4PO8A

Mycobacterium tuberculosis reca glycerol bound low temperature structure iic-cr
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
326
structure length
306
Chain Sequence
b'PDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTGGKALKFYASVRMDVRRVETLKDGTVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
molecule tags Hydrolase
source organism Mycobacterium tuberculosis
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
total genus 96
structure length 306
sequence length 326
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4po8A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4po8A01
2W58A 1CR1A 3OFNA 2BEKA 2X8AA 1UBCA 3T5DA 3Q8XB 3DEFA 3Q9LA 4KODA 3DM5A 1T8UA 2GXUA 2IHBA 4ZIRB 3DPUA 1HE8B 4NDZA 4DLSA 5F3WB 1DELA 3KTAA 2YOGA 1FFHA 2ZRFA 1ZD1A 4NCKA 4TZ0A 4A6PA 5ELXA 3IILA 2X2EA 3K0AA 3CH5A 4C0AC 1XPOA 2QSZA 4KBGA 4KITB 1JJ7A 2OBMA 2QG6A 2ZUCA 5FOTA 2AR7A 5KDOA 1NY5A 4WW0A 3GLFE 3FKSA 4NONA 5A4JA 4QHYA 3SYLA 5CYOA 4XD7A 1XB2A 4D82A 4HZUB 4RD0A 3IDQA 4PAQA 4L16A 4OYHA 3GQBA 1WXQA 4U02A 3RRNA 5DI3B 3CNLA 4Q4HB 1W0KA 1Q1QA 4UJ3A 3VU9A 4DLTA 4C4PA 1A2BA 1A4RA 2IWHA 2FEOA 2QAGC 4HAZA 1E1RD 1QZXA 4DJTA 4YMUA 2VO1A 2J87A 4OQXA 5EQTA 4JYBA 1EG7A 3UWOA 4MRRA 3PEWA 2ZM5A 2UKDA 1E2FA 3AF1A 4F93B 1KJYA 4Q01A 4XWAA 3ADCA 4BPBA 4QFMA 4D26A 1Z0KA 1XZPA 1R0WA 3NEYA 1KK3A 2UZ3A 3CX6A 3QUSA 4RJLA 1ZUNB 3EXAA 1Q3TA 4M1SA 1YRBA 5JEDA 1IONA 3AP3A 3KKPA 4ARZA 4GP7A 2BCGY 1ZUIA 2JLSA 1S3GA 3OE7D 4MYHA 4PO8A 1DG1G 4NYJR 3R8FA 1R5NA 3GMTA 5SZJA 1GNPA 5FFMA 3HPRA 5DLQC 1R4AA 4QOSA 1Z6TA 4UNSA 2EFGA 2GCPA 2EYQA 4A2WA 3SJZA 2GTPA 2V9PA 1HQCA 2BBOA 2YVUA 2C9YA 2KSQA 2VEDA 4L9WA 5HZKA 5JRZA 1VYUA 4TL9A 4R2IA 2J41A 1QDEA 1J70A 4KJZA 3OAAA 1WE2A 3EIHA 2HT6A 3AVQA 4ASUA 2N42A 1CR4A 3EA0A 4WXRA 2IYTA 4ACBA 3TRFA 5E4FA 1ZU4A 5LB2A 2KWIA 2VQSA 4C0QC 2D2EA 2NO6A 4FD2A 1XU4A 4POAA 4V02A 3WRYC 2D2FA 4A2QA 3HR8A 2PEYA 4X8MA 4CEIA 2YZ2A 4LBYA 4KVAA 1NIPA 2QENA 2DHRA 421PA 4FCTA 4KLZA 1NRJB 1VHTA 2IL1A 4DSNA 3VR2A 4RZUA 3QENA 4F4JA 4KAXA 4Q21A 1TF2A 1L4UA 2QMEA 5CITA 5L3SA 1NLZA 4KCGA 4ABYA 4NE2A 4ZI3A 2OXRA 1HQYE 2RGDA 1J7KA 5DHFA 4BEJA 1RC8A 2WBLC 4MKGA 2QE7D 2LKCA 1KTVA 2W2TA 3RYTC 1E2MA 3RHFA 1CBUA 4HAWA 2FU5C 2ONKA 3K8YA 5ANRB 1N5KA 2D62A 2QPOA 2FFBA 4AKEA 1KI3A 5B30A 3EASA 3NIBA 4KU4A 2WTUA 2IYVA 2BKUA 3DVLA 3AF3A 4URUR 3G82C 2OE2A 3LRPA 1RKBA 4P4TA 3AUXA 3VU9B 2D7CA 3BD9A 4FIDA 4HB2A 4IRUB 4CF7A 3U3RA 1Z29A 4A4DA 3LD9A 1G8HA 1OHHA 1AN0A 2QNRA 2O8CA 4OK5A 4Q7KA 3CWQA 3WHLA 1E9RA 3CRVA 1VHLA 2QY9A 3PCRB 5CB8A 2VHCA 3I32A 4HATA 1DBSA 1KI6A 4KHZA 3QIAA 4I1SA 2RGGA 4RCYA 1Q1ZA 3MG9A 3RC3A 4DXAA 4D4JA 3M1IA 2JIZD 4IOJA 1R8QA 4HSEA 4EPYA 1U8YA 2PX0A 1TQ6A 1VYTA 2CVFA 4FN5A 2CJWA 4IDOA 1AS2A 2FGJA 3BE4A 1Y63A 1EGAA 3MWLA 1KGDA 4EPWA 5EXSA 4Q1EA 1KJWA 1T8TA 3LH5A 3AVPA 4KBFA 5JRJA 1ZC3A 3B7GA 3W6PA 4KSCA 1ZVQA 4HAUA 4QGHA 5SZIA 1DAKA 3OIUA 4OQMA 4A8JB 1GRQA 2GF0A 1COWD 2DB3A 2C95A 5E7IA 3NBYC 1KKMA 3D7MA 1RIFA 4GNKA 4JLAA 2H92A 2ZJBA 4Z8XA 4OI4A 4LV5B 2QT0A 3LVQE 3CRRA 4B3CA 4IVQA 2HCBA 4DCSA 4LYAA 2Q21A 1XD9A 1RJ9A 4DCTA 4C0BA 2D4HA 3TLXA 1XTSA 4MYTA 2ZR9A 1JBKA 1FP7A 3G5UA 3KUDA 1GKYA 2WJGA 2PMKA 3FOZA 2F1RA 4CEIB 3B1VA 3W5JA 5F9HA 3AKCA 4ZCLA 4P3YA 2FJUA 3VKHA 2ZROA 2BCJQ 4HDCA 1P2TA 1XEWX 4LJYA 1WBBA 2EW1A 4US1R 4LUCA 2XZPA 2WWXA 3AKDA 4X8LA 1FQJA 1IOZA 5L3SB 2O8EA 2TMKA 1H8EA 1P9RA 2ZS9A 3GJXC 1M2OB 1AZTA 1QRAA 3PXGA 1ZD9A 1EWRA 1NMYA 2IYRA 5D3MA 2G77B 4PC6A 3ADKA 2WICA 2G88A 5AR1A 4QGFA 3KKNA 4CDGA 3PEYA 1NL3A 3ASZA 3WRXC 2ZE8A 4XWKA 1TAGA 2CCJA 3LBNA 2RCNA 2XNDA 1IXZA 2WAYA 1O87A 1QVAA 3DMDA 2C9CA 1GUAA 2Q9CA 3LW7A 1PUJA 5JLJA 1P60A 3P20A 4AIIA 2WWIA 1Z0DA 4B47A 1G291 1TNDA 3R9XA 1D9XA 4B2LA 1HE1C 1XXHE 3THYA 3QXXA 3DO6A 4M1OA 1VKJA 2PL3A 4V0LA 4FI3C 4LJ7A 3KJHA 1KO5A 5LB4A 4PQRA 4LZZA 4TMVA 4XJXA 5AUPB 5KDDA 1Q3HA 5LDDC 4W5HA 5TMPA 4BLTA 4PZLA 1G1MA 1GFIA 5EXTA 3MWYW 1E69A 3EPHA 3NH9A 3WMEA 5AUQA 3TMKA 4PHHA 3MSXA 3UXMA 2WMOB 1NIJA 4JVLA 2ATXA 2ZR0A 4A36A 1JI0A 4NL4H 3TUIC 1G3IA 2QQ0A 4KYIB 1XF9A 3ZVRA 1ZAKA 2JJ2A 2JLWA 1E79A 3O8DA 4V0KA 2DFLA 1KO8A 1QHYA 2BM1A 3CNNA 4XOIA 4BFTA 3FMOB 4IOMA 5AK0A 1BS1A 2W83A 2QEQA 5JCZA 2RGAA 2RB4A 2GJKA 3KJIA 2XSZD 4MYCA 4KXFB 5H1YA 1JR6A 2QU8A 2W6ID 2ZJ2A 4MKHA 1H8HD 3IGFA 4C0JA 1SVOA 3HYTA 4D0LB 2O8FB 1W4CA 1G3QA 2ZSEA 5TB5A 1I2DA 1OFTA 3NG1A 2IT1A 2QUZA 3BH7A 3SFZA 2F3RA 3C8UA 1EFCA 3DDCA 1DS6A 3GJ0A 5J4YA 1HH4A 2BJVA 2RGNC 1QVRA 1NKTA 1ZD8A 2ERXA 1IY0A 4NZYA 2OV2A 2GNOA 2JLYA 3VX3A 2ZJZA 4JBWA 5EZ5A 3ZDQA 5JHHB 1MABA 3L0OA 1RRCA 3BJIC 3HP1A 2RKOA 2B21A 2H8KA 4X8OA 1V5WA 2JEOA 2CL0X 3AVXA 5C4MA 4Q7LA 1VG0B 2ZREA 5FL3A 5HCNA 4FCWA 2I4IA 1BMFA 4D2IA 3ZVLA 1W47A 3C4JA 4US2R 3VFDA 2R9VA 4MITA 1E2PA 1N6IA 2QM7A 2NPFA 2ZJ8A 3BERA 2WM9B 2GRJA 2ANBA 1CEEA 1UKEA 2ZITA 2XXAB 3REFA 4D0GA 3H4MA 1CF4A 4NYIR 3ZYCA 1N25A 4OK3A 3FTQA 3UMRA 4HI0E 1E0KA 2ZSBA 5FUVA 1J8YF 2ZS7A 4QG7A 4UNPA 1H65A 4BLSA 1XP8A 1E3MA 721PA 4LJAA 4QBFA 1CRQA 1YE8A 4PSVA 1KZ7B 1FMLA 4DSTA 4Q1FA 3EC2A 3QPWA 3T1QA 4DCUA 2WVJA 1UBGA 4ERNA 5JI3E 4UKDA 1A7JA 