4PO1A

Mycobacterium tuberculosis reca glycerol bound room temperature structure iic-rt
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
324
structure length
308
Chain Sequence
DREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
molecule keywords Protein RecA
total genus 84
structure length 308
sequence length 324
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4po1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4po1A01
4MYTA 1R6BX 4MGKR 2XSZA 2OE2A 3CR8A 2CMKA 5HKKD 2QQ0A 4CEIB 2F43A 2FX3A 4LCBA 1IN5A 1P2SA 4IDHA 4QNRA 3B1ZA 4LK2A 2RGBA 1SVMA 1XCPA 4LSGA 3BB4A 2V7QA 4IDOA 3KX2A 3B60A 5FH9A 2WTUA 1T5IA 2IYZA 1IOZA 1VCMA 3BBPA 1ZW6A 4KU4A 1EGAA 5FTMA 3ZVLA 2RB4A 4B73A 2XITA 4I99A 1G20E 1ZUNB 4M22A 4OJQA 3CNLA 4ESVA 1GWNA 4JT4A 2ZUDA 5J40A 4NKRA 5DNYB 2D06A 4Q4HA 4URVR 4DDTA 2G88A 3B1VA 2IYRA 4DCTA 5J5CA 4A0HA 1Z2AA 3C4JA 5FL3A 4FD2A 4JJZA 1RYHA 1G6HA 2GEUA 3GLFA 3MJHA 4TLEA 1MR3F 1DAEA 3IIJA 4UJ5A 5AJZA 1MH1A 2ANCA 3KL4A 1NNEA 3VR2A 1XTSA 2ZE5A 1W4AA 4HB4A 2DB3A 3BORA 5HZHA 3NG1A 4NDZA 1GNRA 1M8PA 4P0TA 1AKEA 2OCAA 2J9RA 4G3XA 2JLRA 2IC5A 2XTMA 3T06B 3WBJA 1NLZA 3EC2A 2GXUA 1G9XA 1BYIA 5B58C 1YRAA 1D2EA 1SGWA 5FR1A 5H68A 2KJQA 4D82A 3WYAA 1RZ3A 3N2IA 5TXGA 2ZRMA 2PX0A 3BD9A 4LJ8A 4BFTA 3AVOA 3IPYA 4JLPA 2WWFA 5CB6A 2ZI6A 3ZDQA 5F2EA 3UMRA 2WSSA 1VYTA 5JS7A 2YWGA 3DMDA 3W5IA 1J90A 3U7EB 1K8RA 4KLNA 3C14C 1T5LA 1R8QA 3NXSA 4I1UA 3UKDA 1DPFA 4FW9A 4EKDA 4PZZA 1IN4A 1P60A 5DYIA 4HUQB 4HUTA 1YQTA 1TQ6A 2YC2C 1KZ7B 4B33A 2VLIA 1SVWA 1E94E 2AL7A 2E9SA 4NYIR 3SYNA 1TEVA 4DT1A 4B71A 1VG0B 5BN3A 3W6PA 1W4CA 1Z6XA 3CUEF 4QGFA 3S1AA 2BKEA 2QP9X 4V0NA 2JJ1A 1KIMA 3VTKA 3ZS8A 1M7HA 5BN5A 1WXQA 1JB1A 4KSCA 1UBGA 4FMDF 2CCKA 3CR7A 3W6OA 2F1JA 3LH5A 4GNKA 2FPMA 1KMQA 5AJWA 1AA3A 2CK3A 4NYJR 3SJAA 3ZQJA 1AQUA 4Q7JB 4LJ4A 3TGPA 1OLOA 2WJVA 3NH6A 4FXPA 3P1JA 4DDWA 5JS8A 2J41A 1SXJE 4B3GA 1J7KA 2BVNA 1W0KD 4JYBA 2KBFA 4ASUD 4MYUA 5FUWA 3AP1A 1FMLA 2MMCA 4US0R 2C5LA 1N6KA 1IN6A 2ZRAA 1I2DA 2C04A 1LS6A 2V9PA 3MAAC 2NQ2C 1G8HA 4OI2A 3W5JA 2A7QA 1RYFA 2ZJYA 3B78A 3I73A 4MITA 1OJLA 4RKFA 2ZRDA 1YZKA 1Q1ZA 3AF3A 1UKEA 5AWFC 4TMXA 3W9YA 4WZAE 1XD8A 4O25A 5JHHB 3OE7A 1E4YA 5CM9C 3I3SR 3GJ5A 3I5XA 1ZMXA 1G19A 2ZS7A 4JMPA 5FR2A 5BW8A 3W6NA 1PUIA 3ONWA 4XSGA 2PMKA 1W5SA 4LC0A 3AQ4A 4QC2A 3KDSE 1CLUA 2D4HA 1JAHA 4D2IA 3MGCA 1SVIA 4JL8A 1GL7A 2GJKA 3TIFA 5KPJA 2JLYA 3AGPA 2AD5A 3ZVRA 1VIAA 2ASEA 2A5JA 2CBZA 4A0GA 1NY6A 4PHFA 4XTRA 3W90A 121PA 2AWOA 4Z8XA 3CB4A 5LB2A 3H86A 4LYHA 3CZPA 2KB0A 3LO5A 5KNCA 3EPLA 2J5XA 4TYWA 1CP2A 4TN1A 3C7KA 3PG5A 4IOMA 2GBLC 3LRPA 3B1WA 1NVWQ 3CRMA 4PC6A 5JWRA 3CW2A 5FUVA 3GJ3A 1E3MA 1VYUA 1KK0A 2P0EA 3ZIAD 4JSTA 5C18A 2QAJA 4BUJA 2EVWX 3CH5A 3QOFA 3DPUA 1AS2A 1BO6A 3FMOB 1KNQA 1XXHE 4QOSA 1ZM3A 2F3TA 5JCZA 5GADl 2IS2A 1FX0A 3CBQA 1E4VA 4C0AC 2IYQA 4LWZA 3T61A 4A2PA 3ND9A 4K8OA 5F3WB 4RJLA 2VYFA 1E79D 1E2DA 2ZROA 4IHQA 1KK3A 3A58B 2ONKA 1ESMA 3LW7A 4BZXA 1GKYA 2ORWA 2QT1A 3IILA 3QY0A 1GRQA 5K8IA 2D7CA 1NMXA 4HB3A 1E2EA 3EWSA 5FBLB 3SEAA 2ORIA 2CNWA 5CB8A 1XTKA 1W0KA 4JSYA 4J0QA 3ZVNA 1PLJA 2IXFA 1KSGA 4PANA 4ACAA 3GFOA 5DE3A 2EWWA 3DEFA 1XEFA 3ASZA 2IYUA 4D6PA 2WZQA 2BM0A 1ZU5A 2YC4C 5HE9A 4B76A 3FPAA 4KFSA 3O8BA 1Q22A 1TL7C 1R5BA 3W3ZB 1GM5A 4KVAA 3PVSA 2WJJA 2OXRA 1EFRA 5FBRB 3SJZA 1NVUQ 4LPKA 3A1TA 3KFXA 2NOAA 1M6NA 5GJBA 1Z47A 3AVVA 2WWIA 2GESA 4US2R 5EXPA 2R6DA 2HCJB 3U3MA 3LXRA 4P4TA 1T0JB 4CT4B 2IUSA 4ZCMA 2E87A 2FU5C 4G5OA 4F7WA 1S8FA 1HA3A 4DB2A 3HP1A 3EZ2A 1VKJA 4MH0R 4QM7A 1J99A 2ZR0A 1U8AA 1OB2A 1Z0FA 4TMTA 3FMIA 1N6HA 2A78A 1RKBA 2CHQA 2FFHA 3O47A 4FINA 4Q02A 1II9A 1S0UA 4GP7A 5KDLA 4ZCIA 5KO2A 4JKYA 3AGQA 1XEXB 2WPDD 3ADKA 4UXJA 2IS4A 5JSZA 2H57A 3DHWC 1SVLA 4Q00A 1SXJB 3X1XA 3U4QA 4KLZA 5DLQC 2ANBA 2ORVA 1Q3TA 4GOXA 2IF2A 5CYOA 3RSOA 2GWHA 1T8UA 4BFSA 4WOPA 1QHHA 2F7SA 4MUAA 1R5NA 4IVPA 2CE2X 2ZS8A 1IM2A 3WP0A 4Z1MD 3LDAA 5LD2B 3LBNA 4I4LA 2UKDA 1S9HA 3T5DA 1DELA 3KKOA 1W36D 1KK2A 2OUKA 4AYTA 4EPVA 4L15A 1JQLB 5CITA 2VO1A 3HR7A 1KTVA 1U99A 5HCNA 2JLUA 2OFXA 5SZKB 2YZ2A 3OEHD 1G18A 1XD9A 1E79A 2C8VA 5FPSA 3IHLA 3O8DA 2GK7A 4XJXA 4TTRA 3AH8A 3QE0A 3VKWA 1Q21A 2F1IA 2BJWA 1VG1A 5F98A 2OV2A 2VH5R 5TV2A 4RZ2A 2W6JD 1CRQA 3V9PA 1W0JA 3LV8A 1OXXK 3BXZA 1BS1A 1DS6A 1G8YA 1IXZA 2WKRA 4AYWA 1OE0A 5B64A 1JBKA 3AVQA 2P5TB 3VX3A 4PZLA 4A9AA 1MO5A 1K5GA 1ZBDA 2QBYA 1VG9B 1XX6A 3P20A 3L2OB 4M2LA 1HURA 2YOHA 1GIAA 4QJ5A 1LFDB 4PQYA 2Q9CA 4BEBA 1YZLA 3OFNA 5KHOC 1VIYA 2GK6A 5J4HA 1KDOA 3RC8A 4GMXA 5A4JA 4KYUA 2JLQA 4YMTA 2QA5A 5CIQA 4BFWA 3ETLA 3AVWA 4NCKA 1AA9A 1R8SA 3RABA 3UATA 4ZI2A 1WRBA 3I92A 4TTPA 5G41A 2WV9A 1RPZA 4A8JB 4NYMQ 2LCFA 4D0GA 1VHLA 2DWPA 1OB5A 4H9GA 1XD2A 5AJVB 1DBSA 4F4IA 2J46A 3R20A 4PO1A 8OHMA 2V8OA 1UADA 4HDQB 1K5DA 3GEEA 1QVAA 2H92A 2IYYA 2Q9AA 2AX4A 5CDFA 3TQCA 1Q57A 2G83A 2A2ZA 2OFWA 1NVVR 4G1UC 1NN3A 3K1JA 4AC9A 4FCWA 4A15A 3L43A 1M1YE 4G01B 4O2LA 1EG7A 1OXVA 1U9IA 2ODBA 4XTCS 3IBYA 1P2VA 1E9DA 5JI2E 3QPWA 5GJCA 1RJ9A 2F9MA 2GDJA 1NKSA 3GJ0A 1IQPA 1NN1A 4XOIA 5FTJA 3MWLA 2AXPA 