4PO8A

Mycobacterium tuberculosis reca glycerol bound low temperature structure iic-cr
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
326
structure length
306
Chain Sequence
PDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTGGKALKFYASVRMDVRRVETLKDGTVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 96
structure length 306
sequence length 326
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4po8A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4po8A01
4ABYA 4DHEA 2R9VA 4Q21A 5EUQB 4BE7B 8OHMA 1H8EA 3A1UA 5HKKA 4E03A 3DKVA 4OHZA 3OEHA 5J47A 3K70D 3LNCA 4Q5IA 1LNZA 1ZIPA 1RE0A 4LHVA 2CJWB 1Z0JA 2Y8EA 4DLXA 1NN5A 1J7KA 1D2EA 4K81B 4RFSA 3B6EA 1FUUA 2ORVA 2OCAA 5CIQA 3TGPA 1ESMA 3NC1C 3B7GA 1NVVR 1E2PA 2AKAB 1PUIA 4QBHA 4US1R 3RANA 1U99A 3H0KA 1R0XA 5C18A 2ZJOA 3ETLA 5FOSA 4ZKEA 4QGGA 4LPSA 3AF1A 1Z28A 3MAAC 3QXCA 4F4IA 2ZI7A 2ONJA 1X1RA 2ZJ5A 2ERYA 2VHQA 2OCBA 4D4MA 3B8HA 3PR1A 4JYBA 3QXXA 1TEVA 2FWRA 3Q3JB 4C0BA 2XAUA 1VG9B 2ZJZA 1O3YA 1BKDR 4IFEA 2JIZA 2OZEA 2V1XA 5KTYA 3PIRA 2JLZA 4DIDA 4ILEA 3T1VA 4YMVA 4QG7A 4TZ0A 1K6MA 4ZI3A 3RRMA 2ASEA 5B64A 1FX0A 1Z6YA 4JL8A 3GQBA 5DE3A 4URYR 2RGNA 4JL6A 1W4RA 5D3QA 1N6LA 3R20A 1G5TA 1U2RA 2PEZA 3IHWA 3TAHA 3BFVA 3NH9A 3U44A 1KJYA 4FMDF 1KJZA 1E98A 1KNXA 4QHTA 3WYGA 5EE3A 2KB0A 4TLDA 4DCUA 1FFHA 1ZC3A 3BB1A 5BXQC 1GVNB 1VYVA 2PH1A 3ZZ0A 4BFZA 2FJUA 5J4KA 1T5IA 4CEHB 1X8LA 3CPJB 3OE7D 2FG5A 4JZKA 5DYIA 3OZXA 3WRXC 3D3QA 4QXAA 3MFYA 1GNQA 3BH6A 3U3RA 2V1UA 1JXOA 1G21E 3KXKA 3K9LA 5FBVB 2BBWA 2CL6X 4V0MA 2VYFA 2RGXA 4L9SA 3BB4A 3PUYA 4G5SA 4IOLA 4IJMA 1R2QA 1DVRA 1R5BA 4TMXA 3IILA 4WXRA 4OQMA 3ADCA 1AS0A 1CJUC 4QBGB 4LHYA 4II7A 4LPKA 2ZJ2A 4OJQA 5IF9A 1G8FA 2ZI5A 1W36C 4JT2A 2QAGC 3B1WA 4NP6A 1NY5A 2PCJA 4MH0R 5B57C 1BOFA 2G77B 1E9DA 1D6JA 1G7RA 4LK2A 4Q19A 5CLQA 2WJHA 3A1WA 5JWRA 2E87A 4KVGA 3ZJYA 4WVFA 5EE5B 4ZCLA 4EPRA 2QROA 1JR3A 4EFLA 1XB2A 1U0HC 3B1YA 5LB4A 4MGKR 2QMEA 2VHCA 1EX6A 4UXIA 4UNNA 5BN5A 4TSFA 4M1MA 4Q4AB 4IFBA 2IYQA 2EQBA 2YWFA 2X77A 621PA 5L3SB 221PA 4A6PA 1COWA 3GJ3A 3OEED 4KODA 5AJVB 2D3WA 3H86A 1HEIA 3ZYCA 4O2RA 4PXAA 4MRNA 4NZYA 4Q7LA 1F6BA 1U9IA 2ZI9A 4MGYR 5CM8B 4XH9B 4CEIB 5EQTA 3EPKA 3EA0A 2DWOA 1WCV1 2JATA 4RD4A 1JPNA 2YINC 4PR0A 1E79A 2K5UA 3U7HB 3NDPA 1E2MA 2QENA 3EZ2A 4M2LA 4MKFA 4B2LA 2GKSA 4Z1MD 1W5SA 2OESA 1ZUHA 4GFDA 5JS8A 3EX7C 3FHCB 2ZRNA 4BFUA 3E2IA 1X1SA 2Z43A 2GWHA 4KVAA 4XOIA 4RFSB 3CRMA 2YJTD 5JCZA 3UK6A 3QKSB 4PZYA 2AX4A 3CKLA 4BFVA 4TYNA 1M1YE 1XX6A 2IK8A 4B47A 3BB3A 5JSZB 1ZCBA 1WXQA 1CXZA 1S3GA 4Z51A 1Z0AA 4URVR 4FW9A 5EP2A 3PCRB 3JZMA 3BFXA 2AR7A 2BM0A 3AP1A 3LXRA 1AKEA 3CW2A 2JASA 3B5JA 1ZRHA 2PBRA 2W6IA 3GD7A 3LVRE 3EZ7A 2ZSBA 4JSTA 4UNPA 4YDSA 4A2QA 1CJTC 3SEAA 1NN3A 5EZ6B 1NN0A 2O8FA 4PPQA 2ZJAA 1OKKA 2RGBA 3CX7A 1UAAA 4JVSB 2VP9A 4WXPA 2IX3A 1X3SA 2CCJA 4PPFA 2QY9A 2MSDB 2V8OA 2IXEA 2RHDA 1D9ZA 4AYWA 1CR0A 2XNDD 4TYQA 2ZRLA 4G1UC 4EPXA 2JLSA 1Q1ZA 5HZHA 4P31A 2HCBA 3KXIA 2GDJA 3AP2A 4LDJA 4TWZA 4D0GA 3W9YA 1ZM2A 2QRNA 3WY9A 2ZM5A 1GL7A 5IK2A 4B74A 3FFBA 4UJ5A 2LKDA 2IYTA 3VR1A 2REOA 1ZJ6A 2GAAA 2PLFA 1KSFX 3KUDA 2VHJA 4FD2A 4DXAA 1Z6GA 1FP7A 5TY0A 4M9SA 2EVWX 4D80A 4M1YA 3THYA 3PXGA 2XTMA 3EIEA 4HAWA 2J5XA 1SZPA 1G3UA 1ZM4A 1XTSA 1CRQA 1RRCA 3BXZA 1JQJC 4RVCA 1N6KA 1YJ5A 3O47A 3MG9A 4NKRA 3WMEA 1SVIA 1XU4A 2RGAA 4I1UA 2ZUCA 4M1OA 3UG7A 2B21A 1KYIA 5KSPA 2NOAA 4DC9A 1P9RA 2IS1A 1OV4A 2BJWA 1UBEA 1VPLA 5C1BA 1QHIA 1OH8A 4RZXA 1DAMA 5DHFA 4WOPA 3OESA 3A1SA 3ADBA 4PAMA 1KZGB 2Q21A 3O8CA 4E09A 3MJRA 4XWAA 4FWTA 2P67A 2YNMA 4TMTA 3NBYC 4RY2A 4Y0AA 3AVTA 1NKSA 4IHQA 2ZE5A 3RSLA 4M53A 1QG4A 1YU9A 3KFVA 4TTRA 4A2PA 5HR5A 3U60B 2YVUA 4DLYA 1P73A 4W5HA 4XVRA 2A5YB 3R8FA 4NL4H 3KKNA 4GBMA 4PO8A 1MO4A 1N3BA 1NJFA 5DH9A 1IN7A 3T1OA 5F9HA 3RWMB 3UPUA 1KI1A 1CRPA 3MUFA 1FMLA 1AGRA 4YMUA 2Q9CA 4DZZA 2ZRBA 4TL6A 3T12A 1FMJA 2ZETA 3WNDA 4UNRA 4JLMA 5CLLA 4IW3B 4BZQA 3OFND 3M4YA 1YZKA 4AI6A 3CRRA 1P75A 2O8DA 3VHLB 3ZVNA 1FZQA 1ZD8A 1Z0FA 4G01B 3C5HA 2QPTA 4LV8B 3DOFA 4NYJQ 5KYKA 1IM2A 4MRVA 2NG1A 3U3MA 4NPHA 2D2EA 1QHNA 3N70A 2XSZD 2ZU6A 1KKLA 3IGFA 3K09A 1SVWA 1XCGB 2X8AA 2XGJA 1W48A 5E7IA 1Q1EA 1NN1A 1OFTA 4OI4A 3ZZUA 3R9IA 2BKUA 1S8FA 3SJAA 2W2TA 3IDQA 5AJWA 1TQ2A 1G7CA 4KAXA 1G1MA 3CO5A 4QRHA 2H18A 2VP0A 4DSNA 4EFNA 3QXHA 4KHZA 3K0AB 1KK2A 3D31A 4GNKA 3GJ4A 1HH4A 3LAWA 1U8YA 3CLVA 3WNCA 1R8SA 1ELOA 4Y0VA 1BIFA 1W2GA 2PZEA 2ANCA 2GXUA 2ATVA 2ZE6A 3SC3A 1GWNA 1QBKC 2IYLD 2C98A 2QE7D 1ODFA 4NYIR 4B43A 3PEUA 5FOWA 2E1RA 2JDID 2G9NA 1ZMXA 2JLRA 3AEZA 2AXNA 1EFUA 1HQCA 1Q0UA 2GESA 3FFAA 4IEIA 5G3YA 4BRWA 1M74A 3A36A 1E2KA 2EWWA 2Z83A 1NNEA 2DHRA 4DT1A 2NGRA 4OI0A 1U98A 1KIMA 1GTVA 2WJGA 4M9ZA 4NYMQ 4P4SB 3PENA 5E4FA 3RS3A 5KSZA 2WMNB 2GBLA 1EFHA 2NTYC 4PQYA 4D26A 2ONKA 5K8TA 1P9NA 1R5NA 4XD7A 5HCNA 1OXUA 4HI0E 3C5CA 1K5GA 1XPUA 1JR3D 4URXR 3QBVA 2WIBA 2ZRGA 1TL7C 3VMFA 4B3FX 1E0AA 2EFCB 2OEPA 3KTAA 2IWRA 1EG7A 2WWGA 2ZJ8A 1TU4A 2QMUA 4PAOA 4QBIA 4Q7KA 4U00A 2ODBA 3WXMA 3CR8A 1MRNA 1T0HB 1UJ2A 4N0DA 2V7QD 4JJKA 4HUQB 1WF3A 1W0JA 4G0NA 