3R8CA 1XPUA 2ORVA 1G5PA 2OBNA 2IYXA 3ZIAA 3DM9B 4DUGD 4CW7A 1NP6A 1G3UA 3VX4A 3UATA 4DHEA 1IJEA 2F1HA 1JR3E 1AS3A 2FZLA 2B8WA 3PUZA 1R0YA 3U61B 3EX7C 1DVRA 4M1KA 4WIAA 4DDVA 1J90A 1CLUA 2F1IA 1ZUHA 4G5OA 4V0MA 4YDHB 1T3HA 2FSFA 3FGNA 4RZ2A 4TSFD 5JJKA 3ZZTA 2AWNA 2CNWD 2W2VA 2NOAA 3QSYA 2GKSA 1GL9B 3CM0A 2RGCA 3L0PA 5IT5A 5KYKA 3UG6A 1R2QA 2ODNA 1C1YA 1T0HB 4QM7A 1YHNA 4OI1A 4EPVA 2QGZA 1U90A 4LBWA 4UNRA 5J4HA 4Q1CA 3KXLA 3CX7A 3TKLA 4EFNA 4W5JA 1S96A 1QHXA 4KI0A 4DEXA 4YONB 4JYCA 2Q3FA 3T35A 2PCLA 3PITA 3VMFA 1DAFA 4B75A 1KI4A 1EFUA 3LDAA 4HLQB 5IHPA 1KMQA 1UM8A 4AK9A 1E2JA 1ZM9A 1G17A 3P4XA 4M1MA 4DLYA 1Z83A 3H2YA 4TYNA 4RKEA 2C9OA 2WOJA 1T3SA 4HYYA 1ZU5A 1NMZA 4JBYA 1NVWQ 2VBCA 1SXJB 3GJ6A 1PZNA 5FBRB 3KQLA 2R6FA 1LS6A 2FFHA 3ONWA 4XVUA 4FWIB 3NDBB 4KYUA 1NLFA 3OEHA 3WMFA 2NO7A 2REXB 4RD3A 4EAQA 4AI6A 1NN5A 5FUYA 1NJGA 4M0LA 5IDVA 3KFXA 2IUTA 1Z6YA 2DWPA 2OHFA 5BXQC 4PC7A 1XCPA 1E2HA 1M1YE 1EWQA 2CMKA 2J3EA 2P3SA 3KFVA 2NG1A 2Q9AA 2V3CC 1IXRC 5FTNA 3W34A 1UDXA 2GILA 1ELOA 2F43A 3WYFA 5C1BA 1N6KA 5EP1A 3SYNA 2YJTD 1OXVA 2Y8EA 3RS2A 4ITRC 5FL7D 4DWJA 4I4LA 2ZU0C 2EQBA 4GRAA 5G3ZA 3MUFA 2QRZA 3K0SA 3RAPR 2RGNA 4YC7A 621PA 2OG2A 1R0XA 2OO7A 2QRNA 5JCPA 5JJLA 3U2QA 1XZQA 5J4LA 4C0KA 1Q22A 3A1VA 3IUYA 4XH9B 1UEJA 3ZS8A 1FW6A 2CVHA 3KXKA 2IK8A 1VYVA 1U9IA 1KMHB 1HT1E 2AD5A 1KSHA 4OJKA 4WZBE 2H1LA 4GI7A 3EZFA 1ZNZA 1KK2A 4Q5IA 5K8LA 5KHOC 1CRPA 4NYJQ 1E9CA 2W6IA 2WJJA 4DLVA 4FW9A 5KPJA 4B76A 4BECA 1Z0FA 2ZSFA 4NYIQ 1G5RA 2XSZA 2O8BB 1Q0UA 1COWA 4I1OA 3KKMA 4IFEA 4TYWA 2WKRA 1W36C 1P75A 1Z2CA 2BIFA 3A1SA 1ESMA 4DCNA 3ZVMA 2O8DB 5JEEA 1XXHB 2R6AA 5FH9A 2BC9A 4L8GA 1IXSB 1E2QA 3EZ6A 5DISB 4Q47A 4EKDA 4XTRA 3DKVA 4IDHA 3M4YA 3TJZA 1QHGA 2ZSDA 1NBME 1E98A 1I4DD 1ZNXA 1XWIA 3WP0A 4ZCIA 1HURA 4WA7A 4DT1A 1SKYE 3I73A 2WHXA 2A30A 5JI2E 4G5QA 2KB0A 4CVNA 2HJVA 2WWGA 3EWSA 2ZPTX 2IS1A 5JZVA 1CKEA 4C7OA 1KK0A 1VCOA 1E9SA 4B3FX 3FKQA 4PO1A 2WWWA 5AWFC 4EQ6B 1DADA 1WQ1R 4NYMR 3IHWA 3R7WB 1OW3B 5TY0A 2G1KA 2F9MA 2XZOA 4LHXA 3W90A 3AVTA 3TAUA 2O0HA 4EQ6A 2FFQA 3OIYA 3BRWD 3DMNA 1VG9B 1K8RA 2DFKB 2IF2A 1YR8A 3VR5A 2XTMA 1MO5A 4URWR 4NTZA 3RC8A 3C41J 1XMSA 1M8PA 1P6XA 3RWMB 3L0IB 2ORWA 4HB0A 2C2HA 2OCPA 1D9ZA 2OCYC 1KDOA 4Q1AA 3K53A 4I99A 2ZUBA 1E4VA 5EJEA 3IQXA 1T5LA 8OHMA 3BIFA 5TVKA 3KKOA 2C77A 4URYR 2QAGA 1AA3A 5JMTA 4XIGS 3R9IA 4B32A 2EWVA 1S1CA 2PCJA 1JEEA 4DDWA 1WF3A 5KDLA 3B1WA 5DNYB 3U5ZB 4LWZA 4F7WA 3GLIE 1OB5A 1IN7A 4Z54A 1MRNA 2O52A 1GTVA 1S9DA 2IYYA 5TARA 2O5VA 3LAWA 1KOFA 3QI2A 2XGJA 1MRSA 2DY1A 4RCZA 1KI6B 2R6GA 2WJIA 5KPDA 1OH7A 1NKSA 1MH1A 1XD2B 3A4LA 3U7GA 4P4SB 1EXMA 4PSKA 2BV3A 3K0CA 4B33A 3B85A 1SVWA 1ZM4A 3I8XA 4KO8A 4RD4A 4EFMA 1IJFA 2CJWB 2PH1A 2D74A 2Z83A 1VPLA 1RPZA 3AV0B 2X2FA 4G5RA 3X1YA 1RFLA 3K9LA 1DEKA 3NHAA 4BEBA 1K6MA 1EESA 2KBEA 2ZXUA 3IBGA 1G7RA 1G8FA 2VRWA 2ZANA 3W3AA 3AH8A 3LV8A 3D6TB 2ZTSA 2R2AA 3B13B 3PENA 4D25A 2ZI4A 3VAAA 5FBLB 3TSOA 1OFIA 3B8HA 4W9MC 3AVWA 4TYPA 4KFUA 1TEXA 4TN1A 4PAOA 5JWRA 1ZP6A 1SZPA 4RD1A 4V0ME 3C7KA 2ZRBA 3TH5A 4KVGA 4V0OA 4G5SA 1GWNA 5EE9A 4PR0A 1E0AA 1TF5A 3T15A 2PT5A 5BN4A 3QBTA 1LY1A 2IYSA 2PJZA 3ND8A 2J45A 2CL6X 4MA4A 1CXZA 1NN0A 3X1DA 2OLKA 3GJ4A 3NKVA 5G40A 5BW8A 1A1VA 1NVVR 1MO4A 3O8RA 2W0MA 4BZPA 2ZJ5A 2FPKA 1OPXA 2C03A 2A9KA 4ZDIA 2ZI3A 1G21E 1N6HA 1OIWA 2HXSA 2VHUA 1CTQA 3LO5A 3RNLA 3RWOA 2WWYA 2GJAA 1CJTC 1IY1A 3THWB 1KDTA 3AEZA 1W1WA 3H86A 1VDZA 1M7BA 5DSZA 4M22A 4V03A 4HZIA 3GFOA 3NEJA 4GPTA 2CHVA 4K46A 5C4GB 1JECA 4PPQA 4B44A 3P27A 2VP0A 3NH6A 4OI0A 4MRPA 3I62A 4HDQB 1A2KC 2X1VA 1W0JA 4FMCB 3K9HA 3MLEA 4LBVA 4AKGA 2OEPA 2XB2A 2JJ2D 3W8NA 4OQFA 1TQDA 4AKIA 5J40A 2VHQA 3BOSA 1E0JA 4JJZA 1UEIA 4D4LA 1B0UA 1YVDA 5EP3A 3SBEA 1ZCBA 1E1QA 1TTTA 3HU2A 4DLUA 4FWTA 1ESNA 2GEVA 3SE0A 3E5HA 3IQWA 5FPKA 5EXPA 5BYJA 4QHTA 5JFGA 2DR3A 5GVRA 3MWJA 3A58B 1NNEA 3MGCA 1XJCA 1XBTA 1ZNWA 1S4QA 2UZIR 2V7QA 1UKYA 3GLIB 1ZMXA 1AM4D 4B71A 1DARA 3HPQA 2HEIA 3LXXA 2ODWA 3NC0C 1FUKA 1KO4A 1AGRA 1FPMA 2Z4RA 3A4NA 2IXEA 4B43A 4Q4JB 2J5XA 3UANA 6Q21A 4LYJA 4LJ5A 2IYLD 1HV8A 5KNDA 4LHZA 2XNDD 3LQQA 2O0KA 3P26A 2AXNA 2ZI6A 3W3ZB 1FUUA 2XAUA 2ZRAA 1XCMA 3U7EB 3G0HA 1G7SA 5EP2A 2N1BA 4IOLA 2ZRHA 1IN4A 1P9NA 2WWFA 2Z6VA 3OEEA 1CR0A 3BB1A 2P6NA 3UMFA 4A15A 1M7GA 3CBQA 4OBEA 3AKEA 5FOUA 3MFYA 3EW9A 2ZRIA 2CK3D 3B1ZA 3CX8A 1E9BA 4MQBA 2WV9A 2B6HA 4HAYA 5J5CA 1GITA 5AUNB 1OE0A 5EE0A 1GKIA 4HZUA 4B3BA 1HA3A 2RGXA 1AKYA 2BMEA 4LHYA 2FNAA 2CHGA 3B2EA 4Q02A 1G3RA 5AJZA 2QM8A 4ESHA 3V4RA 3UWKA 4B2IA 3LLMA 2ASEA 2EU8A 4OI2A 2RAPA 4PSAA 3QKUA 2O8DA 1KSJA 4BGDA 2WJVA 3TQCA 1P62B 4XVQA 2WKPA 1ZJ6A 1MT0A 1PVOA 3NBZC 4IW3B 3WMGA 2XZLA 3SS8A 2G9NA 3J81k 3MAAC 3GD7A 2IUUA 4PPFA 1KJZA 4G1UC 4YMTA 1XMVA 3TE6A 2IBMA 2ZQ5A 3QKRA 2A3RA 1WB9A 1XXHA 3AGQA 3BFKA 2VHJA 2GXQA 1E0SA 4DSUA 3W8RA 3PIRA 1GRNA 3TK1A 3QVUA 3KB2A 2V54A 2B7CA 1KKLA 3I72A 1NVUQ 2V7QD 3VHLB 2R6DA 1RJ9B 3U7HB 4RFSA 2E87A 1YZTA 4M9ZA 4F4CA 2BMDA 1TPZA 1XCGB 2DBYA 1WRBA 3DOFA 4A0HA 4FXPA 4MGIR 1F60A 3QPUA 2QQEA 2WJHA 2BEJA 5CM8B 3QOFA 2FDCA 1YJ5A 2IX3A 4OHVA 1RYFA 2MSCB 2HV8A 