4PO8A

Mycobacterium tuberculosis reca glycerol bound low temperature structure iic-cr
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
326
structure length
306
Chain Sequence
PDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTGGKALKFYASVRMDVRRVETLKDGTVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 96
structure length 306
sequence length 326
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4po8A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4po8A01
1DG3A 4B35A 1NP6A 3AVXA 2EVWX 1OFHA 1Z47A 2Q9BA 1M34E 2QA5A 5BQ5A 2ZE5A 4WAUA 3PUXA 2YOHA 2ZE6A 2GF9A 1SVIA 3EAQA 2F3TA 4IOJA 1MT0A 1Z0FA 4UXHA 4TQAA 2CNWD 1CIPA 3KQLA 4Q9LA 1DAKA 3W8RA 1UKYA 5DO9A 4RD2A 1N6PA 4AKHA 5B58C 2NO7A 4S35A 1C4OA 3EZ2A 221PA 2R6DA 5CLQA 4HUTA 4RD4A 4RCYA 4C0JA 1J70A 2ZVPX 5AJXA 2FG5A 3G82C 4R98A 4OQFA 1LV7A 3TUZC 3EX7C 1AM4D 4A0FA 5JBQA 3K70B 5F3WB 1OH8A 1KDTA 5JJLA 5FPSA 1GSIA 4XD7D 2IYRA 3EIEA 2CHVA 4D4KA 2OAQ1 1SXJB 3WNBA 4FMDB 2GCOA 4DIEA 2WWFA 5IK2D 1EFRA 2DFKB 2G9NA 3K0FB 3BB1A 2P5SA 2IYQA 3ZLJA 3W6NA 1CKEA 1JALA 3ADKA 4KXFB 4CVNA 1TQ4A 3C41J 4V0MA 2BIFA 1HE1C 1XJ0A 2ZPTX 2O8FA 1NIPA 2X8AA 1SKYE 1TX4B 3BB4A 2ATXA 1XTIA 2D3WA 5J4VA 2W0SA 1NI3A 3KZ1E 1T6NA 2X1VA 1D2MA 1F60A 1AGPA 1NVUQ 1PLKA 2F43B 3TW4A 1TF5A 2QAGC 3SYLA 1KNXA 3WBJA 4Q4JA 4EJSC 3QNUA 2LKCA 3AEZA 4TLDA 2ZETA 1VIAA 1OYWA 1JJ7A 3B60A 3FHCB 3Q8XB 4ZKDA 1SVOA 1OV4A 2BCJQ 1VG1A 2GNOA 3AM1A 3JZAA 1XCMA 1QVAA 4JBWA 2DY1A 2VP0A 4RZUA 1OYYA 3TE6A 3EWAA 4ASUA 4US2R 3U60B 1G4UR 2WWGA 2CLCX 1ZM9A 2R6CA 2ORWA 2CCKA 2JJ8A 2ZSEA 3NBZC 2FZ4A 2O0HA 1N5KA 4Q7JB 5FTNA 2Y8EA 2H18A 4QC2A 3FKSD 3AF1A 5G41A 3QKSB 4AWXA 1D2EA 3F8TA 5FUYA 5DI3A 3UK6A 2MSCB 5DYIA 1GKYA 1CEEA 1VCMA 4R9UC 2FPMA 3WRYC 2QAJA 1G5PA 2IYSA 4BZXA 1Z6TA 1IXZA 1Q1QA 2QSYA 2IWRA 1S1CA 1GG2A 1G64A 4YMUA 1E96A 2QL6A 4RFSA 3GLHE 3RLFA 4GSYA 3TMKA 4MYHA 3L0IB 2FFAA 3KKPA 4TL8A 5BN5A 2IYLD 2DWQA 4M8NE 3T15A 2VP4A 4LWZA 4IFEA 1E1RA 1XPUA 1CJTC 1QG2A 2A5YB 3UG6A 4L9SA 3ADDA 4PZLA 5FBQB 2IXEA 1AQYA 4XVQA 3CX7A 3SDZA 1XEFA 3UPUA 2NO0A 1TUEA 1II8A 5EZ5A 4CIDA 4G5GA 3RVBA 3GLFB 3FFAA 2NMVA 1UBGA 1G5RA 5E4FA 4RZ3A 1MO4A 2YHSA 4W5WA 4Z8YA 3P26A 1G3MA 4RZXA 1VYUA 1XMJA 4YONB 4CEJB 1TNDA 1MABB 1P2UA 4NYJR 1M1YE 2WVJA 2F6RA 1N6OA 3H0KA 1A2BA 2G88A 4M1OA 2EFEB 4PC1A 4NU0A 1TQDA 3P4YA 4HEJA 2WM9B 4MGKR 4X8HA 2EWVA 1WF3A 3LQRA 2JDIA 1Z6XA 3THOA 3A4LA 3V9PA 4BLPA 2WJYA 4QJ3A 4HB0A 1XRJA 3KKMA 1CU1A 3OFNA 5A4JA 4JL6A 3RS0A 3L0OA 5BYJA 2FSGA 3K0AB 1XD9A 1ZJ6A 2BKUA 3Q7PA 3EZ9A 2O0JA 1SVWA 2Q3MA 5SZKB 1XXHA 1EFHA 1IQPA 1E9DA 2WWHA 1W49A 1U0LA 5FPTA 3WHKA 5K8TA 5IRCD 3FMOB 1RZ3A 3MWYW 3ZQJA 1BOFA 3VU9A 1ZM4A 3T1QA 2WHXA 4P3YA 4IVQA 2CHQA 4FN5A 1AS0A 4PHGA 1H8HD 1KSHA 1W4RA 4CDGA 3SNHA 5HKKA 5EXPA 1DAMA 5IF9A 5LDDC 4WIAA 3VTKA 3LDAA 4DDUA 1CRQA 2YOFA 3KB2A 1BIFA 1YU9A 2WOOA 2R8RA 4C2TA 1JAHA 5FUXA 4QL3A 5DLQC 3PENA 2JLQA 1U90A 4OQLA 3WY9A 3ZS8A 3WYGA 3GJ4A 1DARA 4L15A 821PA 2JLUA 3I73A 4PPFA 4PO8A 3LLUA 3LLMA 4KFSA 3LY5A 1FFHA 3MWLA 1TADA 3QPVA 4LK2A 5LD2B 3GMTA 2DYKA 2R2AA 1K6MA 2JJ1A 1XF9A 4LPSA 2XITA 4PX9A 4XIGS 3ZVMA 3C4JA 3GQBA 1IN5A 1DVRA 2P0EA 4OHWA 2ZANA 2ZIAA 2O0KA 2A5JA 2BM0A 4HAXA 2F1JA 2VF8A 4RD3A 2BEKA 4WXRA 4WVFA 4BWYA 3CBQA 5JHHB 4HLCA 3KJEA 4K46A 1VYVA 1ELOA 2Z83A 3GLIE 1XJQA 5CLLA 2KE5A 1ZUIA 1AZTA 4W5HA 4A8JC 4NYJQ 1XEWX 2O8FB 4A6PA 1OJLA 1YQTA 3ASYA 4V0KA 3SJAA 2ZR9A 1H8ED 3UMSA 3DO6A 1YJ5A 2ZI6A 3GCGA 2AFIE 2E9SA 5LBIA 4GDFA 1AKEA 2FGKA 2W58A 1Z63A 3KDSE 3VNVA 4Q4JB 3VR4A 1R5BA 3CPEA 3OIUA 2DFTA 2AK2A 4XVRA 4ZI2A 3DZ8A 4CT5A 3BXZA 2BMJA 3DKPA 4I81A 4ZKEA 2AXNA 3EW9A 4Q7MB 1NNEA 2ODEA 2XZOA 4MKGA 4V0NA 1KK2A 2YNMA 3H84A 4TYPA 2EYQA 4W5JA 3QBTA 5FL3A 4DT1B 1WB9A 4PTLA 1GNQA 1QZXA 4RD6A 4FWTA 4NCHA 3UWKA 1OLOA 2QGZA 2ZI3A 4HDQB 3DDCA 2ZJAA 3QENA 1Q12A 4YXWD 3Q9LA 3TR5A 1HH4A 4YLGA 1Q57A 4Q5IA 5DI3B 3WP0A 5EXTA 3X1XA 2QMUA 2IUTA 2SHKA 2GA8A 3X1DA 1WP9A 2C78A 4LHWA 1KDRA 2XB4A 1KZGB 1W36C 4F92B 4N1AA 3HU2A 3CR7A 2W2XA 3WNCA 2WIBA 3EARA 4B74A 4C0HA 2O8BA 1J8YF 3IPXA 3U7HB 4LHXA 3CRMA 4KV9A 4RFSB 3K0CC 5AK0A 3H86A 4RJLA 3NH6A 3IPYA 1DAFA 2BDTA 4MGIR 2GHIA 2ZYVX 4LV8B 1Q0UA 3RS4A 2HJVA 1F3OA 2QTHA 2FJUA 2C5LA 1JR3E 4URZR 2PLFA 1R0XA 2ZRDA 1S9DA 4AYXA 3CZQA 2WKPA 1Q1EA 4O2RA 2P6NA 3K53A 4M22A 4ZO4A 3TGPA 3BWDD 1GAJA 2CL0X 1VIYA 1P4SA 4QM7A 3LAWA 1E9BA 2ZRLA 3FE2A 4R7ZA 1OSNA 3GFTA 5FOTA 3GJ7A 4NH0A 2VL7A 2ANCA 2WJIA 5UKDA 421PA 4KHZA 2CE2X 4QJ5A 4LJ9A 2P2LA 4IJMA 1OFUX 3ZZTA 4TLBA 4IVPA 5BN3A 2JATA 1IAQA 4FCWA 2DR3A 2P6RA 3TRFA 1G8YA 1KY3A 3EC2A 1HQCA 1XEWY 5KOYA 2RGNA 3FHOA 1BYIA 1KK0A 4G5QA 4C4PA 4TYWA 3QPUA 3K9LA 4II7A 1G7TA 2GRJA 4CEIA 3AKYA 2B21A 3EXAA 5SZIA 4FMBB 4PFSA 1IOZA 1GITA 2G0TA 2G6BA 1W0JD 1I4DD 1ZD9A 2FFBA 2D2EA 2GJKA 1GVNB 3RABA 1BMFA 1Q3TA 2FZLA 2WWIA 3NG1A 4QFMA 4LJ5A 2OAP1 3BBPA 1Z6YA 2OSBA 2YKGA 2X2FA 1GDDA 1UM8A 1BKDR 1KO1A 4NZYA 3K1JA 3SEAA 4X8MA 1AZSC 2CJWB 3NBFA 4JVMA 4HLUC 2PCLA 3QXSA 1OHHA 3HYRA 2A9KA 2IK8A 4IEIA 5CYOA 1T4GA 2G1JA 2CLDX 1E69A 4F7WA 4LCBA 2BEJA 1MV5A 3KJIA 4P4SB 3ZVRA 3CPHA 1M8PA 