1EFCA 5CITA 1CEEA 4IXNA 2FNAA 3GEEA 1PJRA 2RGCA 3EW9A 2ORIA 3EC2A 2HT1A 3PV0A 2IXGA 1E79D 4LRWA 1DTSA 5KO2A 1CBUA 4TYPA 4JLDA 1TF5A 5H68A 1KI6B 1R4AA 1KI3A 3LX8A 2VP6A 3RC8A 1XEFA 1T8TA 1VYUA 2NMVA 3GEIA 4D2IA 4HB2A 4A8JA 3QKUA 4MDEA 2CEAA 4HZUB 3CZPA 5DSZA 2P6UA 1SKYB 2BMDA 4QJ4A 1XEWY 1RVDA 5C4GB 3TJZA 4US2R 5KPJA 3IO5A 1XP8A 3ZVRA 3W5JA 4F4JA 4B3GA 3SYNA 3W3ZB 4B33A 5FBLB 1Q1BA 5JLJA 3UIEA 2NPFA 3EAQA 1D2NA 3QUSA 4DCTA 2ZYUX 4BFXA 2H8KA 3W3AA 4TTQA 2PT5A 1KTVA 4NONA 2O5VA 3A4MA 4J0QA 3TW4A 4AYTA 1EFRD 2WKQA 3Q7PA 4LJAA 3BOSA 4HAYA 1TX4B 1T3HA 1WRBA 1WMSA 2OV2A 3LDAA 2F1RA 2A3RA 2FEMA 3X1ZA 1XMIA 3K9HA 5IK2D 4OBEA 2ZQ5A 2ZROA 4ZO4A 1S3SA 2BHRA 4I1VA 3EIQA 3FWYA 4RD6A 2FZLA 2L0XA 4OKSA 4H1VA 3OIVA 3FVQA 1N5LA 5FUYA 5JZVA 2OLKA 1T8UA 1E1RD 2EYQA 2ZVPX 3CX8A 1XCPA 1E6CA 1RYHA 2WKPA 1AA9A 4I4LA 1YZNA 3H1TA 4JLAA 3B13B 1US8B 4OK6A 4PAQA 3IPXA 3ZVMA 821PA 2W0SA 4TN1A 4KFUA 2YOGA 5CJPA 2B8TA 4IVRA 2DFTA 2WWHA 2GK6A 4G5RA 4KYUA 1XPRA 3AVQA 1HT1E 1N6OA 1QZXA 1II8B 2FV8A 2ZUBA 3RS7A 3O8RA 2IS6A 1RRGA 5D3MA 2CE2X 3B78A 4CGZA 3QPUA 4R2HA 2HEIA 2QNRA 2YWEA 3SHWA 4C4PA 4YMSA 4N1AA 2ZJBA 4ZDJA 5LD2C 2D7CA 1E2FA 2I1QA 3P27A 1G6HA 2X2EA 4A0HA 4DEYA 2OT3B 2ZAMA 3NBFA 5FL7D 2GCNA 1U0LA 2OFOA 1TU3A 2CJWA 2DYKA 2GETA 3KKQA 4TL8A 3L0OA 3TLXA 4HSEA 3U61B 2ZJYA 2J0QA 1XDBA 1KO7A 3B1VA 3SQWA 4QNMA 5FUXA 3DZDA 3GJ0A 4W9MC 3CM0A 4IOJA 1Y3AA 2QP9X 3SYLA 3W5IA 2CLCX 2XZPA 5KDDA 1VMAA 5FPTA 3LX5A 1TF7A 5F2EA 3VQTA 4D4KA 4PSVA 4QM7A 1IHUA 1G4AE 3MWLA 2WTUA 3KQLA 2A9KA 3THXB 3OEEA 4F93B 2ZI3A 1OIWA 4NCIA 2P6RA 2O8BB 5GADl 1KI4A 1Z2AA 2ZR9A 4NTZA 5DISB 2J0VA 2QTVB 2MSEB 5G53C 2IHYA 4DSOA 2VP5A 2IWHA 2PJRA 2IYYA 3MWKA 4ERNA 1J8YF 4DB2A 4FMBB 2ECKA 4Z1MA 3NVAA 4LV5B 1YRAA 4WAUA 3BH0A 1A5TA 3SDZA 5HPYB 4AKGA 1ZIOA 1GZSA 3D8BA 4FXPA 1NVUQ 2HCJB 3EWSA 2ODWA 5AUPB 3L8YA 2FFQA 2A5JA 1GFIA 4XIGS 1S1CA 2W83A 2FGKA 1Z0IA 3GFPA 3UMFA 3U3KA 3WMFA 1A2KC 3C15C 3CIOA 4A8JB 2J87A 1CR1A 2FFBA 4RZ3A 4WZBE 4BLSA 5B2ZA 4CEHA 2PJZA 3KJGA 4HLQB 3ND8A 4EPTA 3MD0A 1L8QA 3LQRA 1M6NA 4DKXA 2REBA 4WIAA 1AQUA 5KU1A 3IKJA 4C0SA 3AVWA 3EWAA 5E3HA 2NQ2C 4DUGD 2CL7X 5FUVA 1C4OA 3IQXA 3RC3A 3SHFA 3MGCA 1DO2A 3QKTA 1M7GA 1F2UB 5TARA 1UFQA 4LJ6A 4UXHA 3R8CA 3TNFA 1KJWA 2XNDA 2JA1A 1ZAKA 2AL7A 5L3RA 4EJSB 1BO6A 2GJKA 1SULA 4FCWA 4C0LA 4FMCB 4AG6A 4DCSA 2F9LA 1CS4C 4QGFA 1XRJA 4QC2A 5EP1A 5GJWC 2WAXA 3E5HA 2JCSA 4Q9KA 4TYWA 4Q03A 3X1WA 3CONA 5SZIA 1W2HA 4P33A 3TE6A 1SVMA 4OYHA 2QL6A 2Q6TA 3TUIC 2VSXA 4JVNA 2O0KA 1PUJA 2SHKA 3OF5A 4TQ9A 4KFTA 1A2BA 3GFOA 5CB6A 3VX3A 3RABA 3KFXA 1ZM3A 4EIWA 3UMSA 5L3SA 5JJIA 3X1YA 4TMVA 4TYYA 3I3SR 2YHSA 3LD9A 5KDLA 4BWYA 4B71A 4PC2A 1ONBA 1CKEA 4AK9A 1HYQA 2IYUA 1G19A 5FPSA 3AGPA 4S2EA 3HU1A 2N42A 1MRSA 1DO0A 1W4AA 1ZU4A 4CRWB 1A1VA 4CEIA 4FN5A 5AJZA 3NHBA 2RGEA 2QEQA 3GJXC 5FPKA 3NKVA 2W2VA 3ZD7A 3A58B 4U5XA 1ZYUA 2HDNB 4XTRA 1AKYA 1U94A 4BLQA 1CJMA 1FTSA 4JMPA 1NLFA 4OQXA 2GZHA 1XEWX 4HLUA 5BQ5A 3PITA 4CT4B 1DE0A 1SXJC 3CPHA 4C2TA 4OHVA 2WWFA 1M7HA 2AKYA 4TTPA 4WW0A 4KFRA 3WYAA 2RGGA 1SVOA 4PHHA 1II0A 2CHQA 2OM2A 3QKSA 4JBXA 2NO1A 1MO3A 3SOPA 2IS2A 2WIAA 5FBWB 4C30A 4IXMA 1QHXA 2PZGA 3NWJA 3REGA 4HAUA 3T06B 2FZ4A 3SYKA 2QAGA 5JSZA 4WZAE 5JEEA 4A0GA 5IDVA 2ZSDA 3P20A 5JECA 3KUCA 3CRQA 1R0YA 3DM5A 1D9XA 3RLFA 1GIAA 1T6NA 1KY3A 3TW8B 1H8HD 1P2TA 1QG2A 2V4ZA 2WWWA 4LX0A 4QHSA 3OFNA 1TNDA 2ZXUA 3QPVA 3TIFA 5BYJA 3AKDA 1VTKA 4YLGA 3DDCA 5GJVC 5K8IA 2GJ9A 4OK5A 3EZ9A 3WHKA 4EPYA 1G3MA 2H17A 4TMZA 4NYMR 2BEJA 3QJYA 5DGXA 2XSZA 2AFIE 4X8LA 2D62A 4H1UA 1Q22A 2ZRCA 3EPJA 2RGDA 4URWR 4B34A 2X1VA 3K0CA 3LLUA 5BYKA 1YR9A 2O8CB 4LI0A 3V4FA 3QBTA 2DBYA 4BFTA 4DCNA 2WJJA 1OLOA 1ZU5A 1P60A 1TADA 5J40A 3KJHA 3LBHA 1RFLA 1VECA 1OJLA 4FCTA 2ZTSA 2Q3MA 3CPEA 1GM5A 2GF9A 2GZAA 3PVSA 1E3MA 4MRRA 4V0NA 1OF1A 2QQ0A 1UEIA 1GITA 1ZD9A 2QE7A 4G3XA 4X8OA 3TQFA 3DMNA 2QP3A 1ZM9A 2IW3A 4I99A 2JDIA 2FX3A 4IVQA 4LV6A 3VKWA 1OXVA 1KO1A 3P32A 1ZINA 2OLJA 5K8LA 2ZS8A 1GKYA 1YZQA 4NCJA 4XJXA 4YDHB 1KMQA 5CJ2A 1EK0A 1JBKA 4OHYA 4L4UA 1R5OA 2WWXA 2GJAA 2F43B 1NMYA 1E2DA 3THWA 2FSHA 1IJEA 3BORA 1JB1A 1UDXA 4C0HA 4CIDA 3C7KA 5DYGA 2UZ3A 3LRPA 5FR2A 4I1OA 2BOVA 4QJ3A 1YR8A 4AWXA 3M0EA 4G5GA 2WSSA 1AZSC 3JVUA 5FOXA 1WB9A 3AUXA 1OXTA 3GLGB 2BEKA 2GF0A 1Z2CA 1RC8A 2PL3A 1N6NA 3LLMA 1A4RA 1NMZA 3U6KA 3B9QA 3P4YA 1XZPA 3SE0A 4BFWA 4LGMA 1KAOA 4KO8A 3V4RA 1SKYE 2KBEA 1E9SA 4YC7A 1YHNA 3KB2A 1Z6AA 2F1HA 2WBLC 2C2HA 2YOHA 1ZD1A 3VNVA 1PLKA 3JVVA 1CULC 2C9YA 3AKYA 2FDCA 1XMVA 1AM4D 2V7QA 2Z6VA 4PZLA 4JKIA 3K0FA 4MQBA 3TR5A 1UEJA 1DPFA 1KSHA 2NIPA 4LJ8A 1T91A 3NXSA 1SHZA 2DWQA 4NHOA 4QOSA 1NI3A 3V00A 2GNOA 3HPQA 3SI7A 2B7CA 1GDDA 4BEBA 2RGNC 3E70C 4M4SA 2BBOA 1CJKC 4M9QA 2I4IA 5DN6D 2FPMA 3TVTA 4GSYA 3R9WA 3SR0A 1FNMA 1E96A 3D6TB 3K0AA 4HUTA 4O3MA 1TF2A 2X19A 1W36B 2ZRJA 3T1TA 2QAGB 1E9RA 4DLTA 2KBFA 2ZITA 3IIJA 2J9RA 1OIVA 1BYIA 4G5QA 4CW7A 3WBKA 1FUKA 3CR7A 3L0IB 1GKUB 4KXFB 4I81A 4Q4HB 2WPDD 3NEJA 3AH8A 4JLVA 5FI0B 1YZLA 4DLWA 3X1DA 4GMDA 1F2TA 4QBFA 1Z22A 3LV8A 1TQ4A 3QPWA 1KMHA 2H1LA 2EFEB 3RNLA 1EFRA 