4PNYA

Crystal structure of staphylococcal nuclease variant delta+phs i72h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
130
structure length
130
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKHEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I72H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4pnyA00
2F0GA 3OMCA 1KDCA 4YIJA 5HURA 5KIXA 1NSNS 3NUCA 2RDFA 4EQNA 1NUCA 2EYHA 2EYFA 3LX0A 3NHHA 1STGA 3HZXA 4KHVA 5C5MA 3V2TA 2KHSA 1TT2A 4ODGA 2EY2A 1SYFA 3NQTA 4N9PA 3TP7A 2F3WA 2NUCA 2EYLA 4ID6A 1IHZA 4KD3A 5IGGA 5F2DA 5K5PA 2F0QA 2SNMA 3BDLA 4B9WA 1A3TA 4KV6A 5EKLA 5CC4A 3SK8A 3VA5A 3NK9A 4B9XA 4J1MA 4K5VA 2SOBA 4KY6A 5M9OA 2PZWA 2PQEA 2F0EA 4ZUIA 4K5WA 3BDCA 1SNMA 2PW7A 3SK4A 1JORA 2RKSA 2OEOA 1ENCA 4NKLA 3U9OA 1U9RA 3E5SA 4LAAA 4DU9A 3MHBA 3OMGA 5CV7A 2F0KA 2F0DA 2PW5A 3D4DA 3EROA 4NMZA 2F0SA 4TRDA 2F0UA 4H7BA 4WORA 4KD4A 3NXWA 5C5LA 5C3XA 2F0HA 4WRDA 1EY7A 3OSOA 5CV4A 4DGZA 4K5XA 3R3OA 3ITPA 4K2KA 3DMUA 1F2YA 3P75A 1SYDA 5I9OA 4IALA 1A2TA 2SNSA 1STAA 2F0TA 2F0VA 2KQ3A 1JOKA 2EYJA 3SR1A 4PMBA 5C4ZA 2EXZA 2OXPA 2WACA 1AEXA 1SNQA 2F0MA 1A3VA 2EYMA 5IGDA 5JAVA 1KDBA 3MVVA 4KJOA 4PMCA 5CR3A 4RKLA 3TMEA 1SYCA 4IZ8A 4DFAA 1STNA 3QOJA 1EY6A 1F2ZA 2EYPA 3PMFA 4I65A 4KTAA 4KJNA 5IGBA 1SNOA 4EQPA 1EYCA 5IGFA 1A3UA 3T16A 2M00A 3SHLA 1EYDA 1SNCA 2LKVA 5NUCA 5KYLA 4E6IA 3QOLA 3SXHA 2EY1A 5J22A 1EY5A 5KEEA 2PYKA 4NP5A 2F0JA 1STHA 5CGKA 5IIFA 5IOCA 1II3A 1EY8A 5CV6A 5E1FA 4K8IA 4RKBA 3D4WA 1ENAA 1EQVA 1EZ6A 3MZ5A 2F0LA 4QMGA 5J39A 5CV8A 4S3SA 5I9PA 5C6AA 3DHQA 5I6YA 2EY5A 5KGUA 4KY7A 3SK6A 1STBA 5EGTA 4F8MA 5IGEA 2F0IA 4NDXA 1TQOA 1SNPA 4QF4A 5DEHA 1EY9A 4K14A 5IODA 5E3FA 3TP8A 5HGTA 3TP6A 4EVOA 5CV9A 1SYEA 5EKKA 2F0WA 3D8GA 4HMJA 4K6DA 4DF7A 2O4XA 2F0OA 3EVQA 4J6HA 2F0NA 4F7XA 2HQEA 3P1HA 4K2LA 4HTHA 4KY5A 4ZQ3A 3C1EA 1RKNA 1KDAA 3EJIA 3S9WA 3C1FA 3H6MA 2ENBA 4EQOA 5DAUA 5C3WA 3NP8A 4K8JA 2PZTA 1STYA 5C4HA 4PNYA 4QB4A 2PZUA 1A2UA 2EY6A 4IUNA 3ERQA 5J1ZA 1SYBA 3SK5A 1SYGA 3T13A 4G57A 4OL7A 4R8NA 2QDBA 1F2MA 1EZ8A 3QB3A 3MEHA 4HMIA 1JOOA 1JOQA 1SNDA 2OF1A 3MXPA 1TR5A 3D6CA 3HEJA 4N9TA 3RUZA 4ZUJA 1EY0A 5IGCA 5CV5A 1KABA 3OWFA 5KYIA 1EY4A 3TP5A 2F3VA 2F0FA 1EYAA 4ME5A 5KRUA 2EYOA 2RBMA 1KAAA 2F0PA 5I6WA 5JOBA 4MIUA 5ISRA
chains in the Genus database with same CATH superfamily
1E3PA 2JA8G 3G48A 3C3LA 2N3SA 1LLRD 1WJJA 3HZXA 5DLQE 5C5MA 2KHSA 1X6OA 4DUYQ 4JI6Q 1OXXK 5IGGA 5D14A 5IYCG 1KL9A 5IYBG 4YCVA 4B9XA 4LFBQ 2DJFC 4K5VA 2K03A 3M7NA 2PNRC 1MD2D 5D3DA 3AMUA 2N88A 4RGMA 3DEOA 4U68A 3ER0A 4DU9A 3S15B 2CWPA 3UI2A 1C9OA 3HOVG 4OO1I 4WORA 2F0UA 2L9HA 4G4KA 1G2SA 1UEBA 3QWNA 3RD4A 2F52A 4H44C 5EPLA 2V4DA 2ES2A 1RJTA 3JC66 3RZOH 2DUDA 2PI2E 1K0RA 1SYDA 3K7UC 3S16H 2R6GA 2YU9H 3FHWA 4O2DA 5JEAG 3IKJA 3H09A 2K01A 1EIGA 2IHEA 4QQBX 1TVXA 4GLVB 1GOZA 2F4VQ 2WP8J 1PVOA 3F2CA 1W2BA 4LF8Q 4GKKQ 1I3QB 4M1UB 1Z7TA 1VDZA 3EIVA 2JA7G 4C3HH 4GKJL 1JWUD 4NP5A 3FRPB 4NXNQ 4DUZL 1CSPA 5E1FA 1VQ5A 2D2CC 3BS1A 1I4HA 2K6AA 5CV8A 5I9PA 2QF7A 1L1OC 4DV0Q 5KGUA 3KJOA 5IT9c 3CCUA 4MTKA 1DXMA 2CQAA 2F4IA 3CCEA 1GM5A 3M3YH 3MFGA 2F0OA 4BXXG 3GP7A 1M4VA 2NWGA 1TY2A 4PQXA 1VQAA 1SEBD 2AQ3B 3CPFA 3DUZA 2VB2X 3MC0B 5A35A 1W3SA 4HJ9A 1JJCB 4A93G 1HZAA 4X64Q 4ZUJA 1SBBB 1AZPA 1EWIA 1PH3A 1P8LA 2K5WA 3PGZA 2XTIA 3RZOB 5ELBA 2YU9B 2UU9Q 4ZKCB 4RCOA 3LX0A 5E4WC 4NXMQ 1JICA 4KD3A 5EPKA 1RCVD 1LTLA 4C56C 2OTJA 1Z6HA 1ICWA 1V1PA 1PFMA 1H9MA 3Q24A 5M9OA 1VF7A 5LMUQ 1N34Q 2ZM6L 2E5LQ 3L0OA 4IFDI 4K5WA 5EKIA 5EBCA 4C3HB 1IL8A 1RD9D 1K9MC 1VQDA 1B50A 1Q46A 1HXYD 4GZYC 3RLFA 4A3IG 2NZHA 4DR1Q 3W5OA 3CPWA 1EIFA 1EYGA 1BQQT 1X9NA 1O7YA 2A6ED 4RGOS 2H5XA 1A63A 3TREA 4HN7A 3ZYYX 4JV5L 1AZQA 4DK1A 4WJWA 1IBKL 2IX0A 4KKUA 1Q81C 2K7VA 3D6WA 1YJNA 4DFAA 4LF9Q 2G9DA 1PH2A 2MO1A 2ALYB 3TZUA 3CRLC 3RN5A 1E22A 1SNCA 2LKVA 1HA6A 5LL6S 4LF7L 2XN9C 5JPMC 2G5DA 1K8GA 3F2DA 3CF5A 5IOCA 4X66Q 1MBYA 5CV6A 4A76A 3NE5B 2MFIA 3I91A 1PLFA 1QOHA 1VF5C 2QDLA 3JAMi 2WINB 2E2JH 4MZ9A 3SK6A 3M4YA 1WTXA 2R92H 4O0AA 1SMXA 1GHJA 3K59A 4YCUA 3TP8A 3M9BA 4EQ5A 5CV9A 4HMJA 3CCQA 5IY0A 3NWTA 4IN3A 2PQAB 1PFBA 2CVRA 4A3GH 4EQOA 2ENBA 4AH6A 4KHZA 3B6YA 2LFNA 2PZUA 1WTWA 3T53B 2PMZB 1HNWQ 2WB1G 2YV5A 1EQTA 2RCFA 1JOQA 1X55A 2QCPX 2I5HA 3HOZH 2K33A 2KBNA 2MO0A 2VNUD 5EBDA 1RF2D 1F77A 4GNXA 2A5HA 4UP7A 1XTDA 5KIXA 3J81c 1DJRD 4BA1I 1ENFA 1EUJA 3GDEA 2IL8A 3T51B 1PDQA 1E2WA 5FLMG 3U4ZA 2EY2A 2A6EC 1FR3A 4BS9A 4B9WA 4DNIA 2XRQD 3BZKA 2HCCA 1HNZQ 3SK8A 4CDDC 2N8NA 1IYJB 2F0EA 1BR9A 1G291 5ELNA 2BH2A 3NTKA 2RKSA 4LAAA 1Q8KA 4ZLTF 1QUQB 1EFWA 1R9TH 3K58A 2I0QA 1HTLD 3HOUB 2PMZE 3CC2A 1G51A 4XT1B 2Q2TA 1PTOC 5CV4A 4C1NI 3NBIA 3N52A 4JCVE 3P75A 2R92B 1XPUA 1STAA 2A1AA 4FXDA 3CD6A 2FINB 2EXZA 4KLKA 4A3EG 4FF1A 3I55A 2HIVA 4IOAA 1U5KA 4XQJA 2K5NA 4R4OA 4JYAL 4JI2L 3A74A 3CCRA 3H94A 2NVXH 4E6IA 5FO9B 1JCKB 4MN3A 1GXDC 1X3FA 1RHPA 1HR0Q 4DAMA 4A3MH 4IPGA 5LMNL 2B63B 3GTMB 2HDMA 3HOZB 1TWHB 1EZ6A 1U0LA 4F88A 3URYA 3T1HL 1SFOB 2WFWA 4GNXC 3K8AA 2CKZB 3A56A 4F8MA 4QUFA 3Q23A 1VQBA 3RLOA 2KCNA 2HHHL 1AN8A 1ZYRD 1ML0D 2EPBA 3HFZB 3IFTA 3PF4A 1HUNA 4DXGA 1HNXL 4IUPA 3S9WA 1Y1WH 4A3GG 1MIUA 4OWWB 3OYYA 4O1NA 3MXNA 1K3RA 5JPNC 2B2YA 4OXPA 3GO5A 4B3SQ 2XSCA 5G3LD 4JI0Q 3FVQA 1S72A 1R9TB 1SNDA 1F2LA 1JQYD 3D6CA 2ICEC 3QG1A 2Q2UA 2AUJD 1KABA 2F3VA 3FPPA 5IP7H 4X62Q 1Y14B 2LXJA 4LW1A 1E24A 2FJ2A 2RSNA 1K3BC 3HS0C 4AIMA 3KLWA 1I5FA 5K5PA 3NENA 1IBMQ 4FXKC 1RTNA 1O7LA 1SE4A 2RVLA 2NVXB 3BDCA 1SNMA 4B3ML 4RMFA 4RHRA 3I4OA 2UXCQ 5D65A 3EROA 2J7ZA 2A68D 3S14H 3OSOA 1F2YA 3LNNA 1UNSA 4IALA 3LWEA 4X3SA 4Z9CB 2B39A 4ZYSA 1Y1VB 2VL6A 3PUYA 5ELFA 2EDGA 1TWGH 1YNXA 1I6HH 1V1OA 4JI5Q 4P74A 5GAHC 4KJNA 1V8QA 4GOPB 4ZK9B 2JP1A 4FDBA 4R4CA 1X3QA 2B2YC 5NUCA 3TN2A 4DV5L 1LO5D 3GTQH 5J22A 3PUXA 3I4NH 3S1NH 2KECA 3PUVA 4Q5VA 4A3MG 2F0JA 4X65Q 3VR3A 3G7LA 3KLRA 1C4QA 4HEDA 1HRJA 1HA5A 1IL2A 4PZ8A 3CC4A 1Q90A 2VUMB 4KY7A 5EGTA 1NMFA 5C0XI 1OTCA 2OWOA 4K14A 4DV3Q 2Z1CA 1FGUA 1TKWB 1JE4A 1LT6D 3I4MH 3RR5A 3CCVA 3PIPA 4JI1Q 4KY5A 1Y1WG 1BXTA 1B2TA 4FVMA 2PZTA 1H9KA 5T1IA 1PTOB 3TQYA 3H3VH 1KNAA 1I50H 2WIIB 2B2UA 4ZRZA 2OF1A 1J9OA 4R8IA 1EQQA 1U4MA 3K81C 1VQKA 4KKSA 3S14B 1EY4A 3PQIA 1A0IA 5IP7G 2RBMA 2A68C 2X69A 4I7ZC 4DV2L 3GTKB 1JT8A 1XX8A 2JA5B 3H15A 4KHVA 2JA9A 1PH8A 4DV1L 1SYFA 2JQOA 1LV9A 4LWCA 4XQNA 1L0YB 1I6HB 5ELDA 3J7AV 1B44D 3BDLA 1S3OA 3M7GA 1CI3M 3J7YW 3KF6B 2VB3X 3AFQA 4HAEA 1LT4D 4O42A 3GTQB 2H1EA 1JC7A 5C4XH 4WJ4A 2PW7A 1QNUA 3Q8DA 1QNKA 1BUVT 2NTSA 1I94L 2XRSD 4NMZA 5M5YB 4X6AH 3RNUA 1XPRA 4H7BA 4KD4A 2I5MX 2D0OA 2TMPA 1O7ZA 4CDCC 4B08A 1UE5A 3A8IE 1N33Q 1CM9A 1XJVA 1F9RA 2UXDL 3UE0A 2NTTA 1Q3LA 4C3IG 2GVBA 5C3EG 1XNQQ 1IBLL 4LF4L 1B3QA 4TVAB 4IQZA 4M8AA 3I4MB 3J80i 4QJFA 3VR6A 1STNA 1VCIA 2JN4A 3NBHB 1A3UA 4LMQD 5C44B 1KRSA 4IUQA 2D0PA 1S5DD 4ABNA 3O13A 1I50B 1Q1BA 3CCLA 3I4NG 1HZCA 4R4TA 2D5DA 2B2UC 1GUNA 3TRZA 4UHVA 1VQ6A 1S4ZA 3Q22A 4BY7G 5IE8A 2F0LA 1PRTF 4LUOA 5KNBA 1VQ8A 1KHIA 2HQLA 3DHQA 4BA2I 5T1GA 1R4QB 2KCTA 1SE3A 1VQNA 3A7LA 1U4RA 4CJ1B 2AWNA 4U673 1B8AA 4TKOB 3PUZA 4J6HA 4B3TQ 2AKWB 3MA2B 1WTOA 1PH6A 1HJPA 3GTGB 1NY4A 2LMCB 3S2HB 1K0SA 1VQEA 5C4XB 4AYBG 3U4VA 1AFPA 3PIO3 3NWSA 2ZTCA 3ULPA 3MEHA 4LJZC 2LS01 1WVLA 4YHHQ 2ID0A 4WJ3M 1LTTD 1N32L 1V43A 1W6KA 2AUKA 3M4OH 2HT1A 1G6PA 1CKNA 2HCIA 1VQ7A 4FYDA 3A5UA 1G6ZA 2R93H 1B70B 2VQEQ 5CYUA 4QL5A 3TP7A 1V1QA 1IHZA 2IX3A 4DPGA 4BBSG 2QEJC 1SSOA 4XYQA 3GQBA 2M2LA 3X3NA 5IP9H 5C4XG 4A3BH 4NPSA 1UE1A 2RSOA 1VMPA 5FJ8H 4A3KB 2R7DA 2F0KA 4A3JB 4TRDA 1H9SA 1YI2A 1WTPA 1CKOA 3RMHA 2F1MA 1BBWA 3MXUA 5I9OA 3CXCA 1TS2A 1PH9A 4HSPA 4YY3L 4MTNA 1K73C 4HIMA 1VQIA 4A3FH 1ZKOA 1ILPA 4DNTB 1Y8OB 2Q2HA 3A8KE 2AQ2B 5I4DA 3E0JA 1F2ZA 4JBJA 5JJLA 2BDOA 1EYDA 1FJGL 1S5ED 2G9HD 2QEXA 3I90A 3G71A 1JJGA 4CJ0B 1O78A 1PV4A 1E7ZA 1HCZA 1LM0A 4DAYA 3K5NA 5BN3A 2CFMA 2K5QA 3M4OB 2BOSA 5E4XA 4APVA 4FNFA 1NBWA 2EY5A 1J5EQ 1SRUA 3TEHB 1LTBD 2R93B 2L1BA 2B2WA 2FMMA 3PO2H 4MNOA 1L0XB 4CKBA 1IZ6A 2O4XA 2F0NA 1PHJA 1XYIA 1XNRL 1KDAA 2L0CA 1RDPD 3C1FA 3RZDH 3HOYB 3CU7A 2K28A 3S17H 2EY6A 2K50A 3BYTB 4FO2A 4A3BB 4JI4L 4OX9Q 4GS3A 1WD0A 1CQVA 2HIXA 3U58A 2D9UA 1J6QA 3N6RA 1I4QA 3QB3A 4HMIA 4K6LA 4G7OC 2K05A 4N9TA 5K36H 1LABA 4DV6L 4CBVA 1TWAB 3AQQA 1G2TA 4I7AA 3I72A 5JOBA 4JK1C 4A3CG 2CHBD 2H4OA 4EQNA 2RDFA 2B8GA 4GN5A 4A3FB 3ND8A 3V2TA 5BR8L 4POGA 3T4AC 1BBXC 3GTPH 3ULJA 2EYLA 4IURA 2X6LA 3NELA 3L2PA 1MJEA 5EKLA 1UEAB 1QJOA 3EA6A 2HUGA 2I46A 4OO1H 2PZWA 1S5CD 2PQEA 1QG7A 1U4LA 3P20A 2OEOA 2UXBQ 