2CCGA 2EYUA 1ZD9A 4XD7A 1FUKA 4EJSC 2O52A 3FHOA 5M04A 3CX6A 3TR0A 5EP2A 2HT1A 2A5GA 2CHGA 2XXAB 3THXA 2RGCA 3IDQA 4KXFB 4QKQA 4JVSB 2WOJA 1MT0A 1HEIA 3FHTA 2FZ4A 2I1QA 5J47A 5EE3A 2F55A 5FOTA 3T1QA 1WBBA 1E2HA 1E1QA 4R9UC 2JEOA 4DXAA 4ABYA 1YR7A 3VR6A 1VMAA 4UNRA 2V7QD 1IHUA 1KDTA 2ZI5A 1FL9A 5KDDA 5TMPA 2GVZC 1OXTA 2EWVA 3L8ZA 5CIWA 1VPLA 4HLUA 3KKMA 4XWAA 3T35A 3N70A 4A8JC 4WIAA 3TH5A 3KQNA 3EA0A 5EZ6B 1R4AA 4N0EA 1G7SA 3ADBA 4JLVA 2EYQA 2ZR7A 1CULC 1JJVA 2ZEJA 2F6RA 4TLDA 4B35A 2V6JA 2AKYA 2RGDA 3IKJA 2BEKA 421PA 5AUQA 5E95A 4DT1B 4Q7MB 1OW3B 1KO1A 2Q9BA 5FI1B 4IVRA 1Z0KA 2VA8A 1OF1A 1G3QA 1IN8A 1GZSA 1A5TA 1IXRC 4NMMA 1UKYA 1N6NA 2J7PD 2PMDA 4LHYA 1ZCAA 4WAUA 3PUVA 2PEYA 3AV0B 3TE6A 3AF0A 2QEQA 2QGNA 3B8HA 3BS4A 1NBME 1VHTA 1EX7A 1VCNA 3M4YA 4LJYA 1AS3A 1ZRHA 1GNQA 2GBLA 2F1RA 2KWIA 3KJEA 1OFHA 5G3YA 1VCOA 4BZQA 4DCVA 1G3MA 1E2FA 3RVBA 4YXWA 4BWYA 4CRWB 4QBIA 4LBYA 4A4DA 1JPJA 4MUBA 1D9XA 3GFPA 1ELOA 1BYUA 3EC1A 4HB2A 3IUYA 4R2HA 2EFHB 2ZVQX 2WSMA 5HE8A 1WE2A 4A0FA 1GILA 1DG1G 4KHZA 1YHNA 3LQQA 2CEAA 4DLWA 4KJZA 2OILA 5GJWC 2UZIR 2BMFA 2EFCB 2HDNB 1XJCA 2BBOA 1SXJC 1WDTA 4OQMA 3IQXA 4M53A 4CEHB 1CF4A 3NBZC 5LPNA 1UAAA 4BEJA 1QZXA 2EFEB 4LPSA 2OLJA 2Z4RA 2V6IA 1HT1E 2YINC 2G3YA 2UZ3A 4LRWA 4Q47A 3R7WB 4MRVA 3Q5DA 1QF9A 1U90A 1C4OA 4B34A 3MMPA 4UXIA 5KDOA 1QRAA 1SXJA 2ZRKA 3N5CA 5BYKA 1XWIA 3U4QB 4DEYA 1JNYA 2L0XA 4RFSB 2V3CC 4ACBA 3LWNA 1OHHA 4PQFA 1J8MF 4P32A 1FOEB 3ZGXA 1TNDA 3GMTA 3M1IA 3K0SA 4L5BA 4KITB 5AR1A 4F93B 2B92A 1WA5A 2HLDA 2B8TA 1CR1A 4ILEA 4KVGA 2DBYA 2X8AA 3QF7A 1E98A 3H4MA 3H84A 1Z0JA 3KKNA 2G1KA 4IKEA 2WAXA 2PCLA 1SVSA 4HLCA 1U94A 4LHXA 1UEIA 3PCRB 3PUYA 4Q4JA 2REXB 3TMKA 1HQCA 1II8B 1KMHA 4CEJB 1P3JA 1W2HA 3RS3A 3JVUA 3K8YA 1KDPA 2ZRIA 2EW1A 2NO9A 1GG2A 4Q4LA 4OI1A 2AK3A 4DJTA 1ZM2A 1S1MA 3QKRB 3QXSA 3R9XA 4DWJA 2FFQA 2ZVPX 1XMIA 4U7DA 1EFUA 5K8UA 4ZDJA 3BB3A 3ZD7A 2HXSA 1E9FA 3CO5A 2GZAA 3ND8A 2C78A 5CJ2A 5JMTA 2C95A 1FPMA 4XWOA 1D9ZA 2BMJA 4DSOA 2HUPA 3FB4A 2J45A 5DN6D 1Z6YA 3FKSD 1KNXA 3ZJYA 2FV8A 3LXXA 3B9QA 2W0SA 5JJIA 3MG9A 1JECA 3PFIA 5KSOA 2QZ4A 4FCVA 3REFA 4IXNA 1H8EA 5FOVA 4MKHA 3KJGA 3TUIC 4MGYR 2WMNB 2GAOA 4RD4A 4KSBA 4RD3A 1OH6A 4WZBE 4B48A 2W83A 4FMCF 4QHYA 1OFUX 2ODNA 3LQRA 3X2SA 4G0NA 2NG1A 4X8OA 1HV8A 2QSZA 4IOJA 3BFKA 4GPTA 4NE2A 3ADCA 1E69A 2CK3D 4PHGA 3U3KA 4C0BA 1KI7A 2MSCB 3C41J 2TMKA 4PTLA 2C03A 2JAQA 4BPBA 3CNNA 3WHLA 1MO6A 4ZCLA 4I1SA 2IXEA 3QEOA 2VSOA 2X19A 1WBDA 5J4YA 1XEWX 1IJFA 2QP3A 1PLLA 4QJ3A 1S9DA 3RRZA 2B21A 2IT1A 1P75A 3PEYA 4GBMA 5GVSA 4E5UA 3CRW1 2WIAA 1GRRA 2R2AA 3QKTA 4Q4AA 2O5VA 1C1YA 4D81A 1QHYA 3KUCA 2I4IA 4CW7A 4C4PA 4DRZA 3QENA 3A36A 4IRUB 2R62A 3PR1A 1OH5A 4F4JA 2GJ8A 2BOVA 3GFTA 2FSFA 2VBCA 4PQRA 4AG6A 2FDCA 3WYFA 2VEDA 4HLUC 4JLMA 4PAOA 2A9KA 5HPYB 4Q7LA 1NN0A 1L4UA 2CL7X 2OZEA 2WBLC 2YVUA 3D8BA 4EDHA 2NMVA 1F60A 1AM4D 1G16A 4Z51A 5G40A 2RGNC 2VHCA 5EE9A 4C0LA 1J2JA 1ZJ6A 2XTZA 3C5CA 1SXJD 3T12A 3K70B 1H8ED 3AP3A 3M6AA 3EZFA 4M1KA 2IWHA 3P26A 3TUJC 1F5NA 3SE0A 1AQYA 3DO6A 3OZXA 3K53A 4RCYA 2OM2A 2P6UA 1E1RD 3FFAA 1P9NA 1A1VA 3AM1A 2BCGY 3BOSA 2ZQ5A 5FL7A 1GVNB 4EQ6A 5ANRB 1D2NA 3LNCA 3DKPA 4A1FA 1W47A 4AG5A 4LBWA 1GP2A 4EAQA 2AK2A 3VKGA 2PX3A 4V0MA 1E2GA 3QVUA 1LNZA 3K9HA 3PEVA 4MGZR 3EZ7A 1O87A 4DIDA 5BXQC 4A36A 4LHZA 4PC3A 4M9ZA 2QL6A 4JLOA 2VP0A 3SC3A 5FUXA 4TLAA 3ZS9A 2ZS9A 3THYB 2V55B 3CNOA 1KDRA 3E1SA 2BMDA 3Q5EA 4PAQA 2ECKA 1BIFA 5J4KA 1KZGB 3KTAB 3TJZA 4LI0A 2NIPA 4DC9A 2DHRA 2OBNA 4TLBA 1LF0A 1W46A 4UJ3A 1IONA 4CZ2A 3VFDA 1HY3A 1NSTA 1Q12A 2PLRA 3TRFA 4B2IA 4B74A 5JBQA 2GXQA 3OEED 3EPJA 1GFIA 4BE7B 1YZUA 4URZR 4C2TA 5FTNA 3QI2A 2JDIA 1WP9A 4IDQA 1QHGA 1N0WA 1W4RA 2RHDA 2WWHA 4D4KA 3NEYA 4OI4A 5EE5B 5EXSA 4XVUA 3SFZA 2C9CA 4UQOA 2GEDA 2CL6X 1AZTA 1WCV1 4ARZB 4TMZA 2WWXA 2O8DB 2YYZA 2VHJA 4G5GA 2OT3B 5EUMA 2AD1A 4AKHA 4TYPA 3B82A 4EFMA 4V02A 1IY1A 3NVAA 3VU9A 5UKDA 4C0KA 1X8JA 2IF0A 4NH0A 1P9WA 4BLTA 2GJSA 1XXHA 3HPRA 2DFLA 1NJGA 3NEJA 2GTPA 4MRPA 4GL2A 1CEEA 2BIFA 4PPNA 1EFHA 5EP1A 3D31A 5GVRA 1Z28A 1T0HB 3U3JA 2O8EA 2R6AA 5AUOB 2F3RA 2HCBA 4GOJA 5E7MA 4GFDA 4TT3A 1N6RA 2KBEA 4TL7A 3TSZA 4FMBB 3WMFA 1LVGA 1X8KA 1G7CA 1W7AA 1B0UA 1AN0A 1N25A 1NI3A 5DIFA 2O8BB 1F6BA 1KAGA 3BE4A 2XOKA 1XMSA 3LX5A 4NL4H 3TNFA 2QAGA 4RZXA 1FNMA 3ZD6A 1JEDA 4B43A 3BAFA 4A6XA 1EFTA 2XJ9A 2X77A 4HZUB 4JVMA 3U7GA 1G64A 1X3SA 3SI7A 4N1AA 2LKCA 4OBEA 4PR0A 2ZJZA 2BDTA 2F1HA 2RAPA 2W0MA 1CKEA 3HJNA 4TL9A 4C0SA 1N5JA 1YZGA 3SR0A 4DSNA 2XEXA 4L4UA 3R8CA 1ZYUA 1FW6A 4EFLA 3W3AA 2WICA 1T91A 5EZ5A 4CEHA 5EUQB 5SZJA 4MRRA 1NJFA 3MCAA 2QAGC 1Z3IX 2ZYVX 2CE7A 2CLSA 4LGMA 1KSHA 1EFRD 1T3LA 1N5LA 4NCNA 5CM8B 1LY1A 4AWXA 2QMHA 1IBRA 2REOA 1JR3E 1OPXA 2QU8A 5A5GA 4BFUA 4M1WA 4W9MC 2A5FA 3GLFB 2FGJA 5IF9A 1A82A 5EE0A 4YMUA 2G6BA 2CL0X 2JA1A 3WYGA 1N5KA 4QNMA 3TSWA 1UBCA 4Q9LA 3EPKA 4D4LA 2EU8A 1Y63A 2ATVA 4EIWA 2D3WA 2QI9C 3I61A 1FNNA 2WKPA 2ERXA 4KBFA 4Z8YA 3W8NA 5KU1A 4Q1CA 3RANA 4JBYA 3FGNA 4UNNA 2BM1A 4TL8A 4LJ9A 1NIJA 1RJ9B 3KB1A 2PBRA 2PT5A 2EFGA 5L3QA 3DVLA 3KXIA 3NC0C 5L3VA 