4PO9A

Mycobacterium tuberculosis reca glycerol bound low temperature structure iic-br
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
325
structure length
310
Chain Sequence
PDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGESHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Protein RecA, 1st part, 2nd part
total genus 91
structure length 310
sequence length 325
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4po9A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4po9A01
1IAQA 3AF2A 1JNYA 1XMSA 2P3SA 3AM1A 4O2RA 5E7IA 2VYFA 2H92A 4PPNA 1E96A 4DBLC 4DB4A 2GEUA 3E1SA 3PUZA 4HLUA 1ZD9A 3EA5A 2LKCA 3LQQA 4X8HA 1W36C 5TDHA 1JJVA 3AUYA 4G1UC 4M1TA 4QC2A 4BUJA 1BS1A 1II9A 3OIWA 3IHWA 1P2UA 2IUUA 2YWEA 3TW8B 3H1TA 1F2UB 4CGZA 1HE8B 4Q5IA 2ZJYA 1N25A 5KHOC 2VHQA 4TL6A 3U60B 4CEJB 3M4YA 3AKYA 1AA9A 4A6XA 4BRWA 3EPJA 2KBEA 4A15A 1NVVR 1PJRA 4QG7A 2FF7A 1E98A 5EP3A 5AR1A 5D3QA 5H1YA 5KSPA 4D0NA 1EX7A 5TXGA 3FMPB 5DGXA 1R7RA 2D74A 1NLFA 1JR3E 4I1SA 4MYHA 4PSVA 3L43A 2OBNA 3MGCA 2ZUCA 3L8YA 5EQTA 1HURA 1P2SA 3J81k 2VP5A 1D8TA 2IT1A 4PC3A 2D3WA 2Q9AA 2NO0A 3NXSA 2XNDD 1NVVQ 3BB1A 4JS0A 4KYUA 3CZQA 1XEFA 1NRJB 2V6IA 2Q9CA 4DC9A 5JCZA 3HWSA 4D25A 1XX6A 2FZLA 3IILA 3RWOA 2A3RA 2JJ8A 1TPZA 1G9XA 4HATA 4JT2A 4OBEA 3NIBA 2A30A 2DFTA 2GF9A 2RGXA 2WMNB 4GZMA 4TTPA 2IYRA 1S3SA 1GG2A 2NGRA 5E7MA 4A36A 2J0UB 3BFVA 2YYZA 4Q18A 2VSOA 4KU4A 4HB3A 1BIFA 2GTPA 4PR0A 1EGAA 3TVTA 1FQKA 1IONA 2OBMA 1GAJA 5FOUA 1CJTC 2BMDA 4GI7A 4BZPA 2VRWA 2RB4A 1CR2A 1Z6AA 3MJHA 2C8VA 1R6BX 5FBWB 4BE7B 3CWQA 3OE7D 3SQWA 2HYIC 5CM9C 4OHZA 3SFVA 4B3FX 2C99A 2GCOA 2ODBA 4BLOA 2W00A 3VU9A 4HYYA 1E1RA 5JBQA 4PSAA 2V54A 1II8B 3X1DA 3RS2A 4JJKA 1AGPA 1HH4A 3PITA 3WBJA 2C98A 4NYIR 3RS0A 4JBYA 3F3YA 3TBKA 5KO2A 1JAIA 4D6PA 5IF9A 1CRPA 3S1AB 1X8JA 5JSZA 1XTRA 4A9AA 2QG6A 2O8EB 1KY2A 2C77A 4HLDA 1LY1A 5C1BA 1G1MA 4W5JA 1JQLB 3AVUA 4P32A 1U9IA 2G9NA 3KB2A 4PHFA 2LKDA 4PZZA 3RRYA 4KFUA 4WZBE 1YZUA 5H68A 4NYMR 1E0JA 4Q1DA 4LBYA 1RE0A 4KODA 5CDFE 1X86B 4JLJA 5FBLB 5FPKA 5AJZA 4MH0R 1US8A 1P72A 1GL6A 3KKNA 5EP4A 3UANA 4LV6A 4YMTA 2JASA 3LWNA 2NO1A 4LJ7A 1II0A 1QHNA 4MYCA 4A0FA 2QTHA 4GFDA 2A5DA 1QHHB 2ANBA 2BKEA 3WMGA 4TLDA 2OHFA 4P33A 3QPVA 2ZRPA 1NN5A 4EPRA 3KUCA 4A0HA 1GFIA 4LBVA 4IOMA 3IKJA 3AV0B 3QOFA 1LFDB 3VR2A 1WBDA 4RKFA 1IOZA 4IVPA 3QUSA 4LYAA 4PC7A 4DLYA 1A7JA 3OAAD 1ZM2A 1HYQA 1XP8A 4Q9IA 4LJAA 3T15A 2IHYA 2C9OA 1U98A 1NVXQ 4IFBA 4AY2A 3FOZA 1RPZA 1TF5A 4TQ9A 4OJKA 5IK2D 2O8CA 4P0TA 2ZRGA 2QM7A 1ZU4A 5LBIA 4M4SA 5J4LA 4MKHA 4XH9B 4DLZA 3A4MA 2F43A 4A82A 1W47A 1GRQA 3THWA 1JEDA 2GWHA 1U2RA 2DYKA 2WZQA 2XTZA 3JVUA 2B6HA 3BOSA 3V4FA 3B1YA 2XITA 4B3DA 1EFHA 4D2IA 4C7OA 1DELA 2GXSA 1DEKA 1KOFA 4NYJR 4TL7A 5FI0B 3S1AA 3WNBA 1NVUQ 1AJEA 4QJ3A 5FH9A 1TEXA 1TUIA 4DLTA 4J0QA 1YU9A 4OQNA 4LI0A 3HYRA 1MO5A 3P27A 5FBRB 1Z6XA 4FIDA 3BWDD 3A37A 1KKLA 3SJAA 1CR1A 1II8A 2WJVA 5AUNB 4PHTA 5FOVA 4LZZA 1CF4A 4F4JA 4Z1MD 1F2TA 2ORIA 3SJZA 1KO7A 5J4VA 4CEIB 1LS6A 1MABA 3B1VA 2IS2A 4TSFA 5BN4A 3R9XA 3VQTA 5B58C 2WAXA 4Q4JA 3BD9A 2BM0A 2JLRA 3MWJA 4BLQA 5FTMA 1GNQA 1G7CA 2RHDA 5F9FA 2J1LA 4QBHA 2HXSA 2EQBA 3FYHA 3OIUA 4KCGA 5JRZA 4WA7A 2QT0A 2R65A 1UF9A 3FMIA 3WBKA 4PQFA 1NJFA 2WWGA 3NEJA 4DHEA 5HPYB 5DHFA 3PEWA 1NI3A 2OV2A 2IYLD 2G1KA 1VCIA 1BO6A 2G1JA 2W6JD 1A2BA 2EFDB 3GJ3A 2NZJA 1SXJB 1I2DA 2BJWA 1E2LA 4TZ0A 1NVWQ 2Q3MA 4DDVA 4DVGA 2GRJA 1AZSC 4V0KA 1U94A 2IUSA 4A2WA 2BM1A 4MRPA 1E2HA 4RSGA 5HZHA 2HLDD 4JVNA 3WNDA 4AI6A 1W0KD 1RZ3A 1ZW6A 4M9QA 4LPSA 4DLRA 1KI2A 2WJGA 2FZ4A 5KUTA 1UEIA 1H8HD 2IYVA 3RLFA 4QXAA 2W0MA 1KDOA 1IY0A 3SYNA 3ZVNA 2IYQA 4TMXA 4M53A 4TWZA 4HB0A 2ZS9A 3B7GA 4RD4A 1OIWA 1MABB 2AR7A 2QE7D 4ESVA 1DADA 1E9CA 1NP6A 3DVLA 4C30A 1Q20A 4B44A 5JS7A 1ZC3A 3PUXA 3QG1A 3PIRA 4LJYA 2G83A 1SVWA 1DTSA 4JLOA 3KTAA 3AH8A 4B74A 2AWNA 1CBUA 5DH9A 3U2QA 2XNSA 5EXTA 1HUQA 1QHIA 2KI5A 4CRWB 3FVQA 3IO3A 4X8OA 1XRJA 2ZEJA 5LDDC 2J0UA 5JWHA 4L5BA 1QDEA 3ECCA 3QENA 5CK5A 4QL3A 721PA 3SYLA 1UKYA 4OQLA 5FI1B 2OT3B 4FN5A 1YZNA 4HDCA 2YOFA 3DKPA 3G5UA 5LB2A 2HJGA 5AUPB 5CJPA 2FE4A 5BYKA 4FCTA 1UKZA 2FPLA 1NNEA 1DAMA 1W0JD 1X8LA 2GVZC 3KDSE 1UFQA 3ICEA 2ZR9A 3GJ6A 2GDJA 5HZKA 5JFGA 5J5CA 4PO9A 4US0R 3DPUA 4OHXA 1D9XA 4RZXA 2OESA 621PA 2RH5A 4LHVA 3LH5A 4N3NA 1OXTA 1W4RA 4RCYA 4QFMA 2V7QA 1NLYA 1KO8A 2WIBA 4IRUB 2ZM5A 3AVOA 1XTKA 1Q57A 4RJLA 1KMHB 2XJ9A 2Z6VA 3MAAC 3KQKA 4NL4H 1A1VA 4Q47A 2FWRA 4XD7A 1X6VA 2HDNB 4M0LA 3NBZC 2CE7A 4B2PA 4I1UA 3LBHA 3KJEA 5K8TA 3W3ZB 2E1RA 4PC2A 1YZKA 3I62A 2DFKB 4HAZA 1KAOA 2V6JA 1OJLA 2IYZA 3A36A 3CX6A 4QGHA 1X3SA 4NHOA 2IYWA 3GPLA 2JDID 1T8TA 3A1SA 4UXJA 2NO9A 1H8EA 1OIXA 1YR8A 1R0WA 1YZLA 5JCPA 3OZXA 4BZXA 2ZU0C 1OH7A 2QBYB 3LNCA 2A5JA 4JSTA 4EUNA 4C0QC 2VP2A 3K0CC 4HAXA 2W58A 3T1QA 1Q22A 3L0SA 1D6JA 1F3OA 2CLCX 3KJHA 1TAGA 4A1FA 4KVGA 2JLZA 4IVRA 5EXXA 4EDHA 2QY9A 3SFZA 5LD2C 3MWYW 2NG1A 1NMYA 5BYJA 3I8SA 1MO4A 2PT7A 5FBVB 3ZD7A 1G4UR 1N6IA 2CVFA 2WWFA 3B82A 1QZXA 1G5RA 1SULA 1T3SA 3WHKA 4ZCLA 1NMZA 4PAOA 4FWTA 1E0SA 3GLIB 3AQ4A 4CDGA 4MRSA 3Q7PA 