2ZTDA 2L4NA 1TIID 1FD7D 2NB0A 4LNQA 2VQFL 5GADC 2F0HA 3E9HA 1K8AC 3BVZA 2WV6D 2DN8A 4KHPQ 2UUAL 3OHXC 1CHQD 5FO7B 2DNEA 1LTSD 2EYJA 4DNRB 5HY6A 4A3FG 3PO2B 4H02A 1AEXA 2B2WC 2JA6H 2VS1A 1VQOA 3L7ZC 4PMCA 2A6HD 2K4KA 3J81i 5IYDH 5M5WB 4R1JA 3S1QH 3RZDB 4X3UA 3S17B 3OTOQ 1EU4A 4DR3Q 2M00A 2X6GA 1Q86C 1SMYD 4JI7L 4DV7L 1NR4A 1X3EA 1SN8A 2MHVA 1L0WA 4DR6Q 3MZ5A 3FMCA 1LACA 4P73A 4NDXA 2EQSA 1SR3A 4FF2A 4N8FA 2JXMB 1DM0B 2V1CC 3GTPB 1QZGA 3G6JB 2IY5B 1X3GA 2EXDA 1D6EC 2NN6I 4KMUC 4C3HG 3DWQA 1U4PA 2RQXA 1SLJA 3CRKC 1GUOA 3HOUH 3SGIA 3DXJC 1VS0A 4IPDA 3ULLA 3HEJA 1TS5A 4PZ6A 4X3KA 5A2QL 3OWFA 2L12A 3A54A 2OT2A 1GD7A 3ERSX 2Q8IB 3TP5A 1EYAA 4HIOA 4H0LC 5EAYA 1RODA 1QZHA 1GUWA 3HOWH 2BDNA 2K04A 1N8RC 4ODGA 4DV1Q 2JA6B 4EGVA 1XMOQ 4LF5Q 4IFDH 4AQYQ 3S1QB 4DV4L 2SNMA 4EX5A 4KV6A 2MJ8A 2A6HC 1NR2A 1B7YB 3OPOA 4XXEA 4OO1G 2ZT9C 4RGNA 2B63H 3GTMH 1CTMA 1PA6A 3SK4A 1BCPD 1WYDA 4HCSA 1TWHH 2EE1A 1SMYC 4KK7A 1ET9A 2KHJA 2VXWA 2F0DA 3AEVA 4PMWA 1EOVA 2CQOA 2EVBA 1SFOH 2MP1A 3NXWA 5C3XA 3CAMA 3HOXH 1TWFH 1X3PA 4RG1A 4RGTA 2KVMA 5A2QE 4CJ2C 1BOSA 2R3ZA 1WOCA 1YNND 4PMBA 2UUBQ 5COYA 4UY8C 1C0AA 2F0MA 2K1BA 4OWXB 5CBEE 1CK1A 1JWSD 1VQHA 1TXYA 4RKLA 4JI8L 1H95A 3CKIB 2NN6H 1D5XC 3PMFA 1L1OB 2I5LX 4K0KL 3PV0A 2E8GA 4A3DH 4ALPA 4DR7L 3FKIH 1DZ1A 4LFAQ 1ILQA 3BVGA 4TSSA 1VQMA 4DR4L 2MUYA 4RKBA 3SEBA 4DAVA 3EBEA 1I6VC 3KOJA 4IPHA 4RWSC 3PUWA 5C6AA 4DR5Q 4DXFA 5GAEC 1C7YA 3HOWB 2Z4HA 3OW2A 2KJXA 4QIWB 4LUVA 4HIDA 3V05A 2F0WA 1X54A 1WCMH 2FHTA 4K2LA 1PRTD 3EJIA 4OGQC 3H6MA 2D62A 4DUYL 1TS3A 4JI6L 1JB3A 4CHTB 1STYA 4IUNA 3U50C 3E3XA 1NJIC 3QJYA 4JG2A 3SK5A 2Y0SE 1RL2A 1S5FD 3HOUG 5IT9E 4LFBL 1D5ZC 4ZCKA 3MXPA 2Z8LA 1BCPC 3FEWX 2E74C 5GQOA 1XMQQ 1Q7YC 3HOXB 2R92G 4P2CB 1TWFB 3M85A 1Y1VH 4MIUA 5HURA 3BDOA 3SVMA 3HOWG 3PCOB 1NUCA 3NHHA 3KLSA 2QILA 3UDFA 4HJAA 1TT2A 3VYUA 4IFDG 3KLSX 2RHQB 1OXVA 1YNNC 2NUCA 2Z6KA 1MJCA 4QIWE 1L2FA 1F9QA 3VA5A 2ZJQA 3D3RA 4KY6A 4A3DB 2B63G 3S1MB 2XWJB 3WOFA 3FKIB 4DKAC 3C46A 2F4VL 3G6EA 3HOZG 4NKLA 4IUTA 3KFUA 5EPJA 1ET6A 1FGBD 3IAYA 3TBIB 4GKKL 1NTGA 5FLXL 2K32A 1F9PA 1IKLA 4FF3A 1Q1EA 4YWMA 4IFDJ 2VUMH 1HFGA 4NXNL 3HOXG 1E2ZA 1NE3A 5M5XH 4HR7B 4CKEA 3WOEA 3S2DH 2F0VA 1VQLA 5KNDA 2L11A 1EEID 3CC7A 5DM63 1WCMB 2IX1A 1PZID 1FNVA 1EY6A 1PTOH 4G7HC 1M1KC 2RCNA 5IGBA 1DCZA 3H0GH 4IUUA 1H9RA 3SHLA 2OCEA 3OIQA 4A3DG 3SXHA 2EY1A 5HGQA 5KEEA 3KYHC 3AU7A 4LFCL 2YTYA 3U9SA 4ME3A 1EL0A 1NMGA 1WTQA 3GTKH 1V1PB 2ZXOA 1FL0A 3LGJA 4JI3L 4DN4M 4X64L 2JA5H 1T5EA 1DONA 5FLXE 1ASYA 2F0IA 2R7FA 1PMRA 1ZYRC 3STBD 3EVQA 2UU9L 1WCMG 4A3LH 2Z6KC 2GVAA 4NXML 5JJIA 1RKNA 5C3WA 3PIOA 4GKJQ 1VQCA 1PH1A 1EWHA 5C4HA 1G91A 2AHOB 4DUZQ 4JI4Q 1YVCA 5M5YH 3I3CA 3VYRA 1EZ8A 3FP9A 4C2MH 5LMUL 2E5LL 1JJ2A 4UPAA 1TR5A 4KKTA 3DM1A 5CV5A 5KYIA 3HKZE 4DK0A 2A74C 3I56A 2K14A 5M5XB 3CW2C 1Y1VG 2A69D 2F0GA 4RAUC 3S2DB 2WKCA 1HH2P 2JSOA 4DR1L 2DGYA 4F87A 1CA5A 1FYCA 3V96A 3TS0A 2KA7A 2XVSA 5C44H 2CH4A 2OQ0A 4L6TB 1C48A 3H0GB 4Y7NH 4WFN3 3W2DA 1PTOF 1EFID 3BJUA 1YBYA 1HPCA 4ZUIA 2R61A 3MXGA 4R4QA 5AJ3L 3GTOB 3J7ZC 4OIKA 3JAML 2BCOA 2J0TD 2NZOA 1PH4A 1PH7A 2VUMG 4OHJA 1EOTA 1RIPA 4DGZA 4K5XA 1GO3E 2UUAQ 4X66L 1CZGA 2NVTH 2PCFB 1A2TA 1E1TA 1JOKA 4CDEC 3HGBA 4IPCA 4V190 1VQJA 2WACA 2F03A 1SXTA 1A3VA 3VYTA 1HR0W 3GTGH 1EU3A 4HCEA 3GV6A 3IFDA 4XTCS 2ZM6Q 3S2HH 3E0EA 1YZ6A 3GTLB 4KTAA 3STBC 2IWHA 1D8LA 3T1YL 4GNXB 3H0GG 2EZVA 1LTGD 1Y69U 1AH9A 2VZAA 1YHBA 4XDXA 4Q0FA 4C2MB 1WTRA 4XT3B 3OW7A 4PZ7A 4ILWA 4BBRH 1R4PB 5C0XH 1BVSA 1ENAA 1ICFB 3NSWA 3Q0AA 3MWYW 2L15A 5JVH3 3GTJH 3JAME 1YJ9A 2JA5G 4JV5Q 1J8IA 1IBKQ 2CWAA 3CCMA 1PZJD 2A69C 3OIPA 3KJPA 2I07B 1PXUA 4EVOA 2JA8H 4K6DA 3J7AF 4A3LG 3PO3H 3CMEA 4JBKA 4LF7Q 3HP3A 5LHY1 4Y7NB 2QGQA 3KBGA 3F1ZA 1PZKD 4H13C 4A3KH 1A2UA 2B8FA 4A3JH 2J4XA 5IYBH 1HNZL 2QDBA 3WWVA 2E2IB 4IJLA 2IT1A 3MAQA 1GUGA 2HD3A 2F0FA 1QB5D 1CFMA 2ZXPA 4RFBA 5I6WA 2NVTB 1GUTA 5IWAL 5ISRA 3HOVH 4GLXA 1EIYB 1JR0D 2KUMA 4JPBW 3ZJYC 3I4MG 1ESRA 1N36L 4UP9A 2ZXRA 5C44G 4ZAIA 3I73A 1A3TA 5JEAH 1AP0A 3NK9A 4J1MA 4RA8A 3A0JA 1Z47A 1QCBD 1D2BA 4PV1C 1JORA 4C3JH 1IYUA 3MHBA 1CA6A 4BBRB 3K7AB 1T5XD 2L5TA 2PQAA 3X3MA 3MEFA 5C4JH 1K83H 3MXNB 3G4SA 1HTPA 3GTJB 2KHIA 1YITA 3UE1A 1H9JA 2WAQB 2XGTA 4GN3B 1I4PA 4XYOA 2L55A 4B3RL 1Z9FA 2Q8RE 2JA8B 1KDBA 3HOYH 3PO3B 5G3LF 5CR3A 4JI8Q 4RHSA 3QIAA 1EEFD 1HQMC 2EJGC 3VA7A 2CH4W 1FVIA 4EQPA 3T16A 3S24A 3D4RA 1EY5A 2A19A 2OQKA 1TWAH 4B3SL 2GA4B 2C35B 3P7JA 3I70A 3DWAA 5CORA 5FKAC 4BBRG 5C0XG 5M3FH 4G7ZC 5BN5A 3HOVB 4A93H 1Y8PB 3DM3A 3HKSA 3NPPA 2EOTA 2WAQG 3I4LA 4BY1H 1QUQA 3CQZH 4IUVA 4X62L 3Q6SA 1M90C 1PH5A 4JYAQ 4JI2Q 3UDIA 3PO3G 2RDHA 3AFPA 2WAQE 1S5BD 2NVQH 5KNCA 5C0XJ 4K8JA 4A3KG 5LMNQ 3T56B 4NB3A 4MHEA 3TDQA 1SYGA 3I7FA 4A3JG 1IBML 4C3JB 2JEAI 5GROA 3T1HQ 3QO2A 1MI2A 2JA7B 1GJXA 5C4JB 5ELOA 1X65A 1K83B 4ME5A 1QE6A 2EYOA 2UUCL 2NYZD 2UXCL 3A55A 3IL8A 2HHHQ 4Y52H 1BNZA 4BWGB 4DAPA 2Z4IA 4A3IH 1FNWA 1TU2B 2DJGC 1HNXQ 1STGA 1B3AA 2EJFC 5M5WH 2C9OA 1BDOA 1UUPA 2KEEA 1W6JA 2F3WA 1LTAD 3F2UA 3E6ZX 1Q8IA 3HRZC 4KI0A 1LT3D 1D1IA 3C2PA 3D31A 1QVFA 4JI5L 3U9OA 1ENCA 4C3JG 3KK7A 5FOBB 5M3FB 3KDFA 3R2TA 5C5LA 2C5CA 3OWEB 2LY7A 1CSQA 3W1GA 1YJWA 4A93B 2R93G 5JEAJ 2SDFA 3RLNA 4X65L 2FMCA 2NBFA 2QKIC 2K52A 3F8TA 4BY1B 1CQFA 3CQZB 3K6OA 2OXPA 2O5IC 5JAVA 2EYMA 3HOYG 2FFKB 5IP9G 1KIXA 4KJOA 1QILA 1HHVA 2NVQB 4P71A 4FP5D 4A3BG 2MQHA 4YWLA 4DV3L 4DA2A 4B3MQ 5IGFA 5FJ8G 1D7QA 3VR2A 2EJMA 5KYLA 4JI1L 1UAPA 2F3IA 3CP0A 5IIFA 4LFCQ 1MKHA 2LSSA 5M3FG 4HJ7A 4JI3Q 5FO8B 4A3IB 1BBUA 1XWEA 5IGEA 1KC8C 1TQOA 5DEHA 2AMCB 4BY1G 5E3FA 1YEZA 2YTVA 4OWTB 2ZJPA 3QR8A 3CHBD 5HGTA 1GHKA 2N55A 2Q2IA 3S16B 5EKKA 3BG3A 3D8GA 4HJ5A 4JOIA 4CDFC 3P1HA 4DV5Q 4HTHA 1TS4A 4ZQ3A 5DNFA 5JVG3 4XQQA 2RDGA 5FLMH 1RTOA 3NP8A 2P5ZX 2RF4A 2RA4A 1HZ9A 2KEDA 4YCWA 5J1ZA 4G57A 4OIJA 4R8NA 3NTHA 4HJ8A 3KUPA 1ZXTA 3W1BA 2A73B 5TSSA 1K28A 1EY0A 1BO0A 1NNXA 4R9WA 4XIGS 1LT5D 1KAAA 4GOPA 3PO2G 4LF6L 5D3IB 5FK9C 3J80L 4X3TA 1IW7D 3KF8A 4IOCA 4TQUS 1EWCA 1N33L 2QA4A 3CCSA 2F0QA 1I4XA 5CMDA 4A3EH 1XNQL 3M3YB 1OXUA 3L9AX 5JJZA 1B9MA 2ASBA 5K36G 3M4QA 5AJ3Q 3VR4A 5CV7A 3HG9A 5FLXc 3W3AA 3BYYB 2K5HA 2WB1B 2B3GA 1YHQA 4P75A 4WRDA 3E9IA 4DV2Q 1PTOD 4POFA 4DR2L 1NAPA 2SNSA 5EJWA 1KRTA 3IRBA 3RN2A 1TY0A 3MVVA 5LMNW 3TMEA 1Y8NB 3J80E 1KAWA 3FPUB 4JOIC 1STEA 1WTVA 1LYLA 3T1YQ 3K0XA 1SE8A 2K75A 1I94Q 1CKNB 1VQ4A 4B3TL 4JW0A 3GV3A 1A8VA 4JBWA 1OXTA 1EY8A 1SJED 3EQLC 2KENA 4K8IA 1E0BA 4L5SA 4L5RC 1K8OA 2A8VA 1JMCA 2UXDQ 4A75A 3KF6A 4GOPC 4YHHL 2WB1E 1IBLQ 4LF4Q 2JA6G 2Y0SB 5IYDG 5IODA 5IT9L 1MGSA 2BH8A 3TZDA 2O5JC 1X32A 1IW7C 2KOLA 4CKCA 4F7XA 1H9SB 3LWUA 5ELCA 4A3EB 3VYSA 4YWKA 3S1MH 2E76C 2IHFA 2VQEL 1YIJA 1GVPA 3EFXD 4PNYA 3T13A 2AQ1B 4OL7A 1YNJD 4OELB 1UWVA 1F9SA 2JYOA 2E2HH 4DK3C 1QVGA 1G8ZD 3BU2A 4QGUA 4OEMB 3VDYA 1DGSA 1HFNA 5KRUA 3NTIA 3NBHA 4LUZA 5IWAQ 1I4RA 5LL6X 1KDCA 2KCCA 1NSNS 4N8X1 3NUCA 1VQ9A 2EYHA 1N36Q 3K5LA 3K5MA 2Y0SG 2E2JB 1PYBA 3J7A5 1PYSB 2ATWA 1DYQA 4ID6A 4DAYB 4GN4B 2NZ1D 1AE3A 5M3MH 5CC4A 3SDZA 3DEPA 2SOBA 4A3GB 3MFYA 1KLUD 3JAMc 3E5SA 1N32Q 2XIWA 2Z6BA 2PW5A 3TS2A 2F0SA 1EY7A 3ITPA 2BE5D 1NCVA 3J81j 3CCJA 2KQ3A 4B3RQ 1IYVA 1K8MA 1PYWD 1SNQA 5IGDA 1J5EL 4PG3A 4JBMA 1DD2A 2JJQA 1TWCH 2Q8TA 5I2YA 2VW9A 5AFWA 3KDFB 3PSIA 4LF8L 3K80C 2PPBC 2FXQA 3H91A 2E2HB 1GKHA 2ZJRA 4QUCA 1II3A 1YNJC 4OX9L 4QY7A 4A4IA 3D4WA 5JJKA 1EQVA 4R4IA 4YY3Q 2IJ0A 3A8JE 3S1RH 4S3SA 5E7NA 3DLLA 1EQRA 4DV0L 2PI2A 3H3VC 1SNPA 1AE2A 4OONA 1EY9A 2DY8A 2NN6G 1A6XA 1LTID 4DF7A 1A15A 1PRTC 1OXSC 5GAGC 4L8JA 1EIHA 1FJGQ 2K5VA 5M3MB 3PF5A 3HKZB 3FKIG 4IO9A 4UAIA 3GTOH 1PFSA 3ERQA 1SYBA 2B2TA 2OTLA 2MNAA 4L63B 1F2MA 1S40A 2N78A 3RUZA 3NQIA 1P16A 3R8BA 1WI5A 2UXBL 3K5OA 4A3MB 3A5ZB 3H3VI 2UUCQ 1CZWA 2K5DA 1B53A 3OMCA 1IKMA 4YIJA 1KTKA 3J81L 1M8AA 2BE5C 3SE0A 2EYFA 1XNRQ 4KHPL 3BVMA 3GTLH 1LTRD 3NQTA 4CGYB 1OO9B 5F2DA 4V0BA 1MSHA 1TWCB 4C3IH 5M3MG 2DNCA 5C3EH 3HKZG 2MGSA 5DM73 1N34L 1CT1D 1Y1WB 2AWOA 4UDUC 2WKDA 4DV6Q 3OTOL 2B29A 1JWMD 4DR3L 1UE7A 2NVYH 1ESFA 2B2VA 3OMGA 3CMAA 2YYZA 3AB9A 3BZCA 3KF8B 4JVZA 1B9NA 3I2ZA 3S1RB 3R3OA 4DK6C 4KN7C 2M9VA 1IXRA 1BKBA 5BR8Q 3DMUA 1SROA 4DR6L 4BY7H 5EQ0A 4RH6A 1X56A 3SR1A 3OOCA 5C4ZA 3WDNA 2R7ZH 5CBAE 1MSGA 2HDLA 4IZ8A 3F2BA 4LF9L 3J81E 3QOJA 4RCNA 1HUMA 3UDXA 3MTSA 4J8QA 1ASZA 4L5TA 1V9PA 2E2IH 1YHAA 2ICIA 3UDGA 4FF4A 2Z9HA 1DOKA 2VQFQ 2B2TC 1DOMA 2PYKA 2JE6I 2BA0A 1VMCA 4NW2A 1VQPA 2O2LD 5J39A 1SAPA 1Q82C 1N9WA 1O80A 2PNHA 2N49A 1T9HA 2XWBB 1CUKA 1BCPB 1VQGA 1AW7A 3TP6A 1SYEA 3VR5A 5I2XA 1BCPF 4C3IB 3C1EA 5C3EB 5BN4A 4JI7Q 3A7AB 1B1ZA 1TWGB 1XMOL 4DV7Q 4LF5L 1QWYA 3TSSA 4AQYL 4QB4A 3KBXA 3I8ZA 4BBSH 4LK1C 3K7AH 1HNWL 3GD7A 2NVYB 3R93A 1JOOA 4ULLA 2B2VC 3I4NB 3S1NB 1A62A 1GUSA 1JE5A 1CHPD 2CCZA 4KN4C 1DOLA 4J15A 1BF4A 1WFQA 4BY7B 4LF6Q 1LUZA 4ZKBB 1SE2A 1B4OA 2VY3A 2IPKD 1WTHA 3M4PA 2R7ZB 2CW0D 4N9PA 1KD1C 5IYCH 2UUBL 1ZEQX 2Z0SA 3BZDB 3K0YA 1KQSA 1FNUA 3L3OC 1U9RA 4L5QA 4AYBB 3D0FA 3D4DA 3DWPA 2GN5A 1HZBA 1D1KA 3ND9A 4LFAL 4QCLA 4K2KA 1PRTB 4DR2Q 1MHWC 2F0TA 4DV4Q 2MPMA 1HQRD 4DR5L 3ONAB 2R7ZG 4P72A 2SEBD 2QW7A 1E2VA 1SYCA 4HSVA 2EYPA 1CKMA 4I65A 5L37A 4FXGC 1SNOA 4C1NK 1EYCA 5H1SE 1XTCD 2JEBI 2YTXA 1Q12A 2E2DC 4BBSB 1XXGA 3QOLA 4HIKA 2JA7H 1HR0L 2JK8A 5CGKA 1STHA 1SDFA 1O7IA 1WD1A 3S15H 1UE6A 2TSSA 2RHSB 4QMGA 2E75C 4AYBE 3FDTA 5I6YA 1C8CA 1STBA 1XMQL 1KXLA 1JB7A 4QF4A 1KLGD 2BA1A 5J3BA 4A3CH 1ONLA 4BXXH 3R2IA 2HQEA 2PO4A 2CW0C 4GLAC 3ICEA 4K0KQ 2LXKA 4DR7Q 5DAUA 1KNEA 1D5MC 4JC0A 2KCMA 3PIP3 4DR4Q 1I3QH 4JI0L 4IJHA 1XPOA 2DY7A 1PFNA 1I4GA 1VQFA 2IW3A 3EN2A 5IGCA 2EIFA 3K57A 3NEMA 2ZTEA 2XNAC 4UP8A 1QVCA 3AYHB 1E1OA 1SJHD 2F0PA 1L1OA 3J80c 5ELEA