1DG3A 1XZPA 2Q3HA 4NCIA 4EPXA 4F92B 2IWRA 2ZI7A 2OEPA 1GOTA 3EXAA 4TYNA 4WW0A 3QIAA 3BJIC 1L8QA 5TVKA 4PHHA 2D7DA 4I81A 2BJVA 1KMHB 2RHMA 3SBEA 2QUZA 3QPVA 5EJEA 3WRYC 5FOSA 4DCNA 1D2MA 3A4NA 1KI4A 1XJ0A 3CPHA 2O0HA 1L7VC 1KO8A 2RGGA 1VG8A 1G17A 2ZRCA 5JECA 4EJSA 5FTLA 1RRGA 2IYWA 3QKSB 1KJZA 5DHFA 2IBMA 4LC1A 4XVRA 4C0HA 4JYCA 3NBXX 1JR6A 3RDPA 3AF2A 1OSNA 2WAYA 3F5FA 4TYQA 1N3BA 4L9WA 4YMVA 4TQAA 4M9QA 4RKEA 4PC2A 5KOYA 3OESA 4BRUA 4R71A 4BLPA 3BK7A 4DEXA 1M34E 2JDID 3L0PA 1N0VC 2QRZA 3I8XA 5JJKA 4Q9KA 1ZINA 3RS5A 2FJUA 2ZRGA 2QTFA 4YDSA 5KTYA 1A2BA 4Q9JA 5TARA 1I2MA 5B2ZA 2H18A 2WHXA 2RGNA 2UVQA 1DAKA 4IFBA 4BQSA 1VYVA 4YMSA 4LJ5A 1XPOA 4TQ9A 4LYAA 2RGEA 1NMYA 4UKDA 1M2OB 2QGZA 2O8CA 4N0DA 4EPYA 1YRBA 4WXPA 4XH9B 3BGWA 5B30A 2W2TA 4V0OA 4C7OB 1ZM9A 1BH2A 1FUUA 3FHCB 3FDIA 4CEIA 4TMKA 2W58A 1YR9A 1Z0DA 2KE5A 4TZ0A 1OIXA 2CLDX 2Z5FA 1DARA 2NZ8A 4YONB 1T3HA 2X2EA 2GRJA 4ZV4A 5JWOA 5C4GB 5F9HA 5JRJA 4JVNA 2OCBA 3K9LA 1NMZA 2N46A 2VP2A 3E70C 1R0ZA 4ITRC 4IXMA 4RZ3A 5FPTA 1E9SA 2DCUA 3IBGA 2ZETA 3K09C 4H1VA 1DADA 4LY6A 4OQLA 5DO9A 1LF5A 3AEZA 1N0UA 1DVRA 3AVYA 3HPQA 5KUTA 2V4ZA 3U3RA 4BLQA 4C0QC 1Q1EA 2ZE6A 2R65A 2ZYUX 3BB1A 4AKEA 5EQTA 3VKHA 1MOZA 2ERYA 2R6GA 1GL9B 2G0NA 2P65A 2PZEA 2VP5A 2XZOA 5EE1A 5K8LA 1E9CA 4C9BA 3SBDA 2ATXA 3K0AA 3H2YA 3P32A 5IK2D 4X8MA 1NRJB 4K46A 2JGNA 1QG4A 1G5PA 3SFVA 3EW9A 5JEDA 2IUUA 3V4RA 1UF9A 1U0LA 2QMOA 4KCGA 3EZ9A 4HI0E 5LD2C 4W7SA 1N6LA 1ZCBA 3MJRA 1E0JA 1JEEA 4DUGA 3A1UA 3WBKA 2PL3A 3LY5A 4M1YA 3QKRA 3Q7QA 4M4SA 3FYHA 4M1SA 3CH4B 5JRZA 3PXGA 3VHXA 1RRCA 1DE0A 2C2HA 4B3FX 1HUQA 5B57C 1KOFA 2QM7A 3WXMA 2QENA 1CR2A 3DOEA 4CVNA 4BFYA 1E9BA 1P9RA 5SZIA 3U61B 4RCZA 1U8YA 3TW8B 2XAUA 3MRSA 4HATA 2NZJA 2RGXA 3CF0A 2XX3A 4JT2A 3KUDA 4M8NE 4JLBA 4ZI3A 4XVQA 2ZI4A 2ZRHA 2WWWA 4A8JA 4HZUA 1ZU4A 1Z0IA 3IHWA 2YHSA 2ZUBA 3OIVA 1Z2CA 3K70D 2QNRA 5J4LA 2WJYA 2A5DA 4BRWA 1DO0A 2W6IA 1ZNYA 2IYXA 2R9VA 5FUYA 3I5YA 3QQ5A 1XEXA 4LJ7A 4LHVA 3SJCA 2P2LA 3CRQA 4PPQA 5EP4A 5FL7D 1EX6A 3CPJB 4JZKA 1FQKA 1SKYE 3EG5A 1L4YA 4D25A 3NBFA 3IIMA 2ZYWX 4HSEA 3PEWA 1HE1C 2N1BA 3VR3A 1SKYB 1MO3A 3CPEA 3U7HB 1RC8A 1TQDA 2QROA 4LJ6A 2GZDA 3I4LA 2CXXA 1E2PA 5GJVC 4HDOB 3B6EA 4DDUA 3M0EA 3LVQE 4ERNA 4OQNA 3T1OA 4EUNA 1COWD 1HH4A 1ZAKA 2GAAA 4MQBA 1G3UA 4M1OA 2ZSDA 3QXCA 4PZYA 2ZSFA 4OHXA 4AD8A 1BMFD 2HXYA 5CJPA 1PJRA 5E7IA 3AVPA 2WJHA 3TVTA 1GTVA 4Q18A 1TQ2A 2FEOA 1KO7A 2Z6VA 4GMDA 3U7FB 1CTQA 2ZI9A 3EZ6A 3FKQA 1AJEA 1IY2A 4A6PA 1S1CA 1S2MA 2JJ1D 1DOAA 2MSEB 3R9WA 3UMSA 1Q44A 2HF9A 1QHHB 1ZD1A 1QHIA 2J1LA 3QXJA 3GJ7A 4TMVA 4DSUA 3ASYA 3DZ8A 1UFQA 5HZKA 4IFEA 4JIMA 3NHAA 4DDVA 2CVFA 4LYJA 4JKIA 4CF7A 2IUTA 2ZU0C 4FI3C 1DEKA 4WBSA 2GJ9A 2FZLA 1LTQA 3TK1A 4NCJA 1UM8A 2IHBA 4R7ZA 4HAWA 2O0KA 2OAP1 3F0TA 1NVVQ 1T3SA 1HT2E 2BWJA 2ZSAA 4O0MA 3FMFA 3PUZA 5JFGA 1FX0B 4CGZA 4C30A 3ECCA 4IJMA 1E2KA 4LBVA 1MRSA 4II7A 3KQKA 1GSIA 1PZNA 2QG6A 3QNUA 4RVCA 1KI9A 2PLFA 4OHZA 4DLSA 3L0SA 1R10A 3GD7A 1B23P 2Z43A 3P4XA 2NPIA 2HJVA 4GP6A 1R5OA 5FOXA 4BLOA 4Q66C 5E7JA 1RRFA 3RAPR 4LOAA 1T8TA 2BCJQ 2CNWD 2XSZD 2ZI3A 4QM6A 4OHVA 4TTQA 3LBHA 4PC7A 4RSGA 3HYRA 2J0UB 4DZZA 1CIPA 2Z83A 4KFTA 2FPLA 2QTHA 3BWDD 1TUEA 3BRWD 4QHTA 2OBMA 2YOFA 1ONBA 2JIZA 3Q8XB 5CK4A 1NLFA 2GCOB 2D2FA 4A92A 2V1XA 1EFCA 3NHBA 4AY2A 2REBA 5TY0A 1G8PA 1KSFX 1W49A 3EPHA 2Q3MA 3JZAA 3KB2A 1JR3D 3X1ZA 4FWTA 3U44A 1GKIA 1VDZA 2P5SA 4Q21A 2YKGA 1P2UA 1KSJA 1NG9A 1ANKA 1FTNA 1XTJA 3C5HA 2OG2A 3ZQ6A 1CR4A 4D0LB 2GKSA 2P67A 4OQXA 2CDNA 3FTQA 1KJYA 1TU4A 3IQWA 4GZMA 3L8YA 4OK6A 4NZYA 5CK5A 3RRYA 1WMSA 3A4MA 4MYCA 4Q48A 2YWEA 3R9IA 1RW4A 2ZREA 4D80A 2JLSA 4ZPXA 3KZ1E 1KO5A 5FPKA 1PUJA 1TF5A 3DKVA 1KHTA 1D8TA 3BC1A 4OYHA 4B6EA 3PENA 2G1JA 2WWYA 2B7CA 1Q0UA 4MKIA 1XTIA 2ZU6A 3A4LA 2ZR9A 3EIQA 3PEUA 4KFRA 4MRSA 5FTKA 4TYYA 2O0JA 2WMOB 1XXHB 5DGXA 2J59A 5G3ZA 2FNAA 4P3YA 1NBMD 4TSFD 5BYJA 4QBGB 4IEEA 3AVXA 2DR3A 2XZLA 4I1VA 4B3XA 1KKMA 1XJQA 5IDVA 2W6ID 1G7TA 3CX8A 4DLTA 2BBWA 2HF8A 4DLRA 1EK0A 4BASA 1I4LD 1XD2B 4OK5A 3GLFE 4U00A 3LX8A 4NBSA 4TQUS 1P4SA 3TBKA 1VTKA 5J4VA 1UKZA 2Z4SA 2ZITA 5FPHA 3PV0A 5IK2A 1H8HD 2IW3A 1YZQA 2XB2A 1AGPA 4IEIA 4CT5A 2O8BA 1CJMA 1TQ4A 4UNSA 4XIGS 2R8RA 4RFSA 2OESA 2BEJA 5L3QB 1QHXA 2C9YA 1F2TA 5EXTA 5DYGA 3VAAA 1SVOA 1TF2A 4W5HA 4E22A 2N42A 4U02A 3H1TA 1R2QA 4GRAA 4NYIQ 3KXKA 4BFVA 1V5WA 3U6BA 1E1QD 2W6JA 1P62B 1GAJA 2PJZA 2VTKA 3IGFA 2IS6A 4Q1EA 2YV5A 3CIOA 3THYA 1SHKA 1HQYE 4QXAA 4A82A 2H1LA 1OYWA 4DBLC 1ESNA 3B2EA 2KSQA 1G5RA 2D2EA 2O8DA 2YNMA 1YVDA 1A2KC 1E2MA 2ZJOA 4PO9A 3B1XA 1DO2A 3ZZUA 1M7GA 2QMEA 3T1VA 4JJKA 5AUNB 3AKEA 1E0AA 2XOKD 3OHMA 4NTZA 3LLUA 1S4QA 2WM9B 4PAMA 4URWR 3BH6A 4Q5IA 5D3QA 5F9FA 2J7PA 4G5QA 2JLVA 4GOKA 4S35A 1LV7A 3DOFA 1RFLA 3THXB 3Q9LA 1KO4A 1IJEA 3IO5A 4M0LA 4V0KA 3OE7D 3UK6A 2OLKA 2HYIC 1X1SA 1E2LA 1KK1A 1OV4A 4JLNA 3IPXA 4FMDB 5FOWA 2JCSA 3GPLA 5FBWB 2QT0A 3SJBA 1X6VA 3QXXA 3BH7A 1N6IA 5HTKA 4MDEA 3TAUA 1ZUHA 3KXLA 4NCHA 1QDEA 2QM8A 2FEMA 4OQFA 2GILA 3CWQA 3WNDA 2ZRNA 4ZO4A 3Q7PA 1NP6A 2GJAA 1RRPA 1JAIA 3SZRA 3GLHE 4PX9A 4TZ6A 