3RRMA 2ZRDA 2PEYA 1XPOA 2F6RA 2I4IA 4JL6A 4IDOA 4DLUA 1HA3A 5A4JA 2J7PD 3U5ZB 1Q44A 2H7VA 1TU4A 1XJCA 1SKYE 1RIFA 2K5UA 3H84A 4IJMA 4K81B 2BBWA 2A5YB 3RAPR 3RRZA 3AVTA 3OIVA 1IY2A 1TADA 4JJZA 1Z0AA 1VG0B 3KKOA 1R2QA 1IY1A 3TAHA 4BWYA 2HXYA 3CZPA 3K1JA 1VIAA 2F55A 5FOWA 2SHKA 4GZLA 4NCHA 1FTSA 1W44A 1AQUA 1EFUA 4NCNA 3U3MA 2IL1A 1KSGA 4US2R 1OSNA 4MRVA 4JZKA 4GDFA 1QRAA 3VFDA 1N0WA 2VEDA 2GCNA 3QQ5A 1MH1A 1VHLA 3QNUA 1YZQA 4QJ5A 3UWOA 1K5GA 2WWIA 3QPUA 5HR5A 1FL9A 4PQRA 1YE8A 2KB0A 2EWWA 2H17A 1VYTA 3WRYC 5E3HA 3IIJA 4WBSA 1JQJC 1ESMA 5K8LA 3FKSD 3C7KA 1DAHA 2GK6A 3V9PA 3N70A 4OQXA 1MO6A 2BKUA 1S1CA 3R9WA 2QBYA 2WKRA 4CW7A 4W5HA 4Q03A 1XTQA 3TAUA 3CRMA 4EJSC 1P7CA 1T4GA 4ZV4A 1BMFD 2ODWA 1GKUB 3CKLA 1U8ZA 3O8BA 4HZIA 4NP6A 4LSGA 1FMLA 1AN0A 1IXRC 4DRZA 4KSCA 1R5NA 3QE0A 1X1SA 4I1OA 5HCNA 1R4AA 1XD9A 3TSZA 2F1IA 5KPDA 4TLBA 5CIWA 2CL6X 2VBCA 4LJ8A 5FTJA 5J4HA 2WBLC 3NBXX 3QXXA 4B6FA 1LNZA 1G4AE 1XEXB 4NCJA 3LXXA 2OEPA 2REOA 1SXJE 2QT1A 1OFHA 1W4CA 3X1ZA 2BBOA 3JZMA 1WE2A 2WPDD 4Q02A 3NH9A 3P20A 1UPTA 4XVUA 2C95A 3DO6A 2QI9C 4JMPA 4GOXA 5D3MA 5SZKB 3U44A 1CRQA 4DLSA 3FGNA 3K70D 1PVOA 1GKIA 4F91B 4B43A 2OFOA 1M34E 4TMTA 1FNMA 4ZI3A 3RC3A 4BGDA 1E0AA 1VYVA 2WV9A 4EPTA 3D8BA 5FPSA 2QSYA 1KJYA 2JLWA 2C5LA 1GL7A 1NBMA 3NHAA 3GJ8A 4B3XA 4TMVA 3DEFA 3BE4A 3IIKA 3B1ZA 1U0HC 3F8TA 2XZOA 2HT1A 5KSOA 1DS6A 2QTVB 1NG1A 3X1XA 1ZC4A 4DLVA 2YVUA 4WZ6A 4CF7A 1Q1QA 2CNWA 2ZI5A 3LO5A 1P9RA 4MA4A 1LVGA 4KI0A 1UBGA 1OF1A 3THYB 2J0QA 1UBEA 4AYTA 4EKDA 3QF4A 2AHOA 3GEIA 3H0KA 3AKEA 2D2FA 4XSGA 2GJ9A 1WQ1R 4C0SA 4IDHA 2XXAB 5CYPA 5DHAA 4BLPA 4LJ6A 2Q3FA 3BH0A 2WVJA 1ZUHA 3GP8A 1UAAA 3I92A 1G3RA 4JLKA 2KBFA 5EJEA 1XCGB 1UDXA 5DN6A 4OI2A 2VQSA 4WIAA 3RVBA 1W7AA 3TIFA 3A1TA 4DCUA 5EXSA 2YINC 5K8IA 1KGDA 3BB4A 2D7CA 2AK3A 4O3MA 2QN6A 1IJEA 1P60A 2QAJA 1BYUA 4A4DA 4V0LA 5FR2A 2O8EA 3ZQ6A 2BWJA 1T3LA 2QSZA 4OHYA 1EWQA 1W36B 4PZYA 4E22A 2BIFA 2WIAA 2Z43A 2CJWB 4YDHB 1M74A 4PC1A 2RGEA 1P5ZB 1XD2B 3LBIA 2PL3A 4JLMA 4TQUS 2FFQA 1A5TA 1W0JA 1ZBDA 1XWIA 1KYIA 3A6PC 4DSOA 4DSNA 4D4KA 4Q21A 5G53C 3ZZTA 1WA5A 1KO5A 2PCJA 4MGYR 1CJKC 1E2NA 1N6HA 1TX4B 2GESA 4GL2A 1OH8A 2W0SA 3CW2A 3N2IA 3VMFA 4ARZA 1E2JA 3IPXA 1G7RA 4LCBA 4IOKA 3NWJA 2ZRJA 4NTZA 3WY9A 1NF3A 2F1HA 4B33A 5B30A 3C14C 3B13B 3IIMA 1U9IC 3IBYA 4M9SA 4DCNA 1C1YA 2W2TA 3NKVA 2ERYA 3DDCA 3GLHB 3OIYA 5JEEA 3K70C 3D7MA 2D06A 3WP1B 2PLFA 5JEDA 2BC9A 3F5FA 2ZI3A 2RHMA 2QORA 3LBNA 2AL7A 2CEAA 1JJ7A 3KXLA 3CRRA 4AKIA 1D2MA 1T3HA 3THWB 1Z29A 1Z63A 2GAOA 1XU4A 2VPPA 5C2JB 1QHGA 1J8YF 3NH6A 4I4LA 2O8CB 1KO4A 1A82A 2ZROA 2IF0A 3UPUA 2B92A 3FB4A 4DCTA 4G5RA 4LWZA 2GNOA 4EJSA 3C5CA 2JIZA 4GOJA 5G3ZA 4LY6A 3CIOA 3GJ0A 2PEZA 1B0UA 1HT1E 4LJ9A 2HLDA 1TF7A 2J9RA 5BN3A 1WCV1 4XWOA 2NO6A 2OILA 2X2EA 3EWSA 1KK1A 3KQNA 2ZE8A 3MFYA 5FPTA 4E5UA 1E1QD 1NL3A 3TUZC 1OKKD 521PA 2IS4A 1DPFA 2ZIAA 3LY5A 4Q7LA 3UXMA 3FMFA 4WOPA 2QU8A 5FOXA 3VKGA 4NDZA 3K09A 4M9XA 4DDUA 2MSEB 5SZHB 4C0AC 4AG6A 4NU0A 1L8QA 1Q21A 1W5SA 3CR8A 2XOKD 4FD2A 4ESHA 4W9MC 2OAQ1 2BBTA 4OQMA 4B75A 4I1VA 4DSUA 1QG2A 4A0RA 2G6BA 5BN5A 1ZP6A 1OHHD 4MGIR 4A6PA 3H86A 1E1RD 1DO0A 3BRWD 1BKDR 1YR6A 4TSFD 3KFXA 4MITA 2ZR7A 1K5DA 2ZS8A 4HAVA 3RANA 2ZJ5A 4EQ6A 4Z51A 4HLUC 2FN4A 3E2IA 3RS5A 2XOKA 2YV5A 2ZYUX 4RFSB 3RC8A 4Q7KA 2ZTSA 1S9HA 2PMDA 4QOSA 3I72A 4AYWA 2ZRCA 2ZRMA 1Y63A 4BFWA 4E03A 2H57A 5G40A 1AK2A 1QVRA 2ZRNA 1KO1A 4NPHA 5FOTA 2HCJB 3UK6A 3DMDA 2O0KA 1ZNZA 2DWPA 3BK7A 2XSZD 4LHYA 2BJVA 1M6NA 1CJVC 1ZIOA 2QNRA 2J5XA 4G01B 4QGGA 4L16A 1CKEA 1NY5A 1ZCBA 1L2TA 3U3OA 3WXMA 2ZE7A 1X1RA 5JZVA 4NBSA 4MYUA 3EIHA 5KDOA 2Z5FA 1GM5A 3PG5A 3VU9B 1IN5A 1FUUA 1NKSA 2W83A 4JVLA 4QNRA 2A5GA 4XOIA 2JLXA 1W0KA 1YR7A 2ZSBA 4QRHA 4ZIRA 1OXVA 3FHOA 3SDZA 2WM9B 2PT5A 4OHWA 2RGBA 3KQUA 3AF1A 5GJCA 2ZYVX 1DAKA 4PANA 4LV8B 2NOAA 3ZVRA 3OAAA 3RWMB 3ADKA 1LB1B 3DOFA 4PPQA 4KSBA 3CRQA 1KMQA 2OO7A 2OE2A 3U61B 1PUIA 2CJWA 5EE0A 1E32A 3FTQA 2ZITA 2XB2A 4G5GA 1EFCA 4TQAA 3T1OA 1WRBA 1PLKA 3CWZA 4R2IA 5L3RA 4Q9JA 3BJIC 1Z3IX 3NVAA 1RKBA 1K6MA 4R9UC 1CTQA 2O8BA 3QKTA 2B8WA 2QM8A 2A5FA 1VKJA 4OK3A 5AWFC 5CITA 4TYWA 1AA3A 4AK9A 2IYYA 1T6NA 2IS1A 1RJ9B 3ZIAD 1U8AA 3VR6A 1IM2A 3E70C 4TYQA 4XTRA 2OCYC 5DYGA 3SJCA 1SQ5A 3CONA 4Q4LA 3W90A 1S2MA 3UATA 3CR7A 1TUEA 1E79D 2C2HA 2QQ0A 1ZIPA 2IYUA 5HCIA 1CU1A 1GOTA 3DMNA 5F98A 3EZ6A 2JLQA 3HR8A 4OI4A 3SOPA 1XTSA 2Q21A 2FPKA 1TU3A 4K8OA 4KVAA 1UJ2A 2RGAA 4RY2A 3TR5A 2ZJOA 4DIDA 2BV3A 3T34A 1G64A 3U4QA 3PENA 1ZRHA 2ANCA 5HKKD 3IHLA 2X2FA 4Q1AA 3ZS8A 4LYFA 2TMKA 5DLQC 3SN6A 4MKIA 5IK2A 2WWYA 5H8WA 4KBFA 2F3RA 4Q4HA 1J90A 3MMPA 3L0OA 2IWHA 3OE7A 5FL7D 4KYIB 2JCSA 3LLMA 4HLQB 3ASYA 2OBLA 4DJTA 2VTKA 1L4UA 1KKMA 3B8HA 4WXPA 1XBTA 2BHRA 4JKIA 2HT6A 4PC6A 1GIAA 3DL0A 5CIQA 1ZM3A 2P6NA 2EFHB 3VAAA 2BMEA 4Q1BA 2F3TA 2EFGA 4GSYA 4A2PA 5AJXA 1N0UA 3U7FB 4F38A 1JR6A 4DCSA 3P1JA 3T06B 5BQ5A 5FL3A 3GMTA 4AURA 4R71A 3WMFA 2IXGA 3PEUA 1T8UA 1UKEA 2WWHA 3W5JA 4F92B 3EX7C 3LW7A 4NYJQ 2F1RA 4AG5A 1NLZA 1UDWA 1G7SA 2ZUDA 2DBYA 5IT5A 1FOEB 2BBSA 2H18A 2ZXUA 1QHHA 2ONKA 2DCUA 2XJ4A 