  5I2X A;  2PNR C;  1F9R A;  3FEW X;  2HDM A;  3TN2 A;  1TWF B;  4IUN A;  1E2W A;  2FHT A;  4C56 C;  1BCP D;  5DM7 3;  4QIW B;  3S14 B;  1FNU A;  1PDQ A;  4RGN A;  2F1M A;  3J81 L;  2R7Z B;  1LT3 D;  1ROD A;  3M3Y B;  1ZKO A;  1TQO A;  2EZV A;  1R4Q B;  2L55 A;  4G4K A;  4MIU A;  4RH6 A;  1D6E C;  3JAM E;  4F88 A;  2K1B A;  3MTS A;  1GUT A;  1I6H B;  5ISR A;  1HCZ A;  4C3I B;  2Q8I B;  1BF4 A;  2BDO A;  5IT9 E;  3NWS A;  3MZ5 A;  1H9J A;  3S9W A;  2OXP A;  2SNS A;  2K01 A;  3A7L A;  3ERO A;  4DN4 M;  2JEB I;  5LHY 1;  1II3 A;  1GXD C;  5M5W B;  1AEX A;  3AB9 A;  1E0B A;  3VR3 A;  2F0T A;  2K03 A;  3V05 A;  3WDN A;  1EWH A;  3J80 L;  1CM9 A;  1Y1V B;  3NWT A;  5G3L F;  2F0K A;  1G91 A;  3HOV B;  1ZYR C;  3RLF A;  1KDC A;  1WTW A;  1XWE A;  2Q8T A;  1SBB B;  3R3O A;  3RUZ A;  3EQL C;  5JJZ A;  2EVB A;  4A3M B;  1TT2 A;  2LY7 A;  3A56 A;  1X32 A;  4HAE A;  3MA2 B;  4CJ2 C;  4NDX A;  5C3X A;  3CRL C;  3K5N A;  4IUT A;  4RWS C;  4G57 A;  2J0T D;  1CT1 D;  2EYP A;  2G9D A;  1GHK A;  1MBY A;  2L9H A;  1H9M A;  4ABN A;  4KY6 A;  3QO2 A;  1SND A;  2R61 A;  4OO1 I;  2KVM A;  1C4Q A;  1J9O A;  1YNN D;  3TDQ A;  5A35 A;  1SNP A;  3M4Y A;  2XVS A;  1CZG A;  2RSN A;  2LFN A;  1OXV A;  1KLG D;  3BG3 A;  3HS0 C;  2E75 C;  1AZQ A;  1GUO A;  1BOS A;  4X3K A;  1D1I A;  2JA8 B;  1FYC A;  4KKU A;  4S3S A;  4CJ0 B;  2CW0 C;  1TS2 A;  1BXT A;  2BA0 A;  2C5C A;  3L9A X;  1EIG A;  1HFG A;  4BA1 I;  1WD0 A;  3PMF A;  3SVM A;  2WIN B;  1A2T A;  1CQV A;  5EKK A;  2DY8 A;  2WII B;  5CBE E;  3KK7 A;  3I4M B;  4IN3 A;  4K8J A;  2R93 B;  1EY6 A;  1PYW D;  1NUC A;  1HXY D;  3LX0 A;  1EY9 A;  4IUR A;  5EGT A;  5K5P A;  1ESR A;  2XWJ B;  2SDF A;  3SK6 A;  1B9N A;  1EU4 A;  3GTG B;  1I4G A;  1TS5 A;  5IT9 L;  1O7L A;  5KYI A;  5C0X I;  3VYT A;  2I07 B;  4I65 A;  1A2U A;  3RMH A;  2KCC A;  4KI0 A;  3AMU A;  4C3J B;  1I3Q B;  1E2V A;  2JA7 B;  3OWE B;  3A8K E;  4BWG B;  4I7Z C;  1TWC B;  1VMC A;  5HGT A;  1BNZ A;  1XYI A;  2EPB A;  4M1U B;  4IFD I;  4K5W A;  3BS1 A;  1A6X A;  5D65 A;  1JR0 D;  4ZK9 B;  3BZD B;  4AYB B;  2Z4I A;  5IOD A;  4DGZ A;  1U4R A;  5FOB B;  1Q1E A;  3CRK C;  3M85 A;  1LTT D;  3GD7 A;  1R9T B;  4M8A A;  4BY1 B;  5KIX A;  4QUC A;  2ZT9 C;  4J6H A;  2YU9 B;  2K05 A;  3H6M A;  1TY0 A;  4OO1 G;  1RKN A;  3I3C A;  4KKT A;  4XT3 B;  