3B82A 3AVVA 4ZI2A 3W8RA 2OXRA 3GJ6A 5AUQA 2QBYB 5FOVA 3L0PA 4C0AC 4P4SA 3M1IA 5C2JB 4JLPA 1TTTA 5EZ5A 3U5ZB 2YC2C 3AKCA 1I2MA 4JJZA 2G1JA 1M7BA 3FMOB 4L15A 4F92B 4O2LA 3QENA 3H4MA 1IN6A 2RB4A 1VCIA 1E1RA 2AD5A 1Z08A 2IYVA 3R7WA 4URZR 4MYTA 2DPXA 2Z0MA 2IYWA 1VHLA 1CLUA 1QHHB 4MYUA 3AP3A 4M1SA 3AVYA 3BS4A 2QTHA 3C16C 4OL0A 3EPLA 5TDHA 1OH5A 2VEDA 3FOZA 2GTPA 3QF7A 4NU0A 3ZS8A 1E4VA 4RJLA 4D81A 2FSFA 3HYTA 4CYMA 2LWIA 2RH5A 4HUQA 3FKSD 4RD3A 4B2PA 3QXSA 3OAAD 2XJ4A 3K0SA 1Z0DA 3PEWA 2A2ZA 3IHLA 1KDRA 1ETUA 1D5CA 1KO8A 1U9IC 1S2MA 3THWB 3HJNA 4AD8A 1P62B 1OHHD 2FA9A 2JLVA 2WVJA 5KPDA 1G5PA 2ZYVX 1KI6A 1HTWA 1E0SA 1FL9A 1CR4A 2ORWA 5ANRB 5EUMA 2QTFA 5FL7A 3U7GA 1W7AA 2JLWA 1EESA 1U81A 3AKEA 4KFSA 3MCAA 4D4JA 5EP3A 2N46A 1NJGA 4M1WA 1B0UA 5TXGA 4EUNA 5FPHA 3LA6A 2G0TA 1W36D 2NO9A 5L3VA 2PMDA 3ICEA 1UM8A 1NY6A 2Q0HA 4BLPA 5KUTA 2FSIA 3CF2A 3LW8A 3K53A 4EPWA 4ESVA 4HZUA 5HCIA 4PHTA 4NE2A 3KL4A 4UNQA 3I5XA 3ECCA 3G5UA 4Q9IA 5EE1A 2WZQA 1XMSA 1G41A 3D7MA 3B1ZA 2VHTA 1WQ1R 1AN0A 4QFMA 4HLDA 3EIHA 3JZAA 3K0FB 1JJVA 5HTKA 3QKRB 3SN6A 1C1YA 4D25A 5C46F 4BLTA 4GT1A 3RAPR 4D6PA 4K46A 3P4XA 4C7OA 1IXZA 4E5UA 1Z5ZA 1W46A 4TLBA 3U6BA 3A4NA 1MR3F 2BKEA 4LC0A 3WBJA 2CLSA 1BYUA 3E1SA 1LY1A 1YRBA 1G6OA 2IC5A 2O0JA 1Z47A 3KKOA 1FPMA 2GCOA 1X8KA 1IN8A 2WOJA 4W5JA 2CHVA 3DPUA 2CHGA 3B60A 3ZQ6A 1HE1C 1XXHE 1E2IA 5F98A 4IOMA 3ZZTA 3NBZC 3TK1A 2HXYA 3KZ1E 3M6AA 3O8BA 3DZ8A 2EU8A 5HE9A 2ZVQX 2JLQA 3VTKA 3FGNA 4Q18A 1US8A 2C04A 4C3ZA 5B58C 4X8MA 4GZLA 2MMCA 2VTKA 1RJ9B 4FINA 3G82C 1S4QA 1KGDA 3I8SA 4O25A 4BQSA 3AVPA 2HUPA 1AS3A 1KOFA 4JLBA 1F2TB 1TQDA 4DUGA 3U4QB 4U7DA 1IOZA 1KMHB 2ZSAA 3U2QA 1T3SA 4OI2A 1II8A 2IUSA 5FR1A 4LCBA 5DLQC 3FPAA 3BFKA 4KSCA 1UKZA 1LFDB 4JSYA 2VO1A 3UKDA 4IRUB 1NVVQ 2F6RA 4JLKA 2KE5A 2ZRDA 3T35A 1TPZA 4MGIR 2J7KA 4LOAA 4IDOA 1LV7A 3QY0A 4GP7A 1CR2A 4KLNA 2FF7A 1N6RA 4R9UC 3CX6A 2WSSD 1DBSA 3R7WB 3UMRA 1NKTA 2XZLA 3N2IA 2E9SA 2ZRIA 4MUAA 4Z8XA 1SVSA 3QEJA 5GJBA 1A7JA 1NSTA 4ARZA 2ZAOA 1DOAA 3B1XA 1II9A 1SQ5A 2OBNA 3I73A 3G0HA 1OW3B 3THXA 2EFGA 1V43A 4PTLA 2LKCA 3NIBA 2ODNA 2W6JD 1E1QA 2QORA 4BASA 4XVQA 2C96A 2O8BA 1E2HA 3LO5A 2QRZA 4V03A 1G9XA 2QG6A 1WA5A 5GVRA 1NSFA 3AVOA 3TSZA 4LWZA 2A30A 1W5TA 3H84A 1KY2A 3LQQA 1VG0B 1P5ZB 1IN5A 4E22A 3I61A 3A4LA 4TLCA 3VR5A 3K09C 4AKIA 2IF2A 3J81k 2IS4A 3AQ4A 1VCOA 2R44A 3B85A 2XJ9A 4RD1A 3F5FA 4PO1A 1TMKA 1KSGA 1NG1A 2GJ8A 2QT1A 4UQOA 4Q9LA 1ZNWA 1J2JA 2B92A 1KHTA 3CF6R 4PPGA 3K9NA 3PG5A 3Q85A 5G40A 3T1QA 3GJ8A 4LHXA 4A0RA 1H8HA 3U7FB 1GUAA 4GZMA 4QKQA 2JLXA 1L4YA 3B9PA 2J1LA 4M0LA 1G17A 3AV0B 3A1VA 2R6FA 1KK3A 2G88A 1I4TD 4LYHA 1HUQA 1S96A 1ZW6A 3F3YA 1GG2A 4PHFA 3U3JA 3TUZC 1F2UA 1WDTA 4C7OB 4A0FA 5F9FA 1L7VC 3T5GA 2WSMA 3CWZA 2ZPTX 4EJSA 1HT2E 1P61B 2G3YA 1KDOA 4V0LA 5AUOB 2ZS7A 1S9HA 2XB4A 2CVHA 2GCOB 3HDTA 4EPVA 4LC1A 1XXHA 5EXPA 5FPYA 2VHUA 5CB8A 5C4MA 1E2QA 4B3XA 2TMKA 3SNHA 1YZGA 2GK7A 2W2XA 1JAHA 3L8ZA 2XXAB 1KAGA 1RW4A 2CDNA 4NDZA 4FIDA 4LSGA 4RZUA 3NDBB 1ANKA 5FUWA 1AZTA 1E0KA 1NBMD 4JVMA 3GLGE 4ZIRB 1LS6A 4DDTA 3AF0A 4IKEA 3I5YA 1DAFA 1KZ7B 5JMTA 4ZCMA 2PEYA 5AJXA 3CNLA 2FE4A 2CK3D 1KK0A 3W6OA 2OBMA 1G18A 1CTQA 3SFVA 2A78A 1N5KA 1TUEA 4WA7A 3FB4A 1IQPA 2H92A 2YC4C 1FNNA 1F60A 2BMEA 4CVNA 1YZUA 1G5RA 4QL3A 4GMXA 2QUZA 2DR3A 2YKGA 1EWRA 1ZM7A 3HYRA 2R6DA 2WHXA 1KSJA 4X8HA 3KKMA 3ADDA 3BGWA 1CJVC 2IHBA 1XD2B 2VP2A 1G7TA 3I4LA 4LBVA 3IQWA 4TLAA 1NVWQ 3K70C 3WP0A 2FPLA 5TV2A 3GLFA 3AB3A 3T61A 2P3SA 1XTJA 2FN4A 2HYDA 2ZI4A 4B3CA 4K8OA 2QMOA 1ESNA 1UADA 4R7ZA 4ARZB 2XB2A 121PA 1NVXQ 3DKPA 1RYFA 2QP4A 3BRWD 4BFYA 2JJ2D 2ZREA 1G3QA 2P5TB 2XOKD 3LBIA 1EFTA 2WAYA 2B6HA 3TUJC 4NCHA 1Q21A 2HF9A 4URUR 1YZTA 4DIEA 1E0JA 3PUXA 4ASUD 3RHFA 2GHIA 1HE8B 2JJ8A 2Z5FA 3BJIC 3C14C 3QG1A 2ZR0A 4KI0A 4V0OA 3KQKA 5DI3A 2C8VA 4LHWA 1OFUX 2WWIA 1TAGA 3KB1A 2V55B 4MYHA 4FI3C 1G291 5J4HA 3VFDA 1VIYA 4G5OA 4TQUS 1OFHA 2V54A 3PUVA 2V3CC 5FFMA 4AG5A 1VCNA 2B7BA 4JKYA 4LYAA 2O8CA 1UKVY 5DN6A 5SZJA 1PV4A 3WHLA 2QPAA 2AHOA 5BN4A 1NIPA 5LPNA 1DEKA 4TZ6A 5LD2B 5A5GA 3REFA 3FYHA 1ZNYA 2W00A 1T5LA 1W4CA 1GNRA 2JJ1A 5ELXA 3VR4A 1ZC4A 3RVBA 2OAP1 4HB0A 3S1AA 5EXTA 2YV5A 1R7RA 2IF0A 2ZRKA 3A8TA 1G8GA 4BUJA 2P2LA 4F4CA 3BD9A 2UVQA 1Q1QA 2WPDA 1G8YA 4Q7JB 1VYTA 1V5WA 2J59A 4M8NE 1DS6A 3TBKA 4B6FA 4DRZA 1NMXA 1NLZA 2YWHA 1SVKA 3AF2A 4LYJA 3VU9B 4AIIA 2HXSA 4ESHA 1DAKA 3AVUA 3GLHB 4QM6A 4YXWA 4H9GA 2CBZA 1IN4A 5HZKA 2GEVA 2A5DA 2F43A 2J0UB 1DG1G 2ZE7A 3F0TA 1EWQA 3OHMA 1SVLA 2OHFA 2UKDA 3TSOA 1ZP6A 1LVGA 5JJLA 1XXHB 2A5FA 1SKQA 2BMFA 1UBFA 4DWJA 2X2FA 4DCVA 1MO5A 5FTMA 3K9GA 4C0JA 1QHGA 5L3QA 2P6NA 1E99A 3EC1A 4TL9A 2IUUA 4Q1AA 2F3TA 4RD0A 3FHOA 3GLGA 1Q20A 5E95A 1G7SA 1FQJA 3LH5A 1OB2A 3LFUA 3GPLA 4IOKA 3CNOA 5FBRB 4NYJR 1B23P 5B30A 5JI3E 2R6GA 3OIWA 3UWOA 4DSTA 3RWOA 1E1QD 1OB5A 2OUKA 3AGQA 1U90A 1UPTA 4MRPA 3FKSA 3OAAA 3I1FA 4Q1FA 4CEJA 3KQNA 3KX2A 4B44A 1XTRA 2NPIA 3FE2A 2Q3HA 2ZRMA 1G64A 4B76A 1CF4A 4ZV4A 3UATA 5IRCD 1OHHA 2J7PA 3I72A 3KDSE 3FMIA 3SBDA 1L2TA 5F3WB 4QGHA 4KV9A 2HLDD 5CK5A 5EXXA 4Q7MB 5DI9A 4C2UA 