3CPEA 3T1VA 3K0SA 3DZ8A 2VHJA 1VDZA 3DOEA 3VKHA 2AXNA 3D3QA 4DZZA 1GTVA 1NJGA 2IEZA 3ND8A 2QENA 3TMKA 3EXAA 4LOAA 4CYMA 2ORWA 1FFHA 3K8YA 1COWA 3AGPA 1N3BA 1NIPA 4C0HA 3I8XA 3EAQA 5EUMA 3P4XA 4GOKA 4PAMA 3IO5A 5AUOB 1B23P 2VLIA 3KXKA 4L9WA 3W8RA 4EPVA 4D4MA 2B7CA 4L9SA 3THXB 4B47A 4ZO4A 4HDQB 1OH5A 3AF4A 2OM2A 1YKSA 3WHLA 3T5DA 4BFYA 1AIPA 4IXMA 4JLVA 3TSOA 4RFVA 3ZZ0A 5TARA 1FNNA 1XEXA 4M1KA 3KFVA 5DI3A 4TYNA 3U4QB 4PX9A 1KDPA 1Q12A 3CF0A 1M8PA 1AS2A 4V03A 2R2AA 1ZNYA 3HP1A 2BDTA 2C9CA 1KI8A 2OG2A 4MKGA 5DI9A 5FUYA 1JR3D 1T0JB 4Q4AA 1R8SA 1ETUA 1NN1A 1Q1BA 2JJ1D 1VG8A 2BMFA 1KAGA 4XSHA 4FMDF 1XD2A 3U3JA 3ZYCA 5GJBA 2R8RA 3REFA 4FWIB 4FCVA 2OXRA 4A2QA 2GCPA 3CBQA 5L3SA 2XGJA 3W5IA 1R0YA 2ZVPX 4BFTA 2D2EA 4JL8A 4TT3A 1L7VC 1P4SA 4AKEA 1GZSA 2G88A 2BCJQ 4JLPA 3UMFA 3VR1A 2BOVA 3IQXA 4NYIQ 2GVDC 2EFEB 1T9HA 1G5PA 3EZ7A 4G5SA 5CDFA 3V4RA 3U7GA 3GLFB 2CCKA 2JEOA 2RGGA 3TNFA 2V4ZA 2D7DA 2ZRBA 2GXQA 3ADDA 4S35A 4C4PA 1KZ7B 6Q21A 3BBPA 4RKEA 3FFBA 1OLOA 1SXJA 4KAXA 5C4MA 4ASUA 3Q9LA 1BH2A 4LYJA 4ZDIA 1KDTA 1ONBA 2ODEA 4CEHA 1TQDA 4XJXA 4LHZA 2ZRFA 4QBFA 3IQWA 4BRUA 1JB1A 2WWWA 1KK3A 3KKMA 1CR0A 5JHGB 2I1QA 1UADA 3RDPA 4DWJA 3OEHD 1Z6TA 3B6EA 1WB9A 3HPQA 4HB4A 4NCIA 3ZDQA 1U0LA 4RZ2A 1RRGA 4TLCA 1U0JA 1RFLA 2GF0A 1CJMA 4IVQA 1ZVQA 4HUQA 5FPYA 1Z22A 3VR5A 4CEIA 1XTJA 3IPYA 4TZ6A 5FFMA 2NQ2C 3EA0A 4ZPXA 2V8OA 3R20A 1NG9A 3KJGA 1W36D 4V0MA 1EWRA 1IN4A 1GITA 3GLGB 5L8VA 2J41A 4B48A 3SE0A 4QBGB 2IYXA 3K09C 2O0HA 1G19A 1S8FA 2QQEA 2IHBA 3ONWA 3H2YA 3ZQJA 4C7OB 4PO1A 1AM4D 2CLSA 4Q1FA 3RNLA 3HJNA 1P9WA 3LD9A 3Q7QA 4IDPA 4YC7A 5AJWA 4A8JC 2GZDA 3CNLA 2J87A 1RVDA 3SR0A 1KY3A 3BAFA 5G3YA 4Q9LA 3BFKA 5C4GB 1N2CE 2DFLA 1IQPA 4OQFA 1DG3A 2ZQ5A 4ZCIA 1VG1A 3EPHA 3Q72A 2Y8EA 1NSFA 1HEIA 4IW3B 2CMKA 2FSIA 4M22A 3CNNA 3A4NA 4Q4HB 5JI3E 3WYAA 4PHGA 3FE2A 2WICA 4UJ3A 4N1AA 3K70B 4GNKA 3BFXA 4XVRA 1CXZA 2Z0MA 4FMCB 3BH6A 4L8GA 4MKFA 2V7QD 1FP7A 3KTAB 2FGJA 4W5WA 1MOZA 2QUZA 2VO1A 3ZIAA 3QKRB 4UNQA 4HUQB 3MG9A 2VL7A 3E5HA 2BMJA 1W46A 2QP9X 4LBZA 5EXPA 3R7WB 4QNMA 3TQFA 2VF8A 3ZLJA 2IYTA 2J7KA 2NO7A 2ZSEA 2UKDA 3FDIA 1EFTA 1D2NA 2DWQA 3IEVA 4DIEA 1JXMA 1FX0B 3EG5A 3GEHA 4LYHA 2XZLA 4EPXA 2JATA 2KJQA 1QHYA 1ZAKA 1S1MA 4RD3A 1X8KA 3KZ1E 3I1FA 3W6OA 4B32A 4BFXA 2P0EA 2H8KA 1G6OA 1ZM4A 1U99A 2GJSA 2R44A 1XMIA 121PA 3TW4A 2RCNA 3EZ9A 3SQXA 1FP6A 1QHXA 4H9GA 2GK7A 1HQYE 4KFSA 1KIMA 2VIIA 2PZFA 3LRPA 2C03A 1E2DA 2NPFA 2P6UA 3PUVA 1CEEA 4NONA 1J7KA 1N6RA 1YRBA 4WVFA 2UZIR 2ZYWX 8OHMA 4BPBA 5JRJA 2IWRA 3LA6A 3L8ZA 1SXJC 3SYKA 4LPKA 1DARA 5AJYA 2HYDA 1VECA 4TMZA 4II7A 421PA 3QKSA 4NZYA 3NDBB 3CF6R 1E6CA 5JECA 1SGWA 1CP2A 4UNPA 1ZCAA 1JBKA 1E2PA 2FFAA 2PX0A 3LW8A 2GCOB 4KJZA 5E7JA 2FEMA 4V0ME 3HDTA 5JS8A 4TTRA 1R10A 1SKYB 1WMSA 4ERNA 1E0KA 2IX3A 1G8FA 1LV7A 4BQSA 2MMCA 3MWKA 2VHTA 3VX4A 1YRAA 2WAYA 4B35A 4OKSA 1UM8A 1XPRA 1DO2A 2AX4A 3LQRA 4URUR 1MO3A 1MV5A 1SKQA 1VYUA 4N0EA 1HY3A 3OEED 2EYUA 1A4RA 2ORVA 5E4FA 1AGRA 4DB2A 1XDBA 4NMMA 5C46F 2DY1A 2ZI9A 1UBFA 5DE3A 2ATVA 1OH6A 1W4AA 5JJIA 2X19A 4AC9A 1W1WA 2FOLA 1MRSA 2PCLA 4JLBA 2R6AA 2GEVA 3CB4A 3L2OB 3M0EA 4PO8A 3OFNA 1CJUC 2IS6A 5F2EA 2X77A 3KQHA 2NTYC 4YXWD 1HE1C 4URVR 2BEKA 3BXZA 2ZRKA 1GDDA 3NG1A 2ZANA 1VTKA 3I61A 3G0HA 4FMCF 5H70A 3PR1A 4EPYA 3ADBA 4LUCA 2AFHE 2OCBA 1ZJ6A 1SVMA 1Y3AA 3A1UA 4ITRC 5LPNA 1E2GA 3NDPA 2EU8A 3EIEA 3QSYA 3I73A 1TQ2A 3L82B 4YDSA 3X1YA 1NKTA 2NIPA 1CS4C 4C2UA 2ZVQX 1ESNA 3EZFA 3EC1A 4PFSA 3HU2A 5KU1A 1Q1EA 3I5YA 3VR4A 1BYIA 5CLLA 2KE5A 1TL7C 5ANRB 2ODNA 4XWAA 3VNVA 4PTLA 3FWYA 2CHQA 3ICQB 2V55B 1RYHA 3QXJA 1DAEA 3SBEA 2FV8A 4FCWA 1SVOA 1HT2E 4M8NE 3GJ7A 4EJSB 2P67A 3C4JA 5L3QB 3N2EA 4B71A 4V0NA 2QAGC 1JI0A 3U6BA 4NH0A 1IHUA 2C04A 5B2ZA 2O52A 1M7HA 5FR1A 3HU1A 3UMSA 4D80A 4XWKA 2R62A 3CPHA 3R8CA 1G7TA 4YXWA 4TL9A 3SU8A 5FUXA 1G3UA 2I1VB 4BECA 2QGZA 4YMUA 5KNCA 5CLQA 4N0DA 2QROA 1TQ6A 1KI1A 2GJ8A 5P21A 2G0NA 2J59A 4IDQA 1XD8A 3QBTA 2A2ZA 3HR7A 1E9SA 4L4UA 1R8QA 2G77B 3RYTC 2FA9A 2Z4SA 2Q0HA 1RC8A 1XJQA 1W2GA 2CXXA 3RHFA 4EFNA 2W6IA 3BERA 2I3BA 1QG4A 4P3YA 2VHUA 1N5LA 1WXQA 3D31A 1ZM7A 3SNHA 2OSBA 5EUQB 5EP1A 821PA 5JJKA 1GUAA 3MD0A 5EP2A 2P6RA 1AZTA 1RRPA 4IFEA 3QKSB 1WBBA 3A1VA 5DN6D 4OL0A 4HAWA 4Q9KA 5FPHA 2JLYA 3M1IA 4UNNA 1Z6GA 2OCAA 3DHWC 4ZDJA 5M04A 4KLZA 2RMKA 2JA1A 3QF7A 5BW8A 2R6GA 2XAUA 4URXR 1NBME 2QMUA 3IEUA 3QJYA 4TMKA 2J0SA 1SVKA 4NE2A 2ZAOA 3C5HA 4TN1A 4FMDB 1E4YA 3W6PA 2A9KA 3FHCB 3K9GA 4KHZA 5EZ6B 4QGAA 3AVXA 4C9BA 1S0UA 2VP4A 2HUPA 3MJRA 3ZS9A 5EE9A 3SHFA 5CB8A 1Z2CA 1GL9B 1G8HA 4FINA 4QJ4A 1KZGB 1OFTA 3ETLA 3Q8XB 3TR0A 3F0TA 4PAQA 3HYTA 4D26A 1Z28A 4U02A 5IHPA 1LW7A 3C8UA 4B34A 2YZ2A 4ZCMA 2JJ2A 4GMDA 2XNDA 1W49A 4PSKA 4H1VA 3PVSA 1AKEA 2CCJA 1VMAA 1JPJA 3AVYA 2VP6A 3KX2A 1KI3A 1Z47A 3W3AA 4CEJA 1MR3F 1OXUA 5B64A 4BFVA 4KFRA 5DYIA 1N6LA 4FXPA 4OJQA 1R5OA 4ZKEA 1IN7A 1JAHA 5DI3B 2OFXA 4UNSA 5JI2E 3EPKA 1XMVA 1AKYA 3VTKA 1ZU5A 2GXUA 1UEJA 4QHYA 1E2EA 1I4DD 2IEYA 3MWLA 1XZPA 3CRVA 1G20E 2PZGA 5FUWA 5UKDA 3WP0A 3B5JA 4P4SA 4IEIA 1GWNA 4CT5A 3U3RA 4POAA 4DLXA 2WWXA 5G41A 