chains in the Genus database with same CATH topology
3C3LA 1LLRD 3HZXA 5C5MA 2KHSA 1OXXK 5IGGA 5D14A 4B9XA 4K5VA 2K03A 3M7NA 2PNRC 1MD2D 5D3DA 3AMUA 2N88A 4RGMA 3DEOA 4U68A 4DU9A 3S15B 3UI2A 4OO1I 4WORA 2F0UA 2L9HA 4G4KA 1G2SA 3QWNA 3RD4A 4H44C 5EPLA 2V4DA 1RJTA 1SYDA 2R6GA 5JEAG 3IKJA 3H09A 2K01A 1EIGA 1TVXA 1GOZA 2WP8J 1I3QB 4M1UB 1Z7TA 1VDZA 1JWUD 4NP5A 3FRPB 5E1FA 2D2CC 3BS1A 1I4HA 2K6AA 5CV8A 5I9PA 2QF7A 5KGUA 1DXMA 2CQAA 2F4IA 3MFGA 2F0OA 3GP7A 1M4VA 2NWGA 1TY2A 4PQXA 1SEBD 2AQ3B 3DUZA 2VB2X 3MC0B 5A35A 4ZUJA 1SBBB 1AZPA 2K5WA 3RZOB 5ELBA 2YU9B 4ZKCB 4RCOA 3LX0A 5E4WC 1JICA 4KD3A 5EPKA 1RCVD 4C56C 1Z6HA 1ICWA 1V1PA 1PFMA 1H9MA 3Q24A 5M9OA 1VF7A 4IFDI 4K5WA 5EKIA 5EBCA 4C3HB 1IL8A 1RD9D 1B50A 1HXYD 4GZYC 3RLFA 1BQQT 1O7YA 2A6ED 4RGOS 4HN7A 3ZYYX 1AZQA 4DK1A 4WJWA 2IX0A 4KKUA 2K7VA 3D6WA 4DFAA 2G9DA 3TZUA 3CRLC 1SNCA 2LKVA 1HA6A 5LL6S 2XN9C 5JPMC 5IOCA 1MBYA 5CV6A 3NE5B 3I91A 1PLFA 1QOHA 1VF5C 2WINB 3SK6A 3M4YA 1WTXA 1GHJA 3K59A 3TP8A 5CV9A 4HMJA 3NWTA 4IN3A 1PFBA 2CVRA 4EQOA 2ENBA 4KHZA 2LFNA 2PZUA 1WTWA 3T53B 2PMZB 1EQTA 1JOQA 2QCPX 2K33A 2VNUD 5EBDA 1RF2D 1F77A 2A5HA 5KIXA 1DJRD 4BA1I 1ENFA 2IL8A 3T51B 1PDQA 1E2WA 2EY2A 2A6EC 1FR3A 4BS9A 4B9WA 2XRQD 2HCCA 3SK8A 2F0EA 1BR9A 1G291 3NTKA 2RKSA 4LAAA 4ZLTF 3K58A 3HOUB 1HTLD 4XT1B 1PTOC 5CV4A 4C1NI 3NBIA 3N52A 3P75A 2R92B 1STAA 4FXDA 2FINB 2EXZA 4FF1A 4XQJA 3H94A 4E6IA 5FO9B 1JCKB 4MN3A 1GXDC 1RHPA 2B63B 3GTMB 2HDMA 3HOZB 1TWHB 1EZ6A 4F88A 3URYA 1SFOB 3A56A 4F8MA 4QUFA 3Q23A 2KCNA 1AN8A 1ZYRD 1ML0D 2EPBA 3IFTA 1HUNA 4DXGA 4IUPA 3S9WA 4O1NA 3MXNA 5JPNC 2B2YA 3GO5A 2XSCA 5G3LD 3FVQA 1R9TB 1SNDA 1F2LA 1JQYD 3D6CA 2ICEC 3QG1A 2AUJD 1KABA 2F3VA 3FPPA 2FJ2A 2RSNA 3HS0C 5K5PA 4FXKC 1RTNA 1O7LA 1SE4A 2RVLA 2NVXB 3BDCA 1SNMA 4RHRA 5D65A 3EROA 2J7ZA 2A68D 3OSOA 1F2YA 3LNNA 1UNSA 4IALA 3LWEA 4X3SA 4Z9CB 2B39A 4ZYSA 1Y1VB 3PUYA 5ELFA 2EDGA 1V1OA 4KJNA 1V8QA 4ZK9B 2JP1A 1X3QA 2B2YC 5NUCA 3TN2A 1LO5D 5J22A 3PUXA 2KECA 3PUVA 4Q5VA 2F0JA 3VR3A 3G7LA 3KLRA 1C4QA 4HEDA 1HRJA 1HA5A 1Q90A 2VUMB 4KY7A 5EGTA 5C0XI 4K14A 2Z1CA 1TKWB 1JE4A 1LT6D 4KY5A 1BXTA 1B2TA 4FVMA 2PZTA 1H9KA 5T1IA 1PTOB 1KNAA 2WIIB 2B2UA 4ZRZA 2OF1A 1J9OA 4R8IA 1U4MA 4KKSA 3S14B 1EY4A 2RBMA 2A68C 2X69A 4I7ZC 3GTKB 1XX8A 2JA5B 4KHVA 1SYFA 1LV9A 4XQNA 1I6HB 1L0YB 5ELDA 3J7AV 1B44D 3BDLA 3M7GA 1CI3M 3J7YW 2VB3X 4HAEA 1LT4D 4O42A 3GTQB 2H1EA 1JC7A 2PW7A 1QNUA 1QNKA 1BUVT 2NTSA 2XRSD 4NMZA 5M5YB 4H7BA 4KD4A 2TMPA 1O7ZA 4B08A 3A8IE 1CM9A 1F9RA 2NTTA 1Q3LA 4C3IG 4IQZA 4M8AA 3I4MB 3VR6A 1STNA 1VCIA 1A3UA 4LMQD 5C44B 4IUQA 4ABNA 1S5DD 3O13A 1I50B 1Q1BA 2D5DA 2B2UC 1GUNA 1S4ZA 3Q22A 2F0LA 1PRTF 5KNBA 3DHQA 4BA2I 5T1GA 1R4QB 1SE3A 3A7LA 1U4RA 4CJ1B 2AWNA 4U673 4TKOB 3PUZA 4J6HA 3MA2B 1WTOA 3GTGB 2LMCB 3S2HB 5C4XB 1AFPA 3PIO3 3NWSA 3MEHA 4LJZC 2LS01 1WVLA 2ID0A 1LTTD 1V43A 1W6KA 2AUKA 2HCIA 4FYDA 1G6ZA 5CYUA 3TP7A 1IHZA 2IX3A 2QEJC 1SSOA 4XYQA 3GQBA 2M2LA 3X3NA 2RSOA 1VMPA 4A3KB 2F0KA 4A3JB 4TRDA 1H9SA 1WTPA 3RMHA 2F1MA 3MXUA 5I9OA 1TS2A 4HSPA 1ZKOA 1ILPA 4DNTB 1Y8OB 3A8KE 2AQ2B 5I4DA 3E0JA 1F2ZA 2BDOA 1EYDA 1S5ED 2G9HD 3I90A 4CJ0B 1O78A 1HCZA 4DAYA 3K5NA 5BN3A 2K5QA 3M4OB 2BOSA 5E4XA 4FNFA 2EY5A 1LTBD 2R93B 2L1BA 2B2WA 2FMMA 1L0XB 4CKBA 2O4XA 2F0NA 1XYIA 1KDAA 2L0CA 1RDPD 3C1FA 3HOYB 3CU7A 2K28A 2EY6A 3BYTB 4FO2A 4A3BB 1WD0A 1CQVA 2D9UA 3N6RA 3QB3A 1I4QA 4HMIA 4K6LA 4G7OC 2K05A 4N9TA 5K36H 1LABA 4CBVA 1TWAB 1G2TA 3I72A 5JOBA 4JK1C 2CHBD 2H4OA 4EQNA 2RDFA 2B8GA 4A3FB 3ND8A 3V2TA 3T4AC 1BBXC 2EYLA 4IURA 2X6LA 5EKLA 1UEAB 1QJOA 3EA6A 2HUGA 2I46A 4OO1H 2PZWA 1S5CD 2PQEA 1QG7A 1U4LA 3P20A 2OEOA 2L4NA 1TIID 1FD7D 2NB0A 2F0HA 3BVZA 2WV6D 2DN8A 3OHXC 1CHQD 5FO7B 2DNEA 1LTSD 2EYJA 4DNRB 3PO2B 1AEXA 2B2WC 3L7ZC 4PMCA 2A6HD 5M5WB 3RZDB 4X3UA 3S17B 1EU4A 2M00A 2X6GA 1SMYD 1NR4A 2MHVA 3MZ5A 3FMCA 1LACA 4NDXA 4FF2A 2JXMB 1DM0B 3GTPB 3G6JB 1D6EC 2NN6I 4KMUC 4C3HG 3DWQA 1U4PA 2RQXA 3CRKC 1GUOA 3DXJC 3HEJA 1TS5A 4X3KA 5A2QL 2L12A 3A54A 3OWFA 2OT2A 2Q8IB 3TP5A 1EYAA 4H0LC 1RODA 1GUWA 2BDNA 2K04A 4ODGA 2JA6B 4EGVA 4IFDH 3S1QB 2SNMA 4KV6A 2MJ8A 2A6HC 1NR2A 3OPOA 4XXEA 4OO1G 2ZT9C 4RGNA 1CTMA 3SK4A 1BCPD 4HCSA 2EE1A 1SMYC 4KK7A 1ET9A 2VXWA 2F0DA 4PMWA 2EVBA 2MP1A 3NXWA 5C3XA 1X3PA 4RGTA 2KVMA 5A2QE 4CJ2C 1BOSA 2R3ZA 1YNND 4PMBA 5COYA 2F0MA 2K1BA 5CBEE 1CK1A 1JWSD 4RKLA 3CKIB 2NN6H 1D5XC 3PMFA 3PV0A 1DZ1A 1ILQA 3BVGA 4TSSA 2MUYA 4RKBA 3SEBA 4DAVA 1I6VC 4RWSC 3PUWA 5C6AA 4DXFA 3HOWB 2Z4HA 2KJXA 4QIWB 3V05A 2F0WA 2FHTA 4K2LA 1PRTD 3EJIA 4OGQC 3H6MA 2D62A 1TS3A 1JB3A 4CHTB 1STYA 4IUNA 3QJYA 3SK5A 1S5FD 5IT9E 1D5ZC 3MXPA 2Z8LA 1BCPC 3FEWX 2E74C 3HOXB 4P2CB 1TWFB 3M85A 4MIUA 5HURA 3BDOA 3SVMA 1NUCA 3NHHA 3KLSA 2QILA 1TT2A 3VYUA 4IFDG 3KLSX 1OXVA 1YNNC 2NUCA 1F9QA 3VA5A 3D3RA 4KY6A 4A3DB 3S1MB 2XWJB 3WOFA 3FKIB 3C46A 4NKLA 4IUTA 5EPJA 1ET6A 1FGBD 3IAYA 3TBIB 5FLXL 2K32A 1F9PA 1IKLA 4FF3A 1Q1EA 4IFDJ 1HFGA 1E2ZA 4HR7B 4CKEA 3WOEA 2F0VA 5KNDA 2L11A 1EEID 5DM63 1WCMB 2IX1A 1PZID 1FNVA 1EY6A 1PTOH 4G7HC 5IGBA 1DCZA 4IUUA 1H9RA 3SHLA 3OIQA 3SXHA 2EY1A 5KEEA 3AU7A 3U9SA 1EL0A 1WTQA 1V1PB 2ZXOA 4DN4M 1T5EA 1DONA 5FLXE 2F0IA 1PMRA 1ZYRC 3EVQA 1RKNA 5C3WA 1EWHA 5C4HA 1G91A 3I3CA 3VYRA 1EZ8A 1TR5A 4KKTA 3DM1A 5CV5A 5KYIA 4DK0A 2A74C 5M5XB 2A69D 2F0GA 4RAUC 3S2DB 2WKCA 2JSOA 4F87A 1CA5A 1FYCA 3V96A 2KA7A 2XVSA 4L6TB 1C48A 3H0GB 4WFN3 3W2DA 1PTOF 1EFID 1HPCA 4ZUIA 2R61A 3MXGA 3GTOB 4OIKA 3JAML 2BCOA 2J0TD 4OHJA 1EOTA 4DGZA 4K5XA 1CZGA 2PCFB 1A2TA 1JOKA 3HGBA 4V190 2WACA 2F03A 1SXTA 1A3VA 3VYTA 1EU3A 4HCEA 3GV6A 3IFDA 4XTCS 3GTLB 4KTAA 2IWHA 2EZVA 1LTGD 1Y69U 4XDXA 4Q0FA 4C2MB 1WTRA 4XT3B 3OW7A 4ILWA 1R4PB 5C0XH 1ENAA 3NSWA 3Q0AA 3MWYW 5JVH3 3JAME 1J8IA 1PZJD 2A69C 3OIPA 2I07B 1PXUA 4EVOA 4K6DA 3J7AF 3HP3A 5LHY1 4Y7NB 3KBGA 1PZKD 4H13C 1A2UA 2B8FA 2J4XA 2E2IB 2QDBA 2IT1A 3MAQA 1GUGA 2F0FA 1QB5D 1CFMA 2ZXPA 4RFBA 5I6WA 2NVTB 1GUTA 5ISRA 1JR0D 2KUMA 1ESRA 2ZXRA 4ZAIA 3I73A 1A3TA 5JEAH 1AP0A 3NK9A 4J1MA 4RA8A 1Z47A 1QCBD 1D2BA 4PV1C 1JORA 1IYUA 3MHBA 1CA6A 4BBRB 3K7AB 1T5XD 2L5TA 3X3MA 3GTJB 1HTPA 1H9JA 2WAQB 1I4PA 4XYOA 2L55A 2Q8RE 2JA8B 1KDBA 3PO3B 5G3LF 5CR3A 4RHSA 3QIAA 1EEFD 1HQMC 2EJGC 3VA7A 4EQPA 3T16A 3D4RA 1EY5A 2GA4B 3P7JA 5FKAC 3I70A 3DWAA 5CORA 5C0XG 4G7ZC 5BN5A 3HOVB 1Y8PB 3NPPA 2EOTA 3I4LA 4IUVA 3Q6SA 2RDHA 1S5BD 5KNCA 5C0XJ 4K8JA 3T56B 4MHEA 3TDQA 1SYGA 4C3JB 2JEAI 3QO2A 1MI2A 2JA7B 1GJXA 5C4JB 1K83B 4ME5A 1QE6A 2EYOA 2NYZD 3A55A 3IL8A 1BNZA 4BWGB 4DAPA 2Z4IA 1FNWA 1TU2B 1STGA 1B3AA 2EJFC 2C9OA 1BDOA 1UUPA 2KEEA 1W6JA 2F3WA 1LTAD 3F2UA 3E6ZX 1Q8IA 3HRZC 4KI0A 1LT3D 1D1IA 3C2PA 3D31A 3U9OA 1ENCA 4C3JG 3KK7A 5FOBB 5M3FB 3R2TA 5C5LA 2C5CA 3OWEB 2LY7A 4A93B 5JEAJ 2SDFA 2FMCA 2NBFA 2QKIC 4BY1B 1CQFA 3CQZB 3K6OA 2OXPA 2O5IC 5JAVA 2EYMA 2FFKB 4KJOA 1QILA 1HHVA 2NVQB 4FP5D 4DA2A 5IGFA 3VR2A 2EJMA 5KYLA 1UAPA 5IIFA 5FO8B 4A3IB 1XWEA 5IGEA 1TQOA 5DEHA 5E3FA 1GHKA 3CHBD 5HGTA 2N55A 3S16B 5EKKA 3BG3A 3D8GA 3P1HA 5DNFA 4ZQ3A 1TS4A 4HTHA 5JVG3 4XQQA 2RDGA 1RTOA 3NP8A 2RA4A 5J1ZA 2KEDA 4G57A 4OIJA 4R8NA 3NTHA 3KUPA 1ZXTA 2A73B 5TSSA 1EY0A 1BO0A 4R9WA 4XIGS 1LT5D 1KAAA 5D3IB 5FK9C 3J80L 4X3TA 1IW7D 3KF8A 4TQUS 1EWCA 2F0QA 1I4XA 5CMDA 3M3YB 1OXUA 3L9AX 5JJZA 1B9MA 5K36G 3VR4A 5CV7A 3HG9A 3W3AA 3BYYB 2WB1B 4WRDA 1PTOD 1NAPA 2SNSA 5EJWA 1TY0A 3MVVA 3TMEA 1Y8NB 3J80E 