5LDDC 4NYIQ 3ZLJA 3ZH9B 4I1SA 2P0EA 2G83A 4EQ6B 4CZ2A 3L2OB 3SFZA 3GLFB 2VP4A 4IEEA 2DY1A 2CL0X 3KKPA 1XPOA 1XNJA 4TMKA 1JECA 1Z3IX 2BC9A 1GOTA 1W49A 1N6HA 1RZ3A 5CK4A 2O8EA 1M34E 2CCKA 1CU1A 4R98A 2ZR7A 5AR1A 1D8TA 2VRWA 4Q4HA 2IYXA 2GXAA 4P4UA 1F48A 1XBTA 4TMWA 4PQFA 4RSGA 2V6JA 4HAXA 1CIPA 2O0HA 2AK3A 1EX7A 2J46A 1U8AA 2Q3FA 2W0MA 4DLZA 3KQHA 2H7VA 3QI2A 1R6BX 5K8UA 2NZ8A 2ZUDA 5DI3B 1FTNA 2FOLA 1FW6A 2WWYA 2ZE8A 4AKHA 2QBYA 2G0NA 3VR3A 4DSUA 2ZANA 1AA3A 4BRUA 3RSOA 2OBLA 3UWKA 4ITRC 5G3ZA 1PVOA 4AURA 5JS7A 4KYIB 1NIJA 2XZOA 3PJRA 1QVRA 1VG1A 1GP2A 1E9CA 1W4BA 3MRSA 3NHAA 4L16A 1GRQA 4M21A 5BW8A 2CLDX 5P21A 1SXJB 4DDUA 1N6PA 2LCFA 1QHHA 3S1AB 4AC9A 4GL2A 2QPOA 2WJIA 4RCYA 3RRNA 3W90A 1NP6A 1NRJB 1NBME 1PZNA 3BC1A 4BPBA 2D2FA 3EPHA 2WJVA 2YOFA 3TRFA 2FPKA 5SZKB 4PC7A 4Q9JA 2OFWA 3T15A 4A6XA 4US0R 4HAZA 1SHKA 1X86B 1X8JA 2AD1A 2C9OA 1JI0A 2ZRPA 4HEJA 1KO5A 4EKDA 1MABB 4OHWA 2P5SA 4JIMA 4BFSA 4EAQA 4Q02A 4M22A 4XSGA 4B73A 3H2YA 4LBZA 2ZU0C 4L5BA 3GFTA 3THOA 2DFKB 2QI9C 1EGAA 1G8PA 3FMPB 3K0EA 4BECA 1N0UA 3O8DA 3A1TA 1W0KD 1C9KA 3GEHA 2WKRA 3GJ5A 3IEVA 4C9BA 3IPYA 1A82A 4A1FA 3LXXA 4HLUC 4MITA 2JAQA 5L3QB 5JI2E 3TKLA 3W8NA 2ZIAA 3Q7QA 4NCNA 4OQLA 4AKEA 2ZYTX 3OIYA 1KKMA 4A92A 1J90A 2NO6A 4V0KA 3SJZA 4RCZA 4B2IA 4LHZA 1Z83A 2QM8A 5KNDA 1XTQA 5FI1B 3CF0A 1G16A 3Q8XB 3Q9LA 4ACBA 2BWJA 5AUNB 2R8RA 3VKHA 4HAVA 4B48A 3DEFA 5CIWA 4GI7A 1W1WA 3DMDA 2KWIA 2W6JA 4LUCA 2G1KA 3BE4A 3CB4A 4CEJB 2VPPA 1P6XA 2G6BA 1GAJA 3QKRA 1N6IA 1JJ7A 4ZCIA 4XTCS 4BLRA 1VDZA 3DM9B 1E69A 4A2WA 4P4TA 1QHYA 4PX9A 3ZVLA 3UXMA 1JALA 1N0VC 2V6IA 4UXJA 3MLEA 3T5DA 3T34A 1RPZA 2PX0A 4OI1A 3HU2A 5FH9A 3GP8A 2FGJA 3MWYW 4TT3A 2GZDA 4UJ3A 5J4VA 3K0CC 1N0WA 5CDFE 5KSYA 4U02A 5FOTA 2C5LA 3TSWA 4GOXA 2JJ1D 1P4SA 1S0UA 3TMKA 2O8EB 2ERXA 1SXJD 3CUEF 1P2VA 1XJCA 1E9AA 2VF8A 3K8YA 2D4HA 3DHWC 3QNUA 1PLLA 1XJQA 4R71A 1U0JA 2MMGA 4PANA 4BZPA 4FMDB 3SS8A 4YMTA 2QZ4A 1FP6A 1RJ9A 2VL7A 3Q72A 4LJ5A 5KHOC 2IEZA 1OH6A 3FMFA 1R0WA 3HWSA 4Q4LA 3DOEA 2QT0A 2R65A 3I92A 1AGPA 3RRZA 3ASZA 4Q9HA 2R6AA 2GXQA 2IYRA 2C03A 3U4QA 3BK7A 4YXWD 4JLOA 4JLNA 1WBDA 1IBRA 4GOKA 5LBIA 1UDWA 3N5CA 5CM9C 1WE2A 2O52A 2IL1A 3SZRA 1YR7A 2VA8A 1YR6A 1JR6A 4GOJA 2CXXA 4YMWA 5L8VA 5JHGB 1Y63A 1E2JA 1MT0A 2Z4RA 4LYFA 1TQ6A 4M1TA 4JYCA 1ZNZA 2R6CA 1E2EA 4HZIA 2F55A 1Q44A 5E7MA 521PA 5EE9A 4ZDKA 2MSCB 3NG1A 4MRSA 2FFHA 1FX0B 4R2IA 4L8GA 1T0JB 2D7DA 3W34A 3FKQA 1XCMA 4D0LB 2CNWA 3GMTA 3NTUA 1X6VA 2HV8A 4B75A 3IIMA 3U44B 1K8RA 1L4UA 1NBMA 2GEDA 1BMFD 2VSOA 3ASYA 4DBLC 4Q00A 1M8PA 1LTQA 2BMJA 2GVZC 1OPXA 3MSXA 5FTJA 4B3BA 3UANA 1PLJA 1QVAA 2VSFA 5EXSA 4FCVA 4LJ9A 4IDQA 1JNYA 1QF9A 5EJEA 1IY1A 3QIAA 3IIKA 2CK3A 4LZZA 2F1IA 4KBFA 3CH5A 3U3OA 3VHXA 2KI5A 2FSGA 2BBTA 4DDWA 4PQRA 2R2AA 4KJZA 3EASA 1OT3A 4KBGA 1WBBA 2J7PD 1OSNA 4LY6A 3A37A 5AWFC 4GDFA 5AK0A 4D4LA 4CF7A 1KI2A 3Q5DA 2REXB 2IEYA 3GCGA 2AN9A 4Q66C 3PEVA 4V02A 3ZIAD 4P3YA 4QHYA 3BERA 1HURA 3CNNA 1DAHA 1G3IA 5DIFA 4JBWA 1LF0A 5KNBA 3AM1A 4HYYA 2PMKA 3F8TA 3TVDA 3WP1B 4MGZR 2AWOA 2IXFA 4MKHA 5HKKD 1H8ED 1AJEA 1VG8A 4JBYA 2J41A 3IO3A 2BM1A 4N0EA 1AIPA 2WV9A 2DWPA 3OEHD 5JWHA 4HDOB 3RYTC 1OYWA 2IYSA 2QM7A 2QAJA 3PUZA 3RDPA 3NC0C 4YQFA 3TQCA 1HQYE 3QG5A 4P32A 1VIAA 2JJ2A 3QEOA 1T9HA 2XOKA 3CRVA 2OE2A 2FEOA 1P3JA 5FBQB 1Q12A 1XFAA 4OJKA 2RMKA 5H70A 4ASUA 4GRAA 2AK2A 2N1BA 5LB2A 1YQTA 4QJ5A 2H5EA 4EFMA 2RKOA 3GLHE 3RS0A 3VNUA 3ZS9A 4DLSA 4XVUA 2XTNA 1GNPA 2F3RA 4HB3A 3X2SA 1DAGA 2OG2A 1Q3TA 5CDFA 1UKEA 1XWIA 5UKDA 4DVGA 5SZHB 1IONA 1JEDA 1Q57A 2JIZD 2XEXA 3IBYA 4Q48A 5JEDA 5FOUA 1OIXA 2ZYWX 4C0QC 2XXAA 2H16A 4WBSA 4F7WA 4AY2A 3A6PC 3RS5A 3DVLA 2EFHB 2YWGA 1TEXA 5JBQA 1KI9A 4PFSA 3GLIE 1ZUNB 2IBMA 4JLJA 4ZIRA 1IJFA 4RD2A 4UKDA 4D0NA 1XJ0A 1KNQA 2VF7A 5FL3A 2YYZA 4PSAA 3Q5EA 4FWIB 4ON9A 2AXPA 1NL3A 4M9XA 2GCPA 1GKIA 1YKSA 3HPRA 1NF3A 4XSHA 2ZRHA 3C4JA 1JQLB 1KDPA 1QRAA 3OIUA 4EDHA 1LB1B 3NH6A 2BCJQ 3VR2A 2QSZA 3AF3A 1Z6XA 3IEUA 4MDFA 3I62A 3VX4A 2P65A 2WOOA 3LBNA 4CT5A 1ZNXA 1IXSB 4HDCA 2PLRA 3EA5A 1KO4A 4KITB 2NZJA 2JLUA 1XD9A 3DO6A 1N2CE 1D2MA 3NEYA 4PC3A 1I4LD 1XD2A 3SJBA 2O8FB 3EXAA 1GL6A 1VCMA 3LWNA 3KJEA 2PZFA 2RCNA 1O87A 4MUBA 3HR7A 4ACAA 1P2UA 2I1VB 3RS2A 3GLFE 3QF4A 1XEXA 1QDEA 3TR0A 2GEUA 4RZ2A 4Z54A 4W7SA 2OSBA 2HT6A 1JPJA 4LJ7A 1SGWA 4QGAA 3WMGA 2PT7A 1OFIA 1XTIA 1R8QA 3LY5A 1DG3A 1UBCA 1MO6A 3P26A 4NH0A 1E2LA 3BBPA 1LW7A 1MV5A 1LS1A 3FTQA 5JRZA 5DHAA 1CP2A 4TSFD 3THYB 1UBGA 4DLVA 3L43A 3ZQJA 2EYUA 3MJHA 4M1KA 1XMJA 5JHHB 4XWKA 1COWD 4KSBA 2XX3A 3BIFA 2F9MA 3AVXA 4A4DA 3AUYA 1OE0A 4LJYA 2OILA 2DFNA 4TT3D 4B35A 2VQSA 2HLDA 1NG9A 2HYIC 3U7EB 1E32A 1HV8A 1QHSA 2C99A 3AF4A 3QE0A 5KNCA 2DB3A 1UKYA 1ZBDA 4ZPXA 1J70A 3C8UA 2DCUA 4B3DA 4Q4JA 3IUYA 5KDOA 5GJCA 3X1XA 4ZKDA 421PA 5JRJA 2ZRAA 1EXMA 2F7SA 4BGDA 4IDNA 5KSOA 4QNRA 4PC6A 1SXJE 3WNBA 2VLIA 4OHXA 3WRYC 1N25A 2PX3A 4Q1EA 2R62A 4HATA 1YVDA 5FTLA 4RKFA 4XWOA 5BWMA 3PFIA 2KSQA 2Q9AA 4JL5A 3QVUA 1G4UR 3VU9A 4E07A 4MKIA 1AS2A 4OQNA 3GLHA 2UZIR 2BIFA 3VAAA 2FFAA 2QA5A 4B6EA 2V9PA 4P0TA 2ZSFA 4MKGA 4A15A 5J4YA 