2QL6A 3NBYC 1KI4A 1GP2A 4QKQA 2N1BA 1GVNB 4Q19A 4D82A 2JIZD 3O8CA 3PQCA 1XNJA 2Z83A 4XTCS 3B1XA 2F43B 3TE6A 4PPFA 2QAGA 1Q3TA 3MCAA 3O47A 1GNPA 4UKDA 1G41A 3AVVA 3MUFA 1R0XA 3BS4A 3PFIA 2HEIA 1KK0A 3C15C 2ZAMA 2FDCA 2ERXA 4HAYA 3PXGA 3L0PA 1J70A 2NMVA 2MSDB 1FPMA 1Z83A 2ZI6A 4Q48A 4YMWA 3U3KA 2DHRA 3AF0A 3AP2A 4BASA 3CX8A 5B57C 4R2HA 5KDDA 5JWOA 1FZQA 3FKSA 3DKVA 1V43A 2ZYTX 3K9LA 2YNMA 2QEQA 4B2LA 1SXJD 3TSWA 2YKGA 1KNXA 1E2MA 4JKYA 4TYPA 1KI6A 1AS0A 4C2TA 5GJVC 3TLXA 2WJHA 1EESA 3LX8A 4Q01A 2VH5R 2ZJZA 3ND9A 1F2UA 1NIJA 2H16A 2IA5A 4BFZA 3DZDA 3GFTA 4KBGA 1XPUA 2ZETA 3LX5A 3CPJB 1LF0A 1P2VA 2PLRA 1JXOA 3Q5EA 3GLGE 2ZREA 1OFUX 4R98A 4YLGA 5SZJA 4TLEA 3BIFA 3QY0A 3TRFA 1PV4A 3GD7A 4IXNA 2X8AA 5HKKA 2JJ1A 4UNRA 1Q0UA 2IW3A 2DFNA 4M1WA 5FBQB 2WOJA 4DEXA 2R6FA 2R6CA 1KNQA 1E9DA 3AGQA 1G291 2OXCA 2ZPTX 2GETA 4HZUA 3KXIA 5IRCD 2IC5A 3K9NA 1JEEA 1G5TA 1PUJA 2WSSA 2N46A 3GJXC 4JYBA 4DKXA 2YWHA 4F4CA 4ILEA 1N5IA 4AWXA 1ZNWA 2FNAA 2IBMA 5AK0A 3PJRA 2GBLC 1HQCA 2OLKA 4LV5B 1OV4A 2JLSA 2YC2C 3QG5A 2R9VA 4LJ4A 2WTUA 3WYFA 1Z5ZA 4GRAA 4IDNA 3SC3A 5J47A 2ZRAA 2DB3A 2FFBA 2F1JA 5BWMA 2V3CC 1XCPA 2J45A 2ZUBA 4V0OA 2AD5A 4NKRA 5TB5A 3RABA 1XXHA 3AEZA 1YQTA 4E09A 5KYKA 1Z07A 1PLJA 1IN8A 1ZNXA 4M1OA 4ZDWA 4LHXA 2XTNA 2QMOA 4MRNA 4Q00A 1XTIA 4RCZA 3EWAA 3VHLB 2UZ3A 4US1R 4M1MA 1H65A 2G3YA 3PCRB 5E95A 4FI3C 3THXA 3AP3A 4UQOA 2GA8A 3DM5A 1TF2A 4RD1A 3A58B 4MUBA 3RS7A 1Z0IA 3X1WA 3I3SR 3GJ5A 4B3BA 4BEBA 3EC2A 2HF8A 3T1TA 1BMFA 1VG9B 1OFIA 1Q3HA 5KDLA 4HDOB 4GP6A 1G17A 1E9BA 4CVNA 1FX0A 2E9SA 4O0MA 2WMOB 2FU5C 5CB6A 3GLIE 2EWVA 1ZMXA 3WRXC 2AFIE 3TK1A 2EYQA 3FMOB 2CLDX 2AKAB 3B1WA 4B2IA 4PQYA 1ELOA 3KB1A 4Q4AB 1N6NA 1OXSC 4Y0AA 1UBCA 5EE3A 3BH7A 2YWGA 4U00A 3B2EA 1EFRD 5LB4A 2GHIA 4D4JA 3QEJA 2CDNA 3JVVA 5AUQA 1P73A 1KI9A 2Q3HA 3CLVA 4C0JA 3K0FB 1IXSB 2ZRIA 1TEVA 2FSHA 2QGNA 3QPWA 2IYSA 1FQJA 4LDJA 4YONB 3CRW1 2PJRA 3VKWA 5F3WB 3FKQA 3GEEA 4CIDA 1DAFA 4KITB 2OCPA 4LJ5A 2O8DB 4Z54A 5FTLA 1P61B 2BEJA 3ZGXA 4YQFA 2HV8A 1YJ5A 1K8RA 1OW3B 3OESA 2GBLA 4RZUA 2J46A 1C4OA 3OF5A 4DLWA 1I2MA 4M9ZA 4DCVA 4G5OA 4NYMQ 2C78A 2FEOA 2WHXA 2XX3A 4TLAA 1HV8A 4RD6A 3HU3A 3W6NA 2ZJ8A 4KV9A 5D3MB 3SS8A 3U44B 2JJ2D 1GRNA 5EZ5A 1GKYA 4E07A 4IKEA 5JHHB 1E1QA 2ECKA 2QRZA 2J7PA 3QKUA 5L3QA 1RYFA 2WJJA 3QIAA 1D9ZA 1QVAA 3TVDA 2JLVA 1WP9A 3ZH9B 5FL7A 5GADl 5CJ2A 5J4YA 3PEYA 2ZRHA 2PBRA 4KFTA 1SZPA 1P75A 3RSLA 4O25A 1Z0FA 1IBRA 2RGDA 1DAIA 4JL5A 4Q7MB 2XB4A 4D0LB 4QM7A 3K0CA 3T61A 3L0IB 2GZHA 2V1XA 3AKCA 3UKDA 1D5CA 3AP1A 1ZUIA 1V5WA 2C96A 2D4HA 3DM9B 2D62A 5JMTA 3EARA 2B8TA 3X2SA 4OK5A 2W6JA 1KHTA 1XMJA 4PXAA 1EG7A 4UJ5A 3AUXA 4O2LA 4M1SA 4TTQA 2AD1A 1G3QA 3PUYA 4TL8A 5IDVA 4OI0A 1Z2AA 4BLRA 3I4LA 4JVSB 4LX0A 4IHQA 1P3JA 1RJ9A 2PJZA 4LGMA 1Q1ZA 4WW0A 3THOA 1KJWA 2O8FA 4B73A 1PLLA 1CULC 1G18A 1DOAA 1T5LA 2QP4A 4GPTA 3QVVA 2QRNA 1ZM9A 3TUJC 1MKYA 1Z0DA 2ZI7A 3OEHA 1FUKA 3PEVA 4YMVA 5DIFA 1Z0KA 4ZKDA 4DUGD 3GLHA 1XZQA 4CZ2A 1N6OA 4Z1MA 1QF9A 1O87A 4JLNA 2NPIA 2GKSA 3GQBA 3BB3A 4F93B 1OYWA 1E69A 1KSHA 3LXRA 2F7SA 4ASUD 2E87A 2WOOA 2AK2A 4JYCA 1U8YA 1MRNA 3PV0A 3LVRE 2BCGY 4JLAA 1Z6YA 2VP9A 2WSSD 3I32A 4Q4JB 1W2HA 4S2EA 4X8MA 1N6KA 2EW1A 2O5VA 4C0LA 5CM8B 1IXZA 2GJAA 4Z8YA 3RS3A 4DDTA 2P65A 1E79A 5L3VA 5FUVA 4Q1EA 3SJBA 3U7EB 3NC0C 3GFPA 3ZD6A 3RRNA 1SVSA 4V02A 4M21A 4X8LA 2FSFA 1ZD8A 1E3MA 2CE2X 3CF2A 4JBXA 1NN0A 4EIWA 3GJ4A 4JSYA 4MRRA 4HLCA 3HPRA 2DPXA 2VSFA 3IBGA 2CCGA 4Q1CA 3A1WA 2R6DA 2XZPA 3LV8A 3ADCA 2ASEA 1G8GA 4LBWA 2QPTA 3LFUA 4R7ZA 3RSOA 2O8BB 3WNCA 2QZ4A 1ZINA 1AQYA 1J99A 5AJVB 1E4VA 2GXAA 1OT3A 2CVHA 4EQ6B 1ANKA 2A78A 2YHSA 4I81A 4G3XA 1DVRA 1W5TA 3W8NA 3ZJYA 1DBSA 1F60A 4EFMA 4NCKA 1AS3A 2ZRLA 4K46A 3RS4A 3NEYA 1YZGA 1H8HA 2EFCB 4B3GA 5JLJA 2IXFA 1VCOA 1UKVY 3QXHA 4G0NA 4P4UA 1E9RA 4B3CA 4HUTA 3QF4B 4AKHA 1VIYA 1VCMA 1TTTA 2F9MA 4XIGS 4LRWA 5TMPA 1VHTA 2JGNA 2DWOA 4B6EA 1FW6A 1KI6B 2FMXA 4C3ZA 1E94E 4W7SA 1YR9A 4U5XA 3AKDA 3QKRA 1M1YE 2WKPA 1E9AA 1M2OB 4JBWA 2ONJA 2FX3A 2PMKA 2XSZA 4ACBA 5TVKA 5EE1A 2H1LA 1XFAA 4WAUA 1JECA 5KOYA 1US8B 2QE7A 1OPXA 5J4KA 1OKKA 2GZAA 1E2FA 5GVRA 1XEWY 4A8JA 3SBDA 4CT4B 2WKQA 2PZEA 1E99A 3AVPA 4PPGA 1FTNA 3UWKA 5FTKA 3LVQE 4HI0E 1XJ0A 1KSJA 3KQLA 2AWOA 2W6ID 5FOSA 3NBFA 4URYR 3TKLA 2FH5B 1G3MA 3CUEF 3KKPA 3K0AB 3VR3A 3SEAA 1E9FA 1VCNA 4HEJA 1SHKA 4QBIA 1QBKC 5GJWC 4QGFA 1OHHA 4HAUA 4LHWA 3CX7A 4OYHA 2ZR0A 2G0TA 3CNOA 4URWR 3GLFE 2FG5A 2RGNA 4P4SB 4DEYA 1EXMA 3VHXA 1XXHE 5JSZB 2MMGA 2Q9BA 2O8DA 1F5NA 1XEWX 4M1YA 4BEJA 5DSZA 3AF3A 3QBVA 4URZR 2KWIA 2YJTD 2CHGA 1KDRA 3B60A 3Q85A 3KJIA 2Q6TA 1S9DA 4GT1A 4HSEA 2ATXA 2IK8A 3N5CA 4FMBB 2H5EA 3VX3A 1PZNA 1C9KA 3AB3A 4DDWA 2RKOA 1YHNA 3QVUA 2ZJBA 2UVQA 1KK2A 1GSIA 3OHMA 3Q3JB 3IGFA 3C41J 1A2KC 4C0BA 5KNBA 4MDFA 4CEHB 5DO9A 3MRSA 4AYXA 4BFUA 2REXB 1F48A 2YOGA 2ZSDA 1I4LD 3FHTA 1Z08A 2OUKA 3LAWA 4HB2A 4EPWA 5JWRA 3QEOA 3ASZA 3I5XA 2WJIA 3WYGA 2MSCB 2NZ8A 2RAPA 3GCGA 2O8FB 2C9YA 3TQCA 4PHHA 4UXIA 5SZIA 1TMKA 1I4TD 2VHCA 3A8TA 3O8DA 1OB2A 3IUYA 2OFWA 4Q7JB 4LK2A 4WXRA 2XXAA 1XXHB 1W4BA 2AN9A 2CL0X 2VA8A 