4POAA

Mycobacterium tuberculosis reca glycerol bound low temperature structure iic-bn
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
327
structure length
309
Chain Sequence
TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 89
structure length 309
sequence length 327
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4poaA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4poaA01
1E9AA 1L7VC 3NHBA 5D3QA 3RRZA 3BBPA 4TZ6A 1P73A 3NEJA 1JBKA 3GLIB 5FOXA 3ETLA 5GADl 3ZZUA 3AKYA 1Q57A 4AYXA 5HR5A 1M7HA 4M9XA 4RCYA 2QMUA 3QBVA 5L3SB 5KO2A 1CF4A 2XAUA 5LB2A 1TTTA 2ZANA 4KVAA 4HLUA 3T5GA 3IQWA 1AA3A 1KHTA 4ABYA 2ZSAA 1CP2A 5AUNB 2RHMA 1CJMA 4EFLA 4JBXA 1XMJA 1ZCBA 1N5JA 4GRAA 1IHUA 3DVLA 2GBLC 4D0LB 2NZJA 5KPDA 1H65A 4IXNA 4B48A 2FSHA 4QRHA 4YMUA 1T5LA 4XVQA 4AI6A 3W5JA 3I61A 1VDZA 1DAMA 4RJLA 3NVAA 2I4IA 2C99A 2F1JA 1GNRA 1RIFA 4L4UA 3RABA 5L3QB 3IQXA 5EJEA 1XD8A 2ZPTX 1ZP6A 4KSBA 4OHXA 4PPFA 1P7CA 4DHEA 2CL6X 4R7ZA 1RFLA 2P6UA 4KLZA 4XSGA 5HCIA 3THWA 2GA8A 2O8CA 4IRUB 1NVXQ 3NIBA 5EUMA 3UWOA 3MWYW 1DAIA 2OXCA 3NBYC 1R0WA 1ESNA 2AFHE 1Z6GA 1XXHA 4OI1A 4O3MA 1YJ5A 1SGWA 2R6DA 2BKUA 5FUXA 4B35A 1OHHD 4XSHA 2IBMA 4ZKDA 4NTZA 3QKTA 3UWKA 1KJZA 4BZPA 2FEMA 5TVKA 4ZCMA 3EZ2A 1K5GA 4MGZR 1G4AE 1UBGA 2PJZA 2OFOA 1FL9A 2QBYA 1O87A 3N2IA 2ZJAA 1JR3A 3TKLA 2JGNA 2R6GA 4V0NA 3ZVLA 4V0OA 3VR5A 1SVLA 2HV8A 1U8ZA 4AK9A 5JLJA 4DCNA 2FJUA 8OHMA 3I1FA 1FP7A 4PC3A 3U7FB 2YWEA 1N5KA 2ZSEA 3ASYA 2XOKD 3W8NA 5K8IA 4IOJA 4US1R 1HQYE 3GFTA 2W6JD 1XCPA 3QJYA 2E9SA 2C03A 3THOA 3BH6A 1LF5A 2BWJA 2KSQA 1E79D 4OHYA 4B34A 2ZS9A 2UZ3A 2BJVA 1N25A 1VECA 3A8TA 4IKEA 1Z08A 4L5BA 2ZYUX 3EWAA 4S2EA 3TR0A 1JAHA 2EWVA 4JYBA 4HAXA 1YR6A 3ASZA 5AWFC 1K5DA 3A4MA 5FL7A 4HZUA 5FH9A 