2BV3A 2XNSA 5TMPA 1Q3HA 2IUTA 4A82A 3BH7A 2DFLA 1DADA 4JVLA 1P72A 2J0UA 2AWNA 2I3BA 2Z4SA 2W6ID 1IAQA 2ANBA 2C9CA 2GILA 2QU8A 2VIIA 2O8DB 2WMOB 2NO0A 1W44A 2FMXA 2J45A 3SQXA 1I2DA 2GA8A 4GPTA 1XF9A 2GBLC 1F3OA 1OKKD 2YZ2A 5M04A 5TVKA 4HLCA 2C95A 1RKBA 2CNWD 2C77A 4OK3A 3GLIA 1GL9B 2ZRFA 5A0FA 4OQFA 3HP1A 2OCPA 2BBSA 4IDPA 1HA3A 4RFVA 3RRYA 1Z6TA 6Q21A 4MYCA 2KJQA 3VR6A 3ICQB 4IVPA 4BEJA 1KI7A 1N5JA 2JEOA 1MOZA 4BLOA 1BH2A 4POAA 3QSYA 721PA 3FHTA 1E4YA 1E9BA 2D06A 5E7JA 4DEXA 2ZEJA 1E9EA 4Q1CA 3VKGA 4HB4A 1Z8FA 3OE7A 4YONB 4FMCF 1E2GA 1S9DA 4ZDWA 5EE0A 2EWVA 2A5GA 2IA5A 1KDTA 1MKYA 1WP9A 1H65A 2NO7A 2BCGY 2GRJA 2OCYC 3ZGXA 2QMHA 4W5WA 1W0KA 2B8WA 2CVFA 2GAOA 3GJ7A 4PZZA 4DLRA 3MWJA 2GVDC 3B2EA 5GVSA 1Z06A 5FTNA 2H57A 4EQ6A 5JCPA 1KK1A 3HU3A 1DELA 2J3EA 1GRNA 3QOFA 4Q1BA 4DT1B 2BJVA 4A9AA 4PHGA 3QF4B 5J5CA 4NBSA 1XEXB 2ATXA 4Q47A 4WZ6A 1IY2A 4JT4A 4A8JC 4F38A 1Z29A 2VH5R 2W58A 3QXJA 2WJYA 5CYPA 3KJIA 4S35A 3SBEA 4KLZA 2EFDB 2EW1A 4MA4A 4C0KA 2AFHE 1N5IA 1OH7A 1GILA 1KI8A 4DB4A 1IXRC 4HDQB 1RRFA 1Z07A 2C78A 2VBCA 1J8MF 1R10A 4AYXA 5BN3A 1P9WA 3KTAB 3SJCA 5JWOA 1JEEA 1F5NA 3BAFA 3V9PA 1S1MA 2GXSA 3DL0A 3PUWA 2JLYA 3L0SA 1T3LA 3N2EA 1YE8A 1I4DD 2PCLA 3PEYA 4EJSC 1JXMA 1NLYA 4CDGA 1RIFA 4D82A 5DO9A 2D74A 1JAIA 3LVQE 3I32A 3EARA 2F1JA 4Q4JB 3UG6A 1XTKA 2CMKA 5TB5A 5H8WA 1M2OB 2FH5B 5J4LA 1SXJA 4O0MA 5G41A 5JJKA 5JFGA 3K70B 4UNSA 4PO9A 1GSIA 1K5DA 2RAPA 2QGNA 2ODEA 5CYOA 4F91B 2HF8A 2A7QA 3KQUA 4B32A 1G20E 4Q1DA 4PSKA 2OAQ1 2CE7A 2IT1A 4NMMA 1R0ZA 2ZI6A 2ZS9A 1VKJA 2Q9BA 4N3NA 1E9FA 3K1JA 4TQAA 4DLUA 1ZUIA 4KCGA 1MABA 1BS1A 1DARA 1TUIA 3ONWA 1HY3A 2OFXA 3IBGA 3W6PA 4BZXA 3I8XA 1XZQA 4LJ4A 4DJTA 4DDVA 5EP4A 3WYFA 3C41J 1J99A 4GP6A 2RHMA 4KU4A 3L82B 1MH1A 1DAIA 1W47A 2FU5C 4Q01A 1FOEB 2QQEA 3CBQA 3TH5A 1ZCAA 4V0ME 1ZVQA 1FQKA 2IYZA 3CZQA 1OXXK 2JGNA 3GLIB 1RRPA 1G3RA 2HJVA 1Z0KA 1P2SA 4PC1A 2GJSA 1DAEA 2OXCA 3EZFA 3LW7A 2BVNA 4PPNA 1BMFA 1AQYA 3ND9A 3P1JA 4Z8YA 5FTKA 1LF5A 4RKEA 3W6NA 2BDTA 1VHTA 3CH4B 4XD7D 5H1YA 5HE8A 3ZDQA 1IY0A 1E94E 1G8HA 3EG5A 3FDIA 3QQ5A 4LBWA 3CWQA 1XD8A 3BWDD 3KXLA 1T4GA 3ADKA 1OYYA 4LBYA 2HJGA 2QSYA 4ZDIA 1JR3E 4L9WA 1P7CA 4TLEA 3ZD6A 2J0SA 3PQCA 2XITA 3EZ6A 4Q4AA 3MMPA 4NCKA 3HR8A 3SU8A 5AJYA 3RS4A 2QGZA 3CRW1 4IDHA 2WM9B 2XTZA 4A36A 1GRRA 1UF9A 4JS0A 1OXSC 2ZSEA 1W0JD 2QN6A 3ZIAA 5IHPA 5DNYB 2CCGA 1Z63A 1E2NA 5A4JA 4TL7A 3TAUA 1AK2A 1U8ZA 5D3MB 5KOYA 2WICA 3R9XA 3QVVA 5IT5A 2OO7A 3NBXX
chains in the Genus database with same CATH superfamily
2HKIA 4F4DA 2QL9A 3EGEA 3R7BA 3K6JA 2MHCA 1XVVA 5IUNC 4E03A 4RWEA 3ELYA 3OEHA 2OR3A 4WEOA 5ELMA 4JSRA 2AOVA 3CWCA 2AFHA 2CJWB 4WV3A 3VYRB 1THMA 1S01A 3H1BA 3U4IA 2RHWA 3PC4A 1NN5A 5CT5A 4K81B 4RFSA 3WL3A 3B6EA 3GUYA 2Q7DA 3OBBA 1XELA 2AJTA 2QV0A 5LQAA 4LFAB 1O8CA 3G2QA 3Q5GA 3NC1C 3B7GA 1NVVR 1KDZA 1PUIA 3PB3A 1E4EB 4WWHA 1U99A 3PC8C 4ZV7A 1I33A 1N8KA 1T9GR 2H63A 3ETLA 3FFXA 2GBPA 5DVZA 5FOSA 3RH0A 1MG0A 2EKLA 4JY7A 4MVJA 1SUDA 4D74A 1X1RA 4P7FA 2ZJ5A 1P1IA 2ERYA 2C3MA 2FPRA 2XKAA 4MINA 5CBPB 4JYBA 1C0EA 4C88A 1YAHA 2R6HA 4UATA 3QXXA 3Q3JB 5IW8A 4FIZA 4YK7A 2A86A 3IODA 3IAAA 1ZGJA 2ZCUA 2Q5LA 1ORRA 1SUIA 2JIZA 2QOEA 2XKJE 3D7NA 4K1LA 1QCZA 3KALA 4J43A 4GE3A 5HG0A 5JSUA 5CVCA 2D0IA 4TTSA 3T1VA 1Z6PA 4TZ0A 3NUGA 4DOMA 2K7FA 3L01A 2NO4A 3BJRA 1YF3A 1Y80A 4JL6A 4RNDB 3H5NA 3N9IA 5D3QA 1RTTA 1U2RA 2CF5A 2C5AA 3BFVA 4YJ3B 2VUTA 3EXEB 3OVMA 3D4NA 5FAXA 4FLEA 1JHOA 3ZU2A 1KJYA 5FDFA 4FMDF 4IWNA 1E98A 1F4LA 4KACA 1PJZA 1T9BA 4ECEA 3UFBA 1EK1A 3GGCA 3CY6A 3MMZA 4JX9A 4OUKX 4MW1A 4MV1A 4WZBA 3WKAA 1YIOA 3GVPA 4OGFA 1ZC3A 1VMKA 4IUYA 1VYVA 4D96A 5J4KA 1M6VB 4E2YA 4ZV9A 5G4KB 3ER9A 2WKWA 3FYCA 3DZKA 1JHMA 2QUKA 2C7VA 3B2NA 1H4VB 5B4VA 1AVTA 4MV8A 2VRNA 3C3XA 4HNUA 1BRTA 2I54A 4KOAA 4FNMA 2NXCA 5NLLA 2A9FA 1BCRA 1GHTA 3BCSA 3GRYA 5DASA 5FD8A 5CGZA 4N82A 3SZLA 3EGVA 4BMNA 1P0MA 2V1UA 4MX8A 3AR2A 2X1MA 1KMNA 4N18A 4CGYA 1V48A 2BBWA 2FCAA 4MVJM 5F35A 4IIXA 5JNTA 1EX1A 3AJAA 4L9SA 1Z18A 4LXUA 4FQ7A 4PXSA 2EP7A 3CSUA 1S2LA 4IJMA 1R2QA 3GNTA 4TMXA 3RVDA 1W85A 2XMBA 1ZESA 1L4BA 4OQMA 4TTAA 3ADCA 4E7PA 5FLKA 1AS0A 1CJUC 3LXMA 1F6WA 2W2MA 3C3AA 2ZJ2A 3U49A 4EZEA 1G8FA 4ZYTA 1AZWA 5TEVA 5HGXA 1W36C 3DDHA 3PFBA 3OD1A 3NXKA 2OC9A 4BUCA 1EE9A 1CZOA 2NSLA 4Q19A 1PFKA 2PX8A 2WJHA 4XB6B 3G9UA 1RZVA 4WVFA 2C94A 2QROA 1W52X 2PTGA 4M98A 3UK0A 1QQ5A 2IOFK 1U0HC 5LB4A 4MGKR 1C7JA 1PFGA 2IZ6A 4UXIA 1FYEA 5BN5A 1OV6A 4Q4AB 1ADJA 5KCZA 3ANMA 2EQBA 2IIQA 5L3SB 5BNWA 5DGDA 4A6PA 3EJWA 3HDYA 2NTJA 2TSYB 2V6MA 3H86A 1HEIA 3A9VA 3AW9A 2IOFA 1ZR4A 4DYHA 2CGEA 3SWWA 3NATA 2ZI9A 1U9IA 4I5DA 3GNLA 3W2EA 5KS2A 2EW8A 5EQTA 3I5UA 5IZCA 2DWOA 1R3UA 4ZU6X 3E9CA 2JLZA 2FY8A 3OU6A 1WCV1 1T8PA 1JA1A 4H1TA 2EEZA 3KWLA 3A6FA 5B6PA 1E79A 1K2VN 4GGPA 1XN1A 2LBPA 2XLBA 4Z1MD 4M2LA 4B2LA 4MKFA 2GKSA 1YD7A 3IEKA 3JD3A 4ZOBA 1Z0SA 1QU2A 3EX7C 2ZRNA 1TJ5A 2WY2D 1KETA 4BFUA 3E2IA 4H7FA 2Z43A 3VNQA 1UPXA 4KVAA 4FYYA 3CRMA 4P4NA 3QKSB 4UVDA 2KPOA 5JXGA 3DEKA 4REMA 3PZBA 2FK8A 4B47A 4HGQA 3DLCA 1NW5A 2Q0SA 5EJMA 2HSGA 2YBDA 4E3ZA 1WXQA 