3DMNA 1KY3A 3VR4A 1NL3A 1QHSA 3AVTA 1ZUIA 3GLGA 1U0JA 4L8GA 2FSIA 5LBIA 3UXMA 1ZM7A 4BLRA 4AI6A 3VQTA 2FA9A 5IRCD 1KI2A 4DCSA 1E9EA 5JEEA 4C7OA 3ICEA 3U3OA 6Q21A 3C16C 2W2VA 5AK0A 1A7JA 3B13B 3EIHA 2A3RA 3UWKA 1N6OA 1KI6B 1NIPA 3GJ8A 3SU8A 3UPUA 4GSYA 1XU4A 3RLFA 4KAXA 4DLUA 5FFMA 1XPUA 3CX7A 2JASA 4NPHA 2NPFA 2FMXA 3C8UA 3GEIA 3VHLB 2WOOA 2P6NA 3MD0A 4EPTA 5C2JB 1JR3A 4DLZA 2Q0HA 3KKPA 2GCPA 4HUQA 2J0SA 4FIDA 1KYIA 2AR7A 1OHHD 2DFTA 5C46F 1WQ1R 4ZDIA 4AYXA 1YKSA 3QPUA 3OIUA 4RD1A 4D4JA 2O8FA 5CLQA 4WVFA 1I4DD 4A2WA 1W36B 4U5XA 1TUIA 2JLXA 1TMKA 3QF4B 5FPYA 4PSKA 1IAQA 2CJWA 1UJ2A 1XRJA 3K70C 1E99A 2R44A 1F2TB 1P73A 3RNLA 4HAVA 3EWAA 4B3CA 1NBMA 3TLXA 2ZAMA 2OSBA 4EFNA 4OKSA 4HAUA 5JHGB 3SQWA 521PA 3LFUA 1EXMA 2JLWA 2ZANA 4UXHA 2IXGA 2JJ8A 1G4UR 1P5ZB 3D7MA 4P31A 2D74A 4Q9HA 4ZIRB 1II8A 1KI3A 1NVXQ 1A4RA 4Q4AB 2IYLD 3C15C 2DWOA 3RRMA 1VCIA 4BFXA 2ZRLA 3ZLJA 4O2RA 2WWGA 3HR8A 3K0EA 1TEXA 2LKDA 3G0HA 1EWRA 4URYR 3EARA 1U0HC 4KBGA 2ZM5A 4YC7A 2QY9A 4G5SA 2XTNA 2QMUA 2IX3A 2JJ2D 2IEYA 4MKFA 2QE7D 2G77B 4ARZA 4QRHA 3Q3JB 1KJWA 3ZZTA 3U5ZB 1G8GA 3AB3A 2B6HA 2W2XA 2GF0A 5BQ5A 5JCPA 2WSSD 3MFYA 3AF1A 3DM5A 4BGDA 2AFIE 5FOUA 1E0KA 4DUGD 4FCTA 4TLCA 3CZQA 1U81A 1LB1B 3AKDA 3NKVA 4KODA 4HAXA 2FG5A 4JLDA 1E96A 2FGKA 3R8FA 1OYYA 1UKVY 4C2UA 1G7RA 2H16A 3THWA 2AKAB 2J0UA 4IDNA 2IL1A 2WVJA 4Y0AA 1CR0A 1KI8A 4QG7A 4Q4JB 5JWHA 3OIWA 3K0CC 2VF8A 1DAIA 4LUCA 4NU0A 3TR5A 3V00A 3O8RA 3I8SA 1QVRA 4LDJA 2QTVB 1JQJC 3ZH9B 3GLIE 1G41A 3D3QA 1QHNA 4YQFA 1Y3AA 4ZIRA 3GQBA 3CONA 4PHTA 1UPTA 4RZUA 4JBXA 1PLKA 4TSFA 2IS1A 2VHQA 3P27A 2ZXUA 5P21A 5CLLA 1XNJA 4V03A 4OI0A 5DSZA 3REGA 4US1R 4LJAA 4QGHA 5JZVA 2FSHA 3GJ4A 3MWYW 3UMFA 3I62A 1ODFA 1E2NA 2JJ2A 3LAWA 2XNDD 4ZKEA 4KO8A 1CRPA 4W5WA 1XTRA 2QAGB 1HTWA 5KNBA 1S3SA 2J7KA 3NC1C 2RMKA 5LDDC 4O3MA 5TB5A 3CRRA 3ZVMA 1Z07A 2ONJA 4AKGA 1IXSB 1D6JA 2QPAA 5KNDA 2BHRA 3B5JA 4TMWA 2ZJBA 2AN9A 3MUFA 3E5HA 1CBUA 3K9NA 3RS4A 1BMFA 2H7VA 1KI1A 1Z5ZA 4RD2A 4GI7A 4KFUA 4NYMR 1GL6A 3IEVA 2ZPTX 3LA6A 3NIBA 1E2IA 4NONA 1X8LA 4Q19A 2YOGA 2ZSEA 221PA 4JLJA 3K09A 5CYPA 1P6XA 4HLQB 2GCNA 1BKDR 1AGRA 2H17A 1KY2A 1UDXA 4ASUA 5DI3B 3GLIA 2VQSA 3KFVA 3A1SA 2JLZA 1SHZA 5HCIA 3I72A 2CCJA 3N2EA 4RFVA 4WXRA 1JXMA 3L82B 4RD6A 3SN6A 1ZIOA 2HYDA 3TQFA 3MSXA 3AF4A 2ZSBA 4Q1AA 3GLGB 4Y0VA 4B2LA 4B44A 1GRNA 4C0JA 1NY5A 1UBEA 1T6NA 1XPRA 1DAMA 1XMVA 3ZIAA 4OK3A 2GXAA 5TDHA 3SYKA 1XF9A 3EA5A 1ZIPA 2ODEA 3CWZA 3IIKA 2VP9A 3OEEA 2RCNA 4E07A 4Q9IA 1HE8B 4FMCB 4YXWD 1KKLA 3X1WA 1RE0A 5EXXA 4AK9A 4DIEA 1X1RA 3K0AB 1HYQA 3WMGA 4Q01A 2KI5A 3EIEA 4YMWA 5DH9A 2BMEA 5ELXA 4PSVA 1SKQA 2WIBA 2Z0MA 2C77A 3QBTA 1E2JA 1T9HA 3F8TA 3MWKA 3SOPA 1FFHA 4IDPA 4KV9A 2QN6A 2ZJAA 1VECA 1MRNA 2H5EA 3KKQA 4M1TA 5AJXA 1X86B 2Q6TA 2IYVA 1W48A 1G21E 1Z63A 1E2QA 4YDHB 1FP6A 1NF3A 1H8HA 1YR6A 1Z06A 2BBSA 2GA8A 2DWQA 3RC3A 4CIDA 721PA 1EWQA 4TWZA 2YWHA 1G5TA 1SZPA 1Q3HA 3PQCA 1W4BA 1KGDA 4CDGA 4NHOA 1OKKD 4M9SA 3THOA 3U6KA 1TTTA 2O8EB 2GHIA 1R0WA 3HU2A 3QG1A 4LX0A 4P4UA 3GJ6A 2XZPA 5AJYA 1II0A 5JJLA 3HWSA 4B3BA 1W5TA 1GNPA 2G9NA 5HR5A 2J3EA 4JLAA 5DN6A 1XCMA 3VU9B 2C99A 2IA5A 3CRVA 3NWJA 3RSLA 2WKQA 4XWKA 1JXOA 3A6PC 3CKLA 4EPRA 821PA 2O8CB 4DKXA 4KYIB 1US8A 3VR5A 1S3GA 4UNQA 1OT3A 3B85A 1R7RA 3LVRE 3VNUA 4IVQA 1ZNZA 5FI0B 2IK8A 3UG6A 1OH7A 2BBTA 2P6RA 1XDBA 3L0OA 4LV5B 1JI0A 3EAQA 2CVHA 4K81B 4F91B 2RH5A 3MWJA 3W8RA 2NO0A 3FFBA 1BOFA 3LLMA 3PJRA 1NLYA 3QXHA 1SQ5A 2QPTA 3O8CA 4LHWA 1Z8FA 3SNHA 4AKIA 3K0CA 4MRNA 4B6FA 1E0SA 1XP8A 4H1UA 3RS2A 1OIWA 3A8TA 2XGJA 3U2QA 2H8KA 2Y8EA 1OH8A 2LWIA 4JS0A 5KSPA 2C98A 1OFTA 4POAA 3CF6R 3SHFA 2ZIAA 2XNDA 1G8FA 4Z1MA 2VF7A 2GCOA 1YR8A 2ODWA 1PV4A 1WF3A 3D6TB 3ADDA 4XD7D 2GVDC 1T4GA 3CM0A 3K9GA 2AHOA 2HEIA 3B1YA 3QKSA 2DFNA 2CHVA 2CLCX 2FFBA 1G3RA 2NGRA 3DM9B 5H70A 4QGAA 4B47A 1Z6TA 1Z0AA 3QVVA 4NP6A 4QHSA 3OEHA 1G3IA 4OJKA 4I1OA 1NSFA 4F38A 4URUR 5E3HA 4PFSA 1CS4C 3EASA 1SVKA 4UNPA 4DLVA 3EX7C 3BFXA 2VRWA 4JL5A 4P4SB 1L2TA 4ON9A 1E1RA 1OFIA 4QL3A 1R0YA 1XB2A 3GLHB 1M7BA 3B7GA 5KPDA 3QG5A 1W36C 1KAOA 2O8FB 1F3OA 2V1UA 1AZSC 1Z6GA 5JSZB 4B75A 4L16A 3T15A 3I1FA 1D5CA 3VNVA 3TVDA 1YJ5A 4KI0A 4DB4A 3U44B 5EP3A 3FMPB 1XEWY 3TSOA 3AKYA 2F43B 3A1VA 2DFKB 1XTQA 4DLXA 1XZQA 3FOZA 1ZM4A 4URXR 2ZRBA 3OFND 3RRNA 5DHAA 1Q20A 3E2IA 1KI6A 5AUPB 1ZD8A 2NTYC 2W00A 1AS0A 2QQEA 2QPOA 4PO8A 4R98A 3NDPA 5LB4A 3QEJA 1OXUA 2WJIA 2NO7A 3BFVA 4P4SA 3FE2A 1Z22A 3F3YA 1EESA 3ZZ0A 3RS0A 4DHEA 5DI3A 3GLIB 3J81k 3K0FA 5L3SB 1CU1A 3RHFA 1YZNA 4JL6A 4E03A 2ZJ8A 4DVGA 1AK2A 2ZTSA 1O3YA 1ZNWA 2X2FA 4M21A 4MGIR 1U2RA 3AVUA 2ZJ2A 4HLDA 1MV5A 5KYKA 4BLSA 4QFMA 2EFDB 3AUYA 2FPKA 1Z29A 4JBWA 3OF5A 2MSDB 3KJIA 3KTAA 3W34A 4PPFA 4FWIB 4Q03A 3RWMB 2VHTA 4Z54A 3BH0A 2Q3FA 4GZLA 4M9XA 4QGGA 5JI3E 1N2CE 2ZUCA 1XCGB 1YU9A 1M74A 2FWRA 2PJRA 1OKKA 4F4CA 5KSZA 3GLHA 4DLYA 3SQXA 2FE4A 3AUXA 3LBIA 1J8YF 1JALA 2IYTA 4V0ME 1YZTA 1XMJA 3SYLA 3FKSA 2OFOA 1J70A 1U9IC 2C9OA 3V4FA 1F2UB 3NTUA 2J0QA 3IEUA 1P2TA 3SHWA 2A30A 3OIYA 1U98A 4N3NA 4MDFA 3QSYA 4LBZA 2J87A 2ZRJA 2WPDA 4EQ6B 2MMGA 3CLVA 