1RRFA 2RGCA 2X1VA 5A0FA 3TGPA 1OXXK 2YOHA 3REGA 3OFND 2OLJA 4RD0A 2CL7X 5TV2A 2HCBA 2VP0A 1P6XA 4JT4A 4C0KA 2XTMA 2QTFA 3IDQA 3QI2A 4DUGA 1E2QA 3KUDA 1NMXA 1YVDA 1F2TB 2PH1A 1Z06A 1S96A 4IOJA 3OEEA 3R9IA 5KTYA 3W9YA 1XCMA 1L4YA 1RRCA 5GVSA 1TQ4A 1Z0JA 1N6PA 4MQBA 2ZE5A 2FPMA 4Z8XA 4D0GA 4H1UA 2QA5A 2WPDA 3EASA 1E2IA 1ZUNB 3TH5A 3C16C 2J3EA 1JPNA 5C18A 4JIMA 1WDTA 3T5GA 3QXCA 2W2XA 1LF5A 3R8FA 1DE0A 2QP3A 2FFHA 1H8ED 3UG7A 1EK0A 1DG1G 1R0ZA 2JDIA 4TT3D 4YMSA 2IUTA 5BXQC 1G6HA 1OYYA 4D81A 3PUWA 4I99A 4ABYA 2GEDA 4AIIA 3K0AA 3A4LA 4GBMA 3FFAA 4GP7A 2QPAA 2B7BA 1GILA 4RVCA 4BFSA 5TY0A 1IN6A 4F7WA 5CYOA 3K0EA 4GMXA 1O3YA 3SHWA 4A8JB 1JR3A 3B85A 1SVLA 2P5TB 3R7WA 1S3GA 1KJZA 3AVWA 4Q9HA 1SHZA 3TJZA 1R5BA 4EAQA 5A5GA 5JJLA 4MGKR 4A0GA 4ZI2A 3UIEA 1NBMD 2V1UA 3D6TB 4P31A 3BORA 4QHTA 4FW9A 5HTKA 2OAP1 1EX6A 4DXAA 2VSXA 2PX3A 2GAAA 4UXHA 3M6AA 3ZVMA 4DT1A 2LWIA 1BOFA 2ZU6A 3ZVLA 5HE9A 3P26A 4OK6A 1EFRA 3EZ2A 3EIQA 2YC4C 1T0HB 3V00A 1E9EA 5KPJA 3QXSA 3AVQA 1G8PA 4KO8A 4LC1A 2QAGB 2B21A 2RGNC 2ZS7A 4BLTA 4ACAA 3CH5A 2WJYA 3K9HA 2GILA 1IJFA 3GLFA 1DAGA 4QHSA 4B76A 3CO5A 2QPOA 1T5IA 3GFOA 1CLUA 3CH4B 4TMWA 4QM6A 1M7GA 4MGZR 2HF9A 5CK4A 4M2LA 1G16A 1F6BA 4JLDA 4Q66C 3EW9A 1YZTA 5K8UA 4L15A 1N5JA 5DISB 4DSTA 5KSYA 5KNDA 4OHVA 4A92A 3U7HB 2FSGA 3K0FA 3G82C 4MUAA 4EFLA 2P5SA 3GLGA 3B9QA 1TNDA 3T12A 4ARZB 2ZJAA 2LCFA 3CM0A 3P32A 1U81A 1RW4A 1GRRA 1P62B 2IF2A 2W2VA 4OI1A 1D2EA 1LTQA 4ON9A 4F4IA 1P2TA 2GJKA 2VF7A 3MLEA 1N5KA 1SVIA 4RD2A 3Q5DA 3JZAA 4RZ3A 5EE5B 1XB2A 1COWD 2WSMA 3B9PA 3BC1A 1JALA 1Z8FA 2FJUA 3BGWA 4LC0A 3GLIA 2F9LA 1N0VC 2YWFA 2JLUA 2CHVA 3U6KA 4KLNA 4HZUB 2JAQA 3NC1C 2ZJ2A 4PZLA 1G3IA 3LLUA 3WMEA 2KSQA 1XF9A 1NN3A 2OZEA 3SZRA 3LDAA 2IXEA 3UG6A 2ZSFA 4P4TA 5J40A 3NTUA 1OB5A 1FMJA 1VPLA 1OE0A 4BLSA 1J8MF 4JVMA 3KKQA 3H4MA 4MYTA 5DNYB 3MSXA 2AXPA 2HJVA 2BVNA 4BZQA 4XD7D 1MT0A 1ZD1A 5F9HA 2CBZA 4IOLA 5L3SB 2QMEA 2ZSAA 1NY6A 3TUIC 1HTWA 2A7QA 2CK3D 4DT1B 4U7DA 3K53A 2V9PA 2REBA 3VNUA 1LS1A 1ZYUA 4D4LA 4G5QA 3KL4A 4XVQA 3THYA 1U90A 2O0JA 2ZE6A 1KTVA 5FTNA 1CR4A 1P9NA 3B78A 5HE8A 4AD8A 2P2LA 5KSZA 1E2KA 1M7BA 3SI7A 5ELXA 4ZIRB 221PA 1KI7A 1T91A 4AKGA 1J2JA 1G21E 1G8YA 3W34A 1KMHA 4TYYA 1CIPA 2J0VA 5LD2B 1OIVA 3UMRA 2FGKA 3T35A 4WZAE 4Y0VA 1NSTA 1S4QA 3P4YA 2ZI4A 1GNRA 2XEXA 1KSFX 1W48A 2DR3A 3FPAA 3ZZUA 2CNWD 2CK3A 4MDEA 1WF3A 2QMHA 2EVWX 2N42A 4ZDKA 3O8RA 2AKYA 4RFSA 3GLHE 1ODFA 3EPLA 4KXFB 2L0XA 1QHSA 4IEEA 3NHBA 2Z4RA
chains in the Genus database with same CATH superfamily
5B3AA 1ABEA 2J3DA 1I7PA 3OZUA 1Q77A 4DYHA 3AM1A 3GV0A 4O2RA 4CN8A 1IL0A 1THGA 1DL5A 1E7QA 4L5JA 4U6QA 4ETNA 4WADA 3C6KA 3E05A 3IYLW 3ZWQA 3LOQA 3LQQA 3LDUA 5EIBD 3F2VA 2RKBA 3NW9A 4QEZA 1DG9A 3K92A 3AUYA 3ST7A 3OQPA 4GEGA 1BS1A 1JDVA 3OIWA 3IHWA 1P2UA 5HA5A 2YWEA 3H1TA 4QFCA 5JTUA 4JGBA 2HA0A 2ZJYA 5KHOC 3LQYA 3MW8A 3G2HA 4CEJB 3ZWVA 3M4YA 5LCXA 1ZUD1 1W25A 4DDVA 1HDYA 4LDNA 4MPPA 4RK4A 5HUHA 3COJA 1LBEA 1PWZA 3O3CA 2YVQA 2O1XA 2P69A 1JYEA 2C29D 4NCAA 4A15A 1TQHA 1XVVA 2Q4TA 2VUIB 3IBTA 1PJRA 1QWSA 3HZOA 3VI3B 2X8JB 4KWTA 4DNXA 4UTVA 2M6SA 3RQIA 2Q1YA 2DQZA 4G0XA 4JBIA 4JQZA 4LZOA 5EP3A 4BZZA 5CX1B 1U9ZA 2EKBA 5AR1A 3BA1A 5H1YA 4YJ2F 4A8TA 3A7EA 3FMPB 1L1RA 5DGXA 2D74A 2DCMA 3PNLA 4R68A 4WZAB 3MGCA 1UKCA 4ZAZA 4D74A 1MV8A 1FXUA 1OWPA 1P2SA 3U1BA 3O8LA 3L41A 2IT1A 2Q62A 4RL4A 3NHUA 3VZRA 3L6DA 4Y2PA 1SA0B 2GZ1A 4I4NA 4E0BA 4YRBA 3NXSA 4ZCRA 3T4PA 3RAJA 5E7QA 2FZGA 2G36A 2V6IA 3CZQA 4PTYA 4QXQA 5BO5A 3NTOA 4DC9A 2B4RO 3HWSA 3DLHA 4P53A 2N9UA 1PQWA 1FFDA 1UAGA 3RYCA 1BD4A 4J43A 1G9XA 3BXOA 1H93A 1ZZEA 2AUTA 4HQ0A 5ADVA 2A30A 4FE3A 5E7MA 1NLUA 2BI4A 3DOJA 3CW8X 3HEBA 4IQFA 1GG2A 4TTPA 5BURA 5U1PA 4N7BA 4TPKA 4FBGA 3O26A 4Q18A 2HNBA 2VSOA 5IH3A 1JHZA 4KU4A 4ALLA 3UT5B 2V45A 3I9V1 1PJZA 1VM6A 2FW7A 2GTPA 3NVMB 1CERA 4YP6A 1JE1A 2UYYA 3WYEA 3KSUA 1GAJA 1CJTC 1TM7E 4DIMA 3BG5A 1WHSA 1KVQA 1V6CA 2RB4A 2VRWA 3H04A 1R6BX 3HXPA 2NACA 3Q88A 3U3ZA 3CWQA 3OE7D 3SQWA 3KHKA 1G6Q1 2VH2A 4EZEA 3L02A 1H3NA 1WOMA 5JBQA 3UV7A 3E9YA 5DULA 3SDSA 2GBGA 3G9TA 3NAMA 3TL3A 1N2XA 1EX9A 1OREA 1WZNA 1HH4A 3HBJA 4AS1A 3WBJA 4MA5A 2PLAA 4PHCA 3V2IA 4JBYA 1Z6PA 2HSEA 3F3YA 4HNVA 4DYVA 4D45A 5IF9A 3S1AB 4IZOA 3CVVA 4D3FA 1U2QA 1B16A 4POOA 3IOEA 1MW8X 3ILXA 5C53B 2C77A 1VE3A 5J63A 2J31A 1YJAA 3DFIA 5C1BA 3FSJX 4XQGA 5ARDA 5CLIA 5AKJA 3TSAA 1ONOA 1F8GA 1U9IA 5A7HA 4CI9A 4RUKA 4MQEB 4PHFA 3FPCA 5JV5A 3FGOA 1SO8A 2EBUA 4KFUA 2RBEA 4EY5A 1YZUA 4XQ0A 5H68A 2H1FA 2WINI 5I7SA 5EJMA 2GK4A 4Q1DA 1ZQ9A 3U31A 1OCEA 2RK6A 2OV6A 3O7MA 4LBYA 4C14A 4DCGA 1RE0A 3IP6A 1X86B 3AR6A 3IJ5A 4MH0R 1US8A 5EP4A 1GL6A 3RV4A 2O7VA 1KP2A 2JASA 2NO1A 1DRUA 2XCRB 1XRRA 1JG2A 1ESZA 1NW7A 1II0A 3ZDCA 1L9KA 1Y4UA 2AFIB 3HCOA 5CFZA 1U65A 3OU7A 3M4ZA 2QTHA 3H7IA 4WHMA 3BN3A 3EODA 1KXZA 3MWEA 3QXGA 2A5DA 4ZT6A 4RXTA 3UUFA 5IULC 3VJRA 3LXUX 4N9WA 4EPRA 1QYRA 5BT9A 3FUCA 1XTVA 2C8KA 3U62A 2DPMA 4EG7A 1GFIA 5AOAA 2YZGA 4LBVA 1KMCA 2VCYA 4CQMA 2WF8A 1XZGA 2QLMA 3DVSX 4RHEA 4FDTA 2YN0A 1IOZA 3LYAA 5KVVA 2I4LA 1QIEA 3OAAD 1HYQA 1XP8A 2WJWA 