5G3YA 4AG5A 2IS4A 1F5NA 3RRYA 3THXA 2XOKA 3U3MA 1G41A 3VX4A 4B3BA 1WRBA 1P72A 2BKEA 1G4AE 1XTQA 2HCBA 4V0LA 3ADBA 3OEHD 3W3AA 1JQJC 2R6GA 1GWNA 3O8RA 3ND9A 4LZZA 3GJXC 1FUUA 3AB3A 2FEOA 3V00A 2KB0A 1ZBDA 2VLIA 4DLTA 1P2TA 3ZVNA 4OI4A 1OH7A 5CK4A 3FMFA 3KXLA 3VFDA 2RAPA 5CM8B 3BD9A 1D6JA 4DRZA 2ZRGA 4DLWA 2AKYA 5J4HA 4PC7A 1DO2A 1P7CA 3THWA 3VR3A 3CPJB 4G5OA 1G9XA 1R8QA 1S3SA 5K8LA 1U98A 1XPOA 3R8FA 4N0DA 2H16A 1E2EA 1ZNXA 4LBVA 4OHVA 3J81k 5JEEA 3T34A 1OW3B 2ORVA 3EPJA 4DWJA 1KMHA 2HUPA 1N6HA 1VCOA 1Z0JA 3HDTA 3NHAA 1HA3A 4OHXA 1YE8A 2OZEA 2GK6A 4D82A 4ZDJA 2OE2A 3AUYA 1E4YA 1Z2CA 3BFKA 1NVWQ 1NLYA 5HCNA 2FSFA 2CEAA 4IXMA 4JLMA 1V43A 4A2PA 2O5VA 2HYIC 1JAIA 1GFIA 2ZR7A 4IOKA 3DOFA 4UJ3A 5JRZA 1VG0B 4E07A 1K5DA 4URWR 1VPLA 3W5IA 1U8AA 5FFMA 2IYTA 1OE0A 4H1UA 4CGZA 1ZU5A 2ZJYA 1O3YA 1Z0KA 1U2RA 2GEDA 3ICQB 1BYUA 3GPLA 2ZJZA 2QI9C 2EQBA 4P31A 4FINA 2G1KA 1UJ2A 3MWKA 3RS7A 1PLLA 4C3ZA 2AK3A 1DAIA 2RGBA 2WJHA 4B3FX 2J1LA 3CX6A 4BLQA 1PJRA 4AKEA 4GP7A 4OJKA 2QN6A 2XTNA 4Q4HA 2FH5B 1GOTA 3K9HA 3WRXC 2FEMA 4RFVA 2DB3A 1W0KA 3CM0A 3CO5A 2AX4A 2ZUDA 3T1OA 2ZU0C 3O8BA 3BGWA 3PEUA 1G3RA 3CWZA 4DHEA 2NPIA 5FBLB 5EP3A 4BE7B 2BMEA 2WV9A 3G5UA 5AR1A 2YZ2A 3GJ6A 4OK6A 5DN6D 2XTMA 3L43A 3PXGA 1TTTA 1EG7A 1VCNA 4OHYA 3PR1A 5FOVA 4PXAA 2XZPA 1ANKA 2ODBA 5DNYB 1AS3A 1UKZA 3L0PA 5LPNA 3CKLA 3HU1A 4XSGA 3OIWA 2F1IA 4ESHA 2CK3D 4D26A 3TSOA 4QNMA 5K8UA 3I8SA 3E70C 2ZJ5A 1XMVA 3ZVLA 1NY6A 1HQYE 3LW8A 3QKSA 3AP3A 3QPWA 3HJNA 2MSDB 4MRPA 1UEIA 4IEEA 4JLKA 1SXJE 1FQJA 1KK3A 2QU8A 3PV0A 4Z1MA 1TEVA 4KODA 1GL9B 3TQCA 2IX3A 1ZIPA 2XAUA 5FBRB 4XD7A 2BBTA 4UXJA 1Z0IA 4HAYA 4HAZA 2EU8A 2HDNB 4P4TA 5IK2A 2GDJA 4ZV4A 1T3SA 2V8OA 1KGDA 4URUR 1RRCA 4CEIB 2GEUA 4QXAA 2IS2A 2FSIA 4BASA 2ZS9A 5SZJA 3ZS9A 1W44A 1OPXA 1KO5A 1XB2A 5A5GA 3IIJA 5JI3E 4QM6A 1L7VC 4TQ9A 5KDOA 1DPFA 1MH1A 1S0UA 5EUMA 4QRHA 1E1QA 2C77A 4OQXA 1GRQA 4YQFA 2QY9A 4OBEA 1ZAKA 2DBYA 4ZCMA 1YZGA 2VSFA 1I4TD 5AUPB 3OEED 2W6JA 5L3QA 4IDQA 4PSVA 2XSZA 4JIMA 4OHZA 4ZCLA 1XD8A 1FQKA 4GOKA 4PAOA 5AJZA 4GNKA 2ORIA 3THXB 2GXAA 1NVVR 1TPZA 2ZRKA 1MO6A 4BRWA 1NSTA 3A1WA 4MRSA 4LYFA 4E22A 3I72A 3QXXA 3UMRA 4PPNA 2V3CC 2D7CA 1ZUNB 4ARZB 2ZXUA 4I1VA 4BGDA 1AS2A 4MYTA 4BQSA 3UKDA 3FKSA 2CVHA 1CULC 1NN3A 1ESNA 5IHPA 5DI9A 4LI0A 4MA4A 3JVUA 4JVLA 3U4QA 1KJYA 4F93B 4H9GA 4IDHA 3ZIAD 1RIFA 4BFVA 3GFPA 4MRRA 3TR0A 3R9XA 2PZFA 3PUYA 4GOJA 1YZKA 1U0JA 1P2SA 1RYFA 1X86B 3QXHA 4OQNA 5CK5A 2NQ2C 3R9WA 2IUSA 4EPWA 2AFHE 2ZRHA 1Q20A 4HZIA 3QEJA 1JI0A 3GLFE 5CDFA 4YMTA 4NCNA 4LRWA 1T0HB 2PL3A 2EFCB 1KMHB 3B78A 1SQ5A 2OLKA 1ODFA 1SVSA 2Q6TA 4LHZA 4OI1A 4OI0A 1M7BA 4C0KA 1GZSA 5JWRA 1GTVA 1GILA 4MRVA 2MMCA 4R2IA 2OESA 1FP7A 2V1XA 1WCV1 4ZIRB 2J87A 3HU3A 2KSQA 1QHGA 2DFLA 1KI3A 1U8YA 4TL9A 5DE3A 3I5YA 1FW6A 5KO2A 1Z6GA 4KLZA 4NYIQ 3MCAA 2ZRNA 1P75A 3TVDA 1NBMD 3LXXA 2JGNA 3C5HA 3GJ8A 4FI3C 3W34A 3DOEA 3K9NA 1CJKC 4CT4B 4B2LA 1E2QA 4URYR 5FPYA 1MO5A 1I4LD 1W7AA 3EIHA 3BRWD 2Q9AA 3A58B 4Q1DA 4BLOA 2ZS8A 4BEJA 4LY6A 2ONKA 1E0AA 4QNRA 3CONA 1P9WA 4JKIA 4XWOA 4D4LA 5JWOA 1OFIA 2ZQ5A 4Q4HB 1OF1A 2PJZA 1NVVQ 4ZDIA 1KI7A 4DSNA 3B1YA 3W6OA 4JLPA 3AH8A 4WW0A 4C2UA 3NEJA 3TLXA 4Q21A 3GLGA 5J4KA 2RH5A 4B3DA 3T5DA 4OI2A 5BN4A 1H8HA 3U7GA 3CF6R 1E2DA 3U6KA 3U44A 3PJRA 1DO0A 1S3GA 1HEIA 1BO6A 2VP5A 3EZFA 3AP2A 1ESMA 2H1LA 3UATA 2ZUBA 2EYUA 5FOXA 1S96A 2FPLA 3QKRA 1OXVA 4JL5A 2A5DA 2L0XA 2C98A 2ZI7A 3B1XA 4GL2A 4DT1A 4US1R 4URXR 2XX3A 5KNBA 3BS4A 2ZROA 1N2CE 3EZ6A 4QGAA 3QKTA 1D8TA 2YC2C 3IIKA 4QGFA 4DKXA 1Q21A 3U6BA 2GILA 2G77B 4B34A 1YR9A 4X8OA 1HY3A 1HURA 1XP8A 1A2KC 3N2IA 2GJAA 1X3SA 5KTYA 1TMKA 1FL9A 1GP2A 1G8GA 1YZNA 3CUEF 5DISB 1G7CA 2F7SA 4JMPA 1WXQA 3WYAA 3WMFA 5AUOB 4G5RA 1A1VA 4NL4H 3TKLA 4UKDA 4B2IA 2JLYA 4TZ6A 4LJ4A 4C0AC 3A36A 1JNYA 4V0ME 1NG9A 1R5OA 2NTYC 3A6PC 2P65A 3C8UA 1Z28A 2IXFA 1R7RA 3L8ZA 3CR8A 3DM5A 3LW7A 3REFA 1X1RA 4Q01A 2H57A 2D62A 2QP3A 4TMXA 2OEPA 4NMMA 2QRNA 3MRSA 3CRQA 2GAAA 3SYNA 3EPLA 1ZM3A 5JHGB 2ZRMA 1ZW6A 3IILA 3PUZA 3F3YA 4IDNA 1T8TA 3A1SA 4RVCA 3WBKA 2J5XA 2IHBA 3DHWC 3THYA 1H8EA 4PC6A 2BMDA 1ZD8A 4TYQA 1FZQA 4AI6A 2QG6A 2DHRA 1U94A 4KSBA 3OAAD 4I4LA 2RMKA 2D7DA 1Z07A 4G5SA 1E9CA 4YMSA 5D3MA 4GRAA 5FBVB 1E9AA 2GJ9A 1F6BA 4DEYA 5L3QB 2ODNA 3I8XA 1F2UA 3ZZUA 1YVDA 3EZ7A 3W5JA 2WKRA 1XU4A 1KOFA 3PEVA 4DVGA 1SHZA 3VKWA 2J7PD 2BVNA 4KVAA 4D2IA 5C18A 1Q3HA 1R8SA 1RJ9B 1E9SA 4Q47A 1FOEB 2QT1A 5JEDA 4TLCA 1E2KA 2QAGA 2OFOA 4JLOA 4JLAA 3AF3A 4HSEA 5F9HA 4YXWA 4W9MC 3VKGA 3B9PA 3DL0A 1EX6A 3HYTA 1S9HA 1G19A 2WICA 3E5HA 1ZMXA 4G1UC 1A7JA 3CF2A 1ZM7A 1ZYUA 4DBLC 1E2MA 2CCGA 4QHYA 4LSGA 2W83A 5J4YA 1P60A 4M0LA 5J40A 5JS8A 1Y3AA 3U4QB 1WDTA 2NIPA 3VKHA 4A2WA 2PEYA 5FI1B 5H70A 4U7DA 8OHMA 4MUBA 4HZUA 3TAHA 3FMPB 4DLZA 1GNRA 2CJWA 3GJ0A 2J9RA 4O25A 2C96A 3NBYC 3KJGA 3VR6A 1NY5A 2A5GA 1Z29A 2IEZA 4A4DA 2EFDB 1N0UA 2QE7A 3TJZA 2UZIR 3K09A 4DZZA 2ZRCA 4P4SA 5EE9A 2RGGA 1J8MF 1N3BA 1RYHA 2PZEA 1Z83A 3VAAA 1RRPA 4M9ZA 1VKJA 3AV0B 1X6VA 3DM9B 1PLJA 5KYKA 4HLQB 5FBWB 3OE7D 4QBGB 3SI7A 3OESA 1KHTA 1NKTA 4EPYA 3MD0A 1ZCAA 3IBYA 