1G7TA 5DYGA 2OCAA 1D8TA 3V4FA 1G64A 1NI3A 2C98A 3CPEA 1CIPA 3IO5A 5DH9A 2J0VA 3B82A 2I1VB 4FINA 4B34A 4M8NE 3NBXX 2CE7A 2FOLA 3IEVA 2FZ4A 3K09C 1CULC 1D5CA 4Q9KA 1FOEB 3P32A 2OSBA 4D81A 1Z63A 3H0KA 3MD0A 4LOAA 3SNHA 4KFSA 1E9DA 1RVDA 4PC3A 5CJ2A 3RS4A 4H1VA 3GLHE 1OYYA 1C9KA 1LF0A 1QBKC 2NO9A 4GMDA 5FR1A 3TSZA 2RGEA 4PTLA 4B74A 3ETLA 1P3JA 4IVPA 3AB3A 1XMIA 1MO6A 3EPLA 1QF9A 2G3YA 1DPFA 3FE2A 4GT1A 5FOXA 1N5JA 2WOOA 4B3GA 3BH6A 3ND9A 2Q3MA 1Z0AA 2FSGA 4DLXA 3A36A 3GJ5A 2YNMA 2GHIA 5E95A 5CYPA 5EXXA 1OB2A 3V00A 4C2UA 4PXAA 1US8B 5HKKA 2C78A 2FSIA 2NO0A 4JKIA 3DHWC 3CIOA 5DI9A 3ADDA 2IYWA 3PUVA 1E2IA 1US8A 4JJKA 3T34A 4B3DA 1BH2A 3QXHA 2AXPA 3LW8A 5JWHA 1F6BA 2H7VA 4QM6A 1NF3A 1P2VA 1NG1A 4AC9A 1IHUA 4TMWA 4BZXA 5B64A 1S0UA 2IS6A 1XEXA 3QF4A 3AVVA 3PJRA 3QG5A 4PQFA 4XSHA 2O8CB 1YR6A 3QY0A 4U5XA 3GLFB 2IWRA 3KB1A 2YKGA 2OM2A 3KZ1E 4ESVA 4Q9IA 5SZKB 1WCV1 3HU3A 1QHHA 4DEYA 4BRUA 3C5HA 2OXCA 4BLQA 2YWFA 4G01B 3GLHB 4H9GA 4OQNA 1GILA 1YZNA 1U8AA 2MMCA 3FMIA 1AGPA 3P1JA 4E03A 3FDIA 3VR1A 3VTKA 1II0A 2YHSA 5K8IA 2F7SA 3EWAA 1FNNA 2ODEA 3N2EA 3OE7A 5JBQA 4JT4A 2IHYA 4AWXA 3LX5A 4QRHA 2E9SA 3L8ZA 3SJAA 3TR0A 1MV5A 4BRWA 5LD2C 4ZI2A 2P0EA 3W6NA 4Q4LA 5FBVB 1EX6A 2G6BA 4LYHA 3QEJA 3MJHA 1ZM7A 2CCGA 4QJ4A 4RFVA 1XJ0A 1IN8A 3TR5A 4A0RA 4LHVA 3ZQ6A 1QG2A 2C96A 3JVUA 2PT7A 4PZZA 4Q19A 3WBJA 4AURA 4AYTA 1AJEA 1U99A 4QXAA 1SKYB 1KY2A 2ZJAA 1YZQA 1IM2A 1BIFA 1XTQA 1MABB 1BMFD 1DTSA 1J99A 2KJQA 1H8ED 1YKSA 1OSNA 4DC9A 4KFRA 2W00A 1V43A 4TYQA 1G19A 2WKQA 1W0KD 5GJWC 2UVQA 1N6PA 2J0UA 5HPYB 1ZRHA 4TSFA 3EPKA 3A4MA 4TTQA 4WBSA 3Q72A 3VKWA 1MO3A 4AKHA 4XD7D 2GK6A 4R9UC 1X86B 2VP6A 2LWIA 4TTRA 5DN6D 2YC2C 2QA5A 5KUTA 1UBEA 5D3MB 2BHRA 3TW4A 2CE2X 2LCFA 5M04A 2P5SA 1GKUB 1P72A 3WNCA 2J1LA 4DB2A 5FPTA 2FN4A 3BORA 2A7QA 4PHGA 4JL8A 5SZHB 4LBZA 4DLWA 1AK2A 1JNYA 2ZYWX 3CPJB 1SVLA 1U2RA 5JS7A 1XMJA 2F6RA 3WYGA 1AIPA 5FL7A 1TADA 3K0EA 4CYMA 4URVR 1OH5A 4ACAA 1W36D 5G41A 2FE4A 1DAGA 1TQ2A 2DFNA 2WZQA 3KUCA 4O25A 4HAVA 1GNRA 2WWHA 2FSHA 2GVDC 2EFDB 5EE3A 1OH8A 3IPXA 4C7OB 1E79D 3AF0A 5CDFE 2ZRPA 3TVDA 4CIDA 4M4SA 4NPHA 3QBVA 3X2SA 3RS7A 3K70D 4B2PA 1FTSA 2GZAA 5FBQB 1TX4B 1ANKA 4Q7MB 4PHTA 1JPJA 4A0FA 1CJVC 2JLQA 3EG5A 3OZXA 4R98A 1X8LA 1AA9A 1T9HA 4XTCS 3TAHA 2VP4A 3SEAA 3GEEA 4G5GA 3UKDA 5KTYA 2IA5A 3RRMA 4I1UA 5CLLA 3UK6A 2JAQA 1W0JD 2JLZA 1LB1B 3U44A 4IXMA 2GJSA 2ZE5A 5LPNA 1CR2A 3FFBA 1Z47A 4TLEA 5JHGB 4B73A 3NDPA 3LXRA 1VTKA 3K0FB 3QJYA 3RLFA 4MGKR 3JVVA 1R0ZA 3U4QA 3L2OB 1J8MF 4YDSA 4HLUC 3S1AA 2P6RA 4LYFA 5DHAA 3P4YA 4JKYA 1ZINA 1II8B 1PLKA 3O8CA 2H5EA 2OAQ1 1NN3A 5DN6A 2BMFA 3N2IA 4CGZA 1JAHA 3KQKA 2AKAB 4JLBA 2OESA 3B9QA 1II8A 3QQ5A 3CB4A 3T1OA 3U3OA 2ZEJA 5GJVC 3EPJA 2BDTA 3E2IA 5KSYA 4BFZA 1YR9A 4M1TA 3GPLA 3IPYA 4IDQA 3E70C 3AP1A 4DVGA 4BQSA 4CT5A 3D3QA 3K09A 4JLMA 4M9QA 3I1FA 5A5GA 3L82B 1E2DA 3OF5A 4IKEA 1KIMA 4NYMQ 4ZDKA 1M74A 2FG5A 3FFAA 1ZBDA 4K81B 2ZI7A 5HTKA 521PA 2FFAA 2VA8A 3I61A 2YV5A 4JLJA 3SJBA 1KNXA 4TMXA 3OEED 1W5TA 1T4GA 2B92A 2GVZC 4OK6A 2IEYA 4Q9JA 4DUGA 3KQNA 4RKFA 1D2NA 2YWGA 3PVSA 2ZRGA 4I1VA 3I92A 4J0QA 1DAMA 1KI2A 4UXHA 4F4IA 1BKDR 2OUKA 2XJ9A 3NC1C 4PAMA 4M2LA 2RGBA 5UKDA 2OBLA 1W49A 1KDRA 1R6BX 1JALA 2A5GA 3OHMA 4A0GA 1ZYUA 3SFVA 2VP2A 2O0JA 2ZI5A 1YU9A 1EFRA 3CRMA 4Q03A 5FTJA 4TZ6A 2CLDX 1FX0A 2GAOA 3H84A 3AM1A 4RD2A 2GCOA 4M1WA 5BQ5A 5BN3A 1MOZA 1Q57A 1IAQA 2NO1A 3K0CC 3L8YA 4JMPA 3X1XA 4Q18A 4CZ2A 5JECA 5F9FA 2OCBA 3LY5A 1R8SA 2F9LA 2QMUA 1UKVY 2WIBA 2Q3HA 3KJEA 3T5GA 2DPXA 2XTNA 1X8KA 2ZJYA 3LLUA 5TDHA 3PUWA 1SHZA 1PJRA 2GJ8A 3BC1A 3B6EA 2CXXA 4KLNA 4Q7JB 4PHFA 3PEUA 1Z28A 1RE0A 4US0R 1UDWA 2JA1A 3ZJYA 1FMJA 3NBFA 3W9YA 4BLOA 3GLGA 3THWA 5EUQB 1C4OA 3I3SR 4PC1A 1AZSC 1X8JA 1KSGA 3A1UA 2OFXA 1XFAA 2KBFA 2QBYB 2VTKA 4Q00A 2QORA 1Z07A 3OESA 1Z22A 2VH5R 2JJ8A 1PLLA 4KFTA 4TQ9A 1JJVA 1GZSA 1RRGA 3I5YA 4PZYA 3VNUA 1VCMA 1X6VA 2HXYA 1BYUA 1KSFX 4JL5A 1GRRA 4Z51A 1U0HC 1JXOA 4OHXA 2A5FA 1XEFA 2BMJA 2GXSA 2VLIA 3OAAD 1Z6XA 3KX2A 5KNBA 1IN6A 1QHIA 3ZIAD 4D0NA 1HT2E 2QMOA 3T1TA 2GJ9A 4PQYA 4NCJA 1Z08A 4DKXA 1JAIA 2G1JA 5HR5A 2JLVA 4BZQA 2XTZA 1XPRA 3TW8B 2ZRLA 3CW2A 5JS8A 5FOVA 1Z06A 2JLXA 1GDDA 2WAXA 5P21A 3WYAA 3VHXA 5TV2A 3K9NA 1WMSA 3U60B 4O0MA 3RANA 3CKLA 3X1WA 3GEHA 3R7WA 3A37A 2VP5A 4WOPA 2Q9BA 4JVMA 2QP9X 1TUIA 2ZYUX 2YOHA 2AHOA 4PX9A 1O3YA 5KO2A 2IEZA 1W2GA 1FTNA 3RABA 1UBFA 1ETUA 2HJGA 1BYIA 3RSLA 1UAAA 4PFSA 2WIAA 4TMKA 1EFHA 5L3QB 2J46A 3F5FA 4O2RA 4TT3D 1QG4A 3SYKA 1F2TA 2YINC 4B48A 3C16C 1XTJA 4TLBA 2GCOB 4BE7B 3ZH9B 4E22A 1NG9A 3K9GA 2W6JA 3QKTA 3U44B 1N3BA 4NCNA 4LV8B 2NTYC 1K5GA 2CEAA 5FUWA 1I2MA 4IVRA 4UQOA 3PFIA 4UXJA 3RVBA 4BFVA 4PO9A 1YQTA 4DB4A 1VIYA 3SHFA 3LFUA 1JR3D 4HDOB 4JS0A 4LCBA 2OFWA 2QMHA 3B1XA 5HE8A 1G16A 5CK4A 4Y0VA 1Q12A 1E99A 5FPYA 3LNCA 4L15A 4LSGA 3HYRA 4LI0A 2GETA 2ZRCA 3AUYA 3IO3A 1SVMA 1W4AA 3FPAA 1E1RA 1N6OA 3IIMA 2YYZA 5EZ6B 1NSFA 4YMWA 1SVKA 2QROA 3ICEA 3A6PC 2GA8A 2XX3A 2GXAA 4YLGA 3AGPA 4HB3A 2V1UA 1XTRA 2JDID 5K8TA 4HLCA 2CK3A 2O8BA 1N0UA 4YXWA 3NTUA 2F1JA 5L3VA 5GVSA 1VIAA 4UNNA 4PPGA 3SHWA 2FV8A 