1K97A 2YVLA 1OGJA 4RJ2A 3IE1A 1NUAA 5CA1F 2GGSA 2VK1A 3PYXA 4RETA 3CZ5A 4FFLA 4WL0A 5TF0A 1CUGA 4E1BA 1RPZA 1UWCA 2B0JA 4FGZA 4P0TA 2QM7A 1ZU4A 2XT0A 3A3YA 4XH9B 5AOVA 2PKWA 2IEIA 2P9HA 2XYGA 5A2QA 2BN4A 1JEDA 2AN5A 2GWHA 2DYKA 1XXLA 3K15A 4CMHA 2XTZA 1ZD3A 3BOSA 3ECSA 4UREA 4B3DA 1PR1A 1EFHA 1QUFA 1TEHA 2WZBA 3GPDG 1CY0A 3ANYB 1HNXB 2MR6A 4NYJR 3RHZA 4XRGA 4O4IA 3OOHA 4HVTA 5FI0B 3WNBA 4NARA 1TEXA 1IVNA 1QFJA 1HDCA 1JPVA 1OXMA 1PR2A 2IY7A 4DLTA 4ZYTA 5LIPA 1G9TA 1K3UB 4BIMA 3UGKA 1MO5A 4DV0B 4UE2A 1Z6XA 2Q5HA 3OPXA 4FIDA 4WK4B 5JC1A 1YZFA 2LDBA 1II8A 2WJVA 4AJLA 5JQWA 1M5RA 4LZZA 1CF4A 1BDHA 3VTFA 1GFSA 2ORIA 4FYIA 2AJ8A 1O58A 3SJZA 3V7YA 4A10A 3DDWA 4BQIA 5BV2P 4G0ZA 1CDOA 3ET5A 4HPJB 4CEIB 1X0XA 5KVAA 3B1VA 3HJTA 4INAA 4C5BA 2IS2A 1U02A 4TSFA 2H9YA 3DOHA 1PTKA 3I6ZA 1EE1A 3ZHTA 3BD9A 4G2NA 4UUBA 4R1MA 4CKZA 4GF5A 4OGKA 1GNQA 4GM1A 4PW0A 4BFLA 5F9FA 2J1LA 4MWBA 2K7FA 2HXSA 2EQBA 4OF4A 4KCGA 5JRZA 4WA7A 4I1PA 4BMCA 1G20B 1XNQB 3FMIA 5HPYB 1NJFA 2LIVA 3L8DA 3R7BA 2P9BA 5IXJA 4Q9NA 2X1HA 5DHFA 4DCPA 3PEWA 1YKFA 2IYLD 2Y1FA 3M6VA 1VCIA 1T3TA 5HBGA 4JJGA 3CSDA 4UUMA 1A2BA 1KDVA 2X0IA 3GJ3A 2NZJA 5LQMA 1EQUA 3SKYA 2E48A 4BCDA 2V4MA 4DVGA 5AD1A 2Y68A 2Y9PB 2YZNA 4PZEA 4W5QA 3T7TA 1FYVA 4A26A 3IQHX 5BVHA 4A2WA 4BVFA 1OLSA 1QNFA 1TLLA 1AX9A 3PFCA 4NHEA 5TQVA 2EBWA 2BLNA 1X9HA 3LX4A 1YFJA 1XG5A 2PFKA 1E92A 3KHSA 4NZNA 5DWDA 2VDPB 2W2OA 1TAHA 1C7ZA 1CS0B 1A5AB 4R05A 4X63A 2C2YA 1UBSB 1ZW6A 4TKUB 5F1PA 3U1VA 4BV8A 4LPSA 3T7DA 1Q0QA 1RKQA 3P5SA 2H2IA 1AURA 4AG3A 3D3WB 4Y2TA 2WJGA 1EVLA 2BM9A 3F6CA 1S2DA 4OUDB 2OGTA 1HLDA 1UEIA 3DYIA 3CHYA 2X9GA 1A27A 5B4VA 4QXAA 4MPDA 4FDUA 2O3TA 9MHTA 1IY0A 3SYNA 1IB0A 3WL4A 3ZVNA 4UM9B 2JVJA 1YNSA 1IRIA 1W581 2XUDA 4HB0A 2ZS9A 3B7GA 1HXHA 1BJTA 1OIWA 1V47A 2QE7D 3BWCA 4DG9A 3DVLA 1E9CA 2W90A 3S5JA 1K66A 1Q20A 3BF7A 4CIWA 3PCTA 3PEFA 2HPAA 1DEOA 2YUIA 3QG1A 3PIRA 1ZK3A 2WF9A 4OHCA 5LQKA 1H2ZA 5EJGA 4JLOA 4MS1B 3KTAA 3UYLA 1P5HA 3EPRA 3U2QA 1ISHA 2JD2A 5EJ2A 4IRMA 2W70A 4MVJE 3FVQA 3H5VA 4ND4A 2HPVA 3F4KA 3T99A 2PBZA 5T8KA 3TWOA 3OO1A 1JDNA 3ECCA 2WM3A 2P4HX 2QX9A 3H87A 1KVTA 3AETB 4QL3A 1KC1A 1KU0A 4OQLA 5FI1B 2FSUA 1Y1QA 2FYTA 2CV0A 1VL0A 4HDCA 2VBGA 4CM5A 4LF7B 3G5UA 3LPAA 4ND7A 4ZHQA 5AUPB 4IBOA 5CJPA 2FE4A 1SUCA 3DV0B 1NNEA 3KWMA 5JZOA 1R9JA 4BMPB 4EO7A 2ZR9A 3GJ6A 2GDJA 1XMQB 4PO9A 3KDPA 4RHFA 2BFEA 3FYTA 4MS3A 2RH5A 1LDGA 1VJDA 3N2KB 4MUYA 3GUCA 4CLEA 2V7QA 2O1SA 2QTMA 3ANSA 2VZ8A 2YZMA 4IRUB 3NV7A 3MT8A 2ZM5A 1L1QA 1L4MA 2BE9A 2BHTA 4FEYA 1XTKA 4YV2A 1Q57A 4B6OA 4X93A 2Z6VA 4O63O 4F84A 4M0LA 3NBZC 3D3EA 1W94A 4B2PA 3LBHA 2Z98A 4YAOA 1W96A 1YB6A 1PR6A 1YZKA 5C34B 3RIHA 5ICFA 4FFBA 3VRHA 2FZCA 2PZMA 4HAZA 1KAOA 2IYEA 3A36A 4JJ8A 4M38A 4MB2A 1X3SA 1JR4A 1Y3CE 2JDID 1U9JA 1T8TA 4R2JA 3VZCA 3WBFA 5FWXB 3ZJVA 4B3RB 1RWVA 2NO9A 3WLSA 1ZMTA 1R0WA 3ORFA 1D0SA 2G82A 3GEPA 5JCPA 4ZEXA 1OH7A 1C8BA 1GU7A 2HRDA 2Q7OE 4ENTA 2X4GA 3AESA 3K0CC 4RNCA 4C0QC 4CE6A 5KYXA 3SZMA 1GCIA 3T1QA 1Q22A 3L0SA 2RSLA 2CLCX 4KVGA 3RRXA 3WMXA 4MWZA 3TIVA 2B20A 4HQRA 3WGTA 2IPLA 3FYUA 2BKVA 2ZBRA 2F4VB 5D3KA 1P2DA 5EYPB 3SFZA 3IRUA 1F8UA 2C3PA 3E0XA 3R74A 2ZG6A 3PF9A 3K1AA 4NZ9A 1LWOA 2G6TA 1MO4A 1MJNA 1KF0A 2PT7A 4HAOA 1G4UR 4UM5A 3SE7A 2WWFA 3UQYS 1QTIA 1QZXA 1G5RA 4CLDA 1T3SA 1ULBA 3FHJA 3HGTA 4YV1A 3NOVA 4ZCLA 1NMZA 4JEHA 4PAOA 1CVRA 1E0SA 2R86A 2WILA 3AQ4A 1LJLA 2JFBA 3GA0A 3RRMA 1F2DA 4EEKA 1GQ2A 1S4MA 1XMOB 3JR3A 1XPOA 3LPCA 3UJDA 2HK6A 4MHOA 3RSCA 3DE0X 4EBFA 3KYBA 4N8EA 4W9NA 1W4ZA 1Q44A 4EWLA 1XJCA 2HHJA 3N8IA 1XYYA 4IJMA 2BBWA 1YE3A 5EHQA 4J2OA 3FUXA 4WE3A 3R5XA 1P1IA 4ZZ0A 2GZ2A 1RYZA 2Q2QA 4B3HA 4QTXA 4U6SA 1R2QA 1RLJA 4JZYA 4BWYA 3AFGA 3LS2A 2V6BA 3JD3A 3RUPA 3UT5A 4M8KA 2BFWA 1DIRA 3DZFA 4F2GA 1F7VA 1W44A 2I4OA 2LBPA 3E18A 2O7SA 4REQB 2RBKA 3JY6A 3NKLA 4NCNA 4UE6A 1DC3A 3N3BC 1OSNA 3RRBA 4MRVA 4RELA 3QKIA 4WN9B 2R96A 2WWRA 5LZ8A 5U4XA 1N5DA 1SEVA 2MDTA 2EZ4A 3J7TA 1DC7A 4KB5A 5FT9A 1PWYE 1FYWA 2W5UA 2JI7A 4RVDA 3QQ5A 2VYND 1VHLA 2ZUUA 3IT3A 3QNUA 1SA0A 4QJ5A 5HFJA 3UWOA 4WZBB 4D0SA 5FX2A 2HA3A 2Q45A 4F5DA 1PNQA 3C5EA 4J16C 1TT5B 4L02A 3IBFA 5AJTA 3TLKA 3WRYC 1OC4A 1VYTA 6YASA 4BNGA 3IIJA 3C6MA 4XUDA 5E3HA 5KWSA 2YFHA 3EF0A 4MP6A 2P2GA 4DILA 1BROA 2HMWA 1QAOA 4DG5A 1ID1A 1L7RA 4IIUA 5K8LA 2GK6A 3V9PA 5JANA 2V9CA 2EARA 4H1HA 4O4LB 5JCOC 2O8BA 1BMQA 1BS2A 2FG6C 5CD9A 3R9WA 1E5TA 1LXCA 4Q03A 1XTQA 3R5TA 4KAFA 2TMGA 3DGFC 3AR7A 3CRMA 3IODA 4NP6A 3EN0A 4HZIA 4LSGA 4TS9A 4ZO7A 4EGSA 4FB4A 4DRZA 3JQ9A 1X1SA 2GEBA 2B1QA 1EVQA 2VKQA 2PUHA 2X1MA 2X0NA 4I1OA 4B7UA 4DRXA 1XD9A 1ISFA 2F1IA 1KIFA 4TLBA 5KPDA 5CIWA 5DM1A 1M72A 1GV0A 2VBCA 3OH8A 3QQPA 3MELA 3THRA 3JCZA 5FTJA 2ZJ1A 1YS4A 2GKGA 5J4HA 1IY8A 4B6FA 4PY2A 4R9RA 2IZZA 1XEXB 4G9BA 3LKBA 3B3FA 4YJFA 4LNAA 4NEHB 2REOA 3JQGA 4BMVA 5CCBA 3INNA 3U3DA 4N3AA 3SAJA 3F3SA 2EG9A 2BTQA 4R0VA 2QAIA 4W1PA 5EAIA 3HSSA 2M32A 1JQAA 3ZY4A 1WE2A 1U8EA 3K20A 1HRDA 3NH9A 5TT0A 1LSSA 2LD4A 2C95A 4YDQA 4YCBA 2PG3A 4XVCA 2QI9C 3U44A 1JKXA 3L7OA 1CRQA 1IWBB 1T6YA 1CZLA 2A0WA 2JZCA 1JJBA 1SB9A 