2GAOA 2YINC 3SOPA 2F1RA 4BZQA 1ZIOA 3B6EA 2VTKA 3BC1A 1TF2A 2O52A 2W2VA 1SKYB 1GRRA 1I2MA 3TUIC 3NBXX 4XSHA 1GRNA 1XWIA 2OFXA 1E2HA 4NBSA 4D0LB 4E09A 2QTVB 3VNUA 3Q3JB 4DSOA 1WA5A 2WJJA 3NC1C 4JVNA 5DYGA 2VYFA 4AYTA 4TL7A 1KIMA 2IBMA 4B73A 3I92A 1UF9A 1KDPA 1XXHE 4BFYA 5CITA 4B3GA 3I4LA 4U02A 4S2EA 1W0JA 1D9ZA 1YR7A 2WPDA 3C7KA 1D9XA 1P73A 3QF7A 4HLDA 4Y0VA 3Q5DA 4TTPA 4MKFA 4CW7A 1F2TB 5CIWA 4RKFA 3BFVA 2PX3A 4LX0A 4KU4A 4W7SA 5HR5A 3W6PA 4TYNA 2VP9A 3R20A 2GTPA 5AWFC 2PLRA 4M53A 4Q03A 4MDEA 2IXGA 3P4XA 1XDBA 3GLGB 4DLRA 3DEFA 4Q66C 3A4MA 3U44B 1OIVA 3HR8A 4LYAA 4BUJA 3KKNA 3MUFA 3P32A 4TN1A 4KBGA 1U81A 3X2SA 4CF7A 1AJEA 3QKRB 3AUXA 4IFBA 1E79D 4IHQA 3OEHA 4B47A 1TF7A 4G0NA 1FNNA 2OV2A 1NIJA 1CJVC 2YWGA 3M6AA 4B71A 5H1YA 4AKGA 4EPXA 4IVRA 1EFCA 1OFTA 3PUVA 3OIVA 5TXGA 3U3RA 2VO1A 1E94E 2BCGY 5BW8A 2F3RA 3KQKA 2ZRBA 3RC3A 2RGNC 4EFMA 3ZJYA 1OXTA 4DCUA 2DFNA 1N25A 3TQFA 1MKYA 2OCBA 3I1FA 1R6BX 2DWPA 2FWRA 3KL4A 4FCVA 5TV2A 2QPTA 1ZCBA 1LTQA 121PA 1NLZA 2ZJ2A 4DDVA 2QTFA 3IKJA 4F4IA 3KFVA 2J3EA 5HZKA 4NPHA 1J7KA 3KKQA 2GKSA 2CE7A 4LUCA 4LJAA 3GD7A 3KTAB 2Q21A 5FH9A 1WMSA 5J4LA 1PV4A 3V4RA 2IYXA 2IW3A 2PEZA 3IUYA 4MITA 2AN9A 2ZI5A 1Z08A 3L2OB 3M4YA 3CRW1 4PHTA 1VMAA 4I1UA 1DOAA 4KYUA 4DUGA 1KO8A 2VHUA 3DMDA 2ZJ8A 2G83A 1G7SA 3FMIA 1QHHB 4FW9A 2CBZA 2G0NA 4HUQB 3THYB 1HV8A 1UAAA 4ZDKA 4R2HA 4TMKA 4JT4A 2OCPA 3U5ZB 1NRJB 3K0EA 2GK7A 1P9RA 5FTLA 3NTUA 2QQEA 2BHRA 2QMHA 3DMNA 2QRZA 1DE0A 1ZC4A 2ZJBA 4PHHA 5D3MB 2CCJA 1QF9A 4IOMA 2X77A 2REBA 1UBEA 2IF2A 3MLEA 1F2UB 1IONA 3PCRB 3TNFA 2F9LA 3CLVA 2AD1A 4FMCF 3WXMA 2ZJOA 5GJVC 4YMVA 4ZDWA 2LWIA 3ZD6A 3SHFA 2BBWA 1CLUA 3LFUA 3QE0A 4OKSA 2FOLA 2QAGB 4GP6A 3CRRA 3N70A 4NONA 5F98A 1XD2B 3SC3A 5FOWA 4GOXA 1CJUC 2XJ9A 5B64A 1KSFX 4Q9JA 3RWOA 1JR6A 3WYFA 4C0LA 4EPTA 5TY0A 4Q1EA 4AD8A 1X8KA 3QXJA 1A82A 2H7VA 4GFDA 1UEJA 4TTQA 2DPXA 4HZUB 4KITB 2RGEA 1NG1A 3NXSA 2ZE7A 4M9QA 1Y63A 3SS8A 2JJ1D 3KFXA 4A0GA 1U99A 1ZNWA 5DN6A 1G8FA 3MJHA 1VHLA 4Q1CA 1E2JA 2TMKA 3WHLA 3G0HA 5GVSA 3CNNA 2ZRJA 4KSCA 1MR3F 3QJYA 1XCPA 1SVLA 2B8TA 2B7BA 4BFSA 2HJGA 1UFQA 5HTKA 3ZDQA 1G291 2JCSA 1RRFA 3K70C 1XMSA 4LC0A 4XWKA 2CK3A 4D0GA 4C30A 3OHMA 4ARZA 2QP9X 1KI8A 4M1KA 4HDCA 1S8FA 2ZE8A 1IJFA 5B57C 4F4CA 1SXJC 1YRBA 2WSSD 3B82A 5E7MA 4PAQA 1N6NA 1MOZA 2PBRA 1JR3D 4HB4A 4RD0A 2Q3HA 2D4HA 4QHTA 5ANRB 1RKBA 2BMFA 4M1WA 1DAHA 4DEXA 1NMZA 3P27A 4BRUA 2OBMA 3KQUA 1ZUHA 2XNDD 4A1FA 3Q72A 3NWJA 3B8HA 3RS2A 1CR2A 3CZPA 1U9IA 2Z0MA 1CF4A 1D2NA 2P6UA 2KWIA 4D0NA 5FL7D 3R7WB 3X1ZA 5JI2E 1JXOA 3CIOA 3CNLA 5FTMA 4FCTA 4QHSA 3RSOA 4G01B 4F91B 5JFGA 1N5JA 1OT3A 2QMEA 3BIFA 4RY2A 3L0SA 2JLVA 3LBNA 3A8TA 5FUWA 4C0BA 2J7KA 2A3RA 1EX7A 3EA0A 2BOVA 4L9WA 2F1HA 1S2MA 1Q1ZA 2GXQA 1K5GA 5KSOA 1R4AA 3W8NA 2EWWA 4GI7A 4BFWA 2I1QA 4RD1A 3B85A 4KAXA 1YZUA 5AUQA 2XNSA 3C15C 3OEEA 4ZIRA 1EGAA 3QOFA 4U5XA 3ECCA 2ZREA 2OHFA 1E2IA 1LF0A 1E6CA 1NJGA 1P2VA 2R9VA 2PZGA 1G8HA 2EW1A 2N46A 3QXCA 1IN4A 5B30A 1MRSA 3NHBA 3RAPR 1GUAA 1LF5A 3K9GA 5D3QA 5KU1A 4U00A 2AWOA 5FPKA 1QHNA 2WWXA 1COWD 2QPAA 4TSFD 4DDTA 2ZRPA 2UKDA 1AA3A 2R62A 3AVUA 2BC9A 4B2PA 5EE5B 4P32A 3SU8A 2R44A 2RKOA 3ZIAA 4DCSA 1CR1A 4C9BA 2YVUA 4ERNA 1PVOA 3DVLA 3TK1A 4CZ2A 3E2IA 4O3MA 5AJYA 5DHFA 3TW8B 1JJVA 4BECA 4Q1FA 2Z5FA 3AGQA 5HPYB 2EFHB 4LV6A 4NYMQ 1WE2A 1JPJA 2OILA 4D80A 3IQWA 1Z3IX 2ZSBA 2NG1A 4DSTA 1VECA 2FPKA 2J59A 2VHJA 3H1TA 4AG6A 3QI2A 3IO3A 3W9YA 4MYUA 2R6AA 5HCIA 3N2EA 1NVXQ 2CNWA 3I5XA 1W36D 2XGJA 5J5CA 2W6ID 5FR1A 1IXSB 4IXNA 5TARA 3RYTC 1UKVY 1SHKA 2A30A 3EIQA 3UWOA 2O8CB 2H92A 1M6NA 4HB3A 3VR1A 1XPRA 2GF0A 2VSOA 2ERYA 5L3RA 3VHLB 3C5CA 4PAMA 4FMCB 1SVMA 2PT5A 4MRNA 4UNPA 4K81B 4D25A 2ZAOA 4TMWA 5KDDA 3K0SA 1C1YA 3LWNA 5H68A 1NBMA 1Z8FA 3EPKA 5IT5A 1UKEA 2IYYA 4DC9A 3U7FB 2ZYTX 4KBFA 4MYCA 4OK5A 2IT1A 3T1VA 1VCIA 1CR0A 5EXXA 4HATA 4AC9A 4M1YA 2QMOA 3ZQ6A 1NLFA 1KSGA 3ICEA 2K5UA 2V7QD 1G3QA 1KI9A 1R10A 1T91A 1XFAA 2W2TA 4TLEA 3JZMA 1XEXB 2WWWA 1LS6A 4PC3A 1ETUA 1X1SA 1LW7A 2V9PA 4NYIR 3PG5A 1TEXA 1C9KA 2FE4A 4LBYA 3IHWA 5G40A 1TAGA 3LQQA 1XX6A 4UXIA 3T12A 2LCFA 4PC2A 3TIFA 4DSUA 2XZLA 4JLJA 2NO1A 521PA 3B5JA 1LY1A 1TUIA 5FR2A 3U3JA 2HF8A 3TH5A 1DS6A 1Q1BA 2GBLA 3D3QA 1HTWA 4IW3B 3LNCA 3A4NA 1G5TA 2J41A 4B48A 1Z0AA 3F5FA 2JJ2D 1RJ9A 1G7RA 2HXSA 5LD2C 2N42A 3KXIA 3N5CA 1Z6AA 2GESA 2B6HA 2IC5A 3RC8A 1XMIA 5EE1A 1PZNA 3T1TA 2CMKA 5CIQA 4Q4AA 3X1WA 2O8EB 3AVQA 4JL8A 5J47A 2ZM5A 4O0MA 3BERA 1E2GA 1US8A 4DCTA 5L3SA 4AIIA 2JEOA 2AXPA 4Q18A 4DB2A 1QHSA 4J0QA 1GL6A 2JLRA 2P3SA 3HPQA 3BH7A 1FNMA 3WP1B 2HF9A 4B32A 3CF0A 1E2LA 4C0QC 4PQRA 2VIIA 2ZU6A 4NDZA 5C4MA 3ZGXA 3BJIC 4Z51A 1W4CA 4GPTA 1SXJD 2I1VB 4Q9HA 4EQ6A 4PPGA 6Q21A 1KI6A 2WBLC 1AIPA 3BH6A 3FOZA 3U61B 1IY0A 4NTZA 3P1JA 5BYKA 3K8YA 4B3CA 2HLDD 2ZI9A 3QIAA 3RRMA 4DLSA 1QHIA 1U0HC 1SVKA 1W4AA 2REOA 4HAUA 2IYUA 4D6PA 3A1TA 3AVYA 4F38A 1AQUA 3VX3A 4DLXA 1DADA 3TVTA 4JZKA 2E1RA 3L8YA 3O8DA 3KUDA 2FU5C 4QKQA 2AHOA 2VPPA 3UIEA 4FD2A 4IDPA 3NH9A 1N0WA 3MGCA 4C0SA 2OUKA 2J7PA 4JT2A 721PA 1GNPA 4KI0A 4MQBA 2WJVA 1IBRA 1XTSA 4B6FA 3I32A 