3FPUB 1STEA 1WTVA 3GV3A 4JBWA 1OXTA 1EY8A 1SJED 3EQLC 4K8IA 1E0BA 1K8OA 2Y0SB 5IODA 5IT9L 1MGSA 3TZDA 2O5JC 1X32A 1IW7C 2KOLA 4CKCA 4F7XA 1H9SB 3LWUA 5ELCA 4A3EB 3VYSA 2E76C 4PNYA 3EFXD 3T13A 2AQ1B 4OL7A 1YNJD 1F9SA 2JYOA 1G8ZD 1HFNA 5KRUA 3NTIA 3NBHA 1I4RA 5LL6X 1KDCA 2KCCA 1NSNS 3NUCA 2EYHA 3K5LA 3K5MA 2E2JB 1DYQA 4ID6A 2NZ1D 5CC4A 3SDZA 3DEPA 2SOBA 4A3GB 3MFYA 1KLUD 3E5SA 2XIWA 2PW5A 2F0SA 1EY7A 3ITPA 2BE5D 1NCVA 2KQ3A 1IYVA 1K8MA 1PYWD 1SNQA 5IGDA 1DD2A 2Q8TA 5I2YA 5AFWA 2PPBC 3H91A 2E2HB 4QUCA 1II3A 1YNJC 3D4WA 1EQVA 2IJ0A 3A8JE 4S3SA 3H3VC 1SNPA 1EY9A 2DY8A 2NN6G 1A6XA 1LTID 4DF7A 1A15A 1PRTC 1OXSC 4L8JA 1EIHA 5M3MB 3HKZB 4UAIA 3ERQA 1SYBA 2B2TA 4L63B 1F2MA 3RUZA 3NQIA 3R8BA 3K5OA 4A3MB 1CZWA 2K5DA 1B53A 3OMCA 1IKMA 4YIJA 1KTKA 3J81L 1M8AA 2BE5C 3SE0A 2EYFA 3BVMA 1LTRD 3NQTA 4CGYB 1OO9B 5F2DA 4V0BA 1MSHA 1TWCB 2DNCA 2MGSA 5DM73 1CT1D 1Y1WB 2AWOA 4UDUC 2WKDA 1JWMD 3OMGA 1ESFA 2B2VA 2YYZA 3AB9A 1B9NA 3S1RB 3R3OA 4KN7C 2M9VA 3DMUA 5EQ0A 4RH6A 3SR1A 3OOCA 5C4ZA 3WDNA 5CBAE 1MSGA 2HDLA 4IZ8A 3J81E 3QOJA 4RCNA 1HUMA 3MTSA 4J8QA 2ICIA 4FF4A 1DOKA 2B2TC 1DOMA 2PYKA 2JE6I 2BA0A 1VMCA 4NW2A 2O2LD 5J39A 1SAPA 1O80A 2XWBB 1BCPB 3TP6A 1AW7A 1SYEA 3VR5A 5I2XA 1BCPF 4C3IB 3C1EA 5C3EB 5BN4A 3A7AB 1B1ZA 1TWGB 1QWYA 3TSSA 4QB4A 3KBXA 3I8ZA 4LK1C 3GD7A 2NVYB 3R93A 1JOOA 4ULLA 2B2VC 3I4NB 3S1NB 1GUSA 1CHPD 4KN4C 1DOLA 1BF4A 4BY7B 4ZKBB 1SE2A 1B4OA 2IPKD 2R7ZB 2CW0D 4N9PA 1ZEQX 3BZDB 3K0YA 1FNUA 3L3OC 1U9RA 4AYBB 3D4DA 3DWPA 1D1KA 3ND9A 4QCLA 4K2KA 1PRTB 2F0TA 2MPMA 1HQRD 3ONAB 2SEBD 1E2VA 1SYCA 4HSVA 2EYPA 4I65A 4FXGC 1SNOA 4C1NK 1EYCA 1XTCD 2JEBI 1Q12A 2E2DC 4BBSB 1XXGA 3QOLA 5CGKA 1STHA 1SDFA 1WD1A 2TSSA 4QMGA 2E75C 3FDTA 5I6YA 1C8CA 1STBA 4QF4A 1KLGD 2BA1A 1ONLA 3R2IA 2HQEA 2PO4A 2CW0C 5DAUA 1KNEA 1D5MC 3PIP3 2DY7A 1PFNA 1I4GA 2IW3A 5IGCA 3K57A 2XNAC 2F0PA 1SJHD 5ELEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0G A;  3OMC A;  1KDC A;  4YIJ A;  5HUR A;  5KIX A;  1NSN S;  3NUC A;  2RDF A;  4EQN A;  1NUC A;  2EYH A;  2EYF A;  3LX0 A;  3NHH A;  1STG A;  3HZX A;  4KHV A;  5C5M A;  3V2T A;  2KHS A;  1TT2 A;  4ODG A;  2EY2 A;  1SYF A;  3NQT A;  4N9P A;  3TP7 A;  2F3W A;  2NUC A;  2EYL A;  4ID6 A;  1IHZ A;  4KD3 A;  5IGG A;  5F2D A;  5K5P A;  2F0Q A;  2SNM A;  3BDL A;  4B9W A;  1A3T A;  4KV6 A;  5EKL A;  5CC4 A;  3SK8 A;  3VA5 A;  3NK9 A;  4B9X A;  4J1M A;  4K5V A;  2SOB A;  4KY6 A;  5M9O A;  2PZW A;  2PQE A;  2F0E A;  4ZUI A;  4K5W A;  3BDC A;  1SNM A;  2PW7 A;  3SK4 A;  1JOR A;  2RKS A;  2OEO A;  1ENC A;  4NKL A;  3U9O A;  1U9R A;  3E5S A;  4LAA A;  4DU9 A;  3MHB A;  3OMG A;  5CV7 A;  2F0K A;  2F0D A;  2PW5 A;  3D4D A;  3ERO A;  4NMZ A;  2F0S A;  4TRD A;  2F0U A;  4H7B A;  4WOR A;  4KD4 A;  3NXW A;  5C5L A;  5C3X A;  2F0H A;  4WRD A;  1EY7 A;  3OSO A;  5CV4 A;  4DGZ A;  4K5X A;  3R3O A;  3ITP A;  4K2K A;  3DMU A;  1F2Y A;  3P75 A;  1SYD A;  5I9O A;  4IAL A;  1A2T A;  2SNS A;  1STA A;  2F0T A;  2F0V A;  2KQ3 A;  1JOK A;  2EYJ A;  3SR1 A;  4PMB A;  5C4Z A;  2EXZ A;  2OXP A;  2WAC A;  1AEX A;  1SNQ A;  2F0M A;  1A3V A;  2EYM A;  5IGD A;  5JAV A;  1KDB A;  3MVV A;  4KJO A;  4PMC A;  5CR3 A;  4RKL A;  3TME A;  1SYC A;  4IZ8 A;  4DFA A;  1STN A;  3QOJ A;  1EY6 A;  1F2Z A;  2EYP A;  3PMF A;  4I65 A;  4KTA A;  4KJN A;  5IGB A;  1SNO A;  4EQP A;  1EYC A;  5IGF A;  1A3U A;  3T16 A;  2M00 A;  3SHL A;  1EYD A;  1SNC A;  2LKV A;  5NUC A;  5KYL A;  4E6I A;  3QOL A;  3SXH A;  2EY1 A;  5J22 A;  1EY5 A;  5KEE A;  2PYK A;  4NP5 A;  2F0J A;  1STH A;  5CGK A;  5IIF A;  5IOC A;  1II3 A;  1EY8 A;  5CV6 A;  5E1F A;  4K8I A;  4RKB A;  3D4W A;  1ENA A;  1EQV A;  1EZ6 A;  3MZ5 A;  2F0L A;  4QMG A;  5J39 A;  5CV8 A;  4S3S A;  5I9P A;  5C6A A;  3DHQ A;  5I6Y A;  2EY5 A;  5KGU A;  4KY7 A;  3SK6 A;  1STB A;  5EGT A;  4F8M A;  5IGE A;  2F0I A;  4NDX A;  1TQO A;  1SNP A;  4QF4 A;  5DEH A;  1EY9 A;  4K14 A;  5IOD A;  5E3F A;  3TP8 A;  5HGT A;  3TP6 A;  4EVO A;  5CV9 A;  1SYE A;  5EKK A;  2F0W A;  3D8G A;  4HMJ A;  4K6D A;  4DF7 A;  2O4X A;  2F0O A;  3EVQ A;  4J6H A;  2F0N A;  4F7X A;  2HQE A;  3P1H A;  4K2L A;  4HTH A;  4KY5 A;  4ZQ3 A;  3C1E A;  1RKN A;  1KDA A;  3EJI A;  3S9W A;  3C1F A;  3H6M A;  2ENB A;  4EQO A;  5DAU A;  5C3W A;  3NP8 A;  4K8J A;  2PZT A;  1STY A;  5C4H A;  4PNY A;  4QB4 A;  2PZU A;  1A2U A;  2EY6 A;  4IUN A;  3ERQ A;  5J1Z A;  1SYB A;  3SK5 A;  1SYG A;  3T13 A;  4G57 A;  4OL7 A;  4R8N A;  2QDB A;  1F2M A;  1EZ8 A;  3QB3 A;  3MEH A;  4HMI A;  1JOO A;  1JOQ A;  1SND A;  2OF1 A;  3MXP A;  1TR5 A;  3D6C A;  3HEJ A;  4N9T A;  3RUZ A;  4ZUJ A;  1EY0 A;  5IGC A;  5CV5 A;  1KAB A;  3OWF A;  5KYI A;  1EY4 A;  3TP5 A;  2F3V A;  2F0F A;  1EYA A;  4ME5 A;  5KRU A;  2EYO A;  2RBM A;  1KAA A;  2F0P A;  5I6W A;  5JOB A;  4MIU A;  5ISR A; 
#chains in the Genus database with same CATH topology
 1E3P A;  2JA8 G;  3G48 A;  3C3L A;  2N3S A;  1LLR D;  1WJJ A;  3HZX A;  5DLQ E;  5C5M A;  2KHS A;  1X6O A;  4DUY Q;  4JI6 Q;  1OXX K;  5IGG A;  5D14 A;  5IYC G;  1KL9 A;  5IYB G;  4YCV A;  4B9X A;  4LFB Q;  2DJF C;  4K5V A;  2K03 A;  3M7N A;  2PNR C;  1MD2 D;  5D3D A;  3AMU A;  2N88 A;  4RGM A;  3DEO A;  4U68 A;  3ER0 A;  4DU9 A;  3S15 B;  2CWP A;  3UI2 A;  1C9O A;  3HOV G;  4OO1 I;  4WOR A;  2F0U A;  2L9H A;  4G4K A;  1G2S A;  1UEB A;  3QWN A;  3RD4 A;  2F52 A;  4H44 C;  5EPL A;  2V4D A;  2ES2 A;  1RJT A;  3JC6 6;  3RZO H;  2DUD A;  2PI2 E;  1K0R A;  1SYD A;  3K7U C;  3S16 H;  2R6G A;  2YU9 H;  3FHW A;  4O2D A;  5JEA G;  3IKJ A;  3H09 A;  2K01 A;  1EIG A;  2IHE A;  4QQB X;  1TVX A;  4GLV B;  1GOZ A;  2F4V Q;  2WP8 J;  1PVO A;  3F2C A;  1W2B A;  4LF8 Q;  4GKK Q;  1I3Q B;  4M1U B;  1Z7T A;  1VDZ A;  3EIV A;  2JA7 G;  4C3H H;  4GKJ L;  1JWU D;  4NP5 A;  3FRP B;  4NXN Q;  4DUZ L;  1CSP A;  5E1F A;  1VQ5 A;  2D2C C;  3BS1 A;  1I4H A;  2K6A A;  5CV8 A;  5I9P A;  2QF7 A;  1L1O C;  4DV0 Q;  5KGU A;  3KJO A;  5IT9 c;  3CCU A;  4MTK A;  1DXM A;  2CQA A;  2F4I A;  3CCE A;  1GM5 A;  3M3Y H;  3MFG A;  2F0O A;  4BXX G;  3GP7 A;  1M4V A;  2NWG A;  1TY2 A;  4PQX A;  1VQA A;  1SEB D;  2AQ3 B;  3CPF A;  3DUZ A;  2VB2 X;  3MC0 B;  5A35 A;  1W3S A;  4HJ9 A;  1JJC B;  4A93 G;  1HZA A;  4X64 Q;  4ZUJ A;  1SBB B;  1AZP A;  1EWI A;  1PH3 A;  1P8L A;  2K5W A;  3PGZ A;  2XTI A;  3RZO B;  5ELB A;  2YU9 B;  2UU9 Q;  4ZKC B;  4RCO A;  3LX0 A;  5E4W C;  4NXM Q;  1JIC A;  4KD3 A;  5EPK A;  1RCV D;  1LTL A;  4C56 C;  2OTJ A;  1Z6H A;  1ICW A;  1V1P A;  1PFM A;  1H9M A;  3Q24 A;  5M9O A;  1VF7 A;  5LMU Q;  1N34 Q;  2ZM6 L;  2E5L Q;  3L0O A;  4IFD I;  4K5W A;  5EKI A;  5EBC A;  4C3H B;  1IL8 A;  1RD9 D;  1K9M C;  1VQD A;  1B50 A;  1Q46 A;  1HXY D;  4GZY C;  3RLF A;  4A3I G;  2NZH A;  4DR1 Q;  3W5O A;  3CPW A;  1EIF A;  1EYG A;  1BQQ T;  1X9N A;  1O7Y A;  2A6E D;  4RGO S;  2H5X A;  1A63 A;  3TRE A;  4HN7 A;  3ZYY X;  4JV5 L;  1AZQ A;  4DK1 A;  4WJW A;  1IBK L;  2IX0 A;  4KKU A;  1Q81 C;  2K7V A;  3D6W A;  1YJN A;  4DFA A;  4LF9 Q;  2G9D A;  1PH2 A;  2MO1 A;  2ALY B;  3TZU A;  3CRL C;  3RN5 A;  1E22 A;  1SNC A;  2LKV A;  1HA6 A;  5LL6 S;  4LF7 L;  2XN9 C;  5JPM C;  2G5D A;  1K8G A;  3F2D A;  3CF5 A;  5IOC A;  4X66 Q;  1MBY A;  5CV6 A;  4A76 A;  3NE5 B;  2MFI A;  3I91 A;  1PLF A;  1QOH A;  1VF5 C;  2QDL A;  3JAM i;  2WIN B;  2E2J H;  4MZ9 A;  3SK6 A;  3M4Y A;  1WTX A;  2R92 H;  4O0A A;  1SMX A;  1GHJ A;  3K59 A;  4YCU A;  3TP8 A;  3M9B A;  4EQ5 A;  5CV9 A;  4HMJ A;  3CCQ A;  5IY0 A;  3NWT A;  4IN3 A;  2PQA B;  1PFB A;  2CVR A;  4A3G H;  4EQO A;  2ENB A;  4AH6 A;  4KHZ A;  3B6Y A;  2LFN A;  2PZU A;  1WTW A;  3T53 B;  2PMZ B;  1HNW Q;  2WB1 G;  2YV5 A;  1EQT A;  2RCF A;  1JOQ A;  1X55 A;  2QCP X;  2I5H A;  3HOZ H;  2K33 A;  2KBN A;  2MO0 A;  2VNU D;  5EBD A;  1RF2 D;  1F77 A;  4GNX A;  2A5H A;  4UP7 A;  1XTD A;  5KIX A;  3J81 c;  1DJR D;  4BA1 I;  1ENF A;  1EUJ A;  3GDE A;  2IL8 A;  3T51 B;  1PDQ A;  1E2W A;  5FLM G;  3U4Z A;  2EY2 A;  2A6E C;  1FR3 A;  4BS9 A;  4B9W A;  4DNI A;  2XRQ D;  3BZK A;  2HCC A;  1HNZ Q;  3SK8 A;  4CDD C;  2N8N A;  1IYJ B;  2F0E A;  1BR9 A;  1G29 1;  5ELN A;  2BH2 A;  3NTK A;  2RKS A;  4LAA A;  1Q8K A;  4ZLT F;  1QUQ B;  1EFW A;  1R9T H;  3K58 A;  2I0Q A;  1HTL D;  3HOU B;  2PMZ E;  3CC2 A;  1G51 A;  4XT1 B;  2Q2T A;  1PTO C;  5CV4 A;  4C1N I;  3NBI A;  3N52 A;  4JCV E;  3P75 A;  2R92 B;  1XPU A;  1STA A;  2A1A A;  4FXD A;  3CD6 A;  2FIN B;  2EXZ A;  4KLK