1YDGA 2A0KA 2P6PA 4MV6A 1MEJA 4B43A 4HNUA 1UPAA 3NP9A 5FO1A 1WZIA 1NDHA 1FNMA 1VPWA 3IKTA 2Y27A 3RC3A 1EUDB 2FPWA 4MVJM 4RKWA 3M9WA 1LWNA 2WV9A 2GHQA 3EBLA 4A6DA 1GA1A 1QGED 1S8NA 5CB0A 1VB3A 5KJFA 4R5MA 1CFZA 2QSYA 3EXEA 3ENVA 3PS9A 2JRLA 2GSWA 3DV2A 3QHAA 4BB0A 3SWWA 5IUJC 3SBOA 5J9FA 3V33A 1GL7A 1X1QA 4OMDA 1P33A 1RWBA 3BE4A 1L7PA 1E4EB 5GZ1A 2HT1A 3D2BA 3L7BA 3BICA 5SY9A 3X1XA 4ZT7A 4NAHA 4BO6A 1X14A 1OFVA 1E6KA 3DFMA 1GQSA 1NUSA 1Z74A 3WIBA 5BSVA 2JCVA 2C9ZA 1R6DA 2AR0A 4D43A 2BFFA 2ZI5A 1XE3A 5KVSA 4NBUA 1PG2A 1P9RA 1RVV1 2I4TA 2VJKA 3KYDB 3D0RA 4MA4A 5COAA 5BYBA 1IEVA 3SM3A 5L7YA 3S99A 3A28A 3OEWA 1PR9A 2QRKA 5DCUA 4EYOA 1YFZA 2BKAA 3SQOA 1H05A 1GV1A 1WVMA 4OQYA 4FMPA 3HL0A 3VH4A 3HHPA 4YFYA 2QHXA 1WQ1R 4C0SA 2XXAB 1HOTA 4DFDA 5CYPA 2WTXA 4LJ6A 4MW4A 2TS1A 3KOYA 4U2CA 1MC4A 5JPIA 1XROA 3PNPA 1G3RA 1XOIA 2EIHA 5EJEA 1AMNA 3QBEA 1GN8A 1N2ZA 3GRKA 5H81A 3RVBA 3WO0A 3VSCA 3W06A 5A4KA 1G38A 2C2WA 3F6EX 5JD4A 2ZW9A 5LLTA 5LQNA 1FXWA 1U5BA 2DBQA 1KORA 1SU7A 2D7CA 4J91A 4XA8A 4F5YA 4JQOA 5EVJA 3BIJA 3FIJA 3WO1A 1XI2A 3GCXA 2QN6A 4LW8A 4HDKA 1B6RA 1ZNQO 1BYUA 2X7HA 4Y8VA 1B0AA 4KUEA 2ZIFA 4TT8A 5EJ5A 2H00A 4U63A 4ZI7F 1M9NA 2Z43A 3OWHA 3OX4A 1UH5A 4MUKA 3OC6A 1FLDA 4UPDA 1CUBA 2RGEA 4FXOA 1P5ZB 1XD2B 4K7JA 2D2VA 1NQAO 2AF3C 4NY1A 2D1TA 1L7BA 2FFQA 1ZBDA 2XOXA 3MJEA 1KYIA 1POWA 2JFHA 3ZJ5A 3NU1A 5TJ9A 4XXHA 2BHLA 2WYIA 3QX7A 3V9AA 4XYLA 1XHEA 3AUAA 3L8CA 5E6UB 3CLTD 5IAGA 3PRJA 4N0QA 3A6GA 1Z2OX 3FLMA 2GESA 3FDZA 3K4QA 4YYZA 1MNQA 3CUWA 1ECPA 1MVNA 1VKOA 1BD3A 1TVMA 4IG9A 5LXTB 3SLRA 4AJNA 1V8OA 2P9EA 4PV7A 1G7RA 1D7AA 1EP9A 2ZRJA 2H0QA 1F0KA 2CDAA 3O2JA 3C14C 4HXGA 4LKOA 2ZT7A 2X0DA 3IBYA 4BP3A 1O7JA 2H52A 1TM5E 2V58A 2W2TA 4XR4A 5DCLA 2I1LA 5TJHA 3ROMA 3OIYA 2XCSB 5K0FA 2V5UA 5KTMA 1Q0LA 4XCVA 5CLGA 2PLFA 5JEDA 2XDQA 4DARA 2QORA 3K1AB 1PKXA 2CEAA 1RQLA 4PZUA 1W75A 1JJ7A 2ZB7A 5HFAA 4OLHA 4LISA 5M34A 2B78A 1T3HA 3OO0A 4FFRA 1Z29A 1PJSA 4AQ7A 3THWB 2I62A 1J25A 3AUFA 4RCVA 1OLUA 4HXYA 3R6TA 4LVNA 3ZWKA 1SKBA 3NT2A 1QZ3A 4HNAB 4I4LA 4A5OA 1G5QA 2P68A 1A82A 1L5FA 1N7JA 2FLKA 2B92A 2Q9UA 3L06A 3MVEA 4BIIA 5LQRA 4NENA 3UAYA 3MS4A 4NNPA 2JB9A 4R8KA 4JYAB 4KGVA 4GOJA 1WXFA 1IC6A 3EQ2A 5CTJA 3TZHA 1O89A 3CIOA 2O9JA 4MEBA 1VMKA 3WGMA 4RY8A 1HT1E 3I04A 2J9RA 4R8MA 1GDTA 1IJKA 2VEOA 1O57A 2XBUA 3PDCA 4UU0A 5L4SA 1KK1A 3PE4A 1T24A 1NFFA 2P1ZA 1O8BA 1Y8QB 1A50B 1RLUA 5AVQA 3MWGA 4OJMX 2V6MA 3KQWA 2IS4A 3B3QA 3LY5A 4KXQA 1YDHA 2IOYA 2YXBA 3NHRA 2XQIA 3WFIA 1X7DA 2H4HA 1TK9A 3KLPX 3ZDZB 3LT5A 3G68A 4JR2A 1RLMA 1ADFA 1LK5A 3ANMA 3VVCA 4ESHA 2X0RA 5IPFA 5HG0A 1PJ4A 3PQ7A 4OQMA 1E18A 2BGIA 5DP2A 1UBOS 1ZQ1A 4DSUA 4EW2A 2DTDA 4EY7A 2CNDA 3EXEB 4A6PA 1CD5A 1E1RD 1F1JA 2JW5A 2W6PA 4MVWA 4TSFD 5DSTA 2ZR7A 2NUTB 3PX3A 3C7DB 3X2EA 1K5DA 1NQXA 5AKLA 4Y2QA 4HG2A 2HJ9A 5AW4A 5LLDA 2X22A 4HAVA 2ZJ5A 4CMEC 1RYBA 2JGEA 3L5KA 2XOKA 5JVDB 2XTAA 5AVUA 5HM8A 2VZLA 2XZLA 4B4KA 3BXFA 1M1NA 1V8BA 4AYWA 5ALUA 5EJ9A 1QH1B 2ZRCA 2XR1A 1L5NA 2MSNA 5IWAB 1MZVA 4BFWA 4L4SA 1YJ8A 1Y5NA 2JAWA 2ZRNA 4NPHA 5FOTA 3I8OA 1Y42X 1W5AA 1T6XA 2X8WA 3LKZA 1U0NA 5H7XA 5JR3A 2XSZD 1B76A 1AV6A 4IDEA 3D7NA 3HJCA 3Q2OA 4BY9E 4NCXA 3G1TA 1IG0A 4IIEA 3TB4A 4J1TA 5BVGB 3D5TA 3F1LA 3WKEA 1LBHA 1UQRA 5JZVA 1FE8A 4L76A 4DY4A 2MOKA 1EVKA 3EIHA 1O95D 4HX5A 3EDCA 1IN1A 1IN5A 2VAMA 4NFYA 1IWPB 1NKSA 2P4QA 1Q95A 1XR3A 2A5GA 4ML3A 2JLXA 3WGVA 1W0KA 4QRHA 3AFOA 4ENVA 2WM9B 2PT5A 4OHWA 3RU9A 2ONYA 3JQCA 3OZWA 2QTLA 1DC8A 3JD4A 3PF8A 1IY9A 3FAKA 2B1RA 3W2GA 1XDSA 3HKBA 1XQ9A 5HKLA 1DAKA 2O50A 2M6KA 2JIBA 1Y4ZA 3WBKA 5B53A 5JPDA 1QE3A 4G0PA 5KYUB 5IFKA 2C54A 1CZOA 2FOIA 1JWBB 3CRQA 3L7JA 1RRKA 1M2VA 1HEUA 1IU9A 1P29A 1UJBA 1PUIA 2AJTA 2OO7A 2RJOA 3MT7A 5FI5A 2ICAA 4MIYA 3LKDA 3O9ZA 1E32A 4MR9B 3PFWO 4NXMB 1K4YA 2YQZA 2ZITA 3AL3A 3JZDA 3LVFO 3PR3A 3R3JA 3DMTA 2R1ZA 5BSEA 1P6QA 5E2BA 1IBCA 3RYCB 4AO7A 1PFVA 3HEMA 4WOKA 3CWZA 5L3RA 1G9SA 1WUJS 4TV9B 3BJIC 4PG4A 3TG8A 4OOEA 2Q50A 1JH8A 4AMBA 4R9UC 3KOXA 5FNZA 5KWIA 2A5FA 4S1OA 1AA3A 2IYYA 4ISBA 1D4AA 1CJSA 3PHBE 2D0PB 4O4JB 1U8AA 2GM3A 1IM2A 3N0RA 4ND6A 3E70C 4TRMA 4GLBA 4TYQA 3K72B 4Q4LA 1KOLA 1WW3A 4WESB 2YTZA 3RTCA 3UATA 1UAYA 1TUEA 1E79D 2C2HA 3ESAA 4KQIA 2HH9A 2IYUA 3KSBC 1CU1A 2AE1A 2G04A 3A6LA 2V4UA 1Y7LA 4QEKA 4ARAA 4BJ6A 5F98A 2OXEA 3EZ6A 3PYMA 2BI7A 1XDUA 4KHPB 3SC4A 4XM2A 2H85A 1VBKA 1VLVA 5LM3A 4MICA 5JAMA 2CYBA 3T3DA 1O6GA 1RWWA 2PR7A 1GTJ1 1LVUA 2RGAA 4KVAA 4O5AA 4RY2A 5TMPA 3GNQA 5FLXA 1LI4A 1P74A 4PM4A 5D6NA 3MCUA 3X43A 3K6SA 4MPRA 1KRXA 1ZRHA 2B6NA 3B36A 2R5WA 4ALJA 2ANCA 3M49A 4JR1A 3IHLA 5HKKD 3G0BA 5KYNA 3O90A 1SCAA 2VXOA 5FLYA 2JARA 4B3IA 4FGLA 2QIPA 3SN6A 2Q5CA 2BSQA 2HK9A 3RB8A 4QWMA 2Z2JA 2WAAA 1RZVA 2F3RA 1YR1A 3NBAA 4JNKA 1VSQA 4DXHA 5L95A 1ICIA 1HQDA 4H6WA 3WGIA 7REQB 3TPZA 2IWHA 3OE7A 5FL7D 3ZHCA 1HM5A 3ASYA 2VTKA 2R1TA 1GT91 2ON6A 3B8HA 1XBTA 5LKAA 2VJAA 3NNDA 1ONSA 3DL0A 3BAZA 5CIQA 4CV0A 2CY0A 1MRZA 2VWQA 1VGVA 4EI8A 4EYEA 1E1CA 4HQFA 4JUDX 2NZ2A 4RK7A 5AJXA 1N0UA 1IQRA 3TJRA 2QF7A 3W9BA 4DCSA 4F38A 3M4NA 5JUWA 1GN9A 2QUHA 