2I3BA 1G18A 3U3OA 4L16A 4ITRC 4B3XA 3D6TB 1ZD1A 2IYVA 1E9RA 4LOAA 5DH9A 2Q0HA 3PITA 4Y0AA 3SFZA 3HWSA 1OB2A 3TSZA 1DELA 1AA9A 2OCYC 4JS0A 2XB2A 3GP8A 2CXXA 3H4MA 4QBFA 4MDFA 1NF3A 2WIAA 2HT1A 1LFDB 2IUUA 4PZYA 2W00A 3ETLA 3ASZA 1F2TA 1XJCA 5LB4A 4JBXA 4XVUA 1YRAA 4B33A 2ZUCA 1LB1B 3I62A 3KKOA 2GXSA 1ZNZA 1OH5A 2WAXA 3NKVA 4Z1MD 3WMGA 5FOUA 4Z54A 3IQXA 5CDFE 3KQNA 3BB3A 4DLUA 3SHWA 1KAGA 4A0HA 1BS1A 4F4JA 1CBUA 1XTRA 3T5GA 4QG7A 3UG7A 2HT6A 4WZ6A 3MAAC 4PANA 1OXXK 4NCIA 5GJCA 3UANA 3AVVA 2O8DB 4V02A 3LD9A 2FSHA 3GLHA 5HZHA 1NJFA 4WZAE 2ZSDA 3OE7A 1FX0A 3TSWA 1OB5A 1QDEA 3FB4A 4HYYA 4BLRA 4EKDA 2G3YA 4QGHA 1T8UA 3GJ3A 1N5LA 4LJYA 1X8JA 2REXB 4D4MA 3FVQA 4DDWA 3Q85A 1NN5A 3FGNA 4UNSA 5CM9C 4TMZA 1E1QD 1DAGA 4E03A 3RS5A 3LRPA 2RGXA 1PUIA 1RRGA 5JCPA 4I99A 3RHFA 2JIZD 4TWZA 3MMPA 5EP2A 3LH5A 5ELXA 2W6JD 5E7IA 2X2EA 2XSZD 2ZITA 1GL7A 3IGFA 3BFXA 4P0TA 2MMGA 3R8CA 3AF2A 4HAWA 2B92A 4KFUA 4PHFA 3KTAA 1KI1A 2GZAA 3EG5A 4KFRA 4PPQA 1E9EA 1KO4A 1LNZA 2RGCA 4DB4A 3ND8A 3UXMA 3LBHA 2ECKA 2B7CA 2ANBA 1DAEA 2XJ4A 2J0UA 3K09C 3GLGE 3LX5A 1OH6A 3MWJA 1VG8A 4TT3D 4PQYA 1QHHA 4A2QA 4KYIB 3LBIA 4XTRA 4HUQA 2ODWA 1OKKD 1TQ2A 1KI2A 4FIDA 3CW2A 2OFWA 4RKEA 5FUVA 2JA1A 1YKSA 1T3HA 4DLYA 1KMQA 5KPJA 3AKCA 2CL7X 5FTJA 1HUQA 5KDLA 1S1MA 3ZD7A 5F2EA 1R0ZA 1W46A 5KNDA 2BBSA 3ZH9B 3NEYA 1QG4A 1W1WA 4TYYA 4IRUB 5AJWA 3RRZA 1G6OA 1D5CA 1XCGB 3HPRA 1E79A 2IS6A 1KDOA 4GT1A 4ZPXA 1W5SA 1G1MA 1NMXA 2X19A 4Q4LA 3PVSA 3SQWA 4AY2A 1ZC3A 1SULA 1J99A 4X8LA 3KB1A 2ZTSA 4ZI3A 4EJSA 4LHYA 1HT2E 2UZ3A 3QF4B 4NE2A 3RNLA 4B44A 1XD2A 2ASEA 2C8VA 5KUTA 4Q4AB 4YMWA 4XJXA 1NL3A 2WKQA 4LDJA 3EASA 1II9A 1US8B 1N6RA 2MSEB 4IOLA 3KUCA 1DEKA 5P21A 1I2DA 4ILEA 5L3SB 1KI4A 1CJMA 2QSZA 1OIXA 1L4YA 5JWHA 2OCAA 3CB4A 5JSZA 1GM5A 2GETA 3IIMA 4Q02A 1TQ6A 4RSGA 2QP4A 2R65A 2HYDA 3A1VA 2FF7A 3KX2A 5FPHA 4MH0R 2OBNA 5TDHA 1RE0A 4LBWA 2BJVA 4D4JA 1E0JA 2C9CA 1YR8A 1M2OB 1OXSC 3B7GA 3FYHA 2KBFA 1E0KA 5DHAA 4EQ6B 2CLSA 1KI6B 4OYHA 3LA6A 3REGA 1EFRD 2WMOB 1DBSA 2Z4RA 3U7EB 2VF7A 2QORA 5JZVA 1KK1A 2YYZA 1LVGA 3VMFA 1QHYA 5F9FA 2BV3A 1YZLA 4KJZA 1NN0A 4PSKA 4JYCA 2ZS7A 4A82A 2FGJA 4PZZA 4A36A 3AGPA 3AKEA 4JLNA 1ZM2A 1JQLB 3D7MA 4KVGA 3SFVA 4BEBA 3IDQA 3SYKA 5L8VA 3GLIA 1TU3A 1Z5ZA 3ONWA 3QY0A 5FTKA 2WMNB 4B43A 2IYZA 1E9FA 2VEDA 5CYPA 4Q9IA 1FPMA 3FFBA 1JBKA 3FWYA 4JLBA 4GZMA 3AVOA 4LJ7A 2IEYA 3WMEA 1G8PA 1B23P 1KO7A 4POAA 2C99A 4A9AA 4Q00A 4ASUD 3R7WA 2KJQA 4EIWA 5M04A 2C04A 4EUNA 3EPHA 1KYIA 5LB2A 2IS1A 2C2HA 3EC1A 1G20E 1EFTA 3SJBA 2ZRFA 2VH5R 4DCVA 2GEVA 4US0R 5SZHB 2J0SA 4GMXA 1NMYA 3NIBA 2VP6A 4NCKA 4HAVA 3QG1A 2IL1A 1Z06A 3I3SR 3GEIA 1CXZA 4WZBE 4K8OA 1B0UA 4JBYA 1QHXA 4YDHB 4OJQA 1IN7A 4Q9KA 1UPTA 3QSYA 2GCOB 4ACBA 5GJWC 4PQFA 2C03A 4IDOA 3U3KA 2FFQA 2RCNA 3AF4A 1KKMA 2W0MA 3RANA 4EFLA 1EWRA 2VQSA 2WAYA 4JLDA 2ERXA 4EPVA 1AN0A 3NDPA 1TU4A 3QEOA 3QKUA 1E1RD 4Q1AA 1KJZA 4EAQA 2A78A 2IWHA 5JS7A 1RC8A 3GLHB 4JJZA 1W5TA 4JSTA 4A92A 1E3MA 1FX0B 2BM1A 1UDWA 2D2FA 5JRJA 5GADl 2WSSA 1KTVA 3B1ZA 1G16A 4QBHA 4UNNA 5EP1A 1JR3A 2V54A 2QGNA 2WOJA 3LVRE 1FP6A 3AP1A 2ZSFA 4YC7A 2LKDA 4AURA 1FTSA 4LHVA 4Q19A 2H8KA 1TL7C 3SE0A 5JLJA 3UMFA 3KQHA 1Z0DA 2YOGA 4PO9A 2VP2A 2N1BA 1EXMA 1VTKA 2XNDA 3B2EA 1AK2A 4N0EA 4HDOB 2NO9A 2ZYWX 3IBGA 4BPBA 4QGGA 3VR5A 5KSZA 5FL7A 3BAFA 5C46F 4JYBA 1OIWA 2CDNA 3VQTA 4C7OA 5CJPA 5EP4A 5G53C 3HP1A 1E2FA 5BXQC 3BK7A 1M7HA 1ZRHA 3CRVA 3CWQA 3OF5A 4DJTA 2JDID 1UADA 2GWHA 1JPNA 3AQ4A 2ZRIA 4OK3A 1XNJA 2AR7A 4B76A 3OFND 2J0UB 2BBOA 1OXUA 2ZRAA 1HE8B 4XOIA 4KO8A 3BORA 1U8ZA 4AK9A 1ZINA 3CNOA 1E2PA 3E1SA 2NZ8A 3U2QA 4JVSB 3AVWA 1IN8A 1YHNA 4RCZA 2XXAA 2OXCA 4EPRA 5H8WA 2O8CA 4TTRA 5CB8A 1IY2A 1N0VC 1E0SA 2FN4A 1ZP6A 1R0WA 1N6KA 2WZQA 3SN6A 2QE7D 4BFXA 1RW4A 4Q48A 4Q7KA 3NDBB 2WSMA 1T9HA 1ZNYA 1E4VA 5HKKD 4A8JA 1XZQA 2ZR0A 4LJ8A 2OLJA 2OT3B 4LJ6A 1IJEA 1CRPA 4L5BA 4MGZR 4NP6A 4B75A 3PIRA 3SZRA 1W4BA 2Z4SA 4EJSB 1T5LA 1COWA 1U9IC 4TSFA 5JMTA 1II8B 3SJCA 1Q44A 5DSZA 5TB5A 2OM2A 1MO3A 3QQ5A 2AWNA 2EFGA 1ZVQA 3OZXA 4DLVA 3O8CA 1XEXA 2J45A 3AVTA 1XZPA 2J46A 4LPKA 4PO1A 4L4UA 4AYWA 4LBZA 4XH9B 2YWEA 1N6IA 1JEEA 1R2QA 5JSZB 2VBCA 2ZVQX 2F55A 4M1TA 3T35A 2D06A 5KNCA 4M1SA 1CP2A 3MFYA 5JCZA 3C16C 3RRNA 3ZYCA 2IYWA 4LYHA 1RPZA 1W47A 2JLWA 2RGAA 1W2GA 4QOSA 4M9XA 1HYQA 5TVKA 1P3JA 4BFTA 3LO5A 2QM7A 2C9OA 3I61A 1UDXA 3R9IA 2J0VA 3HR7A 3IEUA 2JLZA 2WPDD 1G3UA 4JLVA 4E5UA 4ABYA 2Q9CA 1JECA 2JAQA 1LS1A 2V55B 2VHCA 3PFIA 2NZJA 2W6IA 1XXHB 4AKIA 4XWAA 2P67A 1EFUA 1S4QA 1XTJA 3W90A 5JJIA 2FFHA 4A6XA 2PMKA 2O8EA 3K0CA 1W48A 3VU9B 1NSFA 4M21A 3B9QA 4NYMR 4CYMA 3GLIB 2P5TB 2HEIA 2YWHA 3RSLA 4GZLA 5FOSA 3AKDA 2RHMA 3M0EA 1QBKC 4OL0A 2E87A 3KJHA 5EJEA 3JVVA 4R71A 4Z8XA 1O87A 1IHUA 4KCGA 1JB1A 3O47A 1WQ1R 4FXPA 1ONBA 3OIYA 3DZDA 1CTQA 3GEHA 2JLSA 4NKRA 2OXRA 4WA7A 2V7QA 1FUKA 3GJ5A 3EWSA 4KFTA 3W3ZB 2QROA 4M4SA 4B6EA 2VSXA 2BJWA 4GMDA 2QPOA 2NPFA 1M7GA 3QUSA 4NCJA 3S1AA 1IM2A 2ONJA 4JSYA 2VHTA 4JJKA 621PA 3DKVA 4UNQA 2QBYA 1EWQA 2NOAA 1JXMA 3SBEA 2GJSA 5E95A 1EK0A 4L8GA 2IA5A 2PMDA 1X8LA 3SR0A 4H1VA 4BLSA 