2VHTA 3EIEA 1N6LA 5FPSA 3RS0A 1IQPA 1E96A 4P31A 3RSOA 4HAXA 4A8JC 2BWJA 1FP6A 2DFTA 3OEHD 4JVNA 1E32A 1W5SA 1OFUX 5CK5A 5FOWA 3QVVA 4IDPA 2ZAOA 1E2NA 3DOEA 3F0TA 2H17A 4NHOA 1CP2A 3U3JA 3QF7A 1G4UR 2REOA 3QXCA 2YOFA 4DSOA 4GFDA 1OIXA 1G18A 2XJ4A 1M6NA 2GEUA 3VNVA 2BBWA 1ODFA 1A5TA 3F8TA 3AF4A 1Q1BA 3CRW1 1AKEA 3QKSA 3LA6A 3HR7A 1W4RA 2C5LA 4C2TA 4I81A 3OIWA 4QC2A 2XOKA 1Z0IA 1OFHA 4JLOA 5G3YA 4A2PA 4IDNA 3T61A 1BO6A 3SZRA 4DLRA 4EJSA 2JIZA 4Q66C 1XTIA 1OKKA 3RS5A 4F92B 2J0QA 3AVOA 4LX0A 1UF9A 1DAHA 3SOPA 2H18A 1MR3F 2QZ4A 4QKQA 1G4AE 3K0AB 3TBKA 2XITA 3C15C 4BFXA 2AX4A 3GJ8A 1IBRA 1Q1EA 4OHWA 3ZZUA 4IOKA 4HUQB 3U4QB 1MKYA 2VPPA 5JJIA 1Z8FA 4D6PA 1TU3A 2GDJA 4QGAA 4UNQA 1VMAA 1AS0A 3H1TA 1ZM3A 3QF4B 3RRYA 1EFRD 3B60A 4Z1MD 4MDFA 1NJFA 2BM0A 4QJ5A 1U0LA 2AKYA 4XWOA 2B8TA 5CB6A 4GL2A 1GNQA 3IIJA 1F2UA 1T0JB 4ZV4A 1LV7A 5F98A 4OL0A 3FKSD 2B7BA 4WAUA 5LD2B 3KDSE 4HLDA 4MGZR 4TMTA 4A9AA 3GLHA 3U7FB 1GL6A 4ZDJA 1JQLB 3PUYA 5J4KA 2BBTA 4YQFA 1E6CA 1KY3A 1P4SA 4N0DA 5LBIA 4L4UA 1SXJA 3FB4A 3FHOA 4CEHB 3NVAA 4S2EA 1W4BA 3SBDA 1ZIPA 2FPMA 5CIQA 4P4SA 1G8PA 3CZPA 1HYQA 4UXIA 3BS4A 4ZDWA 2IC5A 4AG6A 1KAOA 5D3QA 1G8GA 3A8TA 4TQUS 4AD8A 2XXAA 3ICQB 3M0EA 4ARZB 4QL3A 2AWOA 3FHCB 4G0NA 4BFYA 3SQXA 2HLDD 4W5WA 4AY2A 4NP6A 1N5IA 1RW4A 3FHTA 1P7CA 1XD8A 2ZE7A 5EE5B 5FBWB 2NZ8A 4GOKA 2BOVA 1NVXQ 1L7VC 1XRJA 3SI7A 2ZE6A 4L9SA 3GJ3A 1G6HA 1N5LA 1N0VC 2GAAA 1N2CE 1E9AA 5KU1A 2HF8A 1T3LA 4CT4B 4WVFA 4TYYA 1D2MA 1S8FA 4JL6A 1S9HA 4R71A 4IEIA 1OH6A 3W6OA 4TWZA 4DDUA 4KSBA 4FMDF 4MUBA 2JJ1D 2FEMA 3LQRA 1F5NA 3CONA 1U0JA 2J0UB 1XNJA 4NU0A 4Y0AA 1GVNB 3B5JA 3QG1A 3ZS9A 2JLUA 3CR8A 4BLPA 1TU4A 5J4VA 2P5TB 5FTKA 3QKRB 4EJSB 3ZQJA 1W46A 1TF7A 4MRSA 2ZSAA 2ATVA 3N5CA 2CHQA 4JLPA 3AQ4A 3SJCA 2WSMA 3Q5EA 3MCAA 4EPRA 1KZGB 1IY2A 2QL6A 3KKQA 2H57A 5E7JA 4EDHA 2CCKA 1JXMA 1Q44A 1KO7A 4B35A 3RS3A 4QNRA 4HUQA 5FI0B 5FR2A 4F91B 3THYB 2EVWX 1G7CA 2CBZA 2JCSA 5IK2D 2DWQA 2FWRA 4IXNA 2HCJB 4BLRA 4DRZA 3GEIA 3IIKA 1R10A 1P2UA 4EIWA 4D80A 2HDNB 2CL7X 2GWHA 4Q1BA 2JASA 2Z43A 1Q20A 1LTQA 1J2JA 2Z5FA 3ZD7A 1D6JA 1LS1A 2GBLA 1B23P 3KL4A 2PBRA 2R65A 2J7PA 3EARA 2QTVB 4R2HA 1HUQA 1WDTA 3LWNA 3VR3A 2J7KA 1DO0A 4ASUD 4P0TA 4GOXA 2FPLA 1JEDA 4DDTA 2NZJA 2ZR7A 1W36B 1QHHB 2MSEB 1RRPA 2VF8A 3PQCA 1BOFA 1L4YA 5B58C 2FA9A 3CLVA 5IK2A 4ZIRA 3TUJC 2Z4SA 3K70B 1YZKA 3VKGA 4YMVA 4RZ3A 3IBYA 4GDFA 2ZS8A 3EZ9A 2CLCX 2F55A 4IHQA 3HU1A 5HCIA 3FWYA 3Q5DA 1LW7A 1S2MA 1M7HA 1EK0A 2IYUA 3U3KA 2FX3A 4A1FA 1KI9A 1U9IC 3F3YA 1KO1A 4OQLA 4CEJB 4WXPA 3R9WA 3RDPA 221PA 4U00A 1F48A 3EZ7A 3WXMA 4R7ZA 4E09A 3KQUA 2J0SA 4G3XA 2CDNA 2DCUA 4Q1DA 4HLUA 1XX6A 2HF9A 4C0HA 3S1AB 3FVQA 121PA 1AQUA 2O8FA 1G8YA 2AK2A 1YR7A 3JZAA 4GP6A 2QI9C 4Q4HA 3M6AA 5KSOA 4M9SA 1OXSC 1KMHA 2HYDA 2EFHB 2OILA 2ZRNA 2PZFA 2SHKA 1XEWY 4QBIA 5J47A 2FF7A 2QAGB 3DZ8A 3MMPA 2IUSA 1X1SA 1DE0A 1PLJA 3K70C 3TNFA 1CJUC 1NMXA 5HZHA 4JLDA 2VSFA 4GOJA 2JLRA 4LJ6A 4MRVA 4M9XA 3T06B 3DZDA 3SDZA 1CJKC 2QSYA 3ZD6A 4BFSA 1DAIA 1NLYA 2DWOA 1NSTA 2V55B 2J7PD 1NN1A 1H8HA 4ZKDA 1KI7A 3HDTA 1XTKA 4TL6A 1RZ3A 4MYUA 1FX0B 4A92A 5CIWA 2VIIA 2LKDA 2VL7A 4QNMA 2ECKA 3SR0A 4TL7A 3L43A 4MH0R 5DO9A 2RHMA 2P67A 2PEZA 5FPHA 3A1TA 4EUNA 2PMDA 3ZZ0A 4TLDA 4F38A 5DE3A 2D7DA 5AJYA 1SXJD 2EFEB 2J59A 3BFVA 3PG5A 1GSIA 1I4LD 1DOAA 1E9EA 3AF2A 1ZNYA 4BFWA 1D2EA 2V6IA 1UFQA 4UJ5A 2EFCB 3JZMA 4HEJA 1GAJA 5DGXA 2Z0MA 4E5UA 1KHTA 4EPXA 1E4YA 3TQFA 3AP2A 4RD6A 4M53A 1FZQA 2A5JA 1T91A 5E7MA 4FCVA 5IF9A 1FL9A 3EAQA 3TSWA 2QTFA 2FH5B 4GZMA 4QBGB 2QBYA 4XVRA 3BAFA 3GLGB 4ON9A 2GF9A 2QGNA 2X19A 1OHHD 5BWMA 4QGGA 2AFHE 2V1XA 5TXGA 1G3MA 2QPTA 2JJ1A 4HB4A 2I1QA 5AUOB 3BK7A 2V6JA 4MDEA 5FUXA 3PEVA 2HUPA 4A6XA 2ZRMA 1UKZA 1OXTA 4BASA 3WNBA 2HT1A 1VCNA 4MUAA 1VECA 2IXFA 2ZAMA 2G0NA 3GFPA 1IN5A 5L8VA 2D06A 5B57C 1NBMD 2OLJA 1OJLA 3GJ7A 1I4TD 1DO2A 1ZC4A 1LNZA 1T6NA 2WPDD 3IHLA 2IW3A 3D31A 3QXSA 4D4KA 1Z0JA 5GJBA 4AYXA 3BXZA 4BUJA 3GFTA 1CJMA 3UMSA 2AFIE 1JB1A 1X3SA 1FNMA 5DIFA 1GL7A 2ORIA 1YZGA 4BFUA 1Z6AA 4DIDA 3DKPA 2CNWA 3T12A 5BN5A 4GMXA 1SXJE 4Q9LA 1SVSA 3EC1A 1UJ2A 1F2UB 1G5TA 1LVGA 1OF1A 2PLRA 2R6CA 3HJNA 2C99A 2IS4A 1GP2A 1Q21A 2YWHA 3MWKA 2GEDA 3UG7A 4AYWA 3KXIA 1LF5A 4QBHA 3ECCA 3BGWA 1U8ZA 3SN6A 3PUXA 4JLKA 2WSSD 1P5ZB 3R20A 2QPAA 4GBMA 2ZU6A 2GCNA 2AK3A 4NCIA 3KTAB 3TIFA 4NMMA 3GLFA 4W7SA 3MRSA 5H8WA 2P2LA 2F43B 2GBLC 5DYIA 3LBIA 2RMKA 2EWWA 4C3ZA 1XEXB 2PX3A 4YXWD 4URZR 4LJ9A 3B9PA 1TMKA 4NKRA 5C46F 3FYHA 2JDIA 4KV9A 1YRAA 3K0FA 4LPKA 1TL7C 5JSZA 2VSOA 2G83A 4JLVA 3MJRA 1WBDA 4GZLA 3B78A 2ZRKA 3PV0A 1L8QA 2IF0A 2K5UA 3GLGE 1W2HA 2REBA 3GLIA 4MGYR 1DG3A 2IXGA 2A78A 2QAJA 2OAP1 3NHBA 2ZUDA 4II7A 4M1YA 4JLNA 4ZO4A 3O47A 1XJQA 1CU1A 2QP3A 4IFBA 4BWYA 4N1AA 1HTWA 1TEVA 2GESA 3QEOA 1KK1A 3WY9A 4HUTA 3QPVA 1W7AA 5EE1A 3ZLJA 1ZCAA 2GZHA 1TQ4A 2VYFA 5EP4A 2IS2A 1U94A 5F2EA 1P73A 4CRWB 4OJQA 1M34E 2C04A 4RVCA 4OKSA 4RSGA 3Q3JB 1S1MA 3HWSA 3SQWA 2BBSA 2KI5A 2W2XA 2O8EB 1U98A 1UPTA 2GZDA 4PANA 3ZGXA 2W6JD 2JGNA 3CRQA 2Q0HA 1FQKA 5H70A 4TMZA 2D3WA 5A0FA 4DT1B 3WP1B 1GG2A 3BWDD 3QE0A 1U81A 2FGKA 