3D31 A;  3ZYY X;  1A15 A;  4NKL A;  1JIC A;  1JOO A;  1Q90 A;  2BDN A;  1SNO A;  3R8B A;  1MSG A;  3KF8 A;  4RGM A;  2BE5 D;  4A93 B;  5FO9 B;  3S1M B;  2XIW A;  3K59 A;  5M3F B;  2A73 B;  5KYL A;  4X3S A;  4K8I A;  2K5W A;  4KHV A;  3GV6 A;  4PMC A;  4K2L A;  2R3Z A;  3QOL A;  1TWH B;  4C1N I;  4EQN A;  2E2J B;  1U4M A;  2RBM A;  1I4R A;  2KA7 A;  5CGK A;  1SFO B;  5E1F A;  5M3M B;  3VA7 A;  1EU3 A;  2ENB A;  3S2D B;  2IX0 A;  5ELE A;  1SAP A;  1EQT A;  4FO2 A;  5CV5 A;  3S17 B;  1EEF D;  1D2B A;  4BY7 B;  1SXT A;  2Z1C A;  1SNM A;  2B39 A;  1SE4 A;  4A3B B;  2F0H A;  2F0M A;  4XQJ A;  4O42 A;  4H44 C;  3NP8 A;  1PTO C;  4B08 A;  5ELC A;  5K36 H;  5CV7 A;  2F03 A;  3DMU A;  1EY5 A;  1STH A;  1IW7 D;  4CKB A;  2G9H D;  2WV6 D;  1B2T A;  4MHE A;  4FNF A;  2PYK A;  1KNE A;  1HA5 A;  4DK1 A;  1LTS D;  1J8I A;  3GV3 A;  1GOZ A;  1PTO B;  5D3I B;  1ESF A;  4JK1 C;  2DNE A;  2F0I A;  1WD1 A;  2HCC A;  3VYS A;  1LO5 D;  4KY7 A;  3D8G A;  1R4P B;  1YNN C;  5J22 A;  2YYZ A;  2A6E C;  4V0B A;  2WAQ B;  4FF4 A;  3QIA A;  4XYO A;  1AZP A;  1H9S A;  1STA A;  2F0D A;  4KKS A;  2EY6 A;  3C1F A;  2OEO A;  1NSN S;  2MP1 A;  3E6Z X;  4OIJ A;  1OXS C;  1BCP C;  4L6T B;  2RQX A;  5C4H A;  2A6H C;  1O7Z A;  4TKO B;  3MEH A;  1OXX K;  5C5M A;  5CR3 A;  3TP6 A;  2EYH A;  5BN5 A;  1PRT F;  1U4L A;  2L5T A;  1RHP A;  2F0L A;  1HFN A;  1ILQ A;  4A3G B;  2E2D C;  1JC7 A;  3LWE A;  2F0J A;  3IFT A;  1EY0 A;  1Q1B A;  2RKS A;  4XTC S;  3ONA B;  5FK9 C;  5KNC A;  1PXU A;  5TSS A;  3HOW B;  1RDP D;  3WOF A;  2PZW A;  2IW3 A;  1KAB A;  1ENC A;  3NBH A;  3SK8 A;  1YNJ C;  2B2Y A;  1SYG A;  1V1P A;  1JB3 A;  4ID6 A;  1G8Z D;  5JEA J;  1DOK A;  1S4Z A;  3U9S A;  3U9O A;  5KRU A;  1WTP A;  1LTB D;  1F2Z A;  1Z7T A;  1B4O A;  5IOC A;  5KND A;  1RTN A;  1W6J A;  2NYZ D;  3CQZ B;  2L11 A;  2K32 A;  5M9O A;  3K5M A;  1SYD A;  2TSS A;  3OOC A;  4XYQ A;  5DAU A;  1STE A;  1EY4 A;  3Q23 A;  1KTK A;  5C44 B;  3A7A B;  1H9R A;  1SMY C;  4EVO A;  1B1Z A;  3I70 A;  1O78 A;  2EJM A;  4KMU C;  1EZ8 A;  4FF1 A;  5C4Z A;  2EDG A;  2F0O A;  2QIL A;  1WTR A;  1TR5 A;  4IUU A;  1I4P A;  4XIG S;  2N55 A;  2V4D A;  3IL8 A;  2XWB B;  2ZXO A;  3M7G A;  2B2T A;  4KHZ A;  3C3L A;  3DEO A;  3HOZ B;  5C0X G;  2WB1 B;  1MGS A;  3MWY W;  5C5L A;  4Y7N B;  3GTQ B;  1GUS A;  