5KSPA 4MUAA 1SZPA 1FTNA 3SJZA 1H65A 1VDZA 2ZEJA 2H5EA 4Q7LA 2PH1A 4CEHA 1P9NA 5E3HA 2QEQA 5L3VA 4MKHA 3DPUA 1F48A 3AF0A 3FHTA 1SKQA 2BWJA 2QM8A 1J2JA 5HE9A 1G17A 2FA9A 3F0TA 4M2LA 3NC0C 2PX0A 2JJ2A 3KXKA 2VHQA 3QVVA 5EQTA 4TQUS 2C95A 4DUGD 1T3LA 5A0FA 1VHTA 2GZHA 2R6FA 3T61A 1KNQA 2GVZC 4HLUA 2A2ZA 3C14C 1BH2A 5JECA 5K8IA 1T0JB 3GFOA 4DXAA 2WWYA 3PUWA 1GKUB 2JASA 5DIFA 5AUNB 3ZZ0A 1II0A 1UBCA 3B1VA 1KKLA 4ON9A 5KPDA 1KZ7B 2GJ8A 1RVDA 5BWMA 1R5NA 4D81A 2I4IA 3Q5EA 2OO7A 3TAUA 3X1YA 3A1UA 5C4GB 2NGRA 4I1SA 1GIAA 4TL6A 3EA5A 1J90A 1N5IA 5E7JA 1SXJA 4C7OB 3TUJC 1AGRA 3QBVA 2Z43A 1K8RA 1V5WA 2J0QA 4BZPA 4EFNA 1L8QA 3K0FA 2AKAB 4FWIB 1M74A 2XEXA 2FX3A 2HLDA 3NVAA 2O8DA 1RFLA 3D8BA 4FMDF 2OBLA 2GBLC 1QVRA 2RHDA 1BMFD 4P4UA 5CB6A 4G3XA 2V1UA 4MKIA 4LGMA 2Q3FA 2V6IA 2JLXA 3QG5A 2XXAB 2F43A 4PR0A 3QVUA 2O8BB 2H17A 4N3NA 5TMPA 1OHHD 1YR6A 2YWFA 1P6XA 2A7QA 3LV8A 4QBIA 2QZ4A 1XTKA 3B1WA 5G3ZA 1QRAA 4HI0E 5EUQB 4ESVA 2QQ0A 1GKIA 4IKEA 5EE0A 1L2TA 3FPAA 1SGWA 2FDCA 4A8JB 2HCJB 3MSXA 2XOKD 3LX8A 3T06B 2B8WA 3RDPA 2FNAA 2FV8A 5KHOC 2ZI4A 4TLAA 4O2LA 5C2JB 1FMLA 2PT7A 4A0RA 3M1IA 2KBEA 1NKSA 2FMXA 5GJBA 5B2ZA 2GCPA 5HE8A 2GXUA 3PEYA 5JJKA 2CVFA 1KSJA 2C9YA 1YZQA 3LVQE 4URVR 1KJWA 1KY2A 3WNDA 3MG9A 2ATVA 2F9MA 1A4RA 2ZYUX 3P20A 5EXSA 2YV5A 2PJRA 2DWOA 3CH5A 2D74A 4UJ5A 4Q1BA 5EZ6B 3RS3A 3IHLA 1XBTA 1R0YA 3FTQA 4PSAA 1W2HA 5IDVA 4RZ2A 4ZCIA 5FI0B 1T5IA 4BLTA 2Z6VA 1E2NA 1N6LA 4TMVA 3SBDA 1WBBA 1CR4A 5GVRA 1UBFA 5DGXA 1E32A 2GCNA 4QJ4A 1JEDA 2QENA 1P61B 4TMTA 2GVDC 1E99A 1P62B 2NO6A 1KAOA 1Z22A 4YDSA 2V6JA 1HT1E 2QUZA 3CH4B 1EESA 2RB4A 1W36B 1MRNA 5CJ2A 1PUJA 2V4ZA 3IO5A 4TZ0A 3PEWA 1WBDA 3FKQA 4HB2A 3ADCA 2QT0A 3QF4A 4DIDA 1A5TA 1DTSA 1NBME 2AL7A 4M9SA 1E98A 1L4UA 3GLFA 2VA8A 3V4FA 1G6HA 3L82B 2GZDA 2WJGA 2JIZA 2XTZA 4NHOA 3BOSA 1YZTA 4MGYR 2AD5A 2ZSAA 4DCNA 2KI5A 1Z2AA 4LC1A 2DCUA 3A37A 2VRWA 3AVPA 3BH0A 3H2YA 1Q22A 3BE4A 3VR2A 4CEJA 4BFUA 1MABA 4UQOA 3RWMB 3VHXA 2WTUA 2HV8A 4OQMA 3PQCA 3LXRA 3K70D 1IXRC 3SQXA 2ZAMA 2RGDA 4M1MA 2CHGA 4XTCS 1VG9B 3GEEA 1IN6A 1P5ZB 1VYTA 2IHYA 2OG2A 3D31A 4JKYA 4EDHA 3Q7QA 2HXYA 3TBKA 1CS4C 3IEVA 1FMJA 4I1OA 4WBSA 1IY1A 3B13B 3MJRA 4LYJA 3K0AA 2YJTD 4TT3A 2UVQA 5C1BA 4A15A 4CRWB 3CX8A 4GBMA 4WOPA 4V03A 4WXPA 3S1AB 4LV5B 2A5FA 4ACAA 1G21E 1OKKA 2QBYB 1DG1G 2PCJA 5EE3A 1ZU4A 4KLNA 1W0KD 3THWB 2YC4C 3OAAA 1AKYA 4V0OA 4P33A 2IF0A 2CL6X 4UNRA 2QNRA 4BFZA 3FDIA 5AJVB 4CEHB 5KSYA 1G3IA 1NN1A
chains in the Genus database with same CATH superfamily
2C5BA 3WB9A 1DIOB 5EJ2A 1NX6A 3AVXA 4DMKA 4WBXC 1OFHA 1Z47A 2GCIA 3J81A 1LPBB 4W6ZA 2JVKA 4WAUA 5BQ5A 1BCSB 1YFKA 2V5AA 4ZTUB 5HOQA 4UBKA 4CODB 5H0IA 2F3TA 1IZ0A 1MT0A 1KVTA 1Z0FA 4EF6A 5DYWA 2RBEA 3X44A 2WYIA 1E8NA 4TZTA 1ZIXA 5IM5A 4Q9LA 3QX9A 2BZ0A 3MELA 1WO8A 5TT1A 4ENUA 2QL7A 5DO9A 2Q4DA 3RBVA 1MIOA 3H2JA 2NO7A 3P9NA 4P22A 5AOCA 1UC5B 4ZEVA 3NHPA 1XR3A 2QS9A 4RSHA 3K2IA 2VJPA 2ZVPX 4BV9A 4ALIA 2V0GA 3B8EA 5AJXA 4HNTA 4QUGA 4ND8A 5IXSA 2FG5A 5A6SA 1BROA 1CUAA 1LV7A 1PWZA 1DBIA 2IHUA 3JQ8A 5CFZA 2HC9A 2GPWA 3LZDA 3WNVA 2Z9BA 4D4KA 4MP3A 4D8TA 2BFCB 1E59A 2GCOA 1NC1A 2FVXA 4TV9F 4YN3A 3P2YA 3RREA 1SH7A 1EFRA 4W7IA 1NHWA 5HILA 2GR9A 2E3JA 1EVIA 1SUEA 3BB1A 3S70A 3GZNB 4K6GA 2P9EA 4Z86A 1XHFA 4QOFA 1CKEA 5TPZD 3ADKA 5JCXA 1GPNA 1TQ4A 4CVNA 1D04A 1ZK1A 2BIFA 1HE1C 3C41J 4V0MA 5KB3A 3G2KA 3ZNPA 4TS4A 1NIPA 4I55A 2FMFA 2X8AA 3ZXSA 5GWXA 4BQNA 3BB4A 3V8EA 1T9BA 1XTIA 2QR2A 4B4UA 1G2PA 5IFLA 1YMUA 4RDHA 5JARA 2R25B 1NI3A 2W0SA 3DXYA 1XP5A 1NURA 2Q4TA 4G36A 1F60A 4UARA 1Y6RA 3A1DA 3HXQA 1TF5A 1KNXA 1E4OA 1GHTA 1SMKA 4GG1A 1ND5A 4N5IX 1NU8A 4L7QA 2Q1YA 2VDWB 4K40A 2VBGA 1GPUA 1IOLA 3ZK8A 4AO7A 3UMGA 3Q8XB 1VIAA 4DYDA 1JJ7A 5AVWA 1T2AA 1YCDA 1SVOA 4U39A 2BCJQ 2IEBA 1VG1A 3AM1A 2XY4A 3L9WA 1O9BA 1P5RA 1KZ1A 4OLJA 1D7OA 3KPVA 4X1YB 3LC0A 3EWAA 4ASUA 5T4EA 1ONPA 4BVJA 1PQWA 1G4UR 2WWGA 3S3TA 5BV0A 5IDQA 2PLNA 5C81A 3AFGA 4NV3A 1Z4LA 5KIAA 2CCKA 2JJ8A 3FCCA 3WB0A 2O0HA 1N5KA 2V0CA 1G98A 3FYUA 5DW3A 2Y8EA 3E5NA 3HO8A 2GBIA 3AF1A 3QKSB 1MT3A 4V38A 5JS6A 5FUYA 4KXXA 1PHRA 3WQRA 5LNK6 4ZZ2A 2MSCB 4D8UA 1GKYA 1WV0A 4HR7A 1HG0A 3G85A 4ZXFA 3S40A 2FPMA 3DB1A 2XW6A 4LX8A 3WRYC 4B6RA 2C2KA 5C8VA 1IXZA 3ZU5A 1FY2A 3RVKA 1YJQA 4D42A 5EJ8A 4LDAA 5BNWA 1EXWA 2OBXA 3TXYA 2IWRA 3AFIA 1IH8A 1RAIA 3O90A 3QTTA 2B99A 1FE8A 2GM9A 1RZRA 1G64A 2YZKA 5FNVF 1IBSA 3QWFA 4FX5A 3ABSB 4H16A 4K5QA 3C3AA 3UA3A 1VIVA 4DV1B 2BP7B 2CLFB 4A91A 2VTBA 2GX6A 1T35A 3BREA 1T5HX 3QMMA 3QWAA 5BN5A 4IIJB 2HK8A 3D1VA 4BS9A 1LSOA 5EJ7A 3FNGA 4M8NE 5JBIA 4B6OA 1L5MA 4KR7A 2NP7A 3DOOA 1WXEA 4BWVA 4ENQA 1VA5A 3OFKA 5JATA 2MTBA 1CJTC 1QG2A 1F1JA 2VPZA 3UG6A 1IHDA 3EDRA 2ZKIA 1JWAB 1QVWA 2FR8A 4DEVA 1Z75A 1AQYA 4XVQA 3AEKB 3CX7A 3L6UA 1XEFA 2FPUA 5K1ZA 2AFHB 3AU8A 2OGSA 4YH1A 3WJ1A 4LNUA 2HF2A 4DIFA 1II8A 3AY6A 4MV8A 5HRAA 3O94A 4QIHA 2J32A 2HLNA 5DBEX 4IDBA 5B3JA 1ZD4A 1P0QA 2UDPA 2X1LA 3HKCB 4AX4A 3LQKA 4GR9A 4C3OB 4CKWA 4MWGA 2XV1A 4RZ3A 4KR9A 4DG8A 2OUIA 3FPLA 4W5WA 3GX1A 1TFUA 5C8YB 4RGYA 1L3CA 1L7DA 4QFDA 4FGLA 1X7GA 3GMSA 