2E1RA 4NH0A 2PLFA 3VR6A 1P2SA 1ONBA 4B6FA 1NVVQ 2XEXA 4LGMA 4YMSA 1Z2AA 3TGPA 4Q9HA 1E2EA 1PUIA 3IKJA 2ZI9A 4TT3A 5FTMA 3VR4A 5BYKA 2CLSA 5AJWA 3LVRE 4LRWA 5KOYA 2PZGA 2A5DA 3UIEA 2V8OA 5K8UA 5G53C 4U7DA 3CR7A 1E2GA 1Z3IX 2ZJOA 3I8SA 2NPIA 1E1QD 2QE7A 4TTPA 4V0NA 4X8HA 5CJPA 3CZQA 1G6OA 1OYWA 4JT2A 1Y3AA 4QHSA 1Z6GA 3BB3A 3QKSB 4JIMA 2I3BA 1SVIA 1KDPA 4N3NA 3TVTA 1E94E 3OFND 2IYZA 5HKKD 4DLZA 2R44A 2RH5A 1ZW6A 1GIAA 3BBPA 2MMGA 2GK7A 4GSYA 5HE9A 3CUEF 1KI8A 4LK2A 1SXJC 3E1SA 4LPSA 1G20E 1N6RA 3KJGA 2VF7A 4TLAA 1DAEA 5FOSA 2WMNB 2ZVPX 2ZIAA 4H1UA 3THOA 3EIQA 3SC3A 4RY2A 2WSSA 2QT1A 4FMDB 5C18A 3L0SA 2VP9A 2JATA 1GM5A 2NMVA 4PC2A 4B6EA 5JSZB 4CEJA 3QNUA 5DI3A 4AG5A 1N0WA 3CPHA 2AD1A 1OXUA 4Q4AB 1UADA 3TUZC 2QTHA 4LC0A 1S3SA 4NBSA 1NY6A 4MKFA 2N46A 4FMBB 5FTLA 1VG8A 2G0TA 3V9PA 4A82A 4EFLA 1EFTA 4Q4AA 2A2ZA 1SQ5A 1XD2A 4M21A 4IJMA 2WPDA 1XDBA 4D4MA 1OKKD 2R8RA 4DCVA 2DYKA 3BFXA 4EJSC 4O2LA 4Q48A 1KAGA 2XNSA 2OFOA 4P4UA 4CEHA 3FMFA 4ZPXA 4K8OA 3U3MA 2ZRJA 3WHKA 3AKYA 3ADBA 5CDFA 4PPNA 2XB4A 2AN9A 4LJ8A 2YC4C 5CM9C 3AVUA 4EPTA 5C2JB 2NIPA 5GADl 1W44A 4E07A 3BH0A 4NCHA 2ANCA 4RFSB 3ASYA 5KSZA 3T1VA 4L5BA 2V4ZA 3CWZA 3DL0A 5JWOA 1PV4A 4JSYA 1SHKA 4LY6A 4LJ4A 4LV6A 3K1JA 3FMPB 3Q7QA 1G41A 2ZETA 3O8BA 5AJVB 1A82A 5GJCA 4DBLC 1AQYA 1WP9A 4A8JA 3Q85A 3IEUA 3ZVNA 1WA5A 3EA5A 2PZEA 4JZKA 1QHSA 2OT3B 5CLQA 2NGRA 2H16A 1E2KA 1KNQA 3OIVA 1JQJC 3A1WA 4Z8YA 4MRNA 1E2LA 1ZIOA 3B1YA 4WZ6A 5AJXA 2EYUA 4JSTA 1OT3A 3I5XA 1OIVA 2IYQA 2VSXA 4N0EA 1TUEA 2OZEA 3UPUA 4ZCMA 1E9FA 3CF0A 3AVYA 1SGWA 5L3QA 4TL8A 1JPNA 3CO5A 1W48A 4C0SA 4ILEA 1F3OA 1R7RA 4QJ3A 1HEIA 3WBKA 4OHYA 4S35A 1F2TB 1K5DA 2WJYA 2ZYTX 2YWEA 1RYHA 3C14C 1OXXK 1ZM2A 2ZRDA 3I4LA 3VQTA 3EZ2A 5IRCD 4O3MA 3GCGA 5KSPA 2BJWA 4IEEA 1Z5ZA 1RRFA 5E3HA 1GOTA 4OHZA 1L2TA 821PA 1OLOA 2ONJA 2MSDB 2Q6TA 3SU8A 4C9BA 1KI1A 1KYIA 3PR1A 1NBMA 3CF2A 1T5IA 3LX8A 4TLCA 1HY3A 4LDJA 2XOKD 1JR3A 2J9RA 1CS4C 3C5CA 1QHNA 3WNDA 4B3XA 3U6BA 1P61B 1YZLA 5EUMA 2ZVQX 2HYIC 1OV4A 3REGA 4ZKEA 2C8VA 4P33A 2A5YB 2W0SA 3BB4A 4WZAE 1P9WA 4DZZA 1II9A 2ERYA 4JVSB 3NXSA 1X1RA 2P65A 5B2ZA 2QP4A 4XSGA 5FI1B 4Z1MA 2F3TA 1G9XA 3Q7PA 3D8BA 1R5OA 5L3RA 5H68A 3QXJA 3THXB 3LBHA 2X77A 4MKIA 3KQHA 5KNCA 3GP8A 2P6UA 1N6NA 1R5BA 1SULA 2ODBA 3NWJA 2BKEA 2FMXA 3U6KA 3THXA 3CNOA 4URXR 4JBXA 1EX7A 4C30A 1YZUA 1SKQA 1VCIA 2ZYVX 3W5IA 2RHDA 4LC1A 2KE5A 4FMCF 2L0XA 3CF6R 1LFDB 3X1ZA 3CH4B 4RZXA 2QN6A 2PJRA 4LHWA 4P32A 2BVNA 2HLDA 3N70A 4Q4JA 4DIEA 3RRZA 2R62A 2NQ2C 1VG1A 2AL7A 4TQAA 4C0LA
chains in the Genus database with same CATH superfamily
4AICA 2ARKA 1LPOA 2XUPA 3DAHA 1CR1A 4PLVA 2I6QA 4X20B 1RIIA 4KO3S 2LR0A 2X8AA 4OQQA 4DR3B 1Q83A 4ZZ0A 3UA3A 1VE3A 1HE2A 1L5HB 3T5DA 3DEFA 4KODA 7AT1A 3DM5A 2IHBA 2QVLA 2H85A 3G0OA 4NDZA 3RREA 2QTBA 2XDQA 3D59A 4XRGA 5KMGB 1I2ZA 2RD2A 5F3WB 4MI1A 4QOFA 2O8VA 1OX4B 2VDVE 3E61A 1ZD1A 3G2LA 1NVGA 1U5CA 1IQUA 4CM9A 4A6PA 1ZD3A 4PCVA 5ELXA 3U62A 3IILA 3KDPA 4LDPA 3AERB 3CH5A 4PW0A 1KXJA 2WVGA 3JARB 1XPOA 1HK7A 3PVCA 3VBEA 2QG6A 2AOXA 4X41A 3CVXA 5A3JA 3GGCA 3PNPA 2F3UA 4S1WA 3ZJTA 5A4JA 1DI0A 1XXLA 2QS9A 2W6QA 4OQ4A 4MMYB 3ROFA 1MTZA 4KQXA 2XQGA 4GYJA 4BMYA 1X0XA 3IDQA 4PAQA 4PYIA 1XZDA 3GQBA 4X95A 3RRNA 3CNLA 1Q1QA 3AM4A 4DR7B 1D6SA 3QYJA 1A2BA 3OHPA 3TN7A 3I6QA 5I01A 1IHYA 1R18A 4I4CA 5K6RA 2AMFA 1E3WA 1BEZA 1E1RD 4UDOA 1B1CA 3N0RA 1Z45A 1HDIA 2Z3VA 5EQTA 2W2KB 1DBWA 1EG7A 3FWPA 3N2GA 4JYBA 1J9GA 3AF1A 3LCVB 5K8JB 5K8CA 5CTAA 1EP9A 2WEKA 5B58T 4D26A 1A9YA 4YJFB 3N53A 1PTKA 1KK3A 5EKDA 1PYDA 1OWMA 3K1AB 2X0JA 4DIBA 2OG1A 2CD7A 2W2NA 3QUSA 3G13A 3AR4A 3EXAA 3GA0A 2DBQA 5GPBA 3HXTA 3FUXA 3O3OB 3SOZA 4L8YA 2L69A 5A06A 3AP3A 3KKPA 2X1MA 4P98A 1P9LA 2BCGY 1ZUIA 4GP7A 5I51A 3Q3HA 4RABA 4DYDA 1F8FA 1XAGA 1YB4A 4E2WA 2IE8A 1FU7A 1ND5A 2V5UA 5SZJA 1GNPA 4I4NA 3FPFA 3HPRA 4QOSA 3ED5A 2APJA 1P18A 1PV1A 3X0DA 4KOAA 4A2WA 4MJLA 1TTQB 3BHMA 4YACA 3EVAA 2BBOA 2YVUA 3UKJA 3LQ4A 2C9YA 4MR7B 5HZKA 5CU7A 3AR6A 5F7XA 1E8NA 1J70A 1NV8A 5AKYA 2HT6A 3ZKWB 1E20A 2PS9A 2N42A 2VRCA 3HBJA 1BRMA 3ABIA 3EA0A 2BGNA 3E7PA 1MX1A 4N5MA 3AILA 3PGXA 4MW7A 2QRVA 2VDQB 4TTAA 1WB5A 4C0QC 2D2EA 2NO6A 4FD2A 3TX2A 1A0OA 5IVHA 1BWSA 3LUJA 5IH3A 3RTCA 4IIVA 3WSTA 5BR1A 4CEIA 4RA6B 5EMLA 2YV2A 1SOVA 4ZVOA 5E6SB 2QENA 2DHRA 4ZAYA 4CT0A 1VHTA 2IL1A 4I14A 5C1PA 2YS6A 2O8NA 2Q5IA 4Q21A 5EFZA 4I1IA 3OC0A 4GPIB 1L4UA 4QYWA 3GRAA 3UCFA 5L3SA 1V8BA 1NLZA 1XI2A 3A3KA 3BQNB 3QZUA 5AVSA 3W0LB 4NIMA 3CEPB 1UP7A 5DHFA 3AETB 1K9VF 1U28C 4JQZA 3UJPA 1RC8A 1LWOA 1PR6A 4N8DA 4OMCA 3RIXA 1PRYA 1E2MA 2V3VA 4G1CA 2IPLA 4OJYA 5DWQA 2XRZA 3ZW9A 4UTNA 4HT3B 2Q50A 2YXDA 3I45A 3QJ5A 4M8IA 2HMSA 4YECA 5KVSA 1KI3A 2XF8A 4TWJA 5CVDA 1TT5A 4KDRA 2ZUSA 3CUYA 3E22B 5FAXA 1MUUA 1LSUA 1RAHA 2O1WA 2IYVA 3H0EA 3PIIA 1LDBA 4Y6GB 4HG2A 3G82C 3AXTA 2P35A 3GXOA 3PE6A 2FSVA 2CUZA 3N58A 1O8CA 3K72B 4CMAA 2WT4A 2XRFA 4Z6KA 3UJ8A 4BNXA 4OO3A 3U3RA 4A4DA 2GFIA 1KEVA 3LD9A 2PD4A 3STWA 1DWQA 1T8YA 2QNRA 4W82A 2R47A 3KTFA 2ZYIA 3GLVA 1Q2UA 4Q7KA 1E9RA 2H4JA 3CRVA 4O5OA 4FS3A 4HGNA 3WLLA 2QY9A 1O58A 3AJDA 1FMTA 5D6OA 