1MABA 3TAHA 5C4MA 2OBLA 3GCGA 2HV8A 4BECA 1MKYA 1Z6AA 3TW4A 3WY9A 1UEJA 3HDTA 4PPGA 1N5IA 1TU3A 4X8LA 2FOLA 2VSFA 3WNBA 2BV3A 2VP6A 3DL0A 4WZ6A 3I32A 3JVVA 5A0FA 3PUXA 4HAZA 1JPNA 2GF9A 3ZYCA 5BWMA 4Q7KA 1Q1QA 2FF7A 2OO7A 1DTSA 2IEZA 3BERA 3GJXC 4Q1DA 3GLGE 2GETA 1RIFA 3H0KA 4LV6A 4OHWA 4R2IA 2OHFA 4W5JA 4Q1FA 1E32A 1ZC3A 4MYHA 1ZP6A 5IT5A 3UANA 3WHKA 3QKUA 3GP8A 2QP4A 2R6FA 4E09A 2EQBA 1CJTC 1LS1A 1N6PA 1GITA 3JZMA 2DYKA 3U60B 5E4FA 3P4YA 3RYTC 5H8WA 3KQLA 3NDBB 4D4MA 2GXSA 2GNOA 4WA7A 2ZE8A 5BN4A 2ZYTX 2JATA 4B2PA 4RY2A 1F2UA 1TX4B 621PA 2B7BA 4IW3B 2BKUA 1US8B 2B8WA 4IOLA 2VIIA 2AWNA 1DAGA 2I3BA 2DPXA 3FWYA 4P33A 4PSAA 4PC1A 4DCUA 3OAAD 1FP7A 3G5UA 2R6CA 3TUZC 2PCJA 1FMJA 1FTSA 5SZHB 2XNSA 3R7WA 3ICQB 1TF7A 3PITA 4HEJA 1PVOA 2GEVA 3KQHA 2F9LA 2D62A 4B3DA 4HAYA 3LW8A 1I4TD 1WB9A 4BFZA 1FQJA 2X1VA 4JLKA 3Q85A 2FN4A 4BZPA 4L9SA 1CJKC 4GT1A 4OL0A 2RGAA 1C9KA 3A37A 1F48A 1ZC4A 2ZRFA 2VP4A 1Z08A 2G0TA 2NO6A 1TPZA 1W1WA 2QSYA 1IN7A 4OHYA 1SULA 4Q1BA 2AFHE 2XJ4A 1YE8A 3AP2A 3K0FB 5L3SA 2A5YB 2I1VB 4V0LA 5FBVB 1XFAA 3BIFA 3S1AB 1RVDA 5C1BA 4B32A 2ZJ5A 3WP1B 1G291 2PH1A 1G6OA 3PIRA 2FFAA 4QBFA 3RWOA 1E9RA 4QBHA 4LV8B 5G53C 3VMFA 4EPWA 3QJYA 4D26A 1E6CA 2HLDD 2OCPA 2E1RA 2HT6A 3G82C 3KJHA 4ZKDA 3RS7A 4DSTA 1GUAA 2RKOA 5FBQB 3T34A 3MLEA 1XBTA 1H65A 1Z83A 1NN5A 4MA4A 2QORA 2V54A 2ZAOA 2DY1A 1AKYA 4HB0A 3UG7A 3CF2A 2GZHA 2ZRPA 3SDZA 4ESHA 5K8TA 1W2GA 3VX4A 1TAGA 2PEZA 2NO1A 1P72A 1OIVA 4TL6A 4A2QA 3HYTA 3VR1A 2JIZD 3OAAA 1P7CA 2HJGA 2VPPA 4QJ4A 2QRNA 5L3RA 4A0RA 2AXNA 2FSGA 2SHKA 1CJVC 4FN5A 1DAHA 2XB4A 5HKKA 4S2EA 1R0XA 1TADA 1ZNXA 3B9PA 3UWOA 3HU1A 3LD9A 1S96A 4X8HA 5IHPA 3UIEA 2J0VA 4IOKA 1MABB 1UDWA 4LZZA 4M1MA 2WJGA 3X1YA 3QUSA 1GKUB 1CXZA 2QE7A 2YJTD 2PZFA 1NG1A 2IYSA 1OXSC 2OCYC 5L8VA 4ZDKA 1P61B 2P3SA 1LW7A 1NKTA 4NYJQ 4YLGA 1W0JD 4PXAA 4D0NA 3WRXC 3WNCA 3DDCA 2OAQ1 2ZE7A 4EJSB 2QBYB 1ETUA 4AIIA 1U8ZA 5D3MA 3TKLA 1MO4A 5DISB 1CJUC 3HU3A 4HDCA 4Q4HB 1DAFA 2OXCA 2VSXA 3QF4A 1UBFA 4XSHA 4ZDWA 3WMEA 2CJWB 3QBVA 2PT7A 4AURA 3T1TA 3L0IB 3THWB 1ZVQA 3IO3A 2IHYA 4MKGA 4TT3D 5D3MB 3FVQA 2PZGA 4HZIA 4C3ZA 4LYFA 2XXAA 1G1MA 2K5UA 4JVLA 3SS8A 3NH9A 1G4AE 5DI9A 5H1YA 3PUWA 4GDFA 3AKCA 2FH5B 2VHUA 5JLJA 1FZQA 3T5GA 2C96A 3NBYC 2VL7A 1W44A 5CDFE 2BC9A 1GDDA 2Q21A 1E9AA 1K6MA 4CEJA 4HYYA 1JJ7A 5KSYA 1Q1BA 1QBKC 1COWA 1V43A 2YWFA 1QG2A 3A1WA 4G5RA 3DZDA 4RD0A 3Q72A 1AIPA 3KQUA 3X1DA 1IY0A 4CYMA 3GEHA
chains in the Genus database with same CATH superfamily
1GEGA 1R6BX 4X64B 4GYJA 4IXTA 1IEWA 4PXYA 1PR6A 5DHQA 4BMNA 4DCJA 3D4IA 2AC2A 2XRYA 2F43A 1FXWA 1P2SA 3CIFA 4JXKA 4B7XA 4U7WA 3QW2A 4KXMA 3QX8A 3KKZA 1PO7A 1HKUA 4B3RB 1BNCA 3B60A 4QQFA 4CMEC 2IYZA 4UPEA 1A71A 3KVOA 4X6YA 1ZW6A 4MEBA 1UXKA 3CS3A 4ZQEA 4DVJA 3VOSA 1Q0TA 2RB4A 1JKFA 3R41A 1HO3A 3LU1A 1LK7A 1NMSA 4G4SP 4XQEA 3V4ZA 3EOBI 1KORA 4OJQA 3CNLA 2B5WA 4JC5A 4CCYA 3R4CA 2YXBA 3WLMA 1KOJA 1EEHA 2D06A 4HX9A 4J29A 3VO9A 2G88A 3C3PA 4QXQA 4URVR 4N3GA 5J5CA 4A0HA 3H13A 4BO5A 1Z2AA 4MIEA 4FD2A 3TZKA 4HEQA 5LQSA 3QYAA 4JJZA 3UJHA 1LQUA 3I6YA 1BWPA 1BU8A 4YJ2A 2P41A 3L7OA 4DNXA 2GEUA 3UJNA 3GLFA 4KHPB 3MJHA 4HNRA 5KYGA 3IIJA 1TFUA 2I55A 3H9BA 2FQ1A 1XTSA 1OBHA 1W4AA 3GDFA 3CUYA 3I2IA 4KH0A 1UT8A 3CB2A 5T3YA 3V97A 1Y5MA 2BUCA 1NHGA 2JI8A 4ZVSA 4NDZA 1GNRA 1CLEA 1FFXA 1M8PA 2JD0A 3GFFA 4UCQA 4JI1B 4NV3A 3OPVA 4WINA 3HV0A 4BU0A 2JS7A 5ETJA 3URMA 3T06B 4CNBA 3H18A 2HK9A 3AC0A 5HDBB 4M9RA 1XHEA 1BYIA 1E63A 1EUQA 1JE1A 3ZN2A 1YRAA 1D2EA 1T4CA 1TRHA 1VOTA 2VK8A 5D6NA 3S99A 1WULS 1AV7A 1MFPA 3WG9A 5EWLB 3WYAA 4Y9TA 1RZ3A 4C43A 3ZLVA 3P4UA 1KVSA 1V1JA 1ZH4A 3CT6A 2ZRMA 2CWWA 1XFDA 4MW0A 4JLPA 3S5UA 4MPTA 2GEFA 3W4JA 3UMRA 3EVGA 2WSSA 1AHNA 1D4FA 1MX1A 1NRIA 5JS7A 5A5FA 3CUKA 1CRLA 3KJQA 4J90A 3C14C 1T5LA 3O0DA 3AY7A 3EDQA 2HHLA 4I1UA 4Z5XA 1KU0A 1ST2A 2BF4A 1KBOA 2QNBA 4DSTA 5BNFA 1KEPA 4F4DA 4HUQB 1XRPA 2J6BA 3E7DA 4MLZA 3WHIA 1TQ6A 1VYHA 4J2OA 2PD3A 2DG2A 3S7ZA 1UIMA 1SVWA 2ADFA 2E9SA 3CKMA 4NYIR 3RRXA 5DX1A 1TEVA 4DA0A 4E51A 4FYVA 3JSXA 3PNLA 4JN6B 1XMQB 1Z6XA 3FCUB 3H4IA 4WY8A 3KNZA 1AXRA 1MEOA 3M4JA 2EATA 4E4TA 2JJ1A 1GUDA 1KIMA 1RBMA 2AOTA 4IJQA 4RHTA 1NVAA 4AX8A 1EJ0A 1Y1PA 4CFZA 3IUPA 4U2GA 1PS0A 5K6TA 2C8LA 2G70A 5CCBA 1DO8A 1UBGA 3BF7A 1N1DA 4DV4B 3AFHA 2BI4A 2CCKA 2R25B 4ZC1A 3TZ6A 5KC8A 5FIUA 5REQB 3ENZA 2FPMA 1KMQA 3O93A 1N8SA 3TGPA 1LJ8A 5KYYB 4D5GA 2Q5JA 2JJYA 4MI6A 1OLOA 4OPMA 5CT5A 3GDHA 4XQCA 3P2KA 3BXGA 1W0KD 4JYBA 5C1OA 2QNIA 2ZAYA 1FMLA 4HDNB 4NE9A 2ZIXB 5DMHA 2MMCA 3TO5A 4GSLA 1A88A 3U26A 4US0R 1NXPA 4D8XA 5JBNA 5KS2A 2O19A 2FPPB 4BN0A 3E22B 1CE8B 1V47A 3CCCA 3DBOB 4AICA 4QODA 4RFLA 4E5KA 3PR3A 4QDJA 1I2DA 1MD9A 1LS6A 1ZJ4A 4OI2A 2QY6A 3I73A 1S02A 2ZJYA 3B78A 5ARBA 3UKJA 4F2PA 5IUJC 4KMSA 2C57A 4MITA 2ZRDA 4RKFA 1YC2A 1YZKA 5CAEA 1HDXA 1Q1ZA 3AF3A 4NOMA 1DPGA 4JUCA 4MUFA 4OKIA 2OC9A 4WZAE 3W4KA 3I5XA 2AX3A 1ZMXA 2R7LA 3RKUA 1SA0B 4GVLA 3EXHC 4UM5A 4JMPA 5FR2A 3BE8A 3W6NA 1PUIA 2H52A 2AIRA 4U9UA 2WY2D 3QPAA 4BUZA 1ZZGA 1VIMA 3ZDEA 3GRFA 3VH4A 4C6TA 3PFNA 4D2IA 1J5EB 1NW5A 