A;  4A3E G;  4FF1 A;  3I55 A;  2HIV A;  4IOA A;  1U5K A;  4XQJ A;  2K5N A;  4R4O A;  4JYA L;  4JI2 L;  3A74 A;  3CCR A;  3H94 A;  2NVX H;  4E6I A;  5FO9 B;  1JCK B;  4MN3 A;  1GXD C;  1X3F A;  1RHP A;  1HR0 Q;  4DAM A;  4A3M H;  4IPG A;  5LMN L;  2B63 B;  3GTM B;  2HDM A;  3HOZ B;  1TWH B;  1EZ6 A;  1U0L A;  4F88 A;  3URY A;  3T1H L;  1SFO B;  2WFW A;  4GNX C;  3K8A A;  2CKZ B;  3A56 A;  4F8M A;  4QUF A;  3Q23 A;  1VQB A;  3RLO A;  2KCN A;  2HHH L;  1AN8 A;  1ZYR D;  1ML0 D;  2EPB A;  3HFZ B;  3IFT A;  3PF4 A;  1HUN A;  4DXG A;  1HNX L;  4IUP A;  3S9W A;  1Y1W H;  4A3G G;  1MIU A;  4OWW B;  3OYY A;  4O1N A;  3MXN A;  1K3R A;  5JPN C;  2B2Y A;  4OXP A;  3GO5 A;  4B3S Q;  2XSC A;  5G3L D;  4JI0 Q;  3FVQ A;  1S72 A;  1R9T B;  1SND A;  1F2L A;  1JQY D;  3D6C A;  2ICE C;  3QG1 A;  2Q2U A;  2AUJ D;  1KAB A;  2F3V A;  3FPP A;  5IP7 H;  4X62 Q;  1Y14 B;  2LXJ A;  4LW1 A;  1E24 A;  2FJ2 A;  2RSN A;  1K3B C;  3HS0 C;  4AIM A;  3KLW A;  1I5F A;  5K5P A;  3NEN A;  1IBM Q;  4FXK C;  1RTN A;  1O7L A;  1SE4 A;  2RVL A;  2NVX B;  3BDC A;  1SNM A;  4B3M L;  4RMF A;  4RHR A;  3I4O A;  2UXC Q;  5D65 A;  3ERO A;  2J7Z A;  2A68 D;  3S14 H;  3OSO A;  1F2Y A;  3LNN A;  1UNS A;  4IAL A;  3LWE A;  4X3S A;  4Z9C B;  2B39 A;  4ZYS A;  1Y1V B;  2VL6 A;  3PUY A;  5ELF A;  2EDG A;  1TWG H;  1YNX A;  1I6H H;  1V1O A;  4JI5 Q;  4P74 A;  5GAH C;  4KJN A;  1V8Q A;  4GOP B;  4ZK9 B;  2JP1 A;  4FDB A;  4R4C A;  1X3Q A;  2B2Y C;  5NUC A;  3TN2 A;  4DV5 L;  1LO5 D;  3GTQ H;  5J22 A;  3PUX A;  3I4N H;  3S1N H;  2KEC A;  3PUV A;  4Q5V A;  4A3M G;  2F0J A;  4X65 Q;  3VR3 A;  3G7L A;  3KLR A;  1C4Q A;  4HED A;  1HRJ A;  1HA5 A;  1IL2 A;  4PZ8 A;  3CC4 A;  1Q90 A;  2VUM B;  4KY7 A;  5EGT A;  1NMF A;  5C0X I;  1OTC A;  2OWO A;  4K14 A;  4DV3 Q;  2Z1C A;  1FGU A;  1TKW B;  1JE4 A;  1LT6 D;  3I4M H;  3RR5 A;  3CCV A;  3PIP A;  4JI1 Q;  4KY5 A;  1Y1W G;  1BXT A;  1B2T A;  4FVM A;  2PZT A;  1H9K A;  5T1I A;  1PTO B;  3TQY A;  3H3V H;  1KNA A;  1I50 H;  2WII B;  2B2U A;  4ZRZ A;  2OF1 A;  1J9O A;  4R8I A;  1EQQ A;  1U4M A;  3K81 C;  1VQK A;  4KKS A;  3S14 B;  1EY4 A;  3PQI A;  1A0I A;  5IP7 G;  2RBM A;  2A68 C;  2X69 A;  4I7Z C;  4DV2 L;  3GTK B;  1JT8 A;  1XX8 A;  2JA5 B;  3H15 A;  4KHV A;  2JA9 A;  1PH8 A;  4DV1 L;  1SYF A;  2JQO A;  1LV9 A;  4LWC A;  4XQN A;  1L0Y B;  1I6H B;  5ELD A;  3J7A V;  1B44 D;  3BDL A;  1S3O A;  3M7G A;  1CI3 M;  3J7Y W;  3KF6 B;  2VB3 X;  3AFQ A;  4HAE A;  1LT4 D;  4O42 A;  3GTQ B;  2H1E A;  1JC7 A;  5C4X H;  4WJ4 A;  2PW7 A;  1QNU A;  3Q8D A;  1QNK A;  1BUV T;  2NTS A;  1I94 L;  2XRS D;  4NMZ A;  5M5Y B;  4X6A H;  3RNU A;  1XPR A;  4H7B A;  4KD4 A;  2I5M X;  2D0O A;  2TMP A;  1O7Z A;  4CDC C;  4B08 A;  1UE5 A;  3A8I E;  1N33 Q;  1CM9 A;  1XJV A;  1F9R A;  2UXD L;  3UE0 A;  2NTT A;  1Q3L A;  4C3I G;  2GVB A;  5C3E G;  1XNQ Q;  1IBL L;  4LF4 L;  1B3Q A;  4TVA B;  4IQZ A;  4M8A A;  3I4M B;  3J80 i;  4QJF A;  3VR6 A;  1STN A;  1VCI A;  2JN4 A;  3NBH B;  1A3U A;  4LMQ D;  5C44 B;  1KRS A;  4IUQ A;  2D0P A;  1S5D D;  4ABN A;  3O13 A;  1I50 B;  1Q1B A;  3CCL A;  3I4N G;  1HZC A;  4R4T A;  2D5D A;  2B2U C;  1GUN A;  3TRZ A;  4UHV A;  1VQ6 A;  1S4Z A;  3Q22 A;  4BY7 G;  5IE8 A;  2F0L A;  1PRT F;  4LUO A;  5KNB A;  1VQ8 A;  1KHI A;  2HQL A;  3DHQ A;  4BA2 I;  5T1G A;  1R4Q B;  2KCT A;  1SE3 A;  1VQN A;  3A7L A;  1U4R A;  4CJ1 B;  2AWN A;  4U67 3;  1B8A A;  4TKO B;  3PUZ A;  4J6H A;  4B3T Q;  2AKW B;  3MA2 B;  1WTO A;  1PH6 A;  1HJP A;  3GTG B;  1NY4 A;  2LMC B;  3S2H B;  1K0S A;  1VQE A;  5C4X B;  4AYB G;  3U4V A;  1AFP A;  3PIO 3;  3NWS A;  2ZTC A;  3ULP A;  3MEH A;  4LJZ C;  2LS0 1;  1WVL A;  4YHH Q;  2ID0 A;  4WJ3 M;  1LTT D;  1N32 L;  1V43 A;  1W6K A;  2AUK A;  3M4O H;  2HT1 A;  1G6P A;  1CKN A;  2HCI A;  1VQ7 A;  4FYD A;  3A5U A;  1G6Z A;  2R93 H;  1B70 B;  2VQE Q;  5CYU A;  4QL5 A;  3TP7 A;  1V1Q A;  1IHZ A;  2IX3 A;  4DPG A;  4BBS G;  2QEJ C;  1SSO A;  4XYQ A;  3GQB A;  2M2L A;  3X3N A;  5IP9 H;  5C4X G;  4A3B H;  4NPS A;  1UE1 A;  2RSO A;  1VMP A;  5FJ8 H;  4A3K B;  2R7D A;  2F0K A;  4A3J B;  4TRD A;  1H9S A;  1YI2 A;  1WTP A;  1CKO A;  3RMH A;  2F1M A;  1BBW A;  3MXU A;  5I9O A;  3CXC A;  1TS2 A;  1PH9 A;  4HSP A;  4YY3 L;  4MTN A;  1K73 C;  4HIM A;  1VQI A;  4A3F H;  1ZKO A;  1ILP A;  4DNT B;  1Y8O B;  2Q2H A;  3A8K E;  2AQ2 B;  5I4D A;  3E0J A;  1F2Z A;  4JBJ A;  5JJL A;  2BDO A;  1EYD A;  1FJG L;  1S5E D;  2G9H D;  2QEX A;  3I90 A;  3G71 A;  1JJG A;  4CJ0 B;  1O78 A;  1PV4 A;  1E7Z A;  1HCZ A;  1LM0 A;  4DAY A;  3K5N A;  5BN3 A;  2CFM A;  2K5Q A;  3M4O B;  2BOS A;  5E4X A;  4APV A;  4FNF A;  1NBW A;  2EY5 A;  1J5E Q;  1SRU A;  3TEH B;  1LTB D;  2R93 B;  2L1B A;  2B2W A;  2FMM A;  3PO2 H;  4MNO A;  1L0X B;  4CKB A;  1IZ6 A;  2O4X A;  2F0N A;  1PHJ A;  1XYI A;  1XNR L;  1KDA A;  2L0C A;  1RDP D;  3C1F A;  3RZD H;  3HOY B;  3CU7 A;  2K28 A;  3S17 H;  2EY6 A;  2K50 A;  3BYT B;  4FO2 A;  4A3B B;  4JI4 L;  4OX9 Q;  4GS3 A;  1WD0 A;  1CQV A;  2HIX A;  3U58 A;  2D9U A;  1J6Q A;  3N6R A;  1I4Q A;  3QB3 A;  4HMI A;  4K6L A;  4G7O C;  2K05 A;  4N9T A;  5K36 H;  1LAB A;  4DV6 L;  4CBV A;  1TWA B;  3AQQ A;  1G2T A;  4I7A A;  3I72 A;  5JOB A;  4JK1 C;  4A3C G;  2CHB D;  2H4O A;  4EQN A;  2RDF A;  2B8G A;  4GN5 A;  4A3F B;  3ND8 A;  3V2T A;  5BR8 L;  4POG A;  3T4A C;  1BBX C;  3GTP H;  3ULJ A;  2EYL A;  4IUR A;  2X6L A;  3NEL A;  3L2P A;  1MJE A;  5EKL A;  1UEA B;  1QJO A;  3EA6 A;  2HUG A;  2I46 A;  4OO1 H;  2PZW A;  1S5C D;  2PQE A;  1QG7 A;  1U4L A;  3P20 A;  2OEO A;  2UXB Q;  2ZTD A;  2L4N A;  1TII D;  1FD7 D;  2NB0 A;  4LNQ A;  2VQF L;  5GAD C;  2F0H A;  3E9H A;  1K8A C;  3BVZ A;  2WV6 D;  2DN8 A;  4KHP Q;  2UUA L;  3OHX C;  1CHQ D;  5FO7 B;  2DNE A;  1LTS D;  2EYJ A;  4DNR B;  5HY6 A;  4A3F G;  3PO2 B;  4H02 A;  1AEX A;  2B2W C;  2JA6 H;  2VS1 A;  1VQO A;  3L7Z C;  4PMC A;  2A6H D;  2K4K A;  3J81 i;  5IYD H;  5M5W B;  4R1J A;  3S1Q H;  3RZD B;  4X3U A;  3S17 B;  3OTO Q;  1EU4 A;  4DR3 Q;  2M00 A;  2X6G A;  1Q86 C;  1SMY D;  4JI7 L;  4DV7 L;  1NR4 A;  1X3E A;  1SN8 A;  2MHV A;  1L0W A;  4DR6 Q;  3MZ5 A;  3FMC A;  1LAC A;  4P73 A;  4NDX A;  2EQS A;  1SR3 A;  4FF2 A;  4N8F A;  2JXM B;  1DM0 B;  2V1C C;  3GTP B;  1QZG A;  3G6J B;  2IY5 B;  1X3G A;  2EXD A;  1D6E C;  2NN6 I;  4KMU C;  4C3H G;  3DWQ A;  1U4P A;  2RQX A;  1SLJ A;  3CRK C;  1GUO A;  3HOU H;  3SGI A;  3DXJ C;  1VS0 A;  4IPD A;  3ULL A;  3HEJ A;  1TS5 A;  4PZ6 A;  4X3K A;  5A2Q L;  3OWF A;  2L12 A;  3A54 A;  2OT2 A;  1GD7 A;  3ERS X;  2Q8I B;  3TP5 A;  1EYA A;  4HIO A;  4H0L C;  5EAY A;  1ROD A;  1QZH A;  1GUW A;  3HOW H;  2BDN A;  2K04 A;  1N8R C;  4ODG A;  4DV1 Q;  2JA6 B;  4EGV A;  1XMO Q;  4LF5 Q;  4IFD H;  4AQY Q;  3S1Q B;  4DV4 L;  2SNM A;  4EX5 A;  4KV6 A;  2MJ8 A;  2A6H C;  1NR2 A;  1B7Y B;  3OPO A;  4XXE A;  4OO1 G;  2ZT9 C;  4RGN A;  2B63 H;  3GTM H;  1CTM A;  1PA6 A;  3SK4 A;  1BCP D;  1WYD A;  4HCS A;  1TWH H;  2EE1 A;  1SMY C;  4KK7 A;  1ET9 A;  2KHJ A;  2VXW A;  2F0D A;  3AEV A;  4PMW A;  1EOV A;  2CQO A;  2EVB A;  1SFO H;  2MP1 A;  3NXW A;  5C3X A;  3CAM A;  3HOX H;  1TWF H;  1X3P A;  4RG1 A;  4RGT A;  2KVM A;  5A2Q E;  4CJ2 C;  1BOS A;  2R3Z A;  1WOC A;  1YNN D;  4PMB A;  2UUB Q;  5COY A;  4UY8 C;  1C0A A;  2F0M A;  2K1B A;  4OWX B;  5CBE E;  1CK1 A;  1JWS D;  1VQH A;  1TXY A;  4RKL A;  4JI8 L;  1H95 A;  3CKI B;  2NN6 H;  1D5X C;  3PMF A;  1L1O B;  2I5L X;  4K0K L;  3PV0 A;  2E8G A;  4A3D H;  4ALP A;  4DR7 L;  3FKI H;  1DZ1 A;  4LFA Q;  1ILQ A;  3BVG A;  4TSS A;  1VQM A;  4DR4 L;  2MUY A;  4RKB A;  3SEB A;  4DAV A;  3EBE A;  1I6V C;  3KOJ A;  4IPH A;  4RWS C;  3PUW A;  5C6A A;  4DR5 Q;  4DXF A;  5GAE C;  1C7Y A;  3HOW B;  2Z4H A;  3OW2 A;  2KJX A;  4QIW B;  4LUV A;  4HID A;  3V05 A;  2F0W A;  1X54 A;  1WCM H;  2FHT A;  4K2L A;  1PRT D;  3EJI A;  4OGQ C;  3H6M A;  2D62 A;  4DUY L;  1TS3 A;  4JI6 L;  1JB3 A;  4CHT B;  1STY A;  4IUN A;  3U50 C;  3E3X A;  1NJI C;  3QJY A;  4JG2 A;  3SK5 A;  2Y0S E;  1RL2 A;  1S5F D;  3HOU G;  5IT9 E;  4LFB L;  1D5Z C;  4ZCK A;  3MXP A;  2Z8L A;  1BCP C;  3FEW X;  2E74 C;  5GQO A;  1XMQ Q;  1Q7Y C;  3HOX B;  2R92 G;  4P2C B;  1TWF B;  3M85 A;  1Y1V H;  4MIU A;  5HUR A;  3BDO A;  3SVM A;  3HOW G;  3PCO B;  1NUC A;  3NHH A;  3KLS A;  2QIL A;  3UDF A;  4HJA A;  1TT2 A;  3VYU A;  4IFD G;  3KLS X;  2RHQ B;  1OXV A;  1YNN C;  2NUC