3AC0A 1S3GA 2GYVA 4Z51A 4XYGA 2O3RA 1BSVA 1YDGA 3ORHA 3M1AA 3CF4A 1B6RA 1L4LA 1AKEA 3O5AA 4UTRA 1P1JA 1BQ4A 4C2AA 2UXCB 3B5JA 1ZRHA 2PBRA 4HNSA 3SXUB 4Z49A 2QLTA 4UNPA 4YJDA 4RQUA 3J80A 5EZ6B 2FWMX 3C3YA 2P4QA 1UAAA 3PFKA 1INLA 1BA3A 2VP9A 1X3SA 1XU9A 3GQBB 4H18A 2MSDB 4HDKA 2RHDA 2WHRA 3AETB 1D9ZA 1Q3KA 3OFKA 3FYTA 2CXTA 2XNDD 3ASVA 2ZRLA 1ZH8A 3A32A 3H75A 4QFCA 3WTCA 2JVKA 2XYVA 1GPJA 2FOIA 1BDBA 3PTAA 1T4CA 3QLVC 3EHDA 2YBEA 4QICA 5IKOA 3SQNA 4D0GA 1VIVA 2FN8A 8GPBA 1E18A 1YR1A 4MUFA 1V9SA 2QRNA 5IT0A 3T41A 5ITZA 2ZM5A 3LTNC 4DR7B 2DH5A 3ZCTA 4B74A 1L4FA 4AQYB 3QU9A 4MTLA 1PSDA 4LSZA 1CVLA 3TBHA 3L07A 2IYTA 3PQEA 4NE9A 3VR1A 5ALJA 2EWMA 3NV7A 5HBRA 4UHJA 2VHJA 1RIIA 2JFQA 2RH4A 3V33A 1QX3A 1PJAA 4U3JB 1Z6GA 3BMOA 4B6QA 4MLZA 3U5TA 4PAWA 2EVWX 4MIKA 3THYA 1FRVA 2UYGA 4UBMA 3BCHA 2G9QA 3L3BA 4HH1A 1GGVA 5HMMA 4G0XA 4QSHA 1NQAO 1U0GA 1UIMA 5A2QA 2J5XA 4L3VA 5JQGB 1XTSA 5L3ZA 1CRQA 1RRCA 3KETA 1ZA1A 3B38A 3OX2A 1BVUA 4NKRA 2M6KA 3WMEA 4CPDA 4G97A 4RLSA 3UMVA 2P8SA 4I1UA 3VKUA 1K0FA 3OKCA 4M1OA 5ITVA 2WMYA 2PKQO 1P9RA 2A0FA 3L4BC 3HEMA 3QX8A 4JMLA 2QD1A 5C1BA 1QHIA 1U1FA 3NRCA 3L02A 3VSCA 3DXFA 3TQSA 2OB1A 2VDUE 4PAMA 5IYZA 4BX0A 1S02A 4WLNA 1JDZA 5IXJA 4I1RA 4XWAA 4E1VA 3FBTA 4WGGA 3DH0A 3WOHA 5IBQA 1R0LA 3CYFA 1O58A 2PSHA 2D8MA 1NKSA 1NJ2A 4IHQA 4J90A 1IIBA 4YUVA 1OTHA 1BWRA 1QG4A 2GN2A 2YVUA 1PJ4A 1P73A 4HT3B 3R8FA 4NL4H 3KKNA 1Z73A 2PMEA 4PGMA 5DN9A 3HBNA 1TKRA 5IVKA 3T4XA 1MO4A 3GG2A 5LBTA 1S89A 1T1JA 3VC2A 3WHPA 5HJ2A 3LQYA 1LC3A 4TV9F 3EMDA 1CRPA 1FMLA 4J6EA 4MVJD 1AGRA 3D2BA 4YMUA 3T12A 3F7MA 1PYGA 3LC1O 1U2EA 1SBIA 4UNRA 4W1SA 2WIJA 1HT0A 1SFRA 3OF3A 3W9BA 3MGKA 3I1YA 4JLMA 3UV3A 4CFSA 4BZQA 2XRZA 2EJTA 4QX6A 1FF9A 4KWHA 3ECSA 2N9UA 3VHLB 1FZQA 2EP8A 4IRXA 3GMDA 4NYJQ 3ZDYB 1PW5A 2NN3C 3DOFA 5A5EA 2DBZA 5JALA 5KYKA 3ET5A 2BGJA 4ZA2A 1JU9A 3DQPA 4EG5A 2VP3A 2EL9A 4GAEA 4RHYA 4N0MA 1V3QE 5ESWA 1KKLA 1CUCA 1EIWA 4LS3A 4D43A 5AKGA 1SVWA 2XGJA 2RKWA 4X44A 1IEQA 4XGIA 4MS1B 4JT9A 1Q1EA 5E7IA 1U28A 4MHOA 4BNUA 3ZZUA 1YNSA 1C8LA 3R9IA 3K1YA 1QGUA 2CVOA 2W2TA 3FNBA 1TQ2A 3IDQA 3R6WA 4RHUA 4YCDA 2YIMA 3OP4A 1AT1A 1G42A 1B6GA 2VP0A 1MUUA 1H1LB 4KHZA 4WZAB 4O4LA 3D31A 2EHJA 1T4BA 3F7NA 4YUZA 3UWSA 3EXG1 3REQA 3CLVA 4Y0VA 3DA8A 3HM9A 4EFDA 1REQA 2ANCA 2ATVA 4PIMA 3SC3A 4EB6B 3ZDDA 2C98A 3FCSB 2GPSA 3HMKA 1NGSA 3ZV4A 2ACWA 1Z6ZA 2OD2A 1EP9A 4KB5A 3EZXA 3FDZA 4K7JA 4ENUA 1L5QA 3DMTA 2Q8PA 4B3HA 1WU8A 1ZMXA 1QYXA 2JLRA 2ZWVA 3AY0A 4PPYA 3BSYA 2AXNA 3HB7A 1EQUA 4HK4A 2EF0A 4EMTA 1X42A 2D5AA 2E4UA 4OXIA 2FJ0A 3DMPA 3MXOA 1UC8A 4NG4A 3TCXB 4CJXA 4LRUA 4DJJA 4IEIA 5EMKA 2R4UA 3Q6IA 1KOJA 1BDMA 4RMGA 1M74A 3EFHA 3PPVA 5JADA 3WJAA 4QLAA 1NNEA 1QNLA 3KKEA 2DHRA 3ETEA 2BFDA 5CLIA 5ECYA 3QMVA 1UM9A 1XUOA 4FNGA 2WJGA 4AUMA 2RARA 5KYTA 3I2FA 3PENA 2O7VA 2GBLA 1EFHA 5AI8A 2NTYC 1Q0QA 3FNEA 2IY8A 3RB8A 1JA0A 2J3MA 4JQSA 2P5UA 4J9UE 2XCIA 2K2QB 5HCNA 1JLRA 1OXUA 1QWSA 1JYFA 3GO4A 3R0JA 2XRYA 3UMYA 1NC1A 1PU2A 2ATCA 1XPUA 5BQFA 1FP4A 2I2AA 3GAAA 2AXQA 2GPNA 3WAJA 1MLDA 2C54A 4FXOA 4NK5A 1DWPA 2ZRGA 1RYMA 1U2QA 2HO5A 4IKPA 5AKYA 3VMFA 1E0AA 3WX0A 1RP7A 5ES3A 5HFAA 1XK6A 1EG7A 1EP3B 1KEEA 4RZSA 5MFPA 3KNZA 2ID8A 2BFOA 4IILA 5FUBA 4INJA 1TAUA 3IVGA 3T3PB 1SXHA 2JBHA 3MWFA 4BBPA 3TDKA 4UPVA 4QFBA 3SNKA 1EGHA 2NVUB 5TF0A 1KVUA 2JH3A 2CD7A 4BO6A 3P97A 3AY7A 1H93A 4TKVA 3ZCPA 4JJKA 2IPOA 2MTBA 5C51B 2BTQA 4IIJB 1EFCA 3F4LA 3IMEA 3LT1A 4M0EA 2FP4B 1CEEA 4IXNA 2FNAA 2J85A 3ONEA 4IO0A 3GEEA 4KDEA 1CUGA 4MHSA 1YHYA 3H8SA 2ZZNA 2R97A 3RROA 4F85A 1E79D 5ICSA 1XA3A 1C3JA 3KOMA 2Q2WA 2HA2A 1CBUA 4RSHA 4LSWA 4TYPA 1LQUA 2V74B 5KO2A 1XI2A 2HMUA 5H68A 3CVVA 2G9RA 1R4AA 1J97A 4YCLA 1CUDA 2FAXA 1XEFA 2FZWA 1A71A 2W8BA 4HRVA 2V03A 5CDYA 1W34A 4GD3Q 1PJCA 4B85A 5L4LA 2CVZA 3QHAA 2ASVA 5JAUA 2OTCA 3QU2A 4D2IA 1P1BA 4A8JA 2O5EA 2QYOA 5DSZA 1W94A 2PUHA 4C4TA 2ZB4A 1VBFA 2H1OA 3HP4A 4GPD1 3VSEA 3HVKA 3CUYA 5KPJA 3NR2A 1Z8DA 3ZWPA 3IO5A 4JFRA 1XP8A 1E60A 1A72A 1SIUA 3SEZA 1QRSA 3W5JA 2R1VB 1TDJA 3HEBA 4LHEA 5G1OA 3SYNA 1UKCA 1O6ZA 1Y1LA 2HJRA 1ZZEA 2YWXA 3HDGA 1ZGZA 3IAUA 4QDXA 1R0CA 1PSWA 5KEIA 2B3DA 3UIEA 4NWIA 2PU7A 3O38A 1RQLA 1RP1A 4DCTA 3KYJB 2HFJA 4BFXA 4INAA 4CKWB 4TTQA 2QRGA 4JUDX 1E63A 1KTVA 3BHIA 4NONA 2L19A 4AULA 4PYLA 3RBAA 4J0QA 4I2VA 3TW4A 3ZDCA 1EFRD 3W05A 4HAYA 2GEJA 1LQTA 3FHJA 3ZWWA 5TJHA 4KV7A 4YRGA 3OLCX 3JAKB 5DHPA 1AKMA 5BOVA 3I37X 2DQ4A 4WXYB 1TZBA 3K30A 4JB8A 1NZDA 1I0ZA 3GPDG 2VHWA 1S3SA 4OLFA 4YAUA 3URMA 4REOA 4OKSA 1PFQA 1F17A 3OIVA 3FVQA 4HSGA 4ND4A 2HDOA 3NTQA 3I53A 3H5LA 3BTOA 5FUYA 5JZVA 4MWTA 3PC2A 5LQUA 1Z82A 2QSJA 3MTEA 4KDRA 4ZYZA 3W1VA 3MJTA 3LUCA 5EJ8A 2WKPA 4KK3A 4TWRA 5IUJC 4WY5A 1GQQA 3FYUC 4MSUA 4UUOA 4RIHA 3EVAA 3KT8A 3ITDA 4AROA 3ZVMA 1X74A 5F5LA 6NULA 5J23A 4IP0A 3SF8B 1UMDB 2BPOA 3A2KA 2W0SA 1OZHA 2NXEA 4NNJA 4FONA 3DFMA 1J24A 3VNAA 2YOGA 3I1JA 3KJZA 2YHIB 3VH1A 2XDWA 4Z7NB 2IBSA 1U6KA 1USVA 2DFTA 2HQOA 2IXDA 4G5RA 4HQRA 4KYUA 2WKSA 3OOYA 4QJBA 4EGJA 2J9FB 4G4IA 1E3WB 1N6OA 1QZXA 1II8B 1SCUA 3ESQA 1PS0A 4XPIA 2Y1KA 4M9CA 5GGXA 