4I08A 3W79A 4EMSA 2QRPA 3BGIA 1DBSA 4DSZA 3ZGLA 3DL2A 4P7FA 1T3ZA 2VZLA 3BSFA 4OM7A 4IGAA 2OMKA 4HSEA 3VYSB 1W5EA 1YVUA 2OORA 4EPYA 4G8DA 3UB3A 4EVIA 2BHTA 2PX0A 3H83A 3WQBA 3NDJA 4IDOA 1NI4A 4RE6A 3TD6A 4TOIA 4RLQA 4X85A 1AS2A 1H22A 2QMZA 1KGDA 2EKZA 3C8ZA 4WNAA 1SN7A 3VNSA 3MM4A 1T8TA 1Y8CA 3N59A 5IAKA 3CLRC 4K6GA 1T9DA 5D85A 5BQ3A 1ZVQA 3SNKA 4G65A 2Z5GA 3L05A 1K6IA 1IPFA 1C9DB 4QGHA 4ZAZA 3MILA 4CKBB 3QWIA 3EPPA 4CUJA 4F85A 4A8JB 3DEAA 4CBVA 3ACCA 4EBFA 1LNSA 4B17A 5REQB 2IHJA 1NAHA 4MR8B 2NVWA 4JLAA 1Z2OX 2UVPB 2FPOA 1SPBS 2VKQA 3L1IA 1K7CA 1GNTA 1MC5A 4NRDA 2H54A 2FPRA 4LYAA 3QWFA 2AG0A 3D6NB 2HMUA 4C0BA 4XDYA 4MV9A 2UYGA 5JV5A 5HKBA 3IQFA 3JQRA 1ZRNA 5AT1A 1JBKA 4P38A 1ZUWA 3KUDA 1IBMB 1GKYA 3HABA 3RSGA 3HDHA 3JZIA 1E6LA 3C5VA 5AHWA 3ZXXA 1V7CA 3WIEA 4ECEA 4ZCLA 5CBKA 4P3YA 1SB9A 2FJUA 3VKHA 1M0WA 4BVEA 1DBRA 3PI6A 4LJYA 1WBBA 3RYCB 5B1IA 2JH9A 3SC2A 3L8HA 3AKDA 2XADA 3H2ZA 4YRBA 1AMOA 3EZGA 2O8EA 1W8IA 4EGJA 1WMEA 4G81A 1P4AA 4KN9S 2TMKA 3UC5A 2IOQA 5BNZA 3ZE0B 1XWWA 5BYAA 2ZS9A 3C39A 2R4UA 1QP4A 1M2OB 4AY4A 5MN4A 1F0NA 4GMKA 1HDOA 1JSRA 3TWOA 2PR2A 4MKRA 1ZD9A 1NMYA 2IYRA 4R2LA 5DX8A 4WY5A 1L5SA 4PXSA 4BO2A 2WICA 2G88A 4NS1A 1E6EA 1ML3A 1OBFO 3B5EA 4DLNA 4QT4A 3WRXC 3FWNA 4XWKA 4KUEA 4HVCA 1TAGA 4RH3A 4TKZA 4MPPA 1IXZA 2YYYA 4QTXA 3AI3A 1GUAA 4A0RA 4YMGA 1PUJA 2BTQB 2ERCA 3NTLA 4ZTBA 1AF4A 5HILA 4Y1RA 1KEEB 5ETJA 3PCTA 4AIIA 4AJIA 4HV4A 1QIJA 1Z0DA 3DAGA 1TNDA 3SC4A 4B47A 5DNCA 3PC6A 5M2QA 4B8YA 1D9XA 1O6BA 3BMNA 3E82A 3JQ9A 3AU9A 3DO6A 4NJEB 2JRBA 1JKFA 4OMDA 4UOEA 3PEWA 2PL3A 5ALQA 1CUGA 5CA0F 1XHEA 4F2DA 4O4HF 3L01A 3A6FA 4TMVA 3L41A 5T57A 4RV9A 1FLAA 2JK1A 3N87A 2C1ZA 3BILA 3F47A 1Y8QA 4W5HA 5CIYA 1PJ4A 1FMCA 4BWGA 1GFIA 1YHZA 3KLOA 2E6KA 1PDWA 3O3CA 1T9GR 1LC0A 4G0ZA 2EJWA 2H6EA 2R7LA 3NH9A 1CQIB 4NBVA 4XB2A 5SV2A 1X9GA 3VVCA 1K7FB 3A2NA 5BSGA 4ED9A 1K66A 2I67A 4QRIA 3DEKA 1G3IA 1BJRE 3BL5A 3EUFA 3ZVRA 4AZSA 5J2UF 1EX1A 4TV8F 2EBWA 4D9NA 4RGBA 1EZZA 3TBFA 1JH8A 3HKBA 1NX9A 2QWXA 3BX1A 2FUG1 3Q3IA 4G6ZA 2BM8A 3JAWA 4IOMA 4BFTA 2BGRA 2V5AA 2XCLA 2VF5X 5BPFA 5JCZA 2RGAA 2YV3A 3JALB 4JQCA 4MYCA 5KU7A 4QWWA 2ZWPA 2V6MA 1K06A 1WQ3A 4CG0A 2RHWA 4UDNA 4XZ3A 4MKHA 3U3XA 1H0SA 2QR3A 4GUDA 3L0YA 4QAQA 3H8SA 1AHIA 3DEHA 4D0LB 1DC3A 2W2PA 3KYDA 4YRTA 2O8FB 1W4CA 2G71A 2EL9A 2VF4X 3E4CA 2ZSEA 4KO4S 2JLCA 1I2DA 2H2FA 3C1AA 1K5PA 2OZKA 4UE2A 3BH7A 4FTWA 3C3YA 2F3RA 3BQ9A 3MELA 3PCXA 3GJ0A 2V9ZA 2BJVA 2RGNC 2BEWA 5D2CA 1IWPB 1NKTA 3GV0A 2WZCA 2OV2A 2JLYA 3HM2A 4FZ5A 2XUOA 4O1IA 3M89A 4O2BF 2RCYA 3IDAA 1NNI1 3ORSA 4JBWA 4U6NA 2Q5QA 5EZ5A 3ZDQA 2HN9A 4KVFA 3URMA 4CLHA 5JHHB 2C5AA 1MABA 4MWEA 1XZMA 4CG1A 1B0AA 4X8OA 2CL0X 1XROA 3KZNA 2I8CA 2HUNA 2ZREA 5HCNA 4C89A 9MHTA 4US2R 3I09A 3HFGA 4EGFA 4JBHA 1E2PA 3PLNA 4GVPA 5IKOA 5L6MB 2IP2A 4Q6BA 4O4LA 1KWGA 2JFXA 2P9QA 3N2ZB 2WM9B 3G23A 4B9EA 1VE1A 1M1UA 2SCUB 1T1SA 1DPGA 4N6GA 3OM8A 4TTSA 3UC9A 3REFA 2Z57A 2X14A 4D0GA 1CY0A 3GFBA 1JILA 3FTQA 4MVCA 2QRUA 4GW3A 1PFWA 4FYVA 2ZSBA 2HZBA 4BNKA 4RH0A 4QUKA 2ZS7A 4O1MA 1OXKB 1CY4A 2QB5A 1XP8A 1E3MA 4QODA 1W1IA 1FFGA 2X5JO 5TC4A 2X0FA 1FYVA 3DFUA 3LLVA 1YE8A 3K9WA 3TZBA 1KZ7B 1JEQB 1X2EA 3EC2A 3R5SA 3QPWA 3T1QA 3TSCA 5KHLB 4CKWA 4AX4A 1UBGA 1P0IA 4ERNA 5JI3E 1A7JA 4L85A 5JCOA 5ALJA 1KAEA 2IYXA 3TPCA 3DM9B 1Z7YA 4HXGA 3ND7A 1SBHA 1G3UA 2QRQA 1YC5A 2VRNA 2IUYA 3QU2A 2E2WA 3UATA 3VX4A 3ZUPA 2C7PA 1GCUA 3JQAA 5FWAA 4Y2RA 3TMAA 5J63A 2W8ZA 3JAKA 3PUZA 5FJIA 3U61B 2X8BA 2QX4A 1KU0A 4RL6A 2R0QC 1LPPA 1EGQA 2XE8A 4MMZB 1D1TA 3UMVA 4B5KA 3DO5A 4N8EA 1J5PA 5TX7A 2FSFA 2C4HA 4ZYXA 1F51E 2RKBA 3ZZTA 3OLQA 2P4SA 2HCRA 1ZK2A 1JJFA 2NOAA 2XVYA 2GKSA 2Q2VA 3EEIA 3OT1B 4JHXA 2J3DA 3QSYA 1C14A 1WEHA 1BVYF 1R2QA 2ODNA 4JWTA 3SE7A 1XDSA 2Q29A 2EC5A 3SKYA 5F2NA 2LD4A 3FGPA 3I6ZA 2OV4A 4OI1A 3ZHVA 4HDAA 4LBWA 3D1JA 4OXIA 4U5QA 3CCCA 4AECA 4GKKB 2AOUB 1NBIA 4XM0A 8MHTA 1JU9A 2AVDA 5H59A 3TM4A 2FZWA 2OCXA 3UHFA 5BT8A 2Q3FA 3PP8A 4P53A 3JTEA 1N4DA 4JP3A 3DFFA 4LJKA 1GJRA 2C2WA 2Q1XA 2Z56A 3PPXA 4HQ6A 2WZDA 3ROPA 3G5TA 3MTIA 4CMCA 3QHAA 3EVNA 2FPPA 1BTOA 3A4YA 1UM8A 1ECFA 3HJUA 3S0JA 4AK9A 4M1MA 4DA7A 3HMQA 1SCJA 2P6PA 3M82A 2F8TA 1E7MA 3FOEC 2P6OA 1T3SA 3WQSB 3AWIA 3S2FA 3TFQA 2OZLB 1BDJA 1ZU5A 1NMZA 1P8AA 2YHIA 4LYYA 4B3HA 5JYDA 1O96B 5K3SA 3TXXA 1S5PA 2FFHA 4L95C 2MJLA 1V16A 1KTIA 2NO5A 4MW2A 1B8UA 1J5EB 3OEWA 1NLFA 3U26A 5H3LA 2GARA 1N7IA 2JGDA 4XCVA 2PWPA 4FHFA 2MT9A 5IDVA 1NJGA 3DP9A 4M0LA 3KFXA 5EEGA 2DFVA 2IUTA 2CW5A 4ITVA 3A1EA 4RC9A 4AZTA 4PNZA 4QPPA 2PL9A 5ABPA 3ZWPA 2F2TA 1RM3A 1WM1A 3C6BA 4PC7A 1N5OX 1UT6A 2CMKA 2G7ZA 4I3FA 1G66A 3JATA 1JHQA 1JVNA 3TQIA 3E84A 1NQWA 2Y0PA 2Q9AA 2H3HA 3IAS6 5CUQA 5IXJA 2V3CC 5FTNA 1NT4A 1UDXA 2GILA 1ELOA 3WDKA 3JS5A 2FN9A 4IHAA 3SYNA 3PQ6A 1OXVA 4UVDA 4J9VA 4H7IA 3GG2A 2QD5A 2Z2JA 5EQDA 5FL7D 2ZU0C 3QVXA 5G3ZA 4E5VA 1OX6A 4D42A 4DQUA 3K0SA 3RAPR 2GMWA 5FWXA 1M0SA 1D2CA 621PA 1XSEA 3GX1A 4KR3A 5JJLA 4O4JA 1QYCA 4NLLA 5ICMA 4WTOA 2NU9B 1GY8A 1QE5A 3LMKA 4FDVA 3O1JC 2FSUA 3WC4A 3ULKA 1PAUA 4HWTA 4QU9A 2WFZA 4AP6A 4BVKA 1HT1E 4JJ4A 1JV2B 