A;  2Z6K A;  1MJC A;  4QIW E;  1L2F A;  1F9Q A;  3VA5 A;  2ZJQ A;  3D3R A;  4KY6 A;  4A3D B;  2B63 G;  3S1M B;  2XWJ B;  3WOF A;  3FKI B;  4DKA C;  3C46 A;  2F4V L;  3G6E A;  3HOZ G;  4NKL A;  4IUT A;  3KFU A;  5EPJ A;  1ET6 A;  1FGB D;  3IAY A;  3TBI B;  4GKK L;  1NTG A;  5FLX L;  2K32 A;  1F9P A;  1IKL A;  4FF3 A;  1Q1E A;  4YWM A;  4IFD J;  2VUM H;  1HFG A;  4NXN L;  3HOX G;  1E2Z A;  1NE3 A;  5M5X H;  4HR7 B;  4CKE A;  3WOE A;  3S2D H;  2F0V A;  1VQL A;  5KND A;  2L11 A;  1EEI D;  3CC7 A;  5DM6 3;  1WCM B;  2IX1 A;  1PZI D;  1FNV A;  1EY6 A;  1PTO H;  4G7H C;  1M1K C;  2RCN A;  5IGB A;  1DCZ A;  3H0G H;  4IUU A;  1H9R A;  3SHL A;  2OCE A;  3OIQ A;  4A3D G;  3SXH A;  2EY1 A;  5HGQ A;  5KEE A;  3KYH C;  3AU7 A;  4LFC L;  2YTY A;  3U9S A;  4ME3 A;  1EL0 A;  1NMG A;  1WTQ A;  3GTK H;  1V1P B;  2ZXO A;  1FL0 A;  3LGJ A;  4JI3 L;  4DN4 M;  4X64 L;  2JA5 H;  1T5E A;  1DON A;  5FLX E;  1ASY A;  2F0I A;  2R7F A;  1PMR A;  1ZYR C;  3STB D;  3EVQ A;  2UU9 L;  1WCM G;  4A3L H;  2Z6K C;  2GVA A;  4NXM L;  5JJI A;  1RKN A;  5C3W A;  3PIO A;  4GKJ Q;  1VQC A;  1PH1 A;  1EWH A;  5C4H A;  1G91 A;  2AHO B;  4DUZ Q;  4JI4 Q;  1YVC A;  5M5Y H;  3I3C A;  3VYR A;  1EZ8 A;  3FP9 A;  4C2M H;  5LMU L;  2E5L L;  1JJ2 A;  4UPA A;  1TR5 A;  4KKT A;  3DM1 A;  5CV5 A;  5KYI A;  3HKZ E;  4DK0 A;  2A74 C;  3I56 A;  2K14 A;  5M5X B;  3CW2 C;  1Y1V G;  2A69 D;  2F0G A;  4RAU C;  3S2D B;  2WKC A;  1HH2 P;  2JSO A;  4DR1 L;  2DGY A;  4F87 A;  1CA5 A;  1FYC A;  3V96 A;  3TS0 A;  2KA7 A;  2XVS A;  5C44 H;  2CH4 A;  2OQ0 A;  4L6T B;  1C48 A;  3H0G B;  4Y7N H;  4WFN 3;  3W2D A;  1PTO F;  1EFI D;  3BJU A;  1YBY A;  1HPC A;  4ZUI A;  2R61 A;  3MXG A;  4R4Q A;  5AJ3 L;  3GTO B;  3J7Z C;  4OIK A;  3JAM L;  2BCO A;  2J0T D;  2NZO A;  1PH4 A;  1PH7 A;  2VUM G;  4OHJ A;  1EOT A;  1RIP A;  4DGZ A;  4K5X A;  1GO3 E;  2UUA Q;  4X66 L;  1CZG A;  2NVT H;  2PCF B;  1A2T A;  1E1T A;  1JOK A;  4CDE C;  3HGB A;  4IPC A;  4V19 0;  1VQJ A;  2WAC A;  2F03 A;  1SXT A;  1A3V A;  3VYT A;  1HR0 W;  3GTG H;  1EU3 A;  4HCE A;  3GV6 A;  3IFD A;  4XTC S;  2ZM6 Q;  3S2H H;  3E0E A;  1YZ6 A;  3GTL B;  4KTA A;  3STB C;  2IWH A;  1D8L A;  3T1Y L;  4GNX B;  3H0G G;  2EZV A;  1LTG D;  1Y69 U;  1AH9 A;  2VZA A;  1YHB A;  4XDX A;  4Q0F A;  4C2M B;  1WTR A;  4XT3 B;  3OW7 A;  4PZ7 A;  4ILW A;  4BBR H;  1R4P B;  5C0X H;  1BVS A;  1ENA A;  1ICF B;  3NSW A;  3Q0A A;  3MWY W;  2L15 A;  5JVH 3;  3GTJ H;  3JAM E;  1YJ9 A;  2JA5 G;  4JV5 Q;  1J8I A;  1IBK Q;  2CWA A;  3CCM A;  1PZJ D;  2A69 C;  3OIP A;  3KJP A;  2I07 B;  1PXU A;  4EVO A;  2JA8 H;  4K6D A;  3J7A F;  4A3L G;  3PO3 H;  3CME A;  4JBK A;  4LF7 Q;  3HP3 A;  5LHY 1;  4Y7N B;  2QGQ A;  3KBG A;  3F1Z A;  1PZK D;  4H13 C;  4A3K H;  1A2U A;  2B8F A;  4A3J H;  2J4X A;  5IYB H;  1HNZ L;  2QDB A;  3WWV A;  2E2I B;  4IJL A;  2IT1 A;  3MAQ A;  1GUG A;  2HD3 A;  2F0F A;  1QB5 D;  1CFM A;  2ZXP A;  4RFB A;  5I6W A;  2NVT B;  1GUT A;  5IWA L;  5ISR A;  3HOV H;  4GLX A;  1EIY B;  1JR0 D;  2KUM A;  4JPB W;  3ZJY C;  3I4M G;  1ESR A;  1N36 L;  4UP9 A;  2ZXR A;  5C44 G;  4ZAI A;  3I73 A;  1A3T A;  5JEA H;  1AP0 A;  3NK9 A;  4J1M A;  4RA8 A;  3A0J A;  1Z47 A;  1QCB D;  1D2B A;  4PV1 C;  1JOR A;  4C3J H;  1IYU A;  3MHB A;  1CA6 A;  4BBR B;  3K7A B;  1T5X D;  2L5T A;  2PQA A;  3X3M A;  3MEF A;  5C4J H;  1K83 H;  3MXN B;  3G4S A;  1HTP A;  3GTJ B;  2KHI A;  1YIT A;  3UE1 A;  1H9J A;  2WAQ B;  2XGT A;  4GN3 B;  1I4P A;  4XYO A;  2L55 A;  4B3R L;  1Z9F A;  2Q8R E;  2JA8 B;  1KDB A;  3HOY H;  3PO3 B;  5G3L F;  5CR3 A;  4JI8 Q;  4RHS A;  3QIA A;  1EEF D;  1HQM C;  2EJG C;  3VA7 A;  2CH4 W;  1FVI A;  4EQP A;  3T16 A;  3S24 A;  3D4R A;  1EY5 A;  2A19 A;  2OQK A;  1TWA H;  4B3S L;  2GA4 B;  2C35 B;  3P7J A;  3I70 A;  3DWA A;  5COR A;  5FKA C;  4BBR G;  5C0X G;  5M3F H;  4G7Z C;  5BN5 A;  3HOV B;  4A93 H;  1Y8P B;  3DM3 A;  3HKS A;  3NPP A;  2EOT A;  2WAQ G;  3I4L A;  4BY1 H;  1QUQ A;  3CQZ H;  4IUV A;  4X62 L;  3Q6S A;  1M90 C;  1PH5 A;  4JYA Q;  4JI2 Q;  3UDI A;  3PO3 G;  2RDH A;  3AFP A;  2WAQ E;  1S5B D;  2NVQ H;  5KNC A;  5C0X J;  4K8J A;  4A3K G;  5LMN Q;  3T56 B;  4NB3 A;  4MHE A;  3TDQ A;  1SYG A;  3I7F A;  4A3J G;  1IBM L;  4C3J B;  2JEA I;  5GRO A;  3T1H Q;  3QO2 A;  1MI2 A;  2JA7 B;  1GJX A;  5C4J B;  5ELO A;  1X65 A;  1K83 B;  4ME5 A;  1QE6 A;  2EYO A;  2UUC L;  2NYZ D;  2UXC L;  3A55 A;  3IL8 A;  2HHH Q;  4Y52 H;  1BNZ A;  4BWG B;  4DAP A;  2Z4I A;  4A3I H;  1FNW A;  1TU2 B;  2DJG C;  1HNX Q;  1STG A;  1B3A A;  2EJF C;  5M5W H;  2C9O A;  1BDO A;  1UUP A;  2KEE A;  1W6J A;  2F3W A;  1LTA D;  3F2U A;  3E6Z X;  1Q8I A;  3HRZ C;  4KI0 A;  1LT3 D;  1D1I A;  3C2P A;  3D31 A;  1QVF A;  4JI5 L;  3U9O A;  1ENC A;  4C3J G;  3KK7 A;  5FOB B;  5M3F B;  3KDF A;  3R2T A;  5C5L A;  2C5C A;  3OWE B;  2LY7 A;  1CSQ A;  3W1G A;  1YJW A;  4A93 B;  2R93 G;  5JEA J;  2SDF A;  3RLN A;  4X65 L;  2FMC A;  2NBF A;  2QKI C;  2K52 A;  3F8T A;  4BY1 B;  1CQF A;  3CQZ B;  3K6O A;  2OXP A;  2O5I C;  5JAV A;  2EYM A;  3HOY G;  2FFK B;  5IP9 G;  1KIX A;  4KJO A;  1QIL A;  1HHV A;  2NVQ B;  4P71 A;  4FP5 D;  4A3B G;  2MQH A;  4YWL A;  4DV3 L;  4DA2 A;  4B3M Q;  5IGF A;  5FJ8 G;  1D7Q A;  3VR2 A;  2EJM A;  5KYL A;  4JI1 L;  1UAP A;  2F3I A;  3CP0 A;  5IIF A;  4LFC Q;  1MKH A;  2LSS A;  5M3F G;  4HJ7 A;  4JI3 Q;  5FO8 B;  4A3I B;  1BBU A;  1XWE A;  5IGE A;  1KC8 C;  1TQO A;  5DEH A;  2AMC B;  4BY1 G;  5E3F A;  1YEZ A;  2YTV A;  4OWT B;  2ZJP A;  3QR8 A;  3CHB D;  5HGT A;  1GHK A;  2N55 A;  2Q2I A;  3S16 B;  5EKK A;  3BG3 A;  3D8G A;  4HJ5 A;  4JOI A;  4CDF C;  3P1H A;  4DV5 Q;  4HTH A;  1TS4 A;  4ZQ3 A;  5DNF A;  5JVG 3;  4XQQ A;  2RDG A;  5FLM H;  1RTO A;  3NP8 A;  2P5Z X;  2RF4 A;  2RA4 A;  1HZ9 A;  2KED A;  4YCW A;  5J1Z A;  4G57 A;  4OIJ A;  4R8N A;  3NTH A;  4HJ8 A;  3KUP A;  1ZXT A;  3W1B A;  2A73 B;  5TSS A;  1K28 A;  1EY0 A;  1BO0 A;  1NNX A;  4R9W A;  4XIG S;  1LT5 D;  1KAA A;  4GOP A;  3PO2 G;  4LF6 L;  5D3I B;  5FK9 C;  3J80 L;  4X3T A;  1IW7 D;  3KF8 A;  4IOC A;  4TQU S;  1EWC A;  1N33 L;  2QA4 A;  3CCS A;  2F0Q A;  1I4X A;  5CMD A;  4A3E H;  1XNQ L;  3M3Y B;  1OXU A;  3L9A X;  5JJZ A;  1B9M A;  2ASB A;  5K36 G;  3M4Q A;  5AJ3 Q;  3VR4 A;  5CV7 A;  3HG9 A;  5FLX c;  3W3A A;  3BYY B;  2K5H A;  2WB1 B;  2B3G A;  1YHQ A;  4P75 A;  4WRD A;  3E9I A;  4DV2 Q;  1PTO D;  4POF A;  4DR2 L;  1NAP A;  2SNS A;  5EJW A;  1KRT A;  3IRB A;  3RN2 A;  1TY0 A;  3MVV A;  5LMN W;  3TME A;  1Y8N B;  3J80 E;  1KAW A;  3FPU B;  4JOI C;  1STE A;  1WTV A;  1LYL A;  3T1Y Q;  3K0X A;  1SE8 A;  2K75 A;  1I94 Q;  1CKN B;  1VQ4 A;  4B3T L;  4JW0 A;  3GV3 A;  1A8V A;  4JBW A;  1OXT A;  1EY8 A;  1SJE D;  3EQL C;  2KEN A;  4K8I A;  1E0B A;  4L5S A;  4L5R C;  1K8O A;  2A8V A;  1JMC A;  2UXD Q;  4A75 A;  3KF6 A;  4GOP C;  4YHH L;  2WB1 E;  1IBL Q;  4LF4 Q;  2JA6 G;  2Y0S B;  5IYD G;  5IOD A;  5IT9 L;  1MGS A;  2BH8 A;  3TZD A;  2O5J C;  1X32 A;  1IW7 C;  2KOL A;  4CKC A;  4F7X A;  1H9S B;  3LWU A;  5ELC A;  4A3E B;  3VYS A;  4YWK A;  3S1M H;  2E76 C;  2IHF A;  2VQE L;  1YIJ A;  1GVP A;  3EFX D;  4PNY A;  3T13 A;  2AQ1 B;  4OL7 A;  1YNJ D;  4OEL B;  1UWV A;  1F9S A;  2JYO A;  2E2H H;  4DK3 C;  1QVG A;  1G8Z D;  3BU2 A;  4QGU A;  4OEM B;  3VDY A;  1DGS A;  1HFN A;  5KRU A;  3NTI A;  3NBH A;  4LUZ A;  5IWA Q;  1I4R A;  5LL6 X;  1KDC A;  2KCC A;  1NSN S;  4N8X 1;  3NUC A;  1VQ9 A;  2EYH A;  1N36 Q;  3K5L A;  3K5M A;  2Y0S G;  2E2J B;  1PYB A;  3J7A 5;  1PYS B;  2ATW A;  1DYQ A;  4ID6 A;  4DAY B;  4GN4 B;  2NZ1 D;  1AE3 A;  5M3M H;  5CC4 A;  3SDZ A;  3DEP A;  2SOB A;  4A3G B;  3MFY A;  1KLU D;  3JAM c;  3E5S A;  1N32 Q;  2XIW A;  2Z6B A;  2PW5 A;  3TS2 A;  2F0S A;  1EY7 A;  3ITP A;  2BE5 D;  1NCV A;  3J81 j;  3CCJ A;  2KQ3 A;  4B3R Q;  1IYV A;  1K8M A;  1PYW D;  1SNQ A;  5IGD A;  1J5E L;  4PG3 A;  4JBM A;  1DD2 A;  2JJQ A;  1TWC H;  2Q8T A;  5I2Y A;  2VW9 A;  5AFW A;  3KDF B;  3PSI A;  4LF8 L;  3K80 C;  2PPB C;  2FXQ A;  3H91 A;  2E2H B;  1GKH A;  2ZJR A;  4QUC A;  1II3 A;  1YNJ C;  4OX9 L;  4QY7 A;  4A4I A;  3D4W A;  5JJK A;  1EQV A;  4R4I A;  4YY3 Q;  2IJ0 A;  3A8J E;  3S1R H;  4S3S A;  5E7N A;  3DLL A;  1EQR A;  4DV0 L;  2PI2 A;  3H3V C;  1SNP A;  1AE2 A;  4OON A;  1EY9 A;  2DY8 A;  2NN6 G;  1A6X A;  1LTI D;  4DF7 A;  1A15 A;  1PRT C;  1OXS C;  5GAG C;  4L8J A;  1EIH A;  1FJG Q;  2K5V A;  5M3M