3KK0A 4XGRA 3WADA 3ZHRA 5E2AA 4MAMA 4ZCQA 4BEWA 5CLJA 3IA2A 1A2BA 1LBEA 3IPCA 4PC1A 2EFEB 3ITEA 4NU0A 1TQDA 4NY1A 1DWQA 3KPUA 5IAEA 1KS9A 4MGKR 3WAGA 1W73A 2EIXA 3LQRA 2JDIA 1Z6XA 4B7ZA 3TOVA 4L74A 3K4QA 2APJA 3VTAA 3GYGA 4Q6WA 5IC6A 1EX1A 3E7FA 2FSGA 3KM0A 3L0OA 4ETNA 3K0AB 4JP8A 5IVHA 1XD9A 2BKUA 3KSRA 3DTYA 4BB6A 2WHQA 3HA5A 2W4QA 3UJDA 2ZBVA 4V0SA 3I1IA 3EZ9A 1TJNA 4Y0NA 2Q3MA 1FJ2A 4R4JA 3FH0A 1E9DA 4C5BA 1CUDA 4XYLA 2FPXA 5FPTA 3EDQA 4MW4A 4Z6KA 5HIAA 3PHJA 3H6HA 1E6LA 3TCNA 3CJTA 3K1TA 2AF3C 4YJDA 2QSJA 1HDGO 1Z74A 3RHSA 1TYCA 1H42A 4PG5A 3EN0A 4FN5A 5JVDF 4ZVQA 1H8HD 1NTOA 3DXXA 5J5VA 5HKKA 2OK7A 5EXPA 2CGEA 2TECE 4Q0MA 3INYA 1MDFA 1U8XX 2IPMA 4RO0A 4WIAA 4DYVA 4DDUA 2VCEA 1WR8A 2YOFA 3HCDA 1DT3A 2PGIA 3KB2A 1V8DA 1ML4A 2FTKE 3U9TA 5ICMA 2P79A 5FLXA 1XJWA 2IDZA 2JIRA 4C2TA 3UXHA 2CKMA 1O8BA 3V1KA 4XARA 4RHUA 4ECAA 1O0SA 3RG2A 3BMOA 4QL3A 3U56A 1ICIA 5TR9A 1W6RA 5E4YA 2WU4A 1MMFB 4B46A 4W7HA 3S2ZA 1VIDA 3NAGA 1FNDA 5E2IA 5TQ2A 4AZWA 3RB8A 4D56A 4IINA 1C3LA 4WNIA 2BFPA 2PH7A 4JBGA 4REQA 3RJZA 3RKSA 821PA 4YAJA 5EIXA 3A3PA 3I73A 2QY6A 3MJ4A 4PO8A 2WSLA 3LLUA 4QUBA 4AZ0A 4E94A 4OBXA 2YJNA 3LY5A 4P84A 3MWLA 4KQHA 2O3QA 1TADA 3QPVA 1NKVA 2YN2A 4MQUA 2ZUFA 1UKCA 4FGZA 3AJAA 4YYEA 1GGHA 3ZWQA 5AW1A 2CJYA 2R2AA 2Q1UA 4M55A 2DUMA 2JJ1A 1XF9A 1NBAA 2KMLA 2XITA 3FNQA 4EKIA 3KSDO 1PSWA 1V1MA 4YRMA 3T7CA 5IAGA 1Q0PA 4W4TA 3F96A 4BVEA 3MMSA 1K8QA 1U5CA 4OHWA 2WDZA 2A5JA 4RPIA 1JKFA 1ZN9A 2F1JA 3RIEA 2VF8A 5F77A 2BEKA 1RXUA 4LW8A 3CTPA 4HH1A 1L4EA 4U2KA 3GLIE 3WGTA 4P3KA 5DV9A 4CKEB 2KE5A 1PW5A 5D5PA 1AZTA 1QZTA 1M2WA 1Z2EA 4AMBA 3IQIX 4DR4B 1RC0A 4FUQA 2O8FB 2I87A 1YQTA 3AIMA 1U28C 4FJ2A 3UKOA 3ESCA 3U7JA 4DCGA 1QDUA 3EUAA 3L8HA 4DT1B 4Y7DA 5DNWA 4MVJE 1AKEA 1Z16A 2FGKA 2W58A 3H1PA 1Z63A 1DMRA 3HEMA 4A10A 4Y6GB 2QLJA 3CPEA 4NCXA 5LQKA 4TVOA 1QH8A 3FWNA 1JKMA 1NW8A 3UHJA 4D99A 3DZ8A 1NNSA 3DKPA 4X71A 4CT5A 4E1VA 1JP7A 2IV2X 3TZQA 4Q7MB 4LEIA 1FVFA 1FUIA 2ODEA 4MWSA 1EP2B 2Y0DA 3QVGA 2XDQB 2ZPUA 3U4CA 2JPDA 4V0NA 3N0VA 3CT4A 2ETVA 4TYPA 4I3HA 3M49A 5CURA 1FFBA 3KP1A 4PTLA 2XPCA 1QZXA 5CFPA 1BWRA 1SA0A 4NCHA 4TWBA 2OC9A 1NVGA 2ZJAA 1BN7A 1I3KA 3GEPA 3LK7A 1IBLB 1W9HA 4NHEA 5IUKC 1GDHA 3TR5A 1HH4A 5JH7A 3NRJA 1POXA 3QEKA 1WUTA 3U13A 4B81A 2AN4A 1WPXA 2XBUA 1ATZA 5DI3B 5JZBA 1VKRA 5EXTA 1I1HA 3C1UA 2QU7A 5D87A 1HFEL 1U7DA 5AQ1A 3OI7A 2D1SA 3VOTA 3BCHA 1ICEA 2C78A 2QW0X 2QTLA 1BU8A 3JAWA 2VKQA 4F92B 3MVEA 1ENOA 3HU2A 4OAQA 4WDRA 5DLDA 3ILXA 3TIVA 3OT4A 2AJBA 4N6OA 2XMRA 4B6JA 5CVVA 3O1HB 1CIVA 3CRMA 1THZA 4OGGA 1I6KA 2OQRA 2P3QA 4RFSB 2J6HA 4JODA 2VCYA 3IPYA 1DAFA 3DPIA 3PLRA 3PRYA 4N47A 1D6SA 3RS4A 3FDZA 2GRUA 3CLUC 3CY6A 2QMQA 3OU7A 4XW2A 1UT8A 1RYBA 2PGNA 3A9SA 1YWGO 2GPJA 3O7WA 3P2JA 3U62A 4PYJA 1BA3A 3OD5A 1O9GA 1R0XA 5DM0A 5A9TA 1Z38A 1RXCA 3OJFA 4BNGA 2Q3DA 3CZRA 3SBOA 1QP8A 3JWGA 1WUKS 3H5OA 3K2EA 3RSSA 3QOXA 3V80A 3BWDD 4QE3A 1NP3A 2I6SA 2W2OA 1NW3A 1VIYA 5G0UA 4QM7A 5EMJA 1VMEA 4I6EA 2DTDA 1E9BA 3ORQA 1A7AA 1OSNA 1MORA 2XDWA 3PDIA 1LDGA 2VL7A 3PD1A 2YVAA 3IAHA 4KQKA 3JWIA 4BX3A 4IJMA 1PTJC 2WK1A 4AO8A 5KTOA 4L07A 3F5MA 1Q3KA 3ZZTA 4TLBA 1KRXA 5FWAA 1PWYE 2JATA 3TB4A 3PFBA 2DR3A 2JGDB 3D8RA 1I0LA 2ADOA 3EC2A 4INAA 3K2QA 4EHFA 2MYPA 3IDSA 3QA9A 4HO1X 4XLLA 4TTAA 1BYIA 1KK0A 2ZB4A 2F48A 4W1RA 4RMHA 3V2GA 4C4PA 3CEPB 2X3UA 5KC9A 1ZXBA 1VI6A 3ZN2A 1G7TA 4MGHA 4TTJA 5HKLA 4EG5A 3RS9A 4BV3A 1IOZA 1GITA 2VZ8A 1F5SA 1ZD9A 2FFBA 3ABQB 1KC3A 1Q3TA 2MR6A 3ZWMA 1V4NA 2FK7A 1Y1RA 3C3BA 1H1DA 2OAP1 3HNOA 3PNLA 2VPTA 3L6BA 3VU3A 1FNCA 2ZUWA 4HGOA 1GDDA 1BKDR 3CG4A 3EDMA 3WYBA 4NZYA 3IP8A 3FNRA 3DJFA 1R0KA 4X8MA 1JG6A 1BJRE 5CEFA 4FR5A 4HLUC 1OYOA 2PCLA 2Q2WA 4BUZA 3JD4A 2A9KA 2IK8A 4X93A 5EIAA 1DEXA 2CD7A 3G5TA 3IVMA 2V4UA 3A6JA 2CLDX 4PZ9A 5A5DA 5C1PA 5NLLA 1AT1A 4F7WA 3I45A 4LCBA 2NX2A 3D3JA 4GZ6A 1Z35A 4P4SB 3CPHA 5E9QA 2ZBUA 3WWZA 1CRWG 3DV0B 4XEUA 3E1GA 3DO8A 3FSGD 2BGWA 2JRBA 4NE9A 3QU5A 3K4PA 4RPHA 1C50A 1RXYA 2RC6A 4B3BA 2V7EA 1KQNA 1O6CA 3T7JA 3B52X 5JSKA 3ADBA 1TQ8A 3E81A 1LCIA 3OEHD 3ZCUA 3KZXA 4HEQA 3HSKA 4NC9A 4R2KA 3IDAA 3WK4A 4H0CA 3WLQA 5TX7A 2L69A 4GYKA 4RPJA 1ZZEA 2HSWA 3D54D 2FEOA 3QPCA 4D44A 4DLTA 2W6ZA 1SC9A 4KYTA 4PLYA 4D9JA 1ST2A 5KZMB 4OI4A 2EKPA 1OH7A 3A2MA 2PGDA 2NU8A 1LX6A 3AY3A 3KQOA 5CM8B 3PGJA 4YRNA 4KPYA 2WB4A 4OBWA 3PD7A 1D6JA 1KAEA 1NPDA 2CNKA 2ZRGA 1ML3A 2AKYA 1IYZA 1T3ZA 2I7VA 3CKYA 3KQWA 3N76A 1P7CA 2OFFA 3Q8MA 3DR3A 1OX4A 3PXUA 5EQFA 4X94A 3CPJB 2WD9A 3EDOA 3U7RA 4G0QA 5ES4B 1JL3A 3VNAA 3NGMA 4NXMB 3BMQA 1U98A 2IV7A 4UU7A 4BO0A 4MR7B 4UPVA 3GQBB 5I3CA 1BOOA 1FTGA 1F8UA 1DRJA 4LBVA 4OHVA 3ZR4B 3ZV4A 3W9SA 2BRUA 3W2GA 1XU7A 3B12A 3LUHA 1MAAA 1OW3B 3AETA 3MWGA 1YONA 4BC0A 4LDRA 4OLHA 5M5BA 1VCOA 1N6HA 1Z0JA 1YL6A 1A5AB 5FO1A 3DE0X 1HA3A 4K03A 2EBFX 1JG2A 1YE8A 3O2JA 4D82A 2BUBA 3AUYA 3ND6A 3OC6A 3KXDA 4HDNB 4NZOA 4FT2A 1USIA 1TVKB 3L5OA 1RJEA 3C6XA 3V7UA 2XCSB 4HDRA 2VSYA 4LHSA 4LFBB 3NB0A 3KHTA 4I2VA 1P91A 1D4ZA 4A2PA 4ZN6A 4P9NA 1PR0A 3A2KA 1L8XA 1EINA 2PZAA 3DOFA 4QUEA 1VG0B 3R0ZA 5FYDA 8MHTA 1QBGA 1R3DA 