1HPC A;  1TS3 A;  1HA6 A;  4KJN A;  4KN4 C;  4FXG C;  1HQM C;  2KOL A;  1SSO A;  2NVX B;  5M5Y B;  1QNK A;  3MFY A;  2QF7 A;  2E2H B;  4Q0F A;  1BUV T;  2A74 C;  2NZ1 D;  2A69 D;  3PUV A;  1F9S A;  3KLS X;  1BR9 A;  4RHS A;  3H0G B;  3OWF A;  1AN8 A;  4C3H B;  4V19 0;  4IUP A;  3NTI A;  2R6G A;  2O5I C;  3MXU A;  2J4X A;  5JEA H;  3GTO B;  2IX1 A;  2QEJ C;  2D2C C;  5IIF A;  3C2P A;  5I9O A;  5K36 G;  1H9K A;  3J7Y W;  1PRT D;  4KY5 A;  3SEB A;  5IGC A;  5KNB A;  2BE5 C;  5COY A;  1EQV A;  2X6G A;  2PZU A;  5EBD A;  5DEH A;  4CGY B;  4R8I A;  1GJX A;  3HRZ C;  3MXG A;  2H1E A;  3D4D A;  1ONL A;  2H4O A;  2KEC A;  3BDL A;  2X6L A;  3TZD A;  3NTH A;  3KUP A;  1CK1 A;  4A3D B;  5IGD A;  1VDZ A;  2CQA A;  4C3I G;  4TQU S;  2IPK D;  2AWO A;  3UI2 A;  1GUW A;  4EQO A;  5F2D A;  1LAC A;  5C0X J;  4PMW A;  4QUF A;  1XTC D;  1CZW A;  3VYR A;  4OIK A;  4G7Z C;  1NAP A;  2XRS D;  3FDT A;  3V2T A;  4EQP A;  4PQX A;  1CA5 A;  2RVL A;  3T51 B;  2LMC B;  1EYC A;  1DM0 B;  2WP8 J;  5FO7 B;  3D6C A;  5ELB A;  4RKL A;  4X3U A;  4UDU C;  2KCN A;  4WRD A;  1Y8O B;  2F0U A;  3I73 A;  1SEB D;  2F0V A;  1B44 D;  2D9U A;  1EEI D;  1UUP A;  4LMQ D;  1ET9 A;  3NK9 A;  5DM6 3;  4A3J B;  2B8G A;  4OL7 A;  5JPM C;  2E2I B;  1DZ1 A;  3HP3 A;  5M5X B;  4E6I A;  4BA2 I;  3SDZ A;  4RCO A;  1FD7 D;  3OIP A;  3Q24 A;  1PRT C;  1JOQ A;  4Q5V A;  1KDB A;  1KAA A;  3I8Z A;  1ICW A;  1STY A;  3OMC A;  4K5V A;  3V96 A;  4L8J A;  2K5Q A;  3DWA A;  3FPU B;  1LTA D;  1SE2 A;  4FXD A;  4HMJ A;  1STG A;  1HHV A;  3TSS A;  2BOS A;  5EPK A;  1UNS A;  4X3T A;  4EGV A;  2SNM A;  1TU2 B;  2JE6 I;  1S5D D;  1WTO A;  1I4H A;  3GTP B;  4BBR B;  4DK0 A;  4A3K B;  1ZXT A;  1SNC A;  4RGO S;  1G6Z A;  3OW7 A;  1A3U A;  3DWQ A;  1NR2 A;  3H91 A;  2L0C A;  5IGE A;  1B50 A;  5EKL A;  4FXK C;  3TBI B;  2JYO A;  3H09 A;  5I4D A;  3PO3 B;  1STN A;  2BA1 A;  2A69 C;  2NTS A;  3HOU B;  1IKM A;  2K5D A;  2IJ0 A;  3K0Y A;  2AUJ D;  4HED A;  1PFB A;  1FNW A;  3A8I E;  3W3A A;  3KLS A;  4ILW A;  1SJE D;  1SNQ A;  3BVZ A;  2F0S A;  2NN6 H;  2RDH A;  2B2U C;  1ZYR D;  3MC0 B;  2M9V A;  3K57 A;  2MJ8 A;  3H94 A;  5G3L D;  2XSC A;  5T1I A;  5EQ0 A;  1QIL A;  2AQ3 B;  2KHS A;  1PMR A;  1RTO A;  2K6A A;  1DJR D;  5I6Y A;  5I9P A;  4OGQ C;  4CJ1 B;  5BN3 A;  1WTV A;  1YNJ D;  4PV1 C;  1PFN