B;  3PF5 A;  3HKZ B;  3FKI G;  4IO9 A;  4UAI A;  3GTO H;  1PFS A;  3ERQ A;  1SYB A;  2B2T A;  2OTL A;  2MNA A;  4L63 B;  1F2M A;  1S40 A;  2N78 A;  3RUZ A;  3NQI A;  1P16 A;  3R8B A;  1WI5 A;  2UXB L;  3K5O A;  4A3M B;  3A5Z B;  3H3V I;  2UUC Q;  1CZW A;  2K5D A;  1B53 A;  3OMC A;  1IKM A;  4YIJ A;  1KTK A;  3J81 L;  1M8A A;  2BE5 C;  3SE0 A;  2EYF A;  1XNR Q;  4KHP L;  3BVM A;  3GTL H;  1LTR D;  3NQT A;  4CGY B;  1OO9 B;  5F2D A;  4V0B A;  1MSH A;  1TWC B;  4C3I H;  5M3M G;  2DNC A;  5C3E H;  3HKZ G;  2MGS A;  5DM7 3;  1N34 L;  1CT1 D;  1Y1W B;  2AWO A;  4UDU C;  2WKD A;  4DV6 Q;  3OTO L;  2B29 A;  1JWM D;  4DR3 L;  1UE7 A;  2NVY H;  1ESF A;  2B2V A;  3OMG A;  3CMA A;  2YYZ A;  3AB9 A;  3BZC A;  3KF8 B;  4JVZ A;  1B9N A;  3I2Z A;  3S1R B;  3R3O A;  4DK6 C;  4KN7 C;  2M9V A;  1IXR A;  1BKB A;  5BR8 Q;  3DMU A;  1SRO A;  4DR6 L;  4BY7 H;  5EQ0 A;  4RH6 A;  1X56 A;  3SR1 A;  3OOC A;  5C4Z A;  3WDN A;  2R7Z H;  5CBA E;  1MSG A;  2HDL A;  4IZ8 A;  3F2B A;  4LF9 L;  3J81 E;  3QOJ A;  4RCN A;  1HUM A;  3UDX A;  3MTS A;  4J8Q A;  1ASZ A;  4L5T A;  1V9P A;  2E2I H;  1YHA A;  2ICI A;  3UDG A;  4FF4 A;  2Z9H A;  1DOK A;  2VQF Q;  2B2T C;  1DOM A;  2PYK A;  2JE6 I;  2BA0 A;  1VMC A;  4NW2 A;  1VQP A;  2O2L D;  5J39 A;  1SAP A;  1Q82 C;  1N9W A;  1O80 A;  2PNH A;  2N49 A;  1T9H A;  2XWB B;  1CUK A;  1BCP B;  1VQG A;  1AW7 A;  3TP6 A;  1SYE A;  3VR5 A;  5I2X A;  1BCP F;  4C3I B;  3C1E A;  5C3E B;  5BN4 A;  4JI7 Q;  3A7A B;  1B1Z A;  1TWG B;  1XMO L;  4DV7 Q;  4LF5 L;  1QWY A;  3TSS A;  4AQY L;  4QB4 A;  3KBX A;  3I8Z A;  4BBS H;  4LK1 C;  3K7A H;  1HNW L;  3GD7 A;  2NVY B;  3R93 A;  1JOO A;  4ULL A;  2B2V C;  3I4N B;  3S1N B;  1A62 A;  1GUS A;  1JE5 A;  1CHP D;  2CCZ A;  4KN4 C;  1DOL A;  4J15 A;  1BF4 A;  1WFQ A;  4BY7 B;  4LF6 Q;  1LUZ A;  4ZKB B;  1SE2 A;  1B4O A;  2VY3 A;  2IPK D;  1WTH A;  3M4P A;  2R7Z B;  2CW0 D;  4N9P A;  1KD1 C;  5IYC H;  2UUB L;  1ZEQ X;  2Z0S A;  3BZD B;  3K0Y A;  1KQS A;  1FNU A;  3L3O C;  1U9R A;  4L5Q A;  4AYB B;  3D0F A;  3D4D A;  3DWP A;  2GN5 A;  1HZB A;  1D1K A;  3ND9 A;  4LFA L;  4QCL A;  4K2K A;  1PRT B;  4DR2 Q;  1MHW C;  2F0T A;  4DV4 Q;  2MPM A;  1HQR D;  4DR5 L;  3ONA B;  2R7Z G;  4P72 A;  2SEB D;  2QW7 A;  1E2V A;  1SYC A;  4HSV A;  2EYP A;  1CKM A;  4I65 A;  5L37 A;  4FXG C;  1SNO A;  4C1N K;  1EYC A;  5H1S E;  1XTC D;  2JEB I;  2YTX A;  1Q12 A;  2E2D C;  4BBS B;  1XXG A;  3QOL A;  4HIK A;  2JA7 H;  1HR0 L;  2JK8 A;  5CGK A;  1STH A;  1SDF A;  1O7I A;  1WD1 A;  3S15 H;  1UE6 A;  2TSS A;  2RHS B;  4QMG A;  2E75 C;  4AYB E;  3FDT A;  5I6Y A;  1C8C A;  1STB A;  1XMQ L;  1KXL A;  1JB7 A;  4QF4 A;  1KLG D;  2BA1 A;  5J3B A;  4A3C H;  1ONL A;  4BXX H;  3R2I A;  2HQE A;  2PO4 A;  2CW0 C;  4GLA C;  3ICE A;  4K0K Q;  2LXK A;  4DR7 Q;  5DAU A;  1KNE A;  1D5M C;  4JC0 A;  2KCM A;  3PIP 3;  4DR4 Q;  1I3Q H;  4JI0 L;  4IJH A;  1XPO A;  2DY7 A;  1PFN A;  1I4G A;  1VQF A;  2IW3 A;  3EN2 A;  5IGC A;  2EIF A;  3K57 A;  3NEM A;  2ZTE A;  2XNA C;  4UP8 A;  1QVC A;  3AYH B;  1E1O A;  1SJH D;  2F0P A;  1L1O A;  3J80 c;  5ELE A; 
#chains in the Genus database with same CATH homology
 3C3L A;  1LLR D;  3HZX A;  5C5M A;  2KHS A;  1OXX K;  5IGG A;  5D14 A;  4B9X A;  4K5V A;  2K03 A;  3M7N A;  2PNR C;  1MD2 D;  5D3D A;  3AMU A;  2N88 A;  4RGM A;  3DEO A;  4U68 A;  4DU9 A;  3S15 B;  3UI2 A;  4OO1 I;  4WOR A;  2F0U A;  2L9H A;  4G4K A;  1G2S A;  3QWN A;  3RD4 A;  4H44 C;  5EPL A;  2V4D A;  1RJT A;  1SYD A;  2R6G A;  5JEA G;  3IKJ A;  3H09 A;  2K01 A;  1EIG A;  1TVX A;  1GOZ A;  2WP8 J;  1I3Q B;  4M1U B;  1Z7T A;  1VDZ A;  1JWU D;  4NP5 A;  3FRP B;  5E1F A;  2D2C C;  3BS1 A;  1I4H A;  2K6A A;  5CV8 A;  5I9P A;  2QF7 A;  5KGU A;  1DXM A;  2CQA A;  2F4I A;  3MFG A;  2F0O A;  3GP7 A;  1M4V A;  2NWG A;  1TY2 A;  4PQX A;  1SEB D;  2AQ3 B;  3DUZ A;  2VB2 X;  3MC0 B;  5A35 A;  4ZUJ A;  1SBB B;  1AZP A;  2K5W A;  3RZO B;  5ELB A;  2YU9 B;  4ZKC B;  4RCO A;  3LX0 A;  5E4W C;  1JIC A;  4KD3 A;  5EPK A;  1RCV D;  4C56 C;  1Z6H A;  1ICW A;  1V1P A;  1PFM A;  1H9M A;  3Q24 A;  5M9O A;  1VF7 A;  4IFD I;  4K5W A;  5EKI A;  5EBC A;  4C3H B;  1IL8 A;  1RD9 D;  1B50 A;  1HXY D;  4GZY C;  3RLF A;  1BQQ T;  1O7Y A;  2A6E D;  4RGO S;  4HN7 A;  3ZYY X;  1AZQ A;  4DK1 A;  4WJW A;  2IX0 A;  4KKU A;  2K7V A;  3D6W A;  4DFA A;  2G9D A;  3TZU A;  3CRL C;  1SNC A;  2LKV A;  1HA6 A;  5LL6 S;  2XN9 C;  5JPM C;  5IOC A;  1MBY A;  5CV6 A;  3NE5 B;  3I91 A;  1PLF A;  1QOH A;  1VF5 C;  2WIN B;  3SK6 A;  3M4Y A;  1WTX A;  1GHJ A;  3K59 A;  3TP8 A;  5CV9 A;  4HMJ A;  3NWT A;  4IN3 A;  1PFB A;  2CVR A;  4EQO A;  2ENB A;  4KHZ A;  2LFN A;  2PZU A;  1WTW A;  3T53 B;  2PMZ B;  1EQT A;  1JOQ A;  2QCP X;  2K33 A;  2VNU D;  5EBD A;  1RF2 D;  1F77 A;  2A5H A;  5KIX A;  1DJR D;  4BA1 I;  1ENF A;  2IL8 A;  3T51 B;  1PDQ A;  1E2W A;  2EY2 A;  2A6E C;  1FR3 A;  4BS9 A;  4B9W A;  2XRQ D;  2HCC A;  3SK8 A;  2F0E A;  1BR9 A;  1G29 1;  3NTK A;  2RKS A;  4LAA A;  4ZLT F;  3K58 A;  3HOU B;  1HTL D;  4XT1 B;  1PTO C;  5CV4 A;  4C1N I;  3NBI A;  3N52 A;  3P75 A;  2R92 B;  1STA A;  4FXD A;  2FIN B;  2EXZ A;  4FF1 A;  4XQJ A;  3H94 A;  4E6I A;  5FO9 B;  1JCK B;  4MN3 A;  1GXD C;  1RHP A;  2B63 B;  3GTM B;  2HDM A;  3HOZ B;  1TWH B;  1EZ6 A;  4F88 A;  3URY A;  1SFO B;  3A56 A;  4F8M A;  4QUF A;  3Q23 A;  2KCN A;  1AN8 A;  1ZYR D;  1ML0 D;  2EPB A;  3IFT A;  1HUN A;  4DXG A;  4IUP A;  3S9W A;  4O1N A;  3MXN A;  5JPN C;  2B2Y A;  3GO5 A;  2XSC A;  5G3L D;  3FVQ A;  1R9T B;  1SND A;  1F2L A;  1JQY D;  3D6C A;  2ICE C;  3QG1 A;  2AUJ D;  1KAB A;  2F3V A;  3FPP A;  2FJ2 A;  2RSN A;  3HS0 C;  5K5P A;  4FXK C;  1RTN A;  1O7L A;  1SE4 A;  2RVL A;  2NVX B;  3BDC A;  1SNM A;  4RHR A;  5D65 A;  3ERO A;  2J7Z A;  2A68 D;  3OSO A;  1F2Y A;  3LNN A;  1UNS A;  4IAL A;  3LWE A;  4X3S A;  4Z9C B;  2B39 A;  4ZYS A;  1Y1V B;  3PUY A;  5ELF A;  2EDG A;  1V1O A;  4KJN A;  1V8Q A;  4ZK9 B;  2JP1 A;  1X3Q A;  2B2Y C;  5NUC A;  3TN2 A;  1LO5 D;  5J22 A;  3PUX A;  2KEC A;  3PUV A;  4Q5V A;  2F0J A;  3VR3 A;  3G7L A;  3KLR A;  1C4Q A;  4HED A;  1HRJ A;  1HA5 A;  1Q90 A;  2VUM B;  4KY7 A;  5EGT A;  5C0X I;  4K14 A;  2Z1C A;  1TKW B;  1JE4 A;  1LT6 D;  4KY5 A;  1BXT A;  1B2T A;  4FVM A;  2PZT A;  1H9K A;  5T1I A;  1PTO B;  1KNA A;  2WII B;  2B2U A;  4ZRZ A;  2OF1 A;  1J9O A;  4R8I A;  1U4M A;  4KKS A;  3S14 B;  1EY4 A;  2RBM A;  2A68 C;  2X69 A;  4I7Z C;  3GTK B;  1XX8 A;  2JA5 B;  4KHV A;  1SYF A;  1LV9 A;  4XQN A;  1I6H B;  1L0Y B;  5ELD A;  3J7A V;  1B44 D;  3BDL A;  3M7G A;  1CI3 M;  3J7Y W;  2VB3 X;  4HAE A;  1LT4 D;  4O42 A;  3GTQ B;  2H1E A;  1JC7 A;  2PW7 A;  1QNU A;  1QNK A;  1BUV T;  2NTS A;  2XRS D;  4NMZ A;  5M5Y B;  4H7B A;  4KD4 A;  2TMP A;  1O7Z A;  4B08 A;  3A8I E;  1CM9 A;  1F9R A;  2NTT A;  1Q3L A;  4C3I G;  4IQZ A;  4M8A A;  3I4M B;  3VR6 A;  1STN A;  1VCI A;  1A3U A;  4LMQ D;  5C44 B;  4IUQ A;  4ABN A;  1S5D D;  3O13 A;  1I50 B;  1Q1B A;  2D5D A;  2B2U C;  1GUN A;  1S4Z A;  3Q22 A;  2F0L A;  1PRT F;  5KNB A;  3DHQ A;  4BA2 I;  5T1G A;  1R4Q B;  1SE3 A;  3A7L A;  1U4R A;  4CJ1 B;  2AWN A;  4U67 3;  4TKO B;  3PUZ A;  4J6H A;  3MA2 B;  1WTO A;  3GTG B;  2LMC B;  3S2H B;  5C4X B;  1AFP A;  3PIO 3;  3NWS A;  3MEH A;  4LJZ C;  2LS0 1;  1WVL A;  2ID0 A;  1LTT D;  1V43 A;  1W6K A;  2AUK A;  2HCI A;  4FYD A;  1G6Z A;  5CYU A;  3TP7 A;  1IHZ A;  2IX3 A;  2QEJ C;  1SSO A;  4XYQ A;  3GQB A;  2M2L A;  3X3N A;  2RSO A;  1VMP A;  4A3K B;  2F0K A;  4A3J B;  4TRD A;  1H9S A;  1WTP A;  3RMH A;  2F1M A;  3MXU A;  5I9O A;  1TS2 A;  4HSP A;  1ZKO A;  1ILP A;  4DNT B;  1Y8O B;  3A8K E;  2AQ2 B;  5I4D A;  3E0J A;  1F2Z A;  2BDO A;  1EYD A;  1S5E D;  2G9H D;  3I90 A;  4CJ0 B;  1O78 A;  1HCZ A;  4DAY A;  3K5N A;  5BN3 A;  2K5Q A;  3M4O B;  2BOS A;  5E4X A;  4FNF A;  2EY5 A;  1LTB D;  2R93 B;  2L1B A;  2B2W A;  2FMM A;  1L0X B;  4CKB A;  2O4X A;  2F0N A;  1XYI A;  1KDA A;  2L0C A;  1RDP D;  3C1F A;  3HOY B;  3CU7 A;  2K28 A;  2EY6 A;  3BYT B;  4FO2 A;  4A3B B;  1WD0 A;  1CQV A;  2D9U A;  3N6R A;  3QB3 A;  1I4Q A;  4HMI A;  4K6L A;  4G7O C;  2K05 A;  4N9T A;  5K36 H;  1LAB A;  4CBV A;  1TWA B;  1G2T A;  3I72 A;  5JOB A;  4JK1 C;  2CHB D;  2H4O A;  4EQN A;  2RDF A;  2B8G A;  4A3F B;  3ND8 A;  3V2T A;  3T4A C;  1BBX C;  2EYL A;  4IUR A;  2X6L A;  5EKL A;  1UEA B;  1QJO A;  3EA6 A;  2HUG A;  2I46 