1VPLA 4URWR 3W5IA 1U8AA 4FYIA 1OE0A 2E0IA 2Q6IA 2WF9A 2X0RA 5K2MA 4B3MB 1NVDA 1QGUB 3QBEA 1XNQB 5C1IA 5GONB 2WAMA 3BIXA 2GEDA 2E5WA 3LIPA 4NWIA 4L4XA 3AHGA 4FD3A 1RAGA 3GPLA 4AVYA 4I3FA 3ORHA 2BW0A 1N8TA 3HJRA 4RSGA 4CM9A 2IH5A 3Q40A 4E46A 4BNDA 3RS7A 1PLLA 4C3ZA 4W1QA 1DAIA 5GZ3A 2BFFB 4K9DA 3FIUA 3CX6A 1YC5A 4BNHA 2ZIEA 3G1TA 6CHYA 5CHEA 3GT7A 1JA1A 5KYGA 3NAMA 1UMBA 5E1BA 2DAPA 2G1AA 2XTNA 4Q4HA 2CXNA 4RHYA 3M82A 3PJGA 2BFBA 2ID7A 4TKUA 3K71B 2DB3A 3CM0A 3FOAA 1JQ3A 1E77A 4LWQA 2ZU0C 3ROMA 2XWJI 4ZAVA 4L4YA 3BGWA 4WKCA 4BY9E 2GD6A 5GZ6A 2W42A 4MRAA 3MFQA 3B6ZA 4ML3A 2KLBA 2D1YA 3P0EA 5EP3A 1P8AA 4BE7B 3IUQA 1NI4B 3WQSB 3C1OA 3PTZA 1A1SA 3KPWA 4EP1A 3CCCA 3DSRA 4IMIB 1SOUA 2XTMA 1SOVA 3PXGA 3AIIA 4YXFA 3IAUA 3PR1A 3FTDA 2AQ8A 1SIBE 3WVNA 3I28A 1KR2A 1DEHA 4QWWA 3VDMA 3ED1A 3RAFC 2WFAA 1R0RE 1MHTA 4FQ5A 3BX1A 2EGGA 4I9UA 2X6QA 3SQOA 4ITUA 4K1XA 3QEMA 1HLPA 4LVOA 3OIWA 2I7DA 4Z53A 2J9ZB 4DG5A 3PR2B 1AV7A 3CRNA 1AGNA 4QNMA 4IIVA 4NPCA 2FW9A 3ZVLA 2YRFA 4C29A 5K3EA 1BD4A 3QUQA 5BXYA 2YY7A 1HQYE 1I1NA 5LMUB 1K27A 3SGLA 3HJNA 1IZ9A 3L7OA 3O2SB 4MRPA 4QO8A 2EIHA 1REQB 5CA1F 1N0IA 1J2EA 3CLUD 1IPFA 2M1ZA 3KZKA 3MERA 2XUOA 1H4VB 1Y8RB 2QE6A 4H7JA 4CM5A 2XECA 4EVQA 5KWSA 1V71A 5HHTA 3GFRA 4Y2QA 4UXJA 1Z0IA 1HNXB 3GBSA 3MTGA 1Z4PX 2EU8A 4MUNA 1VSUA 3NVDA 4ZTBA 4PGAA 2PTGA 4N03A 2HHAA 4NZ9A 1A2OA 3AB7A 2XCTB 1XHEA 2GEUA 3RARA 2IS2A 1XTPA 5TPZA 2IPLA 4DLKA 3BTUA 2ZS9A 5T41A 5SZJA 5DF1A 2GN4A 1E6WA 2R8BA 2PGJA 2WIKA 1WDLA 2RDMA 4HT3B 1SBCA 2GF2A 1SZDA 1CV2A 3IIJA 1C30B 2JC3A 2VH2A 5DRTA 4ER3A 4LXYA 5KYXA 4D74A 1ZR4A 3QPAA 5EUMA 2ISQA 5IH3A 4H1TA 1NOKA 3ZWWA 1E1QA 2CNNA 1Z33A 3SXPA 4YQFA 4WN3A 1WTAA 3GMDA 2GAJA 4E7OA 2EJUA 1KAMA 3PICA 2HADA 4JC5A 4OJTA 4DNOA 1I4TD 1CUJA 1VSVA 2W6JA 3HVKA 4H3KB 4ZYUA 5L3QA 1OFGA 3LZCA 1OBOA 5AKGA 1VKZA 3PPWA 3MC1A 1CS0A 3M9LA 1FQKA 2FJPA 3V1YA 5F1PA 2E49A 4GNKA 2C7PA 1WETA 4J1TC 3THXB 2GXAA 1NR1A 3AF5A 2FQXA 2VDNB 1SN7A 2X86A 3GCXA 4E22A 4EUSA 2AXEA 2D0DA 3K15A 4OOEA 4UOQA 3X0DA 4MS1B 5K6RA 1JA9A 2V96A 4MV7A 3DLHA 4BQSA 2I78A 2FFRA 1K4KA 2A0WA 4R8MA 1QG0A 3WGLA 3F90A 1ORIA 3WLOA 4Z4QA 1M5UA 3OZRA 2PUGA 2DSTA 3DF7A 2NSHA 2VJMA 4J3FA 3KEQA 3SQNA 5AW2A 5FHQA 4W99A 2BI8A 2W6MA 1GPJA 3IQEA 4M60A 4JU8A 3T5AA 3V4ZA 3E2MA 3V32A 5JUWA 4JHLA 2H1RA 2HLPA 4IDHA 4MQEB 2EV9A 2AV6A 1V9SA 3ZIAD 4GKVA 4RJKA 5JNWA 3PC8C 3MAJA 2PZFA 3PUYA 4GOOD 3DR5A 1YZKA 1BAPA 1P2SA 2AUNA 3QHQA 1UC9A 2EGHA 3QXHA 3MINB 4N8SA 3TOZA 2P90A 3ICWA 1EUZA 3QUTA 4MW9A 2QLBA 4QYTA 3T9CA 1NW5A 1YQGA 2OKGA 3DFMA 1XRSB 3DBRA 3AINA 3QEJA 1PFYA 5EIBD 2I62A 4TWRA 4DNXA 3GLFE 4YMTA 2BJHA 1MV8A 3LPDA 1Q0QA 4QDKA 4IJQA 3SIWA 3GZTB 1TZBA 1SQ5A 3B78A 3JWEA 3PE3A 5LZ7A 3V6MA 3EIXA 4D8YA 1E5XA 1ZK2A 2BR3A 2PNFA 3B6JA 4G4SO 2XVAA 3ODPA 4WGGA 4ETIA 4H1WA 2F1OA 1M7BA 3R8XA 2X4DA 1P2BA 3RJTA 4RELA 1GTVA 4YMGA 1XZEA 1QIEA 1U9CA 4MWTA 4EO7A 1DCKA 3OPQA 4ZGBA 4ZIRB 3ZQKA 4WZAA 2Q29A 2DFLA 2DEUA 4C78A 1G8KA 4TL9A 5C5IA 1B8PA 2JFZA 3T5BA 3IB3A 3JD0A 1JFSA 1H93A 5KO2A 2ZR8A 1F51E 3R5TA 2FDRA 3MCAA 6YASA 2PE5A 4TV9A 1IRIA 3TKYA 4IHKA 1L7QA 4LE0A 3CXUA 2BKVA 1E3TA 1XVUA 3GJ8A 4FI3C 3U0VA 3UOGA 3W34A 2CLLB 3NM4A 1BE0A 4BNVA 4RTRA 1MJFA 2FQYA 1VBMA 4URYR 4B2LA 4CT4B 1MO5A 1RJWA 3QK7A 2PS1A 3ELDA 5FHRA 3TZHA 3BRWD 4FE4A 3A58B 2V7VA 2P9YA 2XD4A 2ZS8A 3ZPXA 4BEJA 2ONKA 7REQA 3PJDA 1JDPA 3CONA 1E3JA 3NLLA 2I2DA 4MA0A 4BQFA 1N77A 2JBHA 4ZVVA 5LC1A 1WDKA 1OFIA 1Z4IA 2QMYA 3D3NA 1JIUA 1OF1A 3HV2A 5EJAA 5G0VA 5CT4A 2IPOA 3ACBA 4IUDS 4ZDIA 5I7OA 4JLPA 4U3JB 4BFCA 2HU7A 1T1IA 3F4BA 2XCUA 3S7TA 2P41A 3NEJA 4HTFA 4MUHA 2X4GA 4NDAA 3T9FA 3ZJUA 1ZGHA 7MHTA 2NTVA 5CB4F 1Y33E 4HWSA 5LCXA 1PKXA 5J4KA 3FDFA 1JU3A 5DNDA 4RULA 1H8HA 1X80B 5AQEA 4E33A 2YV3A 4AN4A 2A9QA 3DDHA 1QFJA 1QMGA 2A0FA 3WE7A 5FOXA 1XAIA 5JZSA 5BPHA 2A0XA 1Z4JA 1OXVA 3DWIA 3EHEA 4MV5A 1X15A 3TRDA 2L0XA 3B7PA 9ATCA 2P3OA 4DT1A 2BZGA 5IF3A 1ZHFA 2G5CA 3BXEA 3C6MA 1QLJA 2B36A 3EXEA 1N2CE 3EZ6A 3R3HA 3UJHA 1PNQA 4JXZA 5JJCA 3AERB 3DE7X 1JT2A 1JG7A 2YC2C 3IIKA 4QGFA 4YCAA 4DKXA 3U6BA 5IZCC 3H19A 1YR9A 1YBVA 1RLTA 3DT9A 3KB6A 3OO1A 2JJYA 1HURA 1RKVA 4NARA 1P1JA 1EZ4A 1A2KC 2ZZMA 2R4UA 4QOEA 2X23A 4X5OA 3O8NA 5A1JA 1QIGA 1VLLA 1YZNA 5KTYA 3RVMA 5DISB 2F7SA 1H4QA 9LDBA 1U8TA 2BT4A 2W9XA 1X2BA 3N2NA 3PWSA 1A1VA 3GA7A 1U63A 3HWRA 3TKLA 5JDIC 1Y1QA 4M8SA 1DBRA 3SYRA 5WRFA 4C0AC 4I46A 1JNYA 4D98A 1SD1A 4XCVA 3KZMA 1NG9A 2P65A 1Z28A 1R7RA 2Q45A 2CDCA 3L8ZA 3SSMA 1P74A 3DM5A 3LW7A 3JU3A 4C4AA 4L3OA 3A14A 1TB4A 4Q01A 1ZHOA 2R3SA 4LG1A 4TMXA 1M72A 1T2EA 2PZKA 2QRNA 2V6FA 1ZCJA 3EPLA 3V8NA 1DOZA 4IDNA 3WHPA 1HLDA 1T8TA 2YDXA 3N5KA 1W25A 4UTXA 3WL3A 4Z1OA 3DAGA 1ZY2A 4D92A 2ZIGA 1NTRA 4AI6A 1KE2A 4UEQA 3JQAB 4LS3A 3OAAD 3GVCA 5KX5F 4MCHA 4RIFA 4JI5B 1YL5A 3T9EA 4IIHA 2I4TA 1ZS9A 5FBVB 5LM3A 3W04A 3OE1A 4ZXPA 2PMFA 3WG9A 5AK3A 2EW2A 4I8IA 3W7VA 3V7WA 5KTNA 1ECFA 3OOWA 5B1IA 5DXFA 3PEVA 4ZOEA 4ER5A 1F9AA 4DR5B 1Y6QA 1SQSA 2J7PD 2VJBA 2BVNA 2XGSA 5ENVA 1QMPA 4WH0A 4AKTA 2IELA 1R8SA 1UT6A 4Q47A 4A03A 3ZCVA 4AMUA 2WQ7A 4NV0A 4UBJA 4IQ4A 3VSCA 