1XZKA 2ECOA 4OV6B 3EZFA 3SYMA 5JXGA 5JNUA 1FP4A 4XOUA 5FF9A 1NNUA 1WXHA 4NYJQ 5CA0A 3T3PB 2X2PA 4CM9D 5DZSA 2GS9A 4KL8S 4B76A 3VZCA 4DLVA 2DHEA 4NYIQ 2O8BB 2BEVA 3OBIA 3ONNA 5H7XA 3RSHA 2ECFA 1ZVMA 4KRXA 1B73A 3K6RA 4FDLA 4ZJPA 3ZVMA 1E1YA 2MSWA 3A1SA 1QK5A 2Z2KA 2OAGA 4HNQA 4WK2B 4BKOA 2R5FA 1CJBA 2BC9A 3UWSA 5F5NA 3E9NA 1MAUA 2NV0A 2HB6A 5DISB 2Z2IA 1LDNA 2Q7DA 4DWOA 4FR5A 1XTBA 2O7VA 4M46A 1C3LA 1ZW1A 3KOOA 5JS2A 3UMJA 3M4YA 1JL3A 4FGLA 1Z4LA 1E98A 4YRJA 1I4DD 1R6UA 5B2FA 1CEQA 1QMGA 1QYWA 4HQOA 4FP9A 3Q8WA 3LUDA 3PXUA 1ODKA 2YWDA 2DECA 2FWJA 2VP3A 4XXHA 5G02A 3BTOA 4FB5A 5IUNC 2UUCB 2WHXA 3ODPA 4NDNE 2KB0A 4HCJA 1VHWA 2W48A 3Q1KA 1YUNA 1Z25A 3K1TA 4GLLA 2QTLA 3STYA 3VR5H 5JZVA 2IS1A 3IJ5A 4YB8A 2IHUA 4DLPA 5IJ9B 1GTSA 1YDGA 4JEIA 3L4EA 5T4EA 2NV2B 3LFTA 3TZKA 1T2CA 1SWVA 2V6FA 3O2NA 1DADA 3B3AA 5AWFC 4EQ6B 3IHWA 3MBIA 4JJAA 3JQ6A 5JC8A 4REOA 2G1KA 2F9MA 1S2OA 3C3EA 2C5EA 3UHAA 3W90A 3IQZA 2CVQA 2FYTA 5AOBA 1QRSA 5TPZA 4D45A 1C3XA 2DUMA 3CKKA 1YDMA 3MAGA 3BRWD 4E1AA 4YRIA 1K8RA 2FK7A 5LU8A 2DFKB 1YONA 1L0BA 4IJUA 4QICA 2XGMA 3GF4A 3TE7A 3TZ6A 2C2ZA 3FSRA 4AMUA 4ZK6A 1D4AA 2ORWA 3NGMA 1DX4A 4HB0A 4PIMA 1KDOA 5AKGA 2FW0A 1Q7EA 5K3BA 2GYYA 1BDIA 5D00A 2ZUBA 4V39A 5DYTA 2QNIA 1T5LA 3OU2A 5DDIP 4MYSA 1D2RA 2O3QA 1ISMA 8LDHA 5C53B 3UHOA 3LHFA 2QJOA 1V5GA 4J4TA 3UH0A 2J9GA 5JMTA 1FFWA 1NXVA 4B32A 3IPAA 5JY6A 1SCUA 1Y81A 1A8UA 1AG9A 4G5HA 2JJMA 3MYRA 3RFCA 2YRXA 1V71A 4POOA 1T43A 3A6HA 3NT2A 4RENA 3NTVA 5T4BA 4E5UA 4YRSA 4FEAA 4CKCA 3FYUC 2QN1A 3AM5A 3TIXB 4Z54A 1MRNA 2FLWA 1GTVA 2XYQA 1YQQA 4UUAA 4DDHA 4MUIA 1S9DA 5FLKA 2F4NA 2YMMA 3F98A 2PGIA 1DHTA 1DUVG 1KGSA 1K7SN 1V7ZA 4LXYA 3U4GA 2DE0X 4YPOA 5IDXA 4FGJA 3OPYA 5DKFA 2ZCUA 3ND6A 5BUQA 1Y4SA 2OK7A 5HG0A 2WJIA 4HGPA 5KPDA 1PR4A 1WL8A 2YRWA 1OH7A 2JHGA 3DUWA 2I9PA 1MH1A 1SAYA 1E18A 4IDEA 1MAHA 1ZLYA 4LTNA 2REQB 5H02A 1GCAA 2P4EA 3RUHA 2AZDA 5KQRA 4P6VF 4MLDA 1CYDA 5LU9A 3LYLA 2J9ZB 5CVCA 3FOCA 1C9YA 4WOBA 2CJWB 3INGA 5KYWA 1MJNA 1WKBA 2Z83A 4OB6A 1JHRA 5LZ9A 1W4LA 5C31A 2X2FA 3LZ6A 1L4GA 2DH6A 2P9GA 5ENZA 3JAMA 5KYUA 2FY8A 3ITNA 1RTTA 1ULUA 2C4VA 3NI2A 4X45A 1P0PA 4WMLA 5KQSA 1I0LA 2FE1A 2B8JA 3AJEA 2D3TA 1EESA 3IBGA 1K4KA 1RRKA 5IEJA 2ZANA 5AKLA 4RPGA 5LXTF 5IVDA 1HETA 4DG5A 3HDGA 1YB1A 2R2AA 1RLOA 2JARA 3VAAA 1ZH6A 3OFJA 2POCA 2MR6A 5FBLB 3RO7A 5KOHB 1PEKE 1M67A 5LDGA 3ZY3A 4TYPA 4D8VA 4KFUA 5J2TB 3ZE8A 2C00A 4PAOA 4PYOA 1QG6A 4M0PA 4O4HB 1L5QA 3TH5A 3WL6A 4KVGA 4V0OA 4JX9A 4XLZA 4GPEA 2FOXA 4D02A 4GPAA 3AFHA 2IDMA 2HPVA 2Z1NA 1NOJA 3KSAC 1TF5A 3UT5B 2PT5A 3QBTA 4IIEA 2XR1A 4Y2XA 4JAVC 1N75A 1SR8A 3OMWA 4QPNA 4QUBA 4XFDA 2DPGA 5JT1A 2J45A 2Y92A 3ML1A 1NP3A 1YSCA 3N3BC 4PLYA 2JHPA 3TRIA 5LUBA 3ZU6A 2V0NA 2DETA 4CMBA 5IFKA 4W8GA 5G40A 1FFBA 1QKIA 1YU6A 4HEHA 5HF5A 1GUBA 2BFOA 5BW8A 1U2DC 3NAGA 1MG5A 2FF5A 3PRHA 1ISPA 4GI2A 4U7PB 1XVTA 4BP3A 1L7BA 2DJIA 2A9KA 3PX2A 4ZDIA 3I9MA 1OIWA 2HXSA 3HE3A 5KX5F 1CTQA 2G70A 3ETDA 1IY1A 3K71B 1FF9A 1KDTA 1UK8A 3AEZA 4D6XA 1W1WA 6NULA 1T26A 4DL9A 1LRLA 3UAWA 4I6EA 5K4HA 4P3PA 2H2DA 3NIWA 4UNIA 1GT6A 3OX3A 4FSXA 3EULA 3ZK9A 5C4GB 4HX5A 2QN8A 3V55A 3LO8A 1LDMA 1RWMA 3WS7A 4PPQA 4UVEA 2GN8A 1EDBA 3COPA 4E08A 3NH6A 2PE5A 5IZCC 2AFVA 4MRPA 5DLPA 3NHUA 1ILEA 2WUWE 4IGIA 2X1VA 3DEIA 5EWMA 2ZYDA 2BR3A 1TVEA 2JRCA 4AKGA 2XB2A 5EJGA 2EZ4A 3DV2A 5FADA 3W8NA 4OQFA 1PFKA 3VI4B 3N1UA 1ZGBA 3QNWA 3MT0A 4RA9A 5EIWA 3WLJA 1UEIA 4D4LA 4O2AB 5EP3A 3STHA 2DY0A 3UN1A 5ICSA 1TTTA 2C1EA 4S3MA 4RPHA 3EEQA 4FWTA 4IYJA 1UPXA 3DQZA 3E5HA 4CM7A 1OC2A 4RWEA 4HF7A 2QVCA 5EXPA 4ZV9A 4IQ4A 5HDQA 4CHGA 4E70A 3OJXA 3BRSA 5JFGA 2DR3A 3CC8A 3EK2A 3MWJA 5GVRA 1NNEA 4TRNA 1N8NA 1IJKA 5ALEA 1XBTA 1W96A 3YASA 2WLTA 2YUIA 1ZIDA 2UZIR 4G5XA 4DMGA 1ZMXA 1AM4D 3C74A 3QVJA 1N77A 2Q4BA 3FZNA 3HPQA 2HEIA 2XCQA 4ZHQA 3P0JA 3X44A 2JFHA 3NC0C 1GFWA 2E85A 1AGRA 3TW8A 1K1EA 1KAQA 2CF6A 3OY2A 2YIVX 5TEWA 2NV6A 3ZZNA 5G4KB 1E89A 2IYLD 3H1BA 1HV8A 1DCMA 4ZVVA 4LHZA 2O0KA 3HJCA 5FNVB 2JGLA 2XAUA 3SM3A 3R0QA 4LF8B 4EW2A 3U7EB 3R76A 2WIGA 2WWFA 4RETA 3AETA 3F6SA 3OEEA 4ID9A 3RK1A 4EJ0A 2E82A 1CRLA 1GGMA 1M7GA 4GPZA 3AEKA 5FOUA 5A6SB 5KYGA 4ES6A 2NUPA 5AHOA 1J56A 3WB9A 3CX8A 2R8OA 3FNHA 3U80A 1NXTA 4ALMA 4G67A 1H2EA 2VJLA 2QN9A 5LXTB 1Y37A 2JKVA 3W6ZA 4ETMA 4OU5A 5AUNB 1JXQA 1L5WA 5CLHA 4L8VA 4KHPB 2HWXA 2O2HA 1GKIA 4HZUA 1YR3A 4MQFB 3N2KB 5KJFA 3LT4A 4LXUA 4LHYA 1CLEA 3ZBTA 4OIFA 4Q02A 1DGQA 1BXKA 2C3PA 3T3EA 1C4WA 1A7KA 3R0JA 4EY8A 1JE0A 4PSAA 2RAPA 3GPDG 3QKUA 1KSJA 1K0FA 4BXOA 4QUHA 2FW1A 4Q9NA 1L4EA 3TPFA 1KBQA 2F59A 3ZCPA 3NBZC 2P2SA 3FMGA 2HBZA 3J7TA 4R1OA 1VLHA 2R5WA 3MAAC 2YZNA 3IAAA 2IUUA 5C5CA 2HHCA 1LD3A 3C6XA 4KW7A 4EARA 1GPLA 2IBMA 2PUHA 4O4JF 2OZVA 4QUAA 3UAXA 3TECE 1ESCA 4EMTA 1XXHA 3BFKA 1M8FA 3UWMA 1EK2A 1EHIA 3CXUA 5IM5A 3O5AA 1YDWA 3O9MA 1GRNA 4RIGA 5TPZD 3KZXA 1G8KA 1U2SA 3EXFA 1NFQA 1U9JA 2LZ0A 1Z16A 3I72A 4YRMA 2R6DA 4WD3A 1RJ9B 2Q3EA 2PGNA 3E9YA 2OHGA 4RFSA 3U7HB 1QTRA 4F4CA 2BMDA 2BT4A 3QFCA 2VNJA 1I1OA 5DOZA 1MB3A 1XCGB 1QTNA 4FXPA 2VWPA 2WJHA 2BEJA 2ZIGA 4Z86A 3IVGA 5AK3A 3QOFA 4DMMA 2FDCA 