3ZY6A 1W94A 3DZHA 5ES4B 3IV9A 4MQLA 4PSDA 4EI8A 1BD4A 3TIFA 5KWJA 3RKSA 1JILA 2Z3WA 3MS2A 1VIAA 2ASEA 2CBZA 2G08A 3FPLA 1NY6A 2PR2A 3HXQA 5BOSA 121PA 4Z8XA 1A8QA 4HWTA 4BVJA 1Y81A 3TN7A 4PNEA 1D6SA 4GOMD 3RK1A 1KMMA 2OZLB 4R2JA 1NE2A 3N28A 3CZPA 4GI2A 2KB0A 1EVEA 2J5XA 2VHZA 1CP2A 1JH9A 1ZW1A 2PXHA 3KSBC 2P2CA 2R1ZA 2GBLC 4ZD6A 3N7TA 4N49A 2CYCA 1SXQA 4QPPA 3GLFE 2CBXA 3K6KA 4GM4A 2V58A 4UTPA 5JWRA 2JVJA 2P0EA 1ZJZA 1LDGA 4JSTA 4G0MA 4R2MA 5C18A 5SYNA 4IRXA 4PFJA 4GC9A 3T99A 1EM8B 3DPUA 1AS2A 1TA9A 2E6UX 1BO6A 1WBJB 4K40A 5EQJB 4A7PA 4J7CA 4NMHA 1X87A 1ZM3A 2F3TA 4NFLA 5JCZA 1FX0A 1QTQA 3CBQA 5JO0A 5FI5A 4QIHA 1ESDA 1C30B 3C2QA 4JZYA 4LWZA 2JRLA 3QE9Y 4M49A 3IUQA 1HNZB 2GPSA 1YBMA 3UJAA 1HYHA 4G9BA 2VYFA 4RJLA 4IZIA 4WDRA 4Q24A 5DP1A 1E2DA 4UZEA 3MOIA 3RSGA 3HO8A 4IHQA 3Q7TA 2AG8A 3LW7A 2DSNA 2SKDA 4BZXA 1WDLA 2HM7A 4G1BA 3SJUA 4E1AA 1W76A 1PWEA 4DWOA 4F2WA 2TMGA 4IIHA 2D7CA 2ZBDA 2CFOA 4IDFA 2O2YA 4YUYA 1NMXA 1USIA 1FS5A 4HB3A 3L46A 1S01A 2ORIA 3CV3A 4QWWA 2IS2A 4L6IA 4FYXA 5CA0F 1XTBA 2G9ZA 3GQBB 4L5JA 4ACAA 1I5EA 2HO5A 1C9MA 1C80A 1EGHA 4YCBA 5FT9A 2VJBA 3DEFA 1XEFA 2LRHA 4O5OA 5DGHA 1F06A 3H5OA 3N8KA 2GGSA 2CUNA 2M6LA 3RRJA 2O05A 3N9IA 5HE9A 1DRUA 1Z74A 4NK4A 3TD9A 1NXQA 1NQWA 3AINA 1R5BA 3OEWA 5LUBA 3W3ZB 4CETA 1GM5A 5C35A 1XZMA 3T5AA 2WJJA 5DM70 3NAQA 2AG1A 3AETB 5FBRB 2N0SA 4QECA 4EO4A 4LYYA 2JEYA 1NVUQ 2ZDGA 3DE6X 3GELA 4OL9A 4RTKA 2XDQB 1YI0A 3KFXA 1G5IA 5GJBA 3VO2A 1DX4A 4US2R 1P45A 4F56A 1F2DA 2CKDA 3PE3A 4CT4B 4P4TA 2XT0A 4ZCMA 5K3DA 2E87A 2FU5C 4DJDC 1GT91 1HA3A 3IKMB 4DB2A 3GA7A 3HP1A 4Y0NA 1KXJA 1ZZEA 4MH0R 6REQB 2AF4C 5EJFA 1KP2A 2JJMA 2ZR0A 2HU5A 3I6MA 3PC3A 5KBYA 1OB2A 4D9CA 1XAIA 1N6HA 5BN1A 2G5CA 1BKYA 1PNVA 3CKYA 2FFHA 2CHQA 4H59A 3O47A 4JIGA 2ZB7A 5LJIA 4GP7A 4RQTA 3C6BA 4B85A 1SXHA 5CVUA 5HMMA 5KDLA 1X94A 3ZCTA 4ZCIA 3EVCA 3AGQA 5IJ0A 3AT1A 1XLWA 2WUWE 5D3ZA 2CJYA 2BZ0A 4G4SO 2BUBA 5GV7A 3CCBA 4UXJA 1Q7BA 2IS4A 2Y1FA 1HE5A 2F17A 1K75A 4KDRA 5FNVF 4N41A 2I2FA 4KL8S 5TF4A 5CXSA 1NYQA 2ANBA 3NIWA 3RD5A 2IEIA 2QTLA 5AKZA 5T5QA 3RFUA 1SUFA 4MMZB 4HRYA 4WOPA 1QHHA 2F7SA 3MMZA 1C3OB 2CE2X 2ZS8A 3ETJA 3WP0A 2RI0A 3V4PB 4HRVA 3PGJA 4KXUA 1B14A 5LL6P 2ONZA 1DELA 2AFHA 3A2KA 1K7YA 1KK2A 4EECA 4QOIA 3VTAA 1TOAA 3HHEA 1KTVA 4QWMA 3HKBB 4C7BA 2BM8A 4UE3S 5JROA 2JD2A 1CJSA 2C8VA 3M5PA 3IHLA 3O8DA 5CA1A 3M1YA 3JR3A 4UUNA 5F98A 4D7AA 4KKXB 2QOEA 1RCUA 5HGJA 4HAOA 1BJRE 4P3XA 5TV2A 2V3WA 3F5QA 3U09A 1MIOB 1HSOA 2DFVA 3TLAA 1OXXK 3E58A 4AJHA 1I1OA 4FDMA 5JR3A 2FWIA 3FGZA 4MZXA 4IJWA 2CWDA 1B26A 1Z5GA 2WKRA 3FLEA 4HWKA 3DYIA 1JBKA 4UEJA 4QEKA 1QDUA 4A9AA 1MO5A 2AUTA 3G9TA 2GI4A 2YYYA 5L9AA 4ND4A 2GX6A 4IV5A 1KAHA 3OP4A 3IOBA 3ZI0A 3ZG6A 2NXNA 3BL6A 4KXNA 4LOJA 4XIYA 4Z0HO 3ZV7A 2CXSA 3P9RA 1PSZA 3RF7A 2JAUA 4ER3A 5ECYA 4PQYA 1KAMA 1PDWA 2GYUA 2P4HX 3A3YA 2JANA 1BJKA 4O4HB 1DUVG 3QH4A 4JBNA 3E81A 1U3FA 5F5LA 1FK8A 3QE2A 1T9KA 5D1HA 5HG0A 2VPWA 5IT4A 1WTCA 1U8EA 5KYYA 4D97A 1CF2O 4W5OA 4YPVA 2WKSA 4HNAA 3D1VA 1RJDA 2C54A 2A9QA 3EVFA 4TTPA 2AFHB 2K7ZA 1RPZA 3K4HA 4NYMQ 3W2HA 1VHLA 2IUEA 1ULHA 3WLRA 2XODA 3DAFA 4JEMA 2UYQA 2ZBVA 5AJVB 4C4ZA 5K0JA 3S2EA 3R7DA 5DXFA 2FTKE 1JHZA 1XCLA 1WXHA 3SDSA 4CNQA 2Z95A 4D98A 4R83A 2W8BA 1B2LA 4KGVA 2Q9AA 2AX4A 3EGVA 1OU0A 5CDFA 3P9YA 2R7KA 1A7AA 4BBPA 2F3PA 4EF6A 3D2CA 1HLDA 2XUQA 3HU5A 3KD2A 4AC9A 5GOZA 3STYA 4MEAA 3L43A 3K30A 2JFBA 3HEAA 4YRCA 4BWVA 1D07A 2I99A 3AM3A 4O2LA 3LVBA 1FA9A 3QBJA 1G38A 5AK6A 4ND3A 1CY6A 3SC2B 5JI2E 2VJMB 3P9XA 1I4OA 2F9MA 2XF2A 1NKSA 1IQPA 1JHDA 3H1AA 5K3FA 1HMPA 4DR1B 1LJLA 2CCGA 4YRFA 1OVGA 3RVJA 1FUKA 1MP0A 4LRXA 4DM7A 5LC1A 1UM9B 3CX6A 1RFGE 1O57A 2BY4A 1V7CA 3JXEA 1N32B 8MHTA 4G84A 3THXA 1YI1A 2RGCA 1IZYA 1ZL2A 3RUDA 4LNUA 2WOJA 3T3IA 3VDQA 3S81A 3RKRA 5JDCC 3RARA 2I1QA 4TKLA 4DLLA 2F55A 2HD4A 2YJ5A 1XU9A 5FOTA 4TKVB 1G63A 1AKVA 1E1QA 3WRWA 4HDNA 5GONA 2C7RA 4ABYA 3F9IA 5DCLA 4UNRA 1QYRA 4YGYA 1IHUA 3A0RB 4YRLA 1KDTA 3WE7A 3OETA 3KO8A 1M1NA 1B93A 3C3DA 1JPUA 1CQZA 3E5MA 3L8ZA 3OPMA 4YJHB 1MC1A 1VPLA 2ATIA 3NYWA 3DE5X 3UCFA 1KXZA 1V4VA 2VNHA 3T35A 2K6GA 5FORA 2ISSD 1SO8A 3GF4A 3ZJVA 3A2LA 4MW9A 1V3VA 4WIAA 4YFYA 3WJ7A 4MV7A 1K98A 1L5ZA 1P17A 1X7HA 3DFMA 3BMCB 3O7WA 3WWYA 3QFHA 1E6EA 1IN1A 1YCDA 2QXTA 3ZE2B 3PE4A 1O0CA 4P8RA 5A03A 2AKYA 4MLPA 1QCZA 4PGMA 3BQ9A 2RGDA 3CLRC 421PA 4EBBA 1Q1GA 5AUQA 2VT3A 1B8PA 3ZUPA 4YIHA 2WVAA 1OW3B 4ETMA 1KO1A 3K71B 3KE8A 2FSVC 2Q9BA 5FI1B 4IVRA 1RLMA 3AYZB 1PK9A 5BSTA 2VA8A 3VC1A 4PZEA 4JUDX 3PQ8A 3E22A 3G13A 4L5YA 3D6AA 1N6NA 1SWWA 2J7PD 1WMAA 2CHEA 1AQ6A 2XA9A 4MCAA 1ZCAA 2ZKLA 5DLYA 2W6NA 3KYJB 2PEYA 5D8DA 5B4VA 1RXVA 5FWYA 2F67A 1FDUA 3LWBA 1TYZA 4LJYA 2X7JA 3IOEA 5BNIA 3CU5A 1K6IA 4E6PA 1T9CA 1TCVA 5JY1A 3WOHA 4NJOA 4TXMA 1HYGA 1NQVA 2C31A 2XYRA 3HB7A 5BSWA 2KWIA 1GGJA 1U0TA 1O95A 2ZB8A 1J5XA 3BIWA 3R0QA 4FYHA 5G3YA 5F76A 4DCVA 2PKQP 1D7AA 2CXRA 3MMNA 3UY4A 2HA3A 4XCXA 3H9JA 1JU4A 2UZ1B 4FEGA 2V03A 1JPJA 4WBNA 4TN5A 1Y9JA 3BDVA 4FGJA 3HJFA 1PW5A 2JIRA 1UBLS 4P3KA 2EFHB 1RBZA 2ZVQX 4QNNA 3BMCA 2WSMA 1DGQA 4ZU1X 1B7GO 