A;  4OO1 H;  2PZW A;  1S5C D;  2PQE A;  1QG7 A;  1U4L A;  3P20 A;  2OEO A;  2L4N A;  1TII D;  1FD7 D;  2NB0 A;  2F0H A;  3BVZ A;  2WV6 D;  2DN8 A;  3OHX C;  1CHQ D;  5FO7 B;  2DNE A;  1LTS D;  2EYJ A;  4DNR B;  3PO2 B;  1AEX A;  2B2W C;  3L7Z C;  4PMC A;  2A6H D;  5M5W B;  3RZD B;  4X3U A;  3S17 B;  1EU4 A;  2M00 A;  2X6G A;  1SMY D;  1NR4 A;  2MHV A;  3MZ5 A;  3FMC A;  1LAC A;  4NDX A;  4FF2 A;  2JXM B;  1DM0 B;  3GTP B;  3G6J B;  1D6E C;  2NN6 I;  4KMU C;  4C3H G;  3DWQ A;  1U4P A;  2RQX A;  3CRK C;  1GUO A;  3DXJ C;  3HEJ A;  1TS5 A;  4X3K A;  5A2Q L;  2L12 A;  3A54 A;  3OWF A;  2OT2 A;  2Q8I B;  3TP5 A;  1EYA A;  4H0L C;  1ROD A;  1GUW A;  2BDN A;  2K04 A;  4ODG A;  2JA6 B;  4EGV A;  4IFD H;  3S1Q B;  2SNM A;  4KV6 A;  2MJ8 A;  2A6H C;  1NR2 A;  3OPO A;  4XXE A;  4OO1 G;  2ZT9 C;  4RGN A;  1CTM A;  3SK4 A;  1BCP D;  4HCS A;  2EE1 A;  1SMY C;  4KK7 A;  1ET9 A;  2VXW A;  2F0D A;  4PMW A;  2EVB A;  2MP1 A;  3NXW A;  5C3X A;  1X3P A;  4RGT A;  2KVM A;  5A2Q E;  4CJ2 C;  1BOS A;  2R3Z A;  1YNN D;  4PMB A;  5COY A;  2F0M A;  2K1B A;  5CBE E;  1CK1 A;  1JWS D;  4RKL A;  3CKI B;  2NN6 H;  1D5X C;  3PMF A;  3PV0 A;  1DZ1 A;  1ILQ A;  3BVG A;  4TSS A;  2MUY A;  4RKB A;  3SEB A;  4DAV A;  1I6V C;  4RWS C;  3PUW A;  5C6A A;  4DXF A;  3HOW B;  2Z4H A;  2KJX A;  4QIW B;  3V05 A;  2F0W A;  2FHT A;  4K2L A;  1PRT D;  3EJI A;  4OGQ C;  3H6M A;  2D62 A;  1TS3 A;  1JB3 A;  4CHT B;  1STY A;  4IUN A;  3QJY A;  3SK5 A;  1S5F D;  5IT9 E;  1D5Z C;  3MXP A;  2Z8L A;  1BCP C;  3FEW X;  2E74 C;  3HOX B;  4P2C B;  1TWF B;  3M85 A;  4MIU A;  5HUR A;  3BDO A;  3SVM A;  1NUC A;  3NHH A;  3KLS A;  2QIL A;  1TT2 A;  3VYU A;  4IFD G;  3KLS X;  1OXV A;  1YNN C;  2NUC A;  1F9Q A;  3VA5 A;  3D3R A;  4KY6 A;  4A3D B;  3S1M B;  2XWJ B;  3WOF A;  3FKI B;  3C46 A;  4NKL A;  4IUT A;  5EPJ A;  1ET6 A;  1FGB D;  3IAY A;  3TBI B;  5FLX L;  2K32 A;  1F9P A;  1IKL A;  4FF3 A;  1Q1E A;  4IFD J;  1HFG A;  1E2Z A;  4HR7 B;  4CKE A;  3WOE A;  2F0V A;  5KND A;  2L11 A;  1EEI D;  5DM6 3;  1WCM B;  2IX1 A;  1PZI D;  1FNV A;  1EY6 A;  1PTO H;  4G7H C;  5IGB A;  1DCZ A;  4IUU A;  1H9R A;  3SHL A;  3OIQ A;  3SXH A;  2EY1 A;  5KEE A;  3AU7 A;  3U9S A;  1EL0 A;  1WTQ A;  1V1P B;  2ZXO A;  4DN4 M;  1T5E A;  1DON A;  5FLX E;  2F0I A;  1PMR A;  1ZYR C;  3EVQ A;  1RKN A;  5C3W A;  1EWH A;  5C4H A;  1G91 A;  3I3C A;  3VYR A;  1EZ8 A;  1TR5 A;  4KKT A;  3DM1 A;  5CV5 A;  5KYI A;  4DK0 A;  2A74 C;  5M5X B;  2A69 D;  2F0G A;  4RAU C;  3S2D B;  2WKC A;  2JSO A;  4F87 A;  1CA5 A;  1FYC A;  3V96 A;  2KA7 A;  2XVS A;  4L6T B;  1C48 A;  3H0G B;  4WFN 3;  3W2D A;  1PTO F;  1EFI D;  1HPC A;  4ZUI A;  2R61 A;  3MXG A;  3GTO B;  4OIK A;  3JAM L;  2BCO A;  2J0T D;  4OHJ A;  1EOT A;  4DGZ A;  4K5X A;  1CZG A;  2PCF B;  1A2T A;  1JOK A;  3HGB A;  4V19 0;  2WAC A;  2F03 A;  1SXT A;  1A3V A;  3VYT A;  1EU3 A;  4HCE A;  3GV6 A;  3IFD A;  4XTC S;  3GTL B;  4KTA A;  2IWH A;  2EZV A;  1LTG D;  1Y69 U;  4XDX A;  4Q0F A;  4C2M B;  1WTR A;  4XT3 B;  3OW7 A;  4ILW A;  1R4P B;  5C0X H;  1ENA A;  3NSW A;  3Q0A A;  3MWY W;  5JVH 3;  3JAM E;  1J8I A;  1PZJ D;  2A69 C;  3OIP A;  2I07 B;  1PXU A;  4EVO A;  4K6D A;  3J7A F;  3HP3 A;  5LHY 1;  4Y7N B;  3KBG A;  1PZK D;  4H13 C;  1A2U A;  2B8F A;  2J4X A;  2E2I B;  2QDB A;  2IT1 A;  3MAQ A;  1GUG A;  2F0F A;  1QB5 D;  1CFM A;  2ZXP A;  4RFB A;  5I6W A;  2NVT B;  1GUT A;  5ISR A;  1JR0 D;  2KUM A;  1ESR A;  2ZXR A;  4ZAI A;  3I73 A;  1A3T A;  5JEA H;  1AP0 A;  3NK9 A;  4J1M A;  4RA8 A;  1Z47 A;  1QCB D;  1D2B A;  4PV1 C;  1JOR A;  1IYU A;  3MHB A;  1CA6 A;  4BBR B;  3K7A B;  1T5X D;  2L5T A;  3X3M A;  3GTJ B;  1HTP A;  1H9J A;  2WAQ B;  1I4P A;  4XYO A;  2L55 A;  2Q8R E;  2JA8 B;  1KDB A;  3PO3 B;  5G3L F;  5CR3 A;  4RHS A;  3QIA A;  1EEF D;  1HQM C;  2EJG C;  3VA7 A;  4EQP A;  3T16 A;  3D4R A;  1EY5 A;  2GA4 B;  3P7J A;  5FKA C;  3I70 A;  3DWA A;  5COR A;  5C0X G;  4G7Z C;  5BN5 A;  3HOV B;  1Y8P B;  3NPP A;  2EOT A;  3I4L A;  4IUV A;  3Q6S A;  2RDH A;  1S5B D;  5KNC A;  5C0X J;  4K8J A;  3T56 B;  4MHE A;  3TDQ A;  1SYG A;  4C3J B;  2JEA I;  3QO2 A;  1MI2 A;  2JA7 B;  1GJX A;  5C4J B;  1K83 B;  4ME5 A;  1QE6 A;  2EYO A;  2NYZ D;  3A55 A;  3IL8 A;  1BNZ A;  4BWG B;  4DAP A;  2Z4I A;  1FNW A;  1TU2 B;  1STG A;  1B3A A;  2EJF C;  2C9O A;  1BDO A;  1UUP A;  2KEE A;  1W6J A;  2F3W A;  1LTA D;  3F2U A;  3E6Z X;  1Q8I A;  3HRZ C;  4KI0 A;  1LT3 D;  1D1I A;  3C2P A;  3D31 A;  3U9O A;  1ENC A;  4C3J G;  3KK7 A;  5FOB B;  5M3F B;  3R2T A;  5C5L A;  2C5C A;  3OWE B;  2LY7 A;  4A93 B;  5JEA J;  2SDF A;  2FMC A;  2NBF A;  2QKI C;  4BY1 B;  1CQF A;  3CQZ B;  3K6O A;  2OXP A;  2O5I C;  5JAV A;  2EYM A;  2FFK B;  4KJO A;  1QIL A;  1HHV A;  2NVQ B;  4FP5 D;  4DA2 A;  5IGF A;  3VR2 A;  2EJM A;  5KYL A;  1UAP A;  5IIF A;  5FO8 B;  4A3I B;  1XWE A;  5IGE A;  1TQO A;  5DEH A;  5E3F A;  1GHK A;  3CHB D;  5HGT A;  2N55 A;  3S16 B;  5EKK A;  3BG3 A;  3D8G A;  3P1H A;  5DNF A;  4ZQ3 A;  1TS4 A;  4HTH A;  5JVG 3;  4XQQ A;  2RDG A;  1RTO A;  3NP8 A;  2RA4 A;  5J1Z A;  2KED A;  4G57 A;  4OIJ A;  4R8N A;  3NTH A;  3KUP A;  1ZXT A;  2A73 B;  5TSS A;  1EY0 A;  1BO0 A;  4R9W A;  4XIG S;  1LT5 D;  1KAA A;  5D3I B;  5FK9 C;  3J80 L;  4X3T A;  1IW7 D;  3KF8 A;  4TQU S;  1EWC A;  2F0Q A;  1I4X A;  5CMD A;  3M3Y B;  1OXU A;  3L9A X;  5JJZ A;  1B9M A;  5K36 G;  3VR4 A;  5CV7 A;  3HG9 A;  3W3A A;  3BYY B;  2WB1 B;  4WRD A;  1PTO D;  1NAP A;  2SNS A;  5EJW A;  1TY0 A;  3MVV A;  3TME A;  1Y8N B;  3J80 E;  3FPU B;  1STE A;  1WTV A;  3GV3 A;  4JBW A;  1OXT A;  1EY8 A;  1SJE D;  3EQL C;  4K8I A;  1E0B A;  1K8O A;  2Y0S B;  5IOD A;  5IT9 L;  1MGS A;  3TZD A;  2O5J C;  1X32 A;  1IW7 C;  2KOL A;  4CKC A;  4F7X A;  1H9S B;  3LWU A;  5ELC A;  4A3E B;  3VYS A;  2E76 C;  4PNY A;  3EFX D;  3T13 A;  2AQ1 B;  4OL7 A;  1YNJ D;  1F9S A;  2JYO A;  1G8Z D;  1HFN A;  5KRU A;  3NTI A;  3NBH A;  1I4R A;  5LL6 X;  1KDC A;  2KCC A;  1NSN S;  3NUC A;  2EYH A;  3K5L A;  3K5M A;  2E2J B;  1DYQ A;  4ID6 A;  2NZ1 D;  5CC4 A;  3SDZ A;  3DEP A;  2SOB A;  4A3G B;  3MFY A;  1KLU D;  3E5S A;  2XIW A;  2PW5 A;  2F0S A;  1EY7 A;  3ITP A;  2BE5 D;  1NCV A;  2KQ3 A;  1IYV A;  1K8M A;  1PYW D;  1SNQ A;  5IGD A;  1DD2 A;  2Q8T A;  5I2Y A;  5AFW A;  2PPB C;  3H91 A;  2E2H B;  4QUC A;  1II3 A;  1YNJ C;  3D4W A;  1EQV A;  2IJ0 A;  3A8J E;  4S3S A;  3H3V C;  1SNP A;  1EY9 A;  2DY8 A;  2NN6 G;  1A6X A;  1LTI D;  4DF7 A;  1A15 A;  1PRT C;  1OXS C;  4L8J A;  1EIH A;  5M3M B;  3HKZ B;  4UAI A;  3ERQ A;  1SYB A;  2B2T A;  4L63 B;  1F2M A;  3RUZ A;  3NQI A;  3R8B A;  3K5O A;  4A3M B;  1CZW A;  2K5D A;  1B53 A;  3OMC A;  1IKM A;  4YIJ A;  1KTK A;  3J81 L;  1M8A A;  2BE5 C;  3SE0 A;  2EYF A;  3BVM A;  1LTR D;  3NQT A;  4CGY B;  1OO9 B;  5F2D A;  4V0B A;  1MSH A;  1TWC B;  2DNC A;  2MGS A;  5DM7 3;  1CT1 D;  1Y1W B;  2AWO A;  4UDU C;  2WKD A;  1JWM D;  3OMG A;  1ESF A;  2B2V A;  2YYZ A;  3AB9 A;  1B9N A;  3S1R B;  3R3O A;  4KN7 C;  2M9V A;  3DMU A;  5EQ0 A;  4RH6 A;  3SR1 A;  3OOC A;  5C4Z A;  3WDN A;  5CBA E;  1MSG A;  2HDL A;  4IZ8 A;  3J81 E;  3QOJ A;  4RCN A;  1HUM A;  3MTS A;  4J8Q A;  2ICI A;  4FF4 A;  1DOK A;  2B2T C;  1DOM A;  2PYK A;  2JE6 I;  2BA0 A;  1VMC A;  4NW2 A;  2O2L D;  5J39 A;  1SAP A;  1O80 A;  2XWB B;  1BCP B;  3TP6 A;  1AW7 A;  1SYE A;  3VR5 A;  5I2X A;  1BCP F;  4C3I B;  3C1E A;  5C3E B;  5BN4 A;  3A7A B;  1B1Z A;  1TWG B;  1QWY A;  3TSS A;  4QB4 A;  3KBX A;  3I8Z A;  4LK1 C;  3GD7 A;  2NVY B;  3R93 A;  1JOO A;  4ULL A;  2B2V C;  3I4N B;  3S1N B;  1GUS A;  1CHP D;  4KN4 C;  1DOL A;  1BF4 A;  4BY7 B;  4ZKB B;  1SE2 A;  1B4O A;  2IPK D;  2R7Z B;  2CW0 D;  4N9P A;  1ZEQ X;  3BZD B;  3K0Y A;  1FNU A;  3L3O C;  1U9R A;  4AYB B;  3D4D A;  3DWP A;  1D1K A;  3ND9 A;  4QCL A;  4K2K A;  1PRT B;  2F0T A;  2MPM A;  1HQR D;  3ONA B;  2SEB D;  1E2V A;  1SYC A;  4HSV A;  2EYP A;  4I65 A;  4FXG C;  1SNO A;  4C1N K;  1EYC A;  1XTC D;  2JEB I;  1Q12 A;  2E2D C;  4BBS B;  1XXG A;  3QOL A;  5CGK A;  1STH A;  1SDF A;  1WD1 A;  2TSS A;  4QMG A;  2E75 C;  3FDT A;  5I6Y A;  1C8C A;  1STB A;  4QF4 A;  1KLG D;  2BA1 A;  1ONL A;  3R2I A;  2HQE A;  2PO4 A;  2CW0 C;  5DAU A;  1KNE A;  1D5M C;  3PIP 3;  2DY7 A;  1PFN A;  1I4G A;  2IW3 A;  5IGC A;  3K57 A;  2XNA C;  2F0P A;  1SJH D;  5ELE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...