2B1JA 1YJ5A 3EIOA 5CX1A 4X7PA 2IX3A 3N8IA 2HV8A 3A31A 3FW1A 3KOMA 4MV6A 3Q7RA 1B2RA 1CZNA 4FYMA 5DYGA 1QQ5A 1ZOLA 5EJ9A 2C98A 4WECA 2C57A 2YVLA 4IPTA 4QGSA 1DDGA 2FQWA 2J0VA 3OZSA 4DA8A 2WFLA 4BJ5A 4RK4A 1Q7GA 3KXDA 3O0TA 4FINA 3OPVA 3B3FA 3U5TA 4BGIA 3U7QA 3PD7A 2IJGX 5IS2A 5AI4A 1GPNA 3D5EA 4P0PB 4D81A 3PDHA 3W5BA 4P92A 3T5PA 3GRPA 3Q15C 3S8MA 3SNHA 1J0XO 4CL0A 3CKYA 1N9ZA 1MJFA 1GQOA 2YBEA 3CCBA 3VUEA 4JI5B 1Z34A 4HMQA 1UBRS 1YAHA 3ST7A 3V8RA 4H1VA 5G0TA 4AZVA 4BVJA 3UOWA 5BPHA 1EEXB 4IUBS 4GMDA 1LX7A 4G25A 3FDZA 4HS9A 1IEWA 4JC0A 4X1KA 1KY5A 4PTLA 5FR1A 4NFYA 1XMIA 4PXYA 4LQCA 1VI2A 4LZNA 4D5EA 3G8CA 1N5JA 2WOOA 1T6BY 2Q3MA 3DCIA 4PIVA 4PGGA 1VA4A 3NBKA 4QVKA 3GT4A 3O9ZA 2CMDA 1YMQA 4UARA 1SU6A 5EXXA 3Q8MA 1F4PA 1OB2A 4C2UA 2AN5A 2IBTA 2XRMA 4XR4A 4MO2A 1XCBA 4ZCSA 1A9OA 3V42A 2NUAA 3RKRA 3TTVA 4JKIA 3CJRA 3CIOA 3ADDA 2FFJA 2IYWA 2G7MC 3PUVA 1E2IA 2R8BA 3OM1A 3PDUA 4MQ4A 3KWLA 3DAOA 4JJKA 5TT0A 4B6QA 4E88A 4FHDA 4EHIA 2ATEA 3SVLA 3LW8A 4XRRA 1F6BA 2CDRA 4ENPA 4QM6A 1NG1A 4BZXA 4WX2B 1QVWA 4CUZA 1S0UA 2IS6A 3KQOA 2GZRA 2DKFA 4V38A 2W2LA 3I52A 4PQFA 4MLPA 2LIVA 5DTMA 5AM3A 2IWRA 1KORA 2EEZA 1WSWA 2YKGA 3I9V1 3KZ1E 1PJAA 3N8HA 5AK6A 5IX8A 2FPIB 1DJPA 2QM0A 1WCV1 2LIPA 1M8KA 1QHHA 1A2QA 3GP5A 2W6PA 5TMEA 3H1FA 2YWFA 3G5LA 1IIBA 4LZJA 4AY5A 4ZYWA 2MDTA 5FV4A 2VPXA 3GCZA 1E2UA 4GLBA 5JW6A 2MMCA 5CFMA 1K68A 3CA8A 5B37A 5E3JA 3GUZA 1MB0A 2QHXA 3P1JA 3RF7A 3AY6A 4BRSA 5BMVA 5K8IA 2G67A 3ZHQA 4RJJA 1FNNA 4GZ5A 5JBQA 5BOSA 1NBWB 2BEUB 5BRAA 2CXQA 2IHYA 2RHCA 4K05A 3WLQA 3H04A 2E9SA 4D9JA 4G0VA 1M6EX 1YGPA 1AHNA 1L1QA 2Q27A 5JPCA 4U2FA 3GL9A 2HJWA 2YHUA 4LJSA 2XYVA 2FEAA 1YA4A 1LQ2A 3KS9A 4B2YA 1SOWA 1KVQA 1EA5A 3AR7A 3HB9A 3OZUA 3QEJA 3EXHC 1WY7A 4QJ4A 4C7VA 4F5EA 2QMQA 3ZCXA 1X80B 3ZQ6A 3JVUA 3IUEA 2PT7A 4GDMA 3C6ZA 2X7JA 2BGJA 4KPUB 4B80A 1QF6A 1L8AA 1AJEA 4BQRA 1AQLA 1SA0B 4PCUA 1IM2A 1RZVA 3HO6A 4YN3A 1DFGA 4BQQA 1QQBA 2KJQA 3GNLA 4DC9A 2VDWB 1V43A 2FLKA 3QIVA 4TQGA 2WP0A 2I6UA 1MDFA 2JIOA 3P9RA 4QQKA 4RVOA 2QW0X 3ZCVA 2BFBB 2UVQA 1UM9A 4PZEA 2RI6A 3WRVA 4P7GA 4XGIA 3CVOA 1EWVA 1ZRHA 1MX5A 3HKCA 3VZQA 1QTQA 5DHTA 4ZRDA 4BNJA 4MQ6A 3TM5A 2TRSB 3QMVA 1RLTA 4M99A 4AQ7A 5KOJB 4XQ0A 2V5VA 3NQ41 3T4UA 2CLMB 2L19A 3D2AA 4M1ZA 3JVEA 3WGJA 4RIEA 1RBYA 2GN4A 4AKHA 4XD7D 3EDCA 5FYDA 1RACA 4KMMA 1NRXA 4R9UC 2VP6A 4TTRA 1ZH4A 1R6VA 2N3ZA 4WKGA 2YC2C 1UDRA 5B1EA 5F3RA 5CFQA 3TG2A 1CEYA 3PQ7A 3IAXA 4Y9SA 5D3MB 2VAVA 4OP2A 1GKUB 4DBLE 3P2JA 2I71A 1YBAA 4UHHA 1XJWA 2Q3BA 2CUNA 3CPJB 1KJ9A 2CDCA 3X2EA 1U2RA 4O4LB 5BSVA 1XMJA 1FB5A 3OLYA 5HZGA 4QLOA 1AIPA 3WYGA 4ER7A 4CYMA 3CX3A 2FE4A 2YQ5A 1DAGA 4WXEA 4MROA 1TQ2A 1GR0A 5HDBB 3HK2A 3HC7A 4HAVA 4J90A 1J9ZA 1GNRA 4FHGA 4EECA 4QOJA 1K2WA 5EE3A 5SYNA 1SUCA 3SMVA 4HFMA 1BKSB 4O1HA 5BN3B 3K70D 3ZBUA 1CB0A 2GPWA 2EJTA 4R5HA 4WN9A 1N2CB 1XDZA 2VUTA 1L8XA 3DWEX 3ZDAA 1YHYA 5KJ1A 1JKJA 1ANKA 3IEKA 3S27A 1JPJA 1KU6A 1U3VA 2AG1A 2OHHA 2VAWA 3SR3A 4A0FA 1EFLA 5ESWA 4C07A 1U1GA 4PV7A 1I0ZA 1OAKA 3PC2A 4UCQA 2EFYA 1T9HA 1GG5A 5EUCA 1O7JA 2GTIA 3SEAA 1LTKA 3MCWA 3P2YA 3HCAA 2PH3A 3ABZA 1UZMA 5KTYA 1VMKA 1NXQA 3B3JA 4MVJG 3HJHA 3UK6A 1NV9A 3JQAB 5E0KB 2QI9F 4EG6A 1Y8RA 1N0HA 4G09A 4WPGA 1A3CA 5LPNA 1CR2A 2J3HA 1Z47A 3FFBA 1CC1S 3WLRA 1XZIA 4RJTA 4NBNA 2JVIA 5F78A 4B73A 2AB0A 3USCS 5JHGB 1R4NB 3LXRA 3CKMA 1DIOB 1J8DA 4WGGA 3C3CA 3JVVA 1EUZA 1JW9B 1TZMA 1DLJA 1GU7A 2EJBA 3KOXA 2PVPA 3OLWA 3MQFA 5B3AA 3W7BA 1XRPA 4HLUC 4JIGA 4JY7A 2P6RA 3UYLA 1ZINA 1II8B 1K8ZB 1PLKA 2MR5A 3GYBA 1JMVA 1NN3A 2PNJA 2HDOA 1FDRA 2R7NA 5DN6A 4CGZA 1ZGCA 1PD0A 2CB0A 3EIXA 4X6XA 3KQKA 4F8JA 4G86A 1BN6A 1D5WA 4JLBA 1IHPA 2BELA 3SK0A 3B9QA 1RQ7A 3QQ5A 2O7QA 1VB5A 3VYRB 4A5SA 5EIBD 4TWBA 5GJVC 1DJQA 2BDTA 3NO4A 5GAJA 3RGWS 3CUSA 3TW0A 4YPVA 3FSEA 2ORYA 2AG6A 3MVEA 4D9FA 4YGYA 1UFVA 3DBVO 4IDQA 1K3UB 3PWKA 3TVYA 5DK4A 5FO1A 5H82A 3IVAA 3OP4A 2DAPA 2HIHA 3I1FA 2JB9A 4M9QA 3L82B 4W8OA 5A5GA 2P41A 1WABA 4FCCA 3G2PA 4ZDKA 1EUQA 2J4CA 1YZYA 5AKIA 4FKBA 2ZI7A 1ADCA 4MW5A 3OM9A 2FUKA 2FFAA 3IT2A 1JFLA 1MOSA 3V2UA 1YTUA 4MP8A 3W78A 2YV5A 1RJDA 3P9KA 3PPWA 2XUAA 4Q9JA 1MIHA 1T4GA 1AN9A 4OK6A 3UJ6A 2IEYA 2Q6VA 5I8WA 4YAJA 1ZCFA 4AP5A 4A2CA 1C2TA 1G6KA 2ZRGA 3KUUA 3PVSA 4ILKA 1NRWA 2WP8J 2YVAA 1U7WA 5JTTA 1MAVA 1IMJA 4PAMA 3V3TA 2JGAA 4MW4A 5UKDA 4N82A 4GC5A 1BXRB 1JA0A 1R6BX 4R3NA 3RFUA 1JALA 4G63A 4OEHA 5HXAA 4KR6A 2PH5A 3SFVA 2C61A 2O0JA 2ZI5A 4Q03A 4ZI7A 3F90A 2NXJA 2M1ZA 3M2TA 4PSDA 5FTJA 5DXJA 3H84A 3KPYA 3AM1A 1GADO 4QA9A 2GCOA 1QE3A 3DKRA 2GFQA 1Q57A 4JMPA 1I5EA 1JP7A 1QFSA 1DEAA 3UK2A 4DV6B 2V6GA 1YUBA 2IYFA 4NK5A 3S99A 3MT8A 1UKVY 1O1YA 3U13A 1YE3A 1YQWA 3KJEA 2NVBA 3T5GA 5CYGA 3PD1A 5LQKA 3X3HA 1ZCJA 4I6JA 1TKRA 3PA8A 3LLUA 1USGA 2HWYA 1UDBA 1NYLA 3PPIA 2GJ8A 2HMVA 3E9RA 3L1VA 4KLNA 4QATA 5E38A 1YOBA 4ZZIA 5JYCA 2NXNA 3TLCA 2Y77A 1U7PA 4NNJA 5KBYA 3LYUA 4ESVA 3CZ4A 3NBFA 3THWA 2GAIA 2EKQA 3CH6A 1ULHA 3IKVA 4P7JA 1ZJWA 3ETCA 2WIFA 3H8VA 3ANSA 1CZUA 4CFYA 3L4SO 3IQHX 1FP4B 3B2QA 3E9DA 3I9OA 4N7MA 4GF5A 4JU8A 5ALUA 4ZAXA 5HCUA 3F9CA 4C5CA 1TUBB 3G2NA 3UJ7A 1K3F