3AEKB 2EJUA 4AVYA 2RH4A 3CISA 4LF9B 3KFLA 1ULSA 5DX8A 1FS6A 4FQ8A 3JYLA 4KHZA 3PIIA 1XZFA 1JQDA 3ZBTA 2CEAA 3MTEA 5C37A 4OQPA 2OILA 3H05A 5IVDA 1XELA 4GZ3A 4DNQA 5LOVF 2UZIR 1JE0A 2ZQZA 3JTMA 4YDQA 3O7MA 3IQHX 3LZCA 1WDTA 1G20B 3L8MA 3UK2A 2B1GA 4CF6A 1CF4A 1DKUA 2BFMA 2RH9B 3AI7A 4JBHA 4BEJA 1QZXA 4BNUA 3W5DA 1YCGA 1UAAA 3LXUX 2GBGA 1AA6A 3V1TC 1VRCA 2YINC 4MVJA 5ESWA 1L7PA 4Q47A 5IM4A 2BH2A 2P6PA 2VYVA 3Q5DA 4YY3B 1QF9A 3ZLUA 1LBTA 3G0IA 2YDXA 3O84A 5L4LA 3CW9A 1K4MA 3LC7O 3W6UA 1QRAA 2WHEA 2ZRKA 3N5CA 2AG6A 2EFYA 3T4XA 3VYSB 1RHKA 2ATCA 2HL6A 2C88A 2VT2A 1W5AA 4IHKA 1GR1A 2IE8A 2O14A 5I5GA 3LWNA 1T15A 3AFNA 1KHHA 4P32A 1J8MF 5IC5A 2VBIA 4GPIB 2W48A 4DWWA 3SOZA 2IODA 5TE9A 5AR1A 2FQWA 2YZ7A 5EWMA 2B92A 3IB3A 2UVPA 2RI6A 3IQFA 4JITA 4TV8F 1OGJA 1EDBA 1GSOA 4ILEA 4FSHA 4CTKA 3DCYA 2WA1A 5JSYA 1C7FA 3AJ8A 1UT5A 1TMGE 3H4MA 4WKBA 5FRDA 4C5CA 1KPHA 5BWNA 5A0TA 2Q2VA 4IKEA 2PCLA 1SVSA 4LECA 4LHXA 3ZI7A 1PYDA 1ULAA 2P9TA 2XH8A 3HXLA 2VYND 1L5MA 1IL0A 3HKEA 4G36A 4Q3DA 1XQ1A 4ZPJA 1ZOSA 3ENKA 4H2DA 4PCVA 4Y2JA 1EFAA 1BMTA 3MFQA 4AY5A 4ZJZA 3FDZB 3NXKA 1I24A 1II8B 1DDIA 1KMHA 3MBKA 2O3JA 3QYPA 1R6TA 1P3JA 3AR2A 1K63A 4HGOA 4BKRA 1NQUA 5KAPA 1A9XA 1KDPA 2EW1A 4YJGA 2NO9A 3DT9A 2GN0A 3I04M 1Z37A 1E5DA 3QXSA 4XR4A 5DYWA 3VSEA 4YJ2B 1XR3A 2C7QA 1NI5A 4U7DA 2QU7A 4B79A 1ML4A 3LGSA 2ZT5A 5BR4A 4FHZA 4PBRA 3CO5A 5CJ2A 1DLIA 1Z2OX 2C78A 2QTBA 3LBYA 2QN1A 2C95A 2CY0A 3NHFA 4HGQA 4O2BA 4BVGA 2VPXA 3FG9A 2X8BA 2J45A 5K3EA 1X80B 5CAEB 3ZJYA 2FV8A 4OBXA 3B9QA 2W0SA 2G40A 2V98A 3T3EA 2AZDA 1G4HA 1PWYE 2A0XA 2WYOA 4HFNA 4IXNA 1PGOA 2OKCA 1AKUA 4HY3A 1XDSA 1WR8A 2QJWA 2WMNB 3HB9A 3OF2A 3JWIA 4CQMD 4F97A 3JQPA 1Z33A 2I1WA 2ODQA 5CT6A 5BRAA 5AVXA 5JPCA 2FSPA 1ZKMA 2XMCA 4IOJA 3D6UA 2H7YA 2A94A 3OWXA 4GPTA 4MA0A 4JQSA 4NE2A 1E69A 3C0KA 3U3KA 1L6IA 2PUWA 1JDVA 2ORED 4AQYB 1DZ3A 1X19A 2D8MA 2DPGA 5B1EA 1JB9A 2JAQA 4XDGA 4DNFA 3CNNA 1RNLA 4BPBA 2CLEB 3OQBA 3QEOA 1P9OA 2FSSA 2P9YA 4RMNA 5FNZA 4GR5A 3WJAA 3WZMA 1WBDA 1YR3A 1ZK2A 1IJFA 4F60A 3LHSA 4YQYA 4WERA 5MN6A 2B21A 3DGFC 2DEUA 1FB5A 2IT1A 1P75A 3E9NA 2BKVA 3P9KA 2HJHA 4WXHA 5FKJA 1TZMA 3JVIA 5TMDA 4EUFA 1GRRA 3B6JA 3P9SA 4RQUA 4RVNA 4WASA 3SP1A 2XCUA 3MS4A 3OIGA 3TOZA 3T54A 3WIEA 1QHYA 4D81A 3KUCA 4LYDA 1FXWF 4C2BA 5GP1A 2HMYB 3ETDA 4G23A 3KSMA 4U9HS 3ANYB 5TPZD 2VDMB 2IPXA 1NYRA 1D0VA 5B6IA 4S04A 1OH5A 3OSZA 2GJ8A 2YW9A 1OZ0A 1Q0LA 3K9WA 4Y2GA 1KPGA 4GPBA 2FSFA 3CWCA 1IXYA 3KHSA 4PQRA 1MCZA 3LHKA 3NOOA 1N7GA 3Q9UA 4IZOA 2FDCA 4YAIA 3QPBA 4PAOA 3VNQA 3D3WB 3QKWA 3BRWA 3H04A 5KVQA 3S1LA 5CHYA 4YR9A 1XYYA 1J8DA 4JBIA 3UMCA 4FDVA 4RMGA 3VUFA 2VBFA 1G16A 1AM4D 1T9BA 1X1EA 2PWPA 1NPDA 3BMQA 3HY6A 3LQYA 3OPNA 1ADFA 1TM7E 4AMUA 3ZR4B 1TUBA 3ROZA 1J8VA 3C5CA 1SXJD 3IBCA 3IOMA 3AP3A 3M6AA 3K70B 2G63A 3ZGNA 3EZFA 1ESCA 1IB0A 4M1KA 4NQZA 1D4OA 4HTAA 3QFRA 1F5NA 3C74A 1AQYA 2PS9A 2OGSA 3DO6A 3GNLA 4RCYA 2OM2A 3DULA 4KMRA 4R68A 3ZU6A 1A1VA 1E8MA 3BZWA 4N39A 1T9GS 2C3OA 3DTVD 4PEVA 4A91A 3BXHA 3E8MA 1W5BA 1JKJB 2JK1A 3EDOA 3RVSA 5ANRB 4A1FA 4AG5A 1W47A 4HX2A 3FTFA 1X74A 3UJ6A 4IDCA 4QXRA 4ZYLA 1U3VA 3O9ZA 4V0MA 5EEHA 5H02A 3U4MA 2Z8YM 1DQSA 3PEVA 4MGZR 1EQ2A 1HQKA 1WXXA 3VZSA 5BXQC 4A36A 2AVNA 2QL6A 1HBJA 4MW1A 4TLAA 3PK0A 5CW1A 3ZS9A 2ZS9A 1N2BA 3THYB 1MQAA 4RXTA 1QH0A 3K2BA 3B6ZA 3RC7A 1WTAA 2B94A 3TQRA 5I7EA 1JR4A 3K31A 4PAQA 3HP7A 2ECKA 3EUFA 3F3SA 4OO3A 3AJAA 4OFBA 2XA2A 4RA9B 1FRZA 3TKAA 5J4KA 4LI0A 2HPAA 3TFQA 2EC5A 3L9XA 3L8GA 1W46A 3BULA 1LKZA 1NSTA 2Q99A 3E7PA 2PLRA 1NYLA 3G3EA 3T9BA 4B2IA 2GXQA 3ESRA 4CTNA 2R2GA 3OBBA 4K05A 3QWAA 1GFIA 4BMSA 3KLOA 5CVVA 1IB6A 3PQ4A 4YRIA 1NDHA 3FY4A 1B8OA 3COSA 3N5KA 1QORA 4AU1A 1WP9A 4IDQA 2GTIA 3V32A 5LQNA 2WWHA 2FPGB 4NESA 4BO1A 3NEYA 2C9ZA 1OLUB 2J3JA 5EE5B 5EXSA 1T34A 3NT4A 4EYQA 3A27A 4UQOA 1U28C 2GEDA 2CL6X 3WAKA 1F4VA 4ARZB 2FW6A 2O8DB 2P9CA 1M2EA 3UJ8A 5EUMA 2AD1A 2BJHA 3DBLB 4TYPA 3DZJA 4OGWA 3S4YA 5JCJD 1O6GA 1X8JA 2IF0A 2O57A 2Y67A 4XGIA 1P9WA 3WLQA 5EGSA 2A9JA 2GJSA 5J58A 3CZMA 4XWGA 1ZI9A 3C6KA 3NEJA 4E2ZA 4ZALA 1BCRB 2IP1A 1EFHA 3BWCA 4MIOA 3WLHA 5EP1A 2Y2VA 3D31A 1C1DB 3SDBA 4QPNA 1T0HB 2YTZA 4X5OA 4XD2A 1WZ2A 1SCDA 2F8TA 2SICE 2II6A 5M3BA 4NOKA 3TCXB 1R0BA 4GM1A 4EHAA 1U2PA 3C98A 4OOFA 2X22A 4FMBB 1P2BA 2GJ4A 2JFYA 4H3KB 4HEA1 4DDMA 1S8AA 1Y6RA 2P75A 1B0UA 1R4NA 2O8BB 1NI3A 3IJ5A 2I3GA 4KQ1A 4LA4A 2OZVA 3TNFA 4NL4H 3G7SA 4YT8A 3LLSA 2WD7A 3VSCA 1YS7A 1RT9A 4B43A 2FJPA 1WPQA 2ALJA 5LSAA 2BISA 1EFPB 2X77A 3RYFA 4TXHA 1G64A 4BQIA 2WB2A 2PR7A 1X3SA 3ZCPA 2LKCA 4OBEA 4PR0A 2F1HA 2RAPA 3HJNA 4RPGA 1CKEA 4ZRMA 5BYAA 1YQDA 3VISA 1TGVA 2UDPA 2G80A 2NQTA 1ORHA 4A03A 3IC5A 5KQRA 3T94A 1XQ6A 2CXHA 4RHUA 3U7JA 1T91A 4P5DA 3GVPA 4YMGA 1F20A 1HLGA 3JATA 5SZJA 2P7HA 4MRRA 1ONNA 2X4LA 3MCAA 4ZEWA 3G2NA 4RETA 2QAGC 4M87A 2ZYVX 3CZCA 2QSUA 3HXOA 3C3EA 2Q0QA 1FS4A 3EBPA 4OHPA 1EP1B 4MVCA 1EFRD 3R0XA 4BVBA 1SOVA 4RJJA 1VE6A 2QMHA 2REOA 3IR5A 5DM4A 1X7WA 4CM6A 2OHGA 3PWSA 1OPXA 2OTCA 3ANXA 4FDTA 4XGRA 5A5GA 2DQYA 4M1WA 3ZD8A 4WBNB 3GLFB 1U2SA 4ZMBA 2GLTA 1PT6A 5EE0A 