4BMXA 3GARA 5I5EA 5FL3A 1HDGO 4IVNA 3WMFA 4EKIA 1RE1A 3IAFA 3PE3A 4F92B 1VSBA 2UYOA 5HIKA 4CQNA 3LW7A 3MTEA 3PGMA 4MCJA 4NYJQ 5T4HA 3GZNA 1PR4A 2BR4A 1NLZA 3R0XA 5AFSA 3PEEA 4KMOA 4JYZA 3SYRA 1FYXA 2ZXUA 1QHHA 3UUEA 5HQ3B 2DCUA 3G59A 4RKYA 1KEVA 3T1VA 3BKWA 3I9NA 3TZBA 2XE7A 2B69A 4X41A 3VKHA 2AXNA 5DGIA 1MGOA 1QIGA 3D54D 4DZZA 3ZHRA 3ND8A 3BWXA 2BPOA 4ZAXA 3EXAA 1SKMA 3TQSA 1ZH4A 3P2KA 1IATA 1FFHA 1KJJA 1M6VA 1M54A 2DJ5A 3ZI4A 1VLZA 2HN9A 3NWPA 3TIXB 2CDBA 2PV0A 3WA7A 1OAKA 3EAQA 1L4NA 3I6BA 4X1YB 2IOHA 3ZE0B 4XPIA 4UEWA 5AUOB 4WK2B 3MQFA 1B23P 2DC1A 3K9BA 3GNTA 3ZH2A 1J9ZA 1TECE 1M34A 2JAXA 4MO9A 4UBMA 1X9GA 3DKRA 4L5IA 3WWZA 4B82A 4ZJUA 1JE0A 4D9FA 2FI1A 1CV2A 2CJYA 1SD2A 2OM2A 3EBOA 3SKXA 2H2HA 1CPYA 4KWEA 4LQ4A 4R3UC 4JCCA 4JLVA 4LE2A 1N75A 3TSOA 3D2CA 4A2CA 1Y4DE 5KNDH 1XLTC 1FNNA 5B58T 2RHCA 3AUUA 4WOBA 1QK4A 2VPQA 3R0QA 4MJ3A 4TYNA 4RHTA 5DLEA 5KMGA 3MK31 4H3HB 5J58A 5LA6F 1M8PA 1AS2A 1EIZA 4FNMA 1ORIA 1NE7A 3BD7A 3IDSA 3SJUA 3FXAA 4Y7CA 5EWLA 1D2CA 1KI8A 4QQFA 4QX6A 4MKGA 3EXHA 5FUYA 1H2YA 3M2PA 4MQFB 5AXDA 5I45A 2PWZA 3JWJA 4FONA 1R8SA 1NN1A 2E18A 1QB7A 4X1KA 3TOSA 1Q1BA 3RC9A 2H2AA 1K7FB 2ZT8A 2JFVA 4XSHA 5K0BA 4FMDF 1XD2A 4DBLC 2R8RA 3REFA 4FWIB 2VG8A 4FCVA 4LNUB 3U4HA 4X62B 2EQ5A 3CBQA 1ND5A 1XELA 2ZCUA 3I2IA 3IAM6 2LDXA 4G65A 5L3SA 2XGJA 1H1LA 1X80B 1H1DA 1A2OA 3F71A 4JL8A 3VMMA 1Q5PA 4OGWA 3ZUPA 1L7VC 1LZKA 1P4SA 1GZSA 4R8RA 5DHPA 2G9ZA 4P2GA 4NS1A 2HMYB 1YO6A 2DTEA 1IZZA 4D6YA 4BNTA 5AI0A 1T9BA 2E4UA 4S35A 3A1EA 4C4PA 4N40A 1TFRA 4EA9A 3ZJTA 2EQAA 1S2LA 4MUMA 1PJQA 1OLOA 4HO1X 3K9FC 4G0UA 2PGJA 3TDMA 3DBRA 1RP1A 4ILKA 4JHXA 2ODEA 1TQ8A 4XJXA 4CEHA 4KUHA 5K20A 1BWRA 1SC9A 1TTQB 4O4JF 3V7WA 3IMFA 4EB8A 3PC8C 1OILA 3KKMA 4WV3A 1QORA 3ZDRA 5JHGB 3FN4A 1Q83A 1QPBA 1ZWKA 3Q2IA 5ALYA 5F2OA 5J2UB 2OORC 3B6EA 3RDPA 1ULZA 4K2HA 3SFTA 2QJRA 4IHAA 1P5RA 4S05A 4YQEA 3IP7A 4BNZA 1U0JA 2QX7A 4L0CA 2WZDA 3N8GA 4DNPA 2Q07A 1UXKA 1W35A 2BTOA 1XTJA 3NCHA 3OECA 3VR5A 4UASA 2WYUA 5FFMA 2C3UA 2IEGA 3I1JA 5TMBA 2NQ2C 2G67A 5BV0A 5MFPA 3R20A 3ER9A 1KFKB 1NG9A 3GFVA 1W36D 2HIHA 2CFSA 5CYGA 2B5VA 2P7HA 3DCIA 1OY1A 3IHTA 1U0GA 2BELA 2HU5A 3LA8A 4UEQA 5H0IA 1C7FA 1X7ZB 4QDZA 3TBFA 4B48A 4D6XA 4RHUA 4YWHA 3SE0A 3ZCVA 3K09C 4NJEB 3PQ3A 2O0HA 2FRDA 4FFOA 1O6FA 5CAEA 2QQEA 3H2YA 1RQRA 3ZQJA 3NC4A 4HCJA 2ZZMA 4C7OB 3SVLA 2QTGA 4W8HA 4ZV9A 2L42A 4PEVA 2LV8A 3WMRA 3HJNA 4YCCA 3Q7QA 3HR4A 2J9FB 3ZKWA 1U5AA 1N5MA 2NO4A 1NW4A 2AQHA 3VI4B 1L3BA 2XBMA 3EGCA 1VA5A 5IVIA 1R00A 1DBQA 2CN1A 2DKNA 3BFKA 1RAAA 2DFLA 4OQDA 4RV4A 4AMGA 1VG1A 1XF1A 2XYPA 2Y8EA 1U1CA 1V5EA 2QZSA 4FOPA 4U1RA 3H5NA 2C9MA 1PYOA 4GC5A 4M22A 4Q4HB 2A1UB 3A4NA 3AZOA 5CAEB 2H0RA 2OLEA 1JEQB 2QXTA 3HZHA 1AQLA 3PXBA 5CVDA 3WYAA 1XUOA 3ZD9A 2HNAA 1Y34E 3DNFA 2J32A 3FY4A 3QVJA 4JFAA 4MPJA 2H48A 3PK0A 2QVGA 4U7GA 3IV6A 3W05A 4JX8A 3U09A 2W98A 4MS1A 4W5WA 4UARA 4ADSG 1C9YA 2QUZA 3CB2A 1T4BA 4MUNA 1D1QA 3EIWA 4I14A 1GPUA 3QKRB 4Q3NA 1VE5A 3GF4A 4HUQB 4ZD6A 5BR4A 5KKAA 1L7OA 4LSZA 3SHQA 2IUYA 2Z58A 3QV1A 3NO4A 4WASA 1FMTA 4Y1RA 1EK6A 2A5LA 2QP9X 3EUAA 5EXPA 3ZLJA 1EVYA 4QNMA 4YPVA 2XVAA 3ETJA 4F2PA 3TL6A 1FRVA 2UKDA 1Z73A 4F8JA 5HRCA 5L4NA 5K3FA 5IS2A 4W5TA 2DWQA 4QBKA 2FPGB 3RREA 3VNQA 1UMDA 1DMRA 3EG5A 4DIEA 1N2HA 3GEHA 5HJEA 2F8MA 2UYGA 1H3FA 4JR0A 1BOOA 2GS9A 2IDMA 2R25B 2XNCA 3QU5A 5BSMA 3TGWA 3LJKA 3I1FA 3W6OA 4BFXA 2H8KA 4XWWA 2ZR8A 1G6OA 2E4ZA 3VZSA 5I51A 121PA 1AXRA 2RCNA 1ZBQA 3EZ9A 3QW2A 4QOFA 3VUFA 1I80A 1AU9A 3WFZA 2QB5A 3BD6A 3FRIA 3D1LA 4U0JA 3FB1A 4QOIA 3PXXA 3TZEA 1KIMA 1E8DA 3F9CA 2BUBA 3W2IA 3QPDA 3GO4A 1Z3CA 2C03A 3LRPA 4Z99A 4JP2A 4XSVA 2Q6VA 4KR2A 5FA8A 1HDOA 2YJZA 3UGQA 1LDEA 3AHIA 4MR9A 5E38A 3RO7A 5JRJA 4D3XA 4OXXA 3LA6A 3CXUA 3L8ZA 4TVBA 4JXJA 3JTMA 1H6CA 2GI4A 2VJOA 2PV7A 3FFTA 3RYHA 3VSEA 1QGDA 2HYDA 3WLPA 3EIXA 4G37A 5CHYA 4NZYA 3NDBB 4KVZA 4AQDA 1X7XB 2IV2X 4X90A 5A0TA 4MVJA 2VJYA 3IT1A 1MUUA 2BMAA 4ZGGA 1CP2A 4UNPA 2FFAA 1E2PA 2GCOB 2FN9A 5E7JA 1R6VA 5AVYA 3WISA 2HAEA 1N2IA 3AC0A 2HK8A 2PUDA 4EJ6A 3HDTA 1O8CA 2EJWA 1SKYB 2C5FA 2IX3A 1G8FA 3W7AA 2XMCA 4NPAA 4BQEA 3T12A 3MWKA 2VHTA 2RHTA 2WAYA 2X8LA 3AUKA 4J75A 4LMPA 2XWQA 1HRKA 4O59O 4B35A 4TSKA 2AX4A 3PJDA 4OOFA 4H2DA 1T4MA 2QMQA 1VYUA 4PR3A 3TZKA 3ZDEA 2QNIA 3DYBA 4DY6A 4HWGA 4PG6A 2PRJA 1CEQA 1A9TA 1RFGE 2YHIB 3BMXA 2ZI9A 3GPCA 1FVHA 4WK6A 5CVVA 1HLFA 2PYZA 4X1IB 3O0DA 3UOGA 2ABWA 3C5WP 5LDHA 1W1WA 2IPXA 1MRSA 2PCLA 2R6AA 4BNJA 4BB5A 3CB4A 4TV9A 2DX7A 4EB0A 3URKA 3OFNA 4PO8A 2EERA 3MXOA 4NAUA 3ESYA 1CDEA 2NTYC 1HE1C 1DXHA 2BEKA 1Z4OA 5JNUA 2R7KA 3PGJA 1A5BB 5CEEA 1C80A 3TN7A 3AM5A 3CZMA 3K5IA 4G26A 1SBCA 2P9JA 1FSZA 2HM7A 1CQZA 3DR5A 4MW6A 3WGOA 5HCUA 1OD6A 4ES6A 5KYUA 3L92A 1I10A 2AFHE 5EERA 4MZXA 4CQMB 1Y3AA 2F1OA 2VA9A 3LU1A 3FF4A 4HGQA 1UCFA 1E2GA 2VWHA 2EU8A 1W2WB 3EIEA 2R4UA 3GUVA 3ACCA 4FSHA 4L73A 4YRZA 1PK9A 4FFBB 1IMJA 1SWWA 1NKTA 1A9YA 1K9VF 2QN1A 4B3JA 3IH5A 4ZMRA 2HMSA 1CS4C 2NIPA 4X92A 3MTAA 2O3RA 3WC4A 5F21A 4GXQA 3E81A 2PJDA 2PX4A 3EC1A 4PFSA 1ZSNA 3HU2A 5FV7A 2VUSA 4WA8A 3PFFA 1UBNA 3O4RA 2R48A