3VNBA 5JDCA 3UT5A 5F1YA 1BVHA 1XDWA 2YWEA 4ZDJA 4DKJA 3ZJ4A 2ZJBA 3ZXIA 2BEUB 4OXXA 2D7CA 1G6HA 4HGPA 4V1CA 1WAMA 4PIVA 3OJFA 3NBFA 2TS1A 5FL7D 3WK7A 2QVLA 4PG5A 2CJWA 3KKQA 4TL8A 2CJXA 1D0VA 3QYJA 2XRMA 3U61B 2F3PA 4LFBB 3CXUA 3B1VA 5JH7B 2JI7A 4UHCA 4ZOLA 3SQWA 1W96A 3DF9A 4FPXA 4IOJA 2QP9X 2NUTA 3GNQA 1W19A 3B6JA 2CLCX 4U7FA 4UVHA 3UUWA 1JFSA 4AXXA 5KDDA 3CUTA 4YT5A 2RHCA 3CT6A 3NI2A 1E3IA 2CW5A 4D4KA 1A4UA 2FWJA 3VR6H 1BZYA 2WTUA 3OI7A 3FNHA 5CBPA 1AHNA 2IJGX 2JGKA 3BA1A 3BICA 3LECA 4LTNA 4Q39A 4NFSA 2ZI3A 3IT2A 3DUFB 2PXXA 2JAXA 3ZDXB 1RYDA 5F1KA 5B1DA 2VI5A 5GADl 1WPXA 2J0VA 2QYSA 4D79A 4DSOA 2VP5A 4WJKB 2D1FA 1DJMA 1E7YA 4Y6GB 2O2GA 2ZYIA 1H1TA 2X4IA 1TVMA 1WXIA 1OUMA 2A8YA 4HMPA 5MGBA 3R0XA 4ERNA 4IGEA 5TMDA 3PK0A 1FDOA 1L4GA 4YJ3A 3WLSA 3EXEA 4FMBB 3H0CA 3A3OA 4LV5B 1YRAA 1OPRA 3BH0A 3HSKA 1E1YA 4MVJI 4WAUA 5TF4A 4C04A 5BWNA 1GZSA 3OLXA 3OC0A 3IT0A 4I8XA 1G98A 2ODWA 5AUPB 2QN1A 1RM4A 2FFQA 2A5JA 1SEVA 1SBTA 1VPEA 1RWNA 4AW9A 3E27A 1Q6YA 1S1CA 2W83A 1LZKA 4PQEA 5KB3A 1Z0IA 2X4LA 3E8MA 1X19A 2V7XA 2B61A 3AERA 3GFPA 3WMFA 2FN3A 3C15C 3CJQA 1YOVA 3GEMA 1BEEA 2FPOA 2HMYB 4MLPA 5IH7A 1KOGA 3FNFA 1M6VA 4JT8A 4PYRA 2PJZA 3KJGA 5G4KA 5JVDF 4XIFA 1XRPA 2XWBF 2Q2QA 3LVBA 3FSGD 4HLQB 3ND8A 4ZN6A 3BWYA 4HAOA 3WIBA 1UAYA 2QW1A 3WOVA 1L8QA 1G60A 5IPFA 3NGMA 1DIAA 2FZCA 3EMKA 2QX4A 4WIAA 1P1CA 3IKJA 4GYKA 1USUA 3LVFO 3ISVA 1S2GA 4LCJA 1J09A 2A1TS 3WNZA 1MRZA 3I58A 1AKWA 4RTQA 5FUVA 1ATZA 3IQXA 4DM4A 3MGCA 4UCXA 3LQKA 1TAHA 2QW8A 3P9ZA 3A1EA 1LH0A 3AR9A 3LL4A 3L5KA 1L7RA 5LOVA 1BO6A 4C0LA 4FCWA 4MUNA 4BQNA 3BJMA 4ENQA 5GJWC 3OP1A 1QP7A 2WAXA 5E1DA 3OKAA 3O82A 1H3NA 4ALIA 3V4ZA 3NCTA 5D3KA 1ETHA 1P74A 4UUMA 2R47A 3ZJTA 5PNTA 4MV3A 4EMSA 4P33A 3TE6A 2Y66A 3C8MA 4OXKA 1PZFA 3TUIC 2QIOA 2VSXA 2DJIA 3K20A 2PM8A 3ZVKA 5THXA 1K8QA 1NVKA 1ESZA 3OF5A 5K8VA 4ZJUA 4BQOA 1MFZA 4O0LA 3VX3A 2QGFA 3ZWDA 3ENWA 1PR0A 5IMBA 6CHYA 1ULHA 1ZL0A 1CZLA 1K9VF 2ZVDA 4R3NA 4C07A 1KH3A 3IVAA 5L3SA 1MQSA 1WZNA 1KYZA 4FOOA 5K4GA 2PX4A 4BWYA 4E15A 2R8ZA 3F4BA 2I9PA 2Q5CA 3KSUA 5EMNA 5FPSA 5HRUA 2O0LA 3OEWA 4S2EA 5EWLA 3HCNA 3HU1A 5B37A 5REQB 1T1IA 5I01A 3SJ7A 2XODA 2O2EA 2EQAA 4RSRA 1QCDA 4ZZ3A 2I8LA 1L5LA 5BUQA 4X62B 1A1VA 3NHBA 1TMGE 4QUHA 3GJXC 4ERXA 2HXGA 3I6ZA 4UDYX 3WL7A 4JH0A 5FPKA 3DT9A 2AJBA 2P79A 1IBCA 1R18A 3K31A 3A58B 5ILQA 3RYIB 2I66A 5NULA 1QGDA 3L1JA 3VU3A 4X63A 1LLFA 5DW0A 1NLFA 2PH7A 3DOHA 2FXVA 3NAQA 4HLUA 3PITA 4RH0A 4YCMA 2H2FA 3DKRA 5IKPA 4F56A 4TTPA 5AXBA 1M7HA 2OKGA 1XHFA 5G0SA 2NSHA 3SOOA 1AD2A 1SVOA 2IZ1A 3IBSA 2CHQA 3KQSA 3QKSA 1PZMA 1SUPA 3TD6A 1WP4A 3GA0A 4JN6B 4FFBB 1AB5A 2GI4A 2PX5A 3ONFA 4NMHA 1GYRA 2C97A 2LV8A 5IASA 1IHDA 4WZAE 3L6CA 1SUEA 5BSUA 1PTJC 4A0GA 2PGIA 3DHNA 4FNAA 1IPEA 9LDTA 1D9XA 2XEDA 3OZAA 4LXTA 4PYQA 3TW8B 1H8HD 4GICA 1E3QA 2VN8A 1F6DA 1A4XA 3KPWA 3M83A 3E23A 2XT6A 2WWWA 3H7AA 3A05A 2Q5QA 1WDLA 4GIBA 4LX0A 1GD1O 4MW4A 2OCGA 3IUNA 1Z36A 4ZVOA 5KJEA 1R12A 3GD5A 1IU9A 3SXUA 3HXKA 4YLGA 1U31A 1Y33E 2PRSA 4BNTA 5K8IA 1KMIY 4L4ZA 4YRMA 2J3HA 2UV8A 4K28A 3K1AB 3QH4A 1LJ8A 2KLHA 3EZ9A 3WHKA 3ZOKA 4B9AA 1G3MA 2MSLA 3WLKX 4WXEA 4EPYA 3AETA 4U2CA 4O1HA 5DGXA 2GB4A 4RIFA 6GPBA 3F67A 2QX9A 2PVPA 3RJ9A 1CQXA 2RGDA 4B34A 4G86A 3SS7X 4NAVA 2X1VA 2ZXEA 3LYAA 3K0CA 5TGZA 2O8CB 2DBRA 4TXJA 5GZ6A 2NXJA 1L4NA 5JXWA 2PBZA 5BN4B 3G49A 1P60A 1Y1TA 4GECA 5FCDA 1ZFNA 3M7IA 2XHZA 2X9LA 4DUZB 2P9JA 5J40A 3KJHA 3LBHA 1UJ5A 5BMVB 4FCTA 1J5PA 4MVJF 3JS5A 1GM5A 3L7DA 2GZAA 1ADGA 1YE3A 3LIIA 3OY7A 2NZXA 1E3MA 3Q8KA 1V5EA 1SZJG 5H9WA 3L05A 4QAJA 2QP3A 3JWIA 2PFGA 3JYOA 4AJIA 4FGJA 4B4KA 3E22B 2DSNA 3QKWA 1GZ4A 1OXVA 4H7JA 2D00A 5CURA 5K8LA 2ZS8A 1GKYA 1YZQA 1YKGA 3GAZA 4BBJA 4L57A 4N39A 3TRHA 1JBKA 3HA7A 3FJOA 5B3AA 3RJTA 4JBGA 5ALNA 2HQBA 3OM9A 4NK4A 4FN4A 1E2DA 2G07A 2CNOA 3KT6A 4EW6A 1IJEA 2C0CA 3BORA 2ROQA 3IE0A 2JLBA 1ZK3A 2LVBA 1N5RA 3C7CB 4C0HA 2FTKE 1F8YA 4IG4A 2OHXA 3JWHA 3LE8A 5DYGA 2V0GA 2ZPAA 1PR3A 3TKAA 1R66A 2P2NA 3UHAA 4J1QA 5L51A 1B73A 4KI7A 1U1EA 3TG8A 1YR8A 3RU7A 4AWXA 4DPMA 5EGSA 4O2AB 3NTRA 2WSSA 5K8JB 1AZSC 2P6OA 5FOXA 4TS4A 5CHEA 5CP8A 4BKMA 4MI6A 1Z2CA 1P0CA 1UEXC 3HI6A 3JCZA 3VMMA 1NMZA 1V4NA 2WRZA 1YCFA 3IV7A 4KIWA 4UAGA 1QV9A 1EVKA 4LGMA 3TJMA 1DWQA 1JBQA 1N57A 3V4RA 4KDFA 4EX6A 1YHNA 1Z6AA 3O93A 1M6HA 1V45E 1FYDA 1PLKA 2VQDA 4UUQA 1E2BA 4NOMA 1QIDA 2C9YA 3AKYA 4FGKA 3BBLA 1GCOA 1AM4D 4UUPA 4DLLA 3BWXA 4RACA 2Q9UA 3HFRA 3V4LA 2FMUA 4ENWA 1HFJA 3TM5A 2VDJA 1YJCA 2RK3A 4KIGA 1U3UA 4MARA 3NXSA 1WMDA 1RM0A 2OCLA 3HPQA 4C2UA 5CT8A 1GNVA 2G09A 1CV2A 3I9LA 2BBOA 3JQAB 3ACCA 3DTVB 4XI9A 2FPMA 3TVTA 2C8KA 3INYA 4GSYA 5BSFA 4MAAA 3R9WA 3PTLA 4DDKA 1UZAA 1QH1B 3EBPA 4NJEA 5D6NA 2O3SA 1E6LA 4CR7A 3SR0A 1FNMA 2OKCA 4HO1X 2ZVJA 1H1LA 4DQKA 4LW8A 4WZAA 1BU5A 4YAKA 1BKYA 1JP7A 2GAIA 2X19A 3ICCA 2BHLA 2ZRJA 4RH1A 3KR2A 1P7WA 2ZITA 3OU2A 3RK1A 2J9RA 1OIVA 1BYIA 3H1PA 1DXOA 4G5QA 1PZGA 4NQZA 1A77A 2JAUA 1YC2A 4EB6A 2MINA 4IICA 4DV1B 1CDZA 2G9ZA 4KNYA 1IHXA 2RG1A 3VPBA 2PS9A 1XVTA 3KT0A 3JPYA 1H5NA 2ZZKA 1J25A 3KE8A 3ZDBA 4U6NA 4JLSA 