3ROPA 2O8VA 4YMUA 4M8SA 2CL0X 3WYGA 2GBCA 3FUWA 3P45A 3UV6A 4OQ4A 3M3PA 4NZMA 2QL9A 1RYZA 3M9WA 4UBOA 4LDQA 4F6RB 1CUSA 4E31A 1EXDA 4Q9LA 5IDWA 2D3WA 2C2OA 1B6TA 1NBWB 2WKPA 2JFFA 3BF8A 1NQOA 4MV6A 5C8YA 1UMCA 3W8NA 5KU1A 1JIKA 3BEOA 3GRZA 5AM2A 3RANA 4JBYA 3CGGA 4A10A 4TXLA 1Q11A 3HN6A 2A1TR 1NIJA 3HNRA 1HXHA 2WNHA 1K88A 4JB0A 2PT5A 4J43A 3DPSA 3DVLA 3VDMA 2JGEA 1FNDA 1DG3A 1XZPA 5JANA 4LRQA 4NCIA 4FOLA 4XYMA 1PG2A 4I50F 5F12A 1IH8A 4NS1A 4EPXA 3LFHA 4ADSG 4ZN6A 1SWVA 1GOTA 5FBKA 1ONOA 2OXFA 3QIAA 5B6PA 2XNJA 1ADJA 2D7DA 1PEYA 3NBAA 5IJZA 1D04A 2YFHA 3L7NA 1I5OA 1KMHB 2BJVA 5HF5A 5BMVB 3V3KA 4WK2B 1B8NA 1L4GA 3QPVA 1TB4A 2A1TS 5FOSA 3RT7A 1QF7A 1C50A 4NDAA 5BW6B 5CCEA 1A76A 1G5HA 2RGGA 1G17A 1Q2XA 3GVIA 2VWQA 2LVBA 2IU3A 2G5GX 1RRGA 4HYTA 3TZHA 1KJZA 3EPRA 4QULA 2YY7A 3M81A 1XK6A 2IBMA 1JLMA 3K6RA 2PUEA 2AZXA 5B53A 3RDPA 4QE3A 2E5LB 4DBLE 2YUIA 2YWBA 1B0ZA 1K8ZB 3IMEA 4QBKA 4DIBA 1JSRA 1N3BA 3RUAA 3GJZA 3EK2A 4TQAA 1Y3IA 5DASA 4IIXA 4M9QA 4Y6OA 16PKA 1V3TA 1L4LA 5KOYA 1JFFA 1DCFA 2W2LA 3B20A 3HJCA 2ZT8A 2C94A 3LMKA 3BK7A 1F3LA 4IF6A 4R71A 1L3CA 2JDID 3L0PA 1JJBA 2QTNA 4X92A 1N0VC 4IH4A 1RQRA 5D00A 1CUWA 5JZ9A 2JGRA 2J0EA 2QRZA 4CG0A 4XYLA 3NNDA 1PGPA 2VTEA 1L4NA 2XNHA 3CTMA 3VOTA 4EHDA 4S2UA 3T7EA 2OGZA 1WPRA 2R97A 4PZAA 2DVMA 4IH1A 4ENVA 1ULZA 2QX8A 2O20A 5KQPA 3HSYA 5B2ZA 2FP4B 2F2TA 4KIFA 4N3CA 1XPOA 4YMSA 3EGOA 4ISCA 4LJ5A 4R7GA 4R0VA 3QTLA 1XAHA 2Z2IA 2JFOA 2AC4A 4JEUA 3WDKA 3H2BA 3GCZA 1L7EA 2YIVX 4EPYA 4WXPA 3NHKA 2YJZA 4S3MA 4XH9B 3D6NB 2W2TA 1ID1A 2BI7A 4RPLA 3ACDA 3PB3A 4IUYA 4Y2PA 5LQUA 1BH2A 1ZIXA 4JI8B 1CUCA 3FUVA 2OPBA 4HEHA 2W58A 3L77A 2FMTA 3LPNA 3IQZA 4IPTA 3UGKA 2UYOA 1QXSA 1TO1E 3UOGA 4YONB 4F6CA 1SIWA 1T3HA 4EL0A 1G59A 5I9MA 2LW7A 2ZIZA 5KYVA 1QRDA 4FGZA 5C4GB 5F9HA 2BFEB 3N2NA 5AXBA 2XZTA 2OCBA 4C4RA 4V39A 1M8JA 2P11A 3E70C 2I91A 3N76A 2O0MA 1NBOA 3IBGA 2Y6VA 2OOSA 3K09C 4JGIA 1N33B 2VG8A 3KETA 4KYTA 4KJXA 1LF5A 4NV1A 5LWHA 1KOGA 1Y4ZA 2H63A 2OPHA 4S1WA 4DQVA 4YUXA 1VLZA 1UBNA 3DR5A 2CLIB 1EE9A 1Q1EA 3GUCA 2ZE6A 2R65A 3L4BA 3U48A 5JSFA 1MOZA 1TJ5A 2ERYA 2R6GA 5EIWA 4YRSA 2CDBA 1T9ZA 3GZJA 3O2QB 2VP5A 3Q1KA 3U31A 1KIAA 1IOVA 1SCQA 2VOJA 1GUFA 2H5JA 2QD1A 1JG6A 5AW5A 4YT2A 1IUKA 1FLDA 1FRFS 2X0IA 5CLHA 4MB6A 1P7PA 4PVDA 1OYVA 2HUNA 5IK2D 3AB7A 3QMVA 1NRJB 3RTEA 4C4SA 1YJXA 3G2PA 1G5PA 4UTRA 1YGYA 1BHSA 3SFVA 5JEDA 3BWYA 2IIPA 4BE9A 1WCYA 1YS4A 1HOTA 1M34A 3EZ9A 4HI0E 4EW1A 3FM9A 4OMCA 1ZCBA 1E0JA 4WOCA 4E5DA 2V45A 2H4YA 4EJFA 3U4HA 2DMRA 2PL3A 1OAAA 3NGMA 3QKRA 3Q7QA 3F8SA 2Y9PB 3LOPA 1MENA 1WHTA 4M4SA 5JRZA 2DHDA 1Z4LA 2P9EA 4H4DA 3PXGA 4BNFA 1N3LA 1NJ5A 3C6YA 3Q0IA 4B3FX 1XCBA 2WT8A 2QM7A 1BVRA 3D2LA 3DOEA 1BTOA 2GAJA 2H00A 4BFYA 2WR8A 3JZFA 5SZIA 5A7FA 1U8YA 1JRLA 4FT4A 4GOND 2EL9A 3GH3A 3TW8B 2XAUA 5AOVA 3G0OA 4IRMA 2W5UA 4ZQGA 5C1DA 3K6SA 1P4GA 2JGJA 4U2FA 4XVQA 3DDHA 5A9RA 3DEYX 4HL6A 3SSAA 1NV8A 1IATA 2R47A 1ZU4A 3I5MA 1Z0IA 1PL8A 2N47A 4D1YA 2V7TA 4UBKA 3S7TA 3K70D 2LP4Y 1NUQA 3SIPA 4B17A 4X1YB 5AW9A 1M8FA 3B6IA 5L7YA 1KP9A 4ZJUA 2X2OA 3ETHA 1WUKS 3IA2A 4NPAA 4UU7A 3CPJB 3L8HA 3DOJA 3DXXA 4IIVA 3OX1A 3JZDA 4QQNA 1SKYE 2PRJA 2IITA 3LT1A 2HMSA 2DTEA 3K1ZA 5EPUA 4EW3A 1SOMA 3GPDG 3K8ZA 3JQ7A 2Z9BA 4J0EA 5L4NA 1SKYB 3HFJA 3CPEA 3S55A 1RC8A 2D8AA 1QP0A 4MOWA 2YQ4A 2QROA 3GRVA 4LJ6A 3MWEA 4FLEA 3DTTA 4ZAYA 3ZDYB 5B2FA 4HDOB 5KTRA 2ZWIA 4XVHA 5JBIA 1ZJWA 2GZRA 4ERNA 3ZY4A 2BI8A 1UEXC 4RF3A 1ZAKA 3TBHA 3W5AA 4BVLA 3PLAE 3LYAA 1A9QA 3D6JA 4M1OA 1UDRA 2ZSDA 2NM0A 1NUPA 3DO5A 4OHXA 2Q6VA 3A11A 3LUAA 2AEMA 3UHOA 1N77A 1FVFA 3AVPA 3CJQA 3OIDA 4I1PA 3LDHA 2FRDC 4ZYVA 3BD8A 4FLFA 2HRDA 3HADA 2NN3C 2RCYA 4UUAA 4L51A 4D8WA 4EA9A 1UINA 4X7RA 4WCFA 5F2OA 1MB2A 4N5NA 1L1FA 2MSEB 4IEFB 1JEOA 1PZFA 4MAAA 3GRCA 4UFOA 3HKDA 3UMSA 3RFFA 2J1LA 4J75A 3K2QA 3BM5A 4E5VA 3GJ7A 4TMVA 4B2YA 1QRRA 5CEFA 3NUQA 1X42A 4EY3A 4ND1A 2P9HA 1UFQA 1LD3A 5AO9A 5HZKA 5HMLA 2HFKA 4N6GA 1IDOA 1AKMA 4IFEA 3WR5A 2CVFA 2HREA 2IPNA 2XUZA 3LOQA 3PNPA 4JKIA 4Q3KA 4C0WA 2QMZA 3P8ZA 1UM8A 1R8JA 3LGXA 3OQIA 3VJMA 4AJLA 1JEJA 1MIOA 2O0KA 4NU6A 4LKOA 4D8UA 1MXHA 1HT2E 5BQ3A 3RIXA 4ZJYA 3FMFA 3LT5A 3FFWA 3T1HB 3PCTA 2PUTA 1U1EA 2FP4A 1U8FO 1E2KA 4LBVA 2CBGA 3DOUA 1O4WA 1PJ4A 3QITA 2PRSA 4JI7B 2BR4A 3UV3A 4C7MA 2PXAA 2JRBA 4RVCA 2JH3A 1Z13A 4JK3A 4OHBA 1J23A 2VZ9A 3HFGA 3N0WA 4B8WA 3MBOA 2FHPA 2V6FA 4G5FA 4ZWNA 3GD7A 1JDBC 1I3OA 3M34A 3CLTC 4YRNA 1B23P 1YR1A 4GP6A 2W2KB 3GLQA 2FZGA 4N0MA 3C24A 4TS3A 3QUTA 2H2IA 2DLDA 4I9GA 2JJQA 1V9CA 1Q0HA 2ZI3A 2V65A 1XG5A 2XVXA 3R7SA 5BNWA 2PZAA 1T0IA 2YXEA 1YVPA 3LP6A 1Z25A 3TLZA 4ESOA 1CIPA 1IHXA 4KFTA 4OXIA 3VBEA 3HXKA 1BEUB 2XGSA 3FYSA 3HBJA 1S8NA 2DECA 3GYGA 3HJBA 3S28A 2QVYX 2G67A 4QHTA 5KYTA 1Z18A 2OBMA 4R3UC 4BNIA 3C1UA 2JIZA 2ZJ0A 4CMEA 1C7RA 2JHGA 2O3QA 3ND5A 5ENDA 1QKIA 3U4QA 4QYTA 4A92A 4G0WA 2V1XA 1EFCA 3NHBA 4J03A 5TY0A 2ZUUA 5CXQA 1DXQA 3NYRA 3LUGA 3EPHA 2Q3MA 2Q5LA 4O1HA 4RYDA 1G42A 3DV0A 5CXXA 3JZAA 3TE7A 3KB2A 1JR3D 1NRWA 1PG5A 4L5IA 3X1ZA 5JISA 1ZRNA 4WMLA 1P2UA 3GVCA 3SLGA 3C5VA 4GIBA 3AKZA