A;  2D62 A;  5D3D A;  4ZQ3 A;  1WVL A;  2ID0 A;  1IW7 C;  3T13 A;  1L0X B;  1Y69 U;  3NTK A;  3MXN A;  1U4P A;  3NXW A;  5ELF A;  3GP7 A;  4DNR B;  1LLR D;  2DN8 A;  3J81 E;  4IZ8 A;  4IUV A;  1C48 A;  2TMP A;  2IL8 A;  3LWU A;  1JE4 A;  2ZXR A;  3GO5 A;  5CV6 A;  1CHP D;  5I2Y A;  1TWG B;  2HQE A;  4KV6 A;  4H0L C;  5CMD A;  5FO8 B;  1PTO F;  2B2W A;  2DNC A;  1WTX A;  3JAM L;  4FF2 A;  1TKW B;  2EJG C;  4NW2 A;  1TS4 A;  4KD3 A;  4IFD G;  2F0G A;  4WOR A;  1EY8 A;  5NUC A;  2IT1 A;  2HCI A;  2QCP X;  3MHB A;  5EKI A;  2PMZ B;  3TME A;  3J7A V;  3QJY A;  4RHR A;  2ICE C;  2XNA C;  3FKI B;  5CBA E;  4CKE A;  3VYU A;  3NQT A;  1IYU A;  2NN6 I;  1TVX A;  1I6V C;  4KJO A;  4QCL A;  2PQE A;  2XN9 C;  2A6E D;  1SDF A;  1KDA A;  2A68 D;  3KLR A;  3TZU A;  3GTM B;  5CC4 A;  3NUC A;  2AUK A;  4RGT A;  3SXH A;  3PO2 B;  2NVT B;  3VR5 A;  2X69 A;  3FRP B;  3EA6 A;  4QF4 A;  2MGS A;  2FMC A;  1SE3 A;  3S16 B;  4LK1 C;  4C1N K;  1D5X C;  2EY1 A;  3L3O C;  4QB4 A;  2N88 A;  2A5H A;  3FPP A;  3TP5 A;  1G2T A;  1M4V A;  1OO9 B;  1K83 B;  2M2L A;  4RFB A;  1H9S B;  1Y8P B;  1ILP A;  4DA2 A;  1ET6 A;  3TP7 A;  4A3I B;  3TP8 A;  3MVV A;  1IHZ A;  3OHX C;  4A3E B;  3S1N B;  1D1K A;  3IAY A;  4J8Q A;  4DU9 A;  2PO4 A;  2QKI C;  2CVR A;  1PTO D;  4QMG A;  1TWA B;  2NN6 G;  1TY2 A;  5BN4 A;  1WTQ A;  3P75 A;  5CV9 A;  4XT1 B;  4GZY C;  3PUZ A;  5E3F A;  5IGF A;  4DXG A;  2HDL A;  3K6O A;  3SR1 A;  3MFG A;  3I72 A;  1S5E D;  2IX3 A;  1PFM A;  1O7Y A;  2VNU D;  2F0N A;  3QB3 A;  4ULL A;  1Q3L A;  2EY5 A;  4L63 B;  5JOB A;  3AU7 A;  3NBI A;  3S1R B;  1F77 A;  5C4J B;  1EYA A;  1D5Z C;  1G2S A;  3GTJ B;  2B2W C;  3PIP 3;  3P1H A;  1BO0 A;  4C3J G;  1D5M C;  2F3V A;  1UEA B;  3X3M A;  4U68 A;  3R93 A;  4CBV A;  1RCV D;  2HUG A;  3Q0A A;  4WFN 3;  2PCF B;  5E4W C;  4K14 A;  1QNU A;  3Q22 A;  2KEE A;  2RDG A;  2EXZ A;  1A3T A;  3G6J B;  3BDO A;  3I90 A;  5FLX E;  3R2T A;  5AFW A;  4DAP A;  1PZI D;  1DCZ A;  3K58 A;  3BVG A;  2JXM B;  3GQB A;  1GUN A;  1EIH A;  5C4X B;  1SYB A;  4B9W A;  3T4A C;  3EFX D;  5LL6 S;  1PTO H;  1SYF A;  4RKB A;  2MPM A;  1V1O A;  3WOE A;  2FIN B;  3SK4 A;  5J1Z A;  2NBF A;  3NSW A;  5CV4 A;  1LT4 D;  2B2V C;  4TRD A;  2EOT A;  1Y1W B;  1Q12 A;  2WKD A;  3VR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...