4DL9A 1R50A 2MIIA 3A14A 1W0CA 2P9QA 4E13A 4QBFA 3MCVA 1DC5A 1TQ4A 1IMOA 4JQZA 4RPLA 3H7IA 3ROGA 5J58A 1OAOC 2Q99A 4BRZA 4A8PA 5C1OA 3ON5A 3IP5A 5I9MA 3WJ1A 3AVVA 1MNAA 3AJEA 3S70A 2OXRA 2QBYB 2OXEA 2UDPA 3TLAA 1CUAA 2DR0A 2C88A 2PGLA 1H9CA 1PTKA 2YXEA 3RIYA 1JQBA 4E94A 1HDXA 2CDRA 2Z6AA 3CVJA 1I51A 2YC2C 1KHHA 5JAOA 3E58A 1Z68A 3TKYA 3UMGA 2Y1CA 3KOZA 5JDIC 1KC3A 1Z08A 2VS1A 3GEDA 4PBTA 1M5RA 3PF8A 1DLJA 1HKHA 1XQYA 3ZWBA 1VHLA 4R1UA 1QHHB 2WABA 4UBIA 5JJBA 3AP3A 1SM4A 3AVYA 1RAIA 4D3XA 5IP5A 1TRKA 3C16C 1DKRA 2EERA 4MDYA 4BEVA 3GA7A 5KQGA 3U1BA 1QDUA 5TDHA 4EABA 2YFQA 3FOZA 2OGWA 3QF7A 2NVUA 3RRFA 3DOJA 1PN3A 5DCWA 2FSFA 4N5HX 1E1LA 2XYQA 4CYMA 3K5WA 7MHTA 5TS3A 1I80A 2O7RA 3FKSD 3UYKA 2XADA 4ZYLA 2FP4A 1N9ZA 3P5BA 3ZWNA 1EZZA 4HTFB 1KO8A 2X1HA 2JZOA 4H7PA 5JBNA 4K9LA 4UM7A 1P62B 2QRKA 4HPWA 2YXBA 1C4KA 1OHHD 1R6XA 3QFRA 5EIHA 3ULKA 1G5PA 1ZXBA 2ZYVX 1EJ0A 1E0SA 3G0OA 4RQTA 3HKBA 2Y1WA 3OZ7A 3U7GA 4D8WA 1EESA 1QMGA 3BHMA 5AVUA 1DJLA 2ZTVA 3DDWA 4OHPA 4AJNA 4KFSA 3MCAA 1KZ4A 1F0KA 4D4JA 4M1WA 2V0CA 1O77A 3JX9A 1DQYA 5TXGA 5FPHA 3LA6A 2Z2XA 4QVGA 4GXNA 5L3VA 2PMDA 1UM8A 5KVQA 3BXHA 4B81A 1ICIA 3N3AC 4G5YA 4F5WA 1WUJS 2A0KA 4EPWA 1X7DA 2GN6A 1YBVA 4UM8B 3D4PA 3LCCA 3NP9A 5EE1A 2WZQA 2R1TB 1XMSA 2HADA 2N1MA 1GZHB 3D7MA 1T2FA 5CJJA 5CFRA 1C3LA 4IDCA 2R1VA 2VHTA 4FHEA 4ABTA 5TRTA 4TVKA 1AN0A 3VPGA 4PZEA 4KR3A 3EIHA 2ZSUA 3K0FB 3QE4A 2LDXA 4FNOA 4X7MA 4YJGB 4ZYXA 2L17A 3QKRB 4YPFA 3SN6A 4D25A 5IYZF 1FVFA 5C46F 1JT2A 3R4CA 4E31A 1BG6A 5BQXA 5E2AA 1RZRD 2GA9A 3TCNA 4FLMA 3V6LA 2PR7A 1F38A 4RAOA 1MR3F 3P0IA 3TQQA 4IXWA 1Z5UA 1RSZA 2H4WA 3E1KA 5JNWA 1U3GA 2QN8A 2YWDA 2A9RA 4KWCA 3UJHA 3VR3D 1EHCA 1Z47A 2R4QA 4YDQA 4IAOA 1V7PC 1QO9A 3W4KA 4N9WA 3A2MA 4J7CA 3VYSB 4XWWA 1HE1C 2J31A 4BAZA 3WADA 1E2IA 4QREA 3BRQA 2L82A 5F98A 2XZTA 5KINB 1T8RA 2ECPA 1WZUA 2FN9A 2YN4A 2CV1A 1M2FA 2C3UA 3O8BA 1QVWA 2EU8A 5THQA 3TE7A 3WRYA 2NX2A 3TOVA 2R11A 3FGNA 3BD8A 3SMQA 5E0OA 3BWBA 5CDHA 2VJDA 4S1PA 3RU9A 3QJGA 1RJ9B 1QGOA 3L0YA 4HNAB 4EVRA 5HJEA 1QYWA 1HOXA 1LNQA 1UMDA 3G82C 3SF8A 3QE3A 2A0YA 2CZQA 4FC7A 4K40A 1UBUS 4ZOEA 3DDNA 5ALRA 2YHIA 2CJPA 3QA9A 5LWQA 3BMCB 4KLCA 5A1TA 1F2TB 3TW0A 4YV7A 1FYFA 4WESB 1TKAA 3DCJA 2O50A 3VO2A 4U7DA 2ETVA 3CT4A 3FVWA 3I4FA 1E3WA 3C3PA 4OI2A 1BCSA 1II8A 1Z4KA 2VDWB 3CINA 3DPIA 1PX0A 3ZWCA 4WDQA 4BX2A 3A10A 1MX9A 2XF2A 3BFKA 4KSCA 4QLOA 4P82A 4JSYA 3ZQ4A 4JLKA 1E64A 3GRCA 1VE7A 1OWMA 1RPTA 1N2BA 4LOAA 1L6IA 1C0LA 2YVQA 5DNUA 3F9CA 1UFVA 4GP7A 5IKMA 1USKA 4Z53A 3EW7A 3G59A 1N6RA 3CEHA 4MR8A 4LJKA 4O4LF 4R9UC 1W76A 5KOIA 1MT3A 2WSSD 1WOMA 4MS3B 5JH7A 5DKFA 4CU2A 1K8YB 3EDQA 2C4NA 4JJAA 1DBSA 3PPXA 3EQ6A 3UMRA 1KQOA 3N1UA 1R6VA 4MUAA 3U7IA 1SVSA 3QEJA 5TLSA 2CUNA 4JIGA 1WCIB 2ZAOA 2J9GA 3MLAA 3VDQA 2HTEA 1II9A 1SQ5A 2OBNA 2X0KA 3I73A 4QDUA 1PG5A 3H9UA 2IYAA 3KZNA 3PNBA 4YHBA 2WB2A 3U4MA 4PTLA 4EJ6A 3DUFA 4BYMA 2W6JD 5JNRA 4P92A 3H2SA 4J03A 5KWVA 4XVQA 1HYEA 5A0TA 3UHOA 2H7XA 4YRKA 1G9XA 2AMFA 2QG6A 4GLOA 3T7DA 4DN6A 9LDBA 5LLDA 5GVRA 3H2HA 3GX1A 1MIOB 2Y05A 3C1TA 5EINA 3G2KA 5E3JA 1RWMA 4AP6A 4RVCA 3H84A 1O4VA 4XYLA 3LQQA 2IKSA 3UUEA 5HXAA 2OORC 3AJ9A 4E22A 3JQ8B 5LZ5A 3N07A 1P4AA 1JH8A 3NIFB 4I55A 4TLCA 3K09C 3ZE1B 4D6YA 3J81k 1B1AA 3FF4A 3HBMA 1TA4A 4NPCA 1FFEA 3TLEA 3G6WA 3PDWA 2PD6A 3B85A 2XJ9A 3FFWA 4A73A 4B4DA 1KSGA 2FP3A 5JY6A 2QT1A 1U7WA 4RF4A 5AHRA 3WG9A 3F2VA 1IZZA 1TFRA 1U0EA 2B92A 1VPTA 2IOQA 2PGAA 1Z7YA 4NY1A 5AHXA 3FM9A 3R6DA 5KIAA 1F3LA 4LNAA 3HGQA 3VA7A 5A7GA 4D8UA 1GUAA 3GIWA 2IZOA 1FIUA 2R5NA 1FFDA 4JVOA 3B9PA 3I6BA 4BN4A 3QYAA 3ESCA 1E61A 1AE1A 2IZ7A 2W48A 2R6FA 1LI5A 3V7NA 3LL7A 1RRKA 4LYHA 4OSOA 2ZATA 3ZE0B 5I7EA 1S96A 1ZW6A 4KKXB 4PHFA 2WJWA 4G07A 2WE8A 2G0AA 1WDTA 3HB5X 1HR0B 3S4YA 4V0RA 3IA7A 3UO8B 3T5GA 2WSMA 5FO1A 1C9JA 2ADOA 1B26A 1P61B 4UZSA 1YS4A 2MT9A 2Q6VA 1HTTA 2WHQA 3JQQA 3OPYI 1JBEA 2L42A 3E3NA 2I6GA 4ENSA 1FMCA 3F90A 4O4JF 2GCOB 3NHZA 3OIGA 1EH5A 4GKJB 2VHUA 2YHUA 1KL7A 1AUPA 2Q1WA 1E2QA 2OYRA 1HYGA 3SNHA 3HVRA 1G8AA 2JJQA 2W2XA 1T5HX 2XXAB 1UP4A 1KAGA 2X8JB 1M6YA 2G67A 1RW4A 4RX1A 3UY4A 3RVRA 3EPPA 3ZY2A 2HD4A 3QWIA 1N8TA 2MR6A 1ZD5A 3C98A 4FIDA 1SU6A 4P9NA 4UU1A 5JCJA 1YVPA 2HU8A 4XSVA 2UXDB 4DCOA 3PR2B 1N2ZA 4XDYA 2C4UA 2KYRA 5EJ7A 3DNMA 3OKPA 4BO9A 2QJWA 3N87A 4BDTA 4CKEB 3A0UA 3H9JA 1GRVA 3EGCA 1JHXA 4FHFA 1NX6A 3VNRA 1KZ7B 4MO9A 2D5BA 3DVAB 3SDBA 4JYPA 5JMTA 1IDN1 5REQA 5EHNA 1WD5A 2GZRA 2MDTA 1CTQA 1C2TA 2BRUC 3LDFA 3WGOA 2CV2A 3IUQA 2OZPA 1N1GA 3NOQA 4WA7A 5IFKA 1IQPA 3TI7A 1F4PA 1ZW1A 5CX1A 2BMEA 1NPDA 1YZUA 3C6MA 3DBHB 5CU7A 1DX6A 2YKGA 3W8EA 1JKIA 2G6TA 4GMKA 1EWRA 2C61A 3D5TA 3CMMA 2R6DA 2WHXA 1KSJA 4X8HA 4LF7B 1I01A 1HDIA 1L6RA 1LU9A 2G5GX 3BGWA 3GVHA 1CJVC 3CX3A 3Q1KA 4CIAA 2H51A 2NYRA 1R37A 2EL7A 5FWXA 3I4LA 3IQWA 5AKHA 3QHQA 2ZR8A 4OFWA 4R01A 4F1JA 6REQB 4RENA 3L6RA 3LWDA 2VCYA 3EE6A 1Y7LA 1YJAA 4YAIA 2FPLA 2Q5JA 1AUOA 3B1JA 3EUEA 3RYHB 1ECJA 2W2LD 2P3SA 1YRLA 3OCUA 2RGUA 3VOBA 3ZD9A 1EXNA 3A6LA 4I08A 1BJRE 1OAAA 4K8OA 4MB6A 2VDRB 3TI9A 2FMHA 3SLKA 2VRCD 1MZPA 2XB2A 3TW8A 2