1JHDA 2FPWA 1DIBA 1E2KA 2HREA 3OZAA 1E1CB 2FPOA 3BMNB 3AF3A 3IUMA 4NS4A 5F9HA 3RVQA 5EWLB 4CN8A 1YDEA 1S7GA 2Q99A 3DL0A 2RGYA 1G19A 1UPXA 3D1LA 1UPCA 4RQAA 3M1AA 1QIJA 3KU1A 3CF2A 4DBLC 5H9VA 1Q6YA 5KYNA 3CLHA 1Q15A 2W83A 3BZUA 1P60A 2O2XA 2X9LA 3ONDA 4M0LA 3MMXA 1KBOA 2FZEA 3SF0A 2OP1A 4UZEA 3DW1X 2QLLA 5H70A 2VTDA 3EAGA 3OQBA 4HZUA 3TAHA 3O8QA 3FMPB 3FZEA 4EEZA 4ATNA 2ZT6A 3GJ0A 4O25A 2ZSIA 3Q7SA 3CJRA 3ZDEA 3TM5A 4EB6B 1TUGA 1TCAA 2W6CX 4V24A 5CCDA 2QQFA 3PIDA 4LQ4A 2QE7A 2UZIR 2JI9A 3FYSA 1W9MA 4UUBA 5E6UA 1BCRB 2ZRCA 3CLRC 3H1BA 1R8XA 3NETA 4H7HA 3WYNA 4L5CA 2P5UA 3D3EA 2PZEA 5FO0A 1IAVA 2EJWA 4XUEA 8ADHA 2VDUE 5IANA 3OVMA 2QJFA 1EBUA 4J3NA 1E18A 2G63A 5DWDA 3AV0B 2IIVA 5H59A 1JSZA 3WAKA 4ZMSA 5YASA 3ZE6A 1BX3A 1KP2A 4CKXA 5IYZB 2C83A 3VA7A 3LM8A 2IHJA 4R69A 4BB9A 2R85A 1EVEA 1ZCAA 3IBYA 1IWBB 4GDMA 4XYGA 2YINC 1KYXA 1JDJA 3ED5A 3T3MB 5DM4A 3SOPA 1RYDA 2Q5QA 6AT1A 5MF6A 1ONNA 4PLVA 2FUKA 1QYXA 3GVXA 1C7EA 4F3KA 2O52A 3JY6A 1DBPA 3OZDA 3INNA 3TUIC 1VE6A 2OFXA 3TDKA 1NWCA 4D0LB 5REQB 4BC1A 5IM4F 2WQ6A 2ES4A 4EELA 1FFAA 1KIFA 2XNHA 3WYEA 5JQGB 1ADBA 1V16A 2IBMA 3BXPA 2RARA 4MUMA 1J0AA 3DXFA 4XM2A 4YJGB 3V7NA 5BR7A 4G4GA 1XXHE 5CITA 2QK4A 3I4LA 4HDSB 4L6IA 4MVXA 3K2BA 2FOXA 3R5KA 1VFPA 1XZGA 4F4FA 3FBTA 3NHKA 4HNVA 1I51A 1D9XA 3IP6A 1Q0HA 3QF7A 4HLDA 4YB8A 3W9BA 5E1MA 3RLFA 4TTPA 1L1RA 5CIWA 1EVJA 1OWMA 5JPIA 4Z4HA 3LIIA 4RVUA 1PR1A 2PX3A 5A4AA 5IKMA 3KL2A 4Z4IA 1RWBA 4HWGA 2O54A 1CUEA 4I19A 3AJ8A 5K45A 2QJOA 3GT3A 1JXQA 3T41A 3P4XA 4GOMD 3NHFA 2Z8YA 3UZUA 4BPRA 4DLRA 2IHNA 3IT1A 3TXXA 3WWOA 3ESZA 1IRXA 1RXIA 1W88B 3U44B 4JAVC 4V2IA 3CSDA 1KBQA 4TN1A 1S2IA 5KNDD 1U81A 3X2SA 4P3PA 2X1MA 2IOYA 3QKRB 2UZ0A 4CCAA 3GB9A 3OEHA 2W90A 1Q7EA 2R7AA 1T4MA 1FNNA 2ORYA 2OV2A 2SECE 2YWGA 4G0NA 2GAFA 4G1BA 4BCDA 4AKGA 1X9IA 3OIVA 1NJ1A 1E94E 3CLSC 3BVPA 2F3RA 2J3MA 4UBOA 4KVFA 4BLVA 3WGVA 3NP9A 1QHFA 4YBRA 4EFMA 1AHHA 4CM4A 2I34A 3DYBA 1XAGA 1LC3A 4K26A 2QG4A 4YECA 4Z9BA 1SZCA 1QGOA 3WWDA 2FWRA 1RZUA 1YCFA 1ZCBA 1BFUA 3R3WA 5H3HA 3O0DA 2YJ6A 4RAQA 4DDVA 3AOEA 3IKJA 1KARA 2J3EA 3SF8A 5EWMB 1Y7TA 2GKSA 2ZOSA 3TOXA 3VKFA 4F4HA 4LUCA 1WABA 3GD7A 3LSYA 2HRBA 3F6RA 3PDJA 3RUCA 4CGYA 1YOBA 3EGIA 3L2OB 3M4YA 4LRSB 5GINE 2CNLA 3LKBA 4KAJA 1SD5A 4FEEA 4I1UA 1DOAA 4KYUA 3VSAA 4DUGA 2VHUA 3I05A 4UU0A 4XGNA 3ZXIA 1ESCA 1P3DA 1T5BA 4FW9A 4BYMA 4FOSA 4MR9A 4HUQB 1UAAA 1K4MA 5IAOA 4M7PA 3EZGA 1IB0A 1QZ3A 5I5EA 2VI5A 3L7LA 4KK3A 4UHFA 1A4IA 1NRJB 1KF0A 2GK7A 2CLEB 5JNLA 3NTUA 1VLQA 1XOIA 2WFZA 5A0TA 1OI3A 4I6GA 1GQOA 1CRLA 2QRZA 5I8ZA 1TIBA 2O4UX 5LA6B 3UYKA 1VYHA 4Y18A 2CCJA 5AI0A 5E4JA 1QF9A 4IOMA 4L85A 3TNLA 1D2RA 2JANA 3BXHA 4YRIA 4O4JB 1JSRA 3MLEA 2CV1A 1YB6A 4Y1GA 3PCRB 3U4AA 4NZPA 2AD1A 1H2HA 1JDZA 3OQNA 2CJXA 2ZJOA 1U4OA 3MTBA 1U80A 4F04A 1D2HA 1VGRA 4PG7A 4CM1A 1N2EA 3LFUA 3QE0A 5F2KA 1O5IA 2QAGB 4ALNA 3PP8A 4NONA 3LMKA 2A7XA 4KWTA 4RY9A 2YMMA 5EVJA 4GOXA 1CJUC 3HGMA 2EZUA 2GNAA 4Q9JA 1ID8A 4EPTA 1ZMBA 2F4VB 5TY0A 3MCTA 3DL4A 4L2IA 3UJ3X 1NT4A 3M33A 3R7LA 5K0FA 1SCUB 3KHUA 3OU6A 1AF4A 4IJWA 2VHEA 4G41A 5AW0A 2H7VA 4GFDA 2CJFA 3OLWA 4TTQA 4I8XA 4IO1A 2IFTA 1KEEA 1NG1A 2W6OA 3MJTA 2ZE7A 5BSRA 1PJSA 3PYLA 4Z0NA 2GZ1A 3UHOA 4A0GA 3WA7A 1DCTA 3MJHA 4Q1CA 3HA2A 2Y0CA 4M0CA 1V6AA 1GG9A 4HBGA 2ZRJA 1CF9A 2Y1GA 4G4IA 4Y2YA 1UFRA 1L5LA 3LFHA 4EYOA 2VXCA 2P5YA 3R40A 5B4TA 1RLIA 1U2DA 2HJGA 4INZA 2ORED 4JQSA 1UFQA 4JGGA 1SHLA 3HWWA 5AVVA 4MSUA 4UUPA 1NJSA 2VUHB 3V1TC 4WOJA 1NUQA 4I8DA 2HY7A 3CS3A 2OQVA 1OI2A 4D0GA 3V3TA 3VDQA 2C2BA 5DYNA 1PR9A 1A9RA 1T5OA 2EHJA 3BTSA 3PZRA 3VC2A 5LZ2A 4EZIA 2AQKA 1YRBA 2PRIA 2WSSD 2YV1A 4P4LA 4IGFA 3CLRD 3JQFC 4LXXA 1YK1A 1B26A 5LXTB 3FX2A 3MWFA 5CDTA 5I9MA 4R40A 4PYNA 2MINA 2X0IA 4M1WA 3DTTA 1OUMA 4RHXA 2R68A 1NMZA 2MYNA 2V4MA 3I52A 4JFRA 4BRUA 4RSMA 3FPGA 2OBMA 3HUUA 3LX4A 3MB5A 4LOHA 5EWJA 4A1FA 3NX4A 4WQMA 3LY7A 1N57A 1U9IA 3QTBA 1D2NA 3JYQA 3VR5D 3TQQA 3HBAA 2J3JA 1YI8A 2G4VA 3CNLA 3L7BA 3X2FA 4BB5A 4QHSA 3UMCA 3L07A 3QMPA 3RIMA 5KVCA 2VK8A 3C97A 2HHCA 3IA7A 5EN4A 3GG9A 1UC4B 1TC2A 3JTMA 3L0SA 4A23A 2FMIA 2RAFA 4M76B 3OH8A 2A3RA 2G36A 5GGXA 1V96A 3PX3A 4ZT4A 2BOVA 4L9WA 5ECYA 5C8XA 3N58A 4OUDB 4PM4A 2OZVA 1JMVA 3HC7A 5A05A 2BFEB 4RD1A 4XR9A 5THXA 2BFWA 5HF8A 1IUKA 3UKJA 4HGPA 4G37A 3F8SA 5KQSA 2GYUA 3QOFA 5JLAA 3ECCA 3V1LA 5CVEA 2Q8NA 2VUIB 1R4ZA 1HO3A 1JZSA 1UXHA 1YJCA 3GBVA 5BOSA 3KG2A 4KMSA 1LWOA 2X0DA 5JMPA 3R7AA 4FSXA 3THSA 2O3TA 3C39A 1D2GA 1GGJA 1KFKB 3KOXA 1AZLA 4B3HA 3NMUF 5B30A 3ZHSA 3EVEA 5JROA 1WDWB 1MRSA 3JXEA 3NHBA 4GLFA 4TRJA 5EI5A 4D3FA 1GUAA 1GZ5A 3LUGA 2FEPA 4P58A 5D3QA 4H77A 4PCUA 1QONA 2AWOA 4GLJA 5FPKA 3CINA 4E5SA 3SKXA 1XKTA 4ANFA 4Z4GA 3I9MA 2WWXA 2DECA 4MMYB 4TSFD 5I9IA 1WJGA 3UK7A 3UQYS 3CCFA 1M2VB 2UKDA 2QRVB 4MW5A 4B82A 4ETWA 3AVUA 4RGBA 1LBTA 3JATB 4X1IA 1URPA 1N4AA 3GL9A 1IZ8A 4CQNA 3WOHA 1WG8A 2RKOA 4M37A 3ZIAA 1CR1A 4EJFA 3HB0A 1R6TA 2YVUA 1GU0A 2A1TS 3KQQA 3T4UA 3QX3A 3RO7A 4CZ2A 3E2IA 4JP1A 4O3MA 5HPYB 4BECA 1Y89A 2Z5FA 3AGQA 4WSOA 4E2FA 3CLSD 3WGHA 1T0IA 4L6CA 1PU2A 1S01A 4LV6A 5C7OO