3DMDA 2YHSA 2DPXA 1RRGA 4NCHA 1ANKA 4LBVA 3MJHA 4KYIB 1E98A 1NIPA 2Q9AA 1G64A 3D8BA 1F48A 1J2JA 2CCGA 5BQ5A 1YZTA 3WNBA 4AG6A 1E4YA 2DCUA 1IAQA 1XZPA 4BFUA 1E2QA 4OI2A 3WMGA 2GXAA 5UKDA 4NYMQ 1CJKC 4Q4JB 5E3HA 4TQAA 5HE9A 1COWD 4TWZA 1W5SA 1EXMA 3NEYA 3U61B 3GJ8A 5K8LA 4MKFA 2AWOA 1D2MA 3BH0A 2REBA 3DDCA 1ZD8A 1KMQA 4FMDF 3MFYA 1M6NA 1TX4B 1XEWX 2XEXA 4Z51A 3I32A 1UKZA 2WJHA 2QSZA 4CEJB 3K1JA 3WRXC 5JCPA 3U7HB 1NJFA 1YR9A 3DHWC 3E70C 3P27A 3WP0A 5F2EA 1OJLA 2BDTA 3P20A 5KNBA 2JLXA 1TUEA 2YWFA 1UADA 2JATA 4Q1DA 3UATA 3EPJA 2D3WA 2VYFA 4F4IA 5KHOC 1GFIA 3H4MA 2YOHA 4BFXA 1F2TB 1IJEA 4GP7A 4B75A 1CR4A 1EFTA 1ZD9A 2QN6A 3FHOA 3W3ZB 1ZM3A 4GOXA 1PLKA 2GAAA 1UKYA 1KIMA 4TT3D 5SZJA 1J99A 3GPLA 4LJ8A 2HJGA 4DUGD 4M1KA 1YZLA 3T1QA 4BFWA 1G8YA 4Q4HA 3SJZA 1GG2A 1QDEA 3EZ6A 2VSXA 3TAUA 1OF1A 2K5UA 1WQ1R 4YC7A 1NN5A 1ZU4A 5CIQA 3AVOA 5FOSA 1UDWA 4M53A 1NJGA 1A2BA 3ZS9A 1FOEB 2PCLA 4YXWA 4JVNA 1H8ED 5CM8B 3FGNA 5EP2A 4BPBA 1G20E 4GZLA 4QL3A 5KDLA 3PXGA 1G8PA 3I8XA 5CK5A 2AHOA 1BH2A 2C98A 3A1VA 3KTAB 5KDOA 1EX7A 5EZ5A 2WV9A 4LBZA 2ORIA 2P67A 2R6AA 4IOLA 4C0LA 1TEXA 5FOWA 2PZGA 3D6TB 1N0UA 4B76A 4C2TA 5B58C 2JIZA 1FPMA 2O8BA 1UFQA 2ZS7A 1M1YE 1Z0JA 2OCAA 3ICEA 1OH8A 2VRWA 1ZM9A 3REGA 3ZIAA 2ORWA 4NCNA 1S96A 2WSSD 3MLEA 4C0HA 4I1VA 2CCKA 3SYLA 1ODFA 1XPUA 4TTPA 4PO9A 4GP6A 3DZ8A 5E4FA 1KSHA 3L82B 1I4DD 1HT1E 2ZI5A 2D2FA 3K0FA 3IGFA 4WZAE 3R7WB 3ND9A 2QL6A 4Q7MB 5EP3A 2W6ID 2NO7A 1IJFA 2BMJA 2ZRGA 4C0AC 2A9KA 4NBSA 3OHMA 4JLPA 3GCGA 3GJ7A 4Q00A 3SZRA 1BMFD 4C0SA 3AB3A 4MUAA 4KI0A 1I2MA 2HXSA 4I99A 4PAMA 3GLIA 1RRPA 1YZGA 2V9PA 2XSZA 3M6AA 5EXTA 3JZAA 3LXXA 3UG6A 3REFA 3WYGA 3LWNA 3FWYA 2H57A 4JIMA 1Y63A 3VHLB 5L3SA 4KBGA 2J0UB 1RZ3A 4D82A 3QIAA 2W58A 4IEIA 4MKGA 4G5RA 2QP9X 4QGGA 1Z2CA 2RGDA 4ESVA 1X6VA 4PO1A 1N0WA 1V43A 4Q9JA 1KZGB 2NO0A 2QPOA 1W2GA 1OKKA 5FI0B 4PAOA 1A4RA 2JASA 3VR4A 3EIEA 2YC4C 2OBLA 4PPGA 1MOZA 2A5JA 3HPRA 2DWPA 4P32A 2GEDA 1P2VA 3AF1A 3BWDD 3A58B 2ZJBA 2RGGA 3MWLA 4JBYA 4TMXA 4GSYA 2LKDA 1LNZA 2OBNA 2ODWA 2IS4A 4KV9A 3ZD6A 3M1IA 1H8HD 1AS0A 4BLOA 4PHGA 2DR3A 4A2QA 4DCUA 3OIYA 1NLYA 1KO7A 4G01B 3WNDA 2GBLA 2WVJA 4MKIA 4XWKA 2YOGA 2F3RA 1EK0A 1RPZA 4CDGA 1YU9A 4XD7D 2YYZA 3KQKA 2J9RA 3FFAA 4D4LA 4DCVA 4D0NA 4DSNA 3QF4B 1QHHB 2ONKA 4TYYA 3LX8A 2P65A 1KZ7B 1TAGA 1G5RA 2H7VA 3EX7C 2H16A 5FR1A 2CVHA 5JHGB 2J87A 4JVSB 4WVFA 5J40A 1LS6A 2YINC 3GFOA 3KQUA 1T3HA 2EW1A 2KBEA 1KTVA 2ZVQX 3ZZTA 2RHDA 2QZ4A 4PR0A 3SQWA 1EFRA 4EPTA 4LJAA 1N6KA 2FZLA 4QGHA 2XZOA 4W5JA 4PSVA 5KPJA 4A0GA 2HF8A 4EUNA 2GETA 2F43A 3A36A 1UKEA 1YR8A 3A1WA 3SBDA 4Q7LA 3F5FA 1DO0A 3LA6A 3B9QA 2IYQA 4OK3A 1AKYA 4PC1A 2Z6VA 1KSJA 3W5IA 4OKSA 1S3SA 3QSYA 1D5CA 3AVTA 4DSOA 1E2MA 2BHRA 2ZI3A 1GRRA 2HXYA 3HPQA 4OJKA 2FGKA 2V6JA 3WMEA 2WWYA 2ZR9A 2G77B 3TJZA 4Q1CA 3LNCA 4TMTA 4Z1MD 2QM7A 2DFNA 4JS0A 4OQLA 2Z4RA 4AKEA 1EFHA 4PPNA 4F7WA 2OE2A 2IYVA 5EP4A 4HAUA 2C9CA 4TZ0A 3NBZC 1KNQA 4PZYA 1OT3A 1G7RA 2J3EA 5FUVA 4ZI2A 4F92B 1E9BA 1GOTA 1E0JA 1F2UB 1Q3HA 1EWRA 2X1VA 3FKSD 5FBQB 4GOKA 5BN3A 4NH0A 1VCOA 3AP2A 3TMKA 4MUBA 4TN1A 2IXFA 1XNJA 5DHFA 3RS5A 1QHYA 1E2FA 4LI0A 4RD3A 3AEZA 4D6PA 4GDFA 1XRJA 4E09A 1NL3A 2N42A 4F91B 2P6NA 5CIWA 1DAKA 1NVVR 2W00A 2QORA 3BOSA 1W0KA 4OL0A 4KFUA 2GJ8A 3U6KA 3MJRA 4I4LA 2B8TA 1OIWA 3CLVA 3WHLA 1Z47A 2WOJA 3BGWA 2ZU0C 4DDWA 1WBDA 4DVGA 1OHHA 3EG5A 2X8AA 4DDVA 3RYTC 1X1RA 2JLUA 2QE7D 4V03A 3O8CA 2A2ZA 2RMKA 1EG7A 3SDZA 3G0HA 1SKQA 1P2SA 3WRYC 1ZUIA 4TYPA 2O8CB 2FG5A 3ZQJA 4LV8B 4D2IA 4W7SA 4GT1A 1BO6A 1S2MA 3KQHA 4CEJA 1SHKA 5IK2D 2ATVA 5CJPA 4M1TA 3ZZ0A 1IQPA 5LBIA 1F60A 4KU4A 4G0NA 1R0ZA 5DISB 3LVQE 1XXHB 2QT0A 3FHCB 3QXHA 2HT1A 3NC1C 3QVVA 3RSLA 2VIIA 2XOKA 4YMVA 4C7OB 2O8EA 4P33A 1BOFA 5JJLA 4ZDJA 5BN5A 1F2TA 4RD4A 1DARA 4JLVA 1OYYA 1OFHA 2ORVA 3TNFA 2EFHB 3L0IB 5KU1A 2C78A 2QBYB 2D2EA 2J59A 1E79A 2GEUA 4XWAA 3BAFA 3GLHE 4A82A 1JJ7A 3OEED 4QJ4A 3WHKA 3RNLA 1N2CE 4JL5A 2JLSA 4XVUA 1NNEA 2ODBA 2OO7A 4IDPA 2IF2A 3RC3A 1K8RA 1XMVA 1VPLA 4KO8A 2H8KA 2XGJA 2GJSA 4TMVA 1ONBA 4Q19A 2AL7A 3V00A 2CE2X 2WKPA 1XTRA 2F1IA 3GMTA 4ARZA 1SVKA 3FHTA 5H70A 4B2IA 1TNDA 2P3SA 3VR1A 4NL4H 2ZE5A 2QI9C 2ANCA 3EZFA 3KTAA 5ANRB 4NP6A 4PQRA 1COWA 3EIHA 4IFBA 3TBKA 3TSZA 2QA5A 4NYIR 4MA4A 3UKDA 2C5LA 2GJAA 4HZUB 4PPQA 1TQ4A 4NCKA 2YVUA 4OHVA 1R8SA 3UIEA 4RZ3A 3P4YA 4FW9A 1KI2A 1RJ9B 1J8MF 4TL8A 4BECA 2CDNA 2O0HA 5FTJA 4A6PA 2V6IA 4YLGA 3T06B 5KSZA 1TF2A 1T8TA 2IXEA 3VMFA 1X1SA 3BFVA 3OEHA 4Q66C 3R9IA 4E5UA 1ZRHA 2VP6A 2O8DA 1V5WA 1UF9A 3QG1A 1DBSA 4DLUA 1OIVA 2AXNA 1GAJA 1G8FA 2IWHA 3WYAA 5JCZA 1E9SA 3AV0B 2ASEA 4LHZA 3R7WA 1A82A 4MYHA 1JQLB 3AVUA 2IK8A 4Q02A 2BJWA 1XD2B 1ZIOA 4NE2A 3CF0A 4JJKA 2OXRA 1WP9A 4PANA 2C2HA 3VHXA 1VYUA 4XJXA 1P6XA 1R2QA 4V02A 3AQ4A 3W6PA 1ZNZA 3GLIE 5AR1A 1UPTA 2WJJA 1IY0A 1E0KA 1ZCAA 4MDEA 1G8HA 5CDFA 1KJWA 4QG7A 3RANA 3ZVRA 4B32A 1D9XA 1R4AA 1H8EA 1XDBA 1G18A 3H1TA 4JLKA 5GJCA 1YKSA 3D3QA 1MR3F 4GOJA 1M8PA 1X8LA 4M1SA 4Q9LA 1G8GA 2KI5A 2NZ8A 2JAQA 2J0VA 4NHOA 5FUYA 4EPRA 2J7PA 2E1RA 3HR7A 1OLOA 1ZMXA 3BFKA 1AK2A 2PZFA 1E1QD 4Q4HB 1WE2A 2FFHA 2O52A 1II8A 4EKDA 3SBEA 2WWWA 4RZ2A 2IEYA 2MMGA 2W83A 1JNYA 1OXSC 4KVGA 5E7IA 1GTVA 2WSSA 3QOFA 2ZREA 3PCRB 5DLQC 5FBWB 2ZQ5A 1FFHA 2PH1A 1XTJA 3ADBA 1ZM4A 2FGJA 1Z6TA 2ZM5A 3DZDA 4Z8YA 2ODEA 1EGAA 1GSIA 3NC0C 4XIGS 5TB5A 1AS2A 2QQ0A 1DG3A 3QF4A 4C30A 1QHHA 1GNPA 3H0KA 2Q9BA 4LYHA 1IY2A 3HR8A 1RYFA 3SJAA 1VYTA 3TVTA 2ZRHA 1Q1EA 2O8BB 1GUAA 2B21A 3KQNA 1I2DA 2ZEJA 2PJRA 4FIDA 4IFEA 1EESA 3FKQA 2PX0A 1SXJC 2ZXUA 3CR8A 1L4UA 3VQTA 3WBJA 3U7GA 1XPOA 3OE7A 3V4FA 3G82C 2VHQA 3BC1A 1MO3A 2ZRMA 3O8BA 2C96A 4DSTA 3L8ZA 4CF7A 4JLNA 3I8SA 1SXJB 2WOOA 1G19A 4ZCIA 1FTNA 4JMPA 2AXPA 3K0FB 3ONWA 1Z6XA 4ERNA 2W0MA 2IXGA 4QHTA 3SC3A 1IOZA 3QG5A 4UXIA 3S1AA 5HKKD 4TTRA 1UBEA 5EXSA 1TQ2A 4JT2A 4TLEA 1VG1A 3TVDA 2ZUBA 4I81A 5L3RA 2ZRFA 2A3RA 1YZKA 2PLFA 3AUYA 1KMHB 3AUXA 3TLXA 1IXZA 4QBGB 4R71A 4BLPA 3AVYA 3CRQA 1DAHA 3W9YA 3A1SA 3PV0A 1ZC3A 1ZD1A 4QFMA 3E1SA 1AGRA 2ZI7A 2QT1A 4A2WA 3X1XA 3TSOA 1F2UA 2A30A 3CNOA 1TU3A 4URXR 1E2LA 2QENA 1OH5A 3RDPA 2IT1A 3RS3A 3UMFA 1ELOA 2G9NA 4LOAA 3X1YA 3EAQA 4ZDKA 4JLDA 3HU3A 2P6RA 4N0DA 3L2OB 4V0LA 4K46A 4XD7A 5AJWA 1QF9A 2WHXA 3CRRA 2BKEA 1PVOA 5DO9A 2GEVA 4BZXA 5AJXA 2QGZA 1OXTA 2B8WA 2H18A 2P5SA 1YRAA 2HLDA 4MRPA 4ZV4A 2IYRA 2WAYA 3CIOA 4F93B 1FNNA 4B2LA 5BXQC 621PA 3U4QA 1W4RA 2OEPA 3C4JA 4IDNA 4WBSA 1US8A 1HYQA 2CEAA 2GVDC 3EC2A 4MQBA 4TQ9A 2JLQA 3IIJA 3T1TA 2FSGA 3UXMA 1PV4A 3SE0A 4EPVA 2G83A 5JI3E 1Q1QA 3GLGA 5JZVA 1VCNA 3B1ZA 3PUWA 3QEOA 3QBTA 4EFMA 3MWJA 4LJ9A 4AD8A 2G1KA 2ZRLA 1GL6A 1NRJB 2CLSA 2PCJA 3QKSA 4Q9IA 4DLXA 3MUFA 3NH9A 4LPKA 4QBHA 5FI1B 4IDHA 2ZS8A 3CB4A 4Z1MA 1E2KA 2PMKA 2XZPA 4XVRA 4JLBA 4DCTA 1N6LA 1T9HA 4US2R 3SFVA 2CK3D 4CIDA 1A2KC 4DIEA 4C7OA 1D6JA 3PUYA 2VSOA 1X3SA 3Q72A 4NKRA 4OHZA 4NYMR 2ZYWX 3DOEA 1E2NA 4M0LA 2F43B 3OAAD 3FKSA 3LD9A 3HU2A 4B3GA 5FOTA 3RWOA 1T6NA 1XMSA 4UXHA 3Q5DA 3RS7A 5J4LA 2AKYA 4URUR 1Z06A 4L9WA 4QKQA 1E2HA 2QAGC 3FYHA 3GJXC 2XJ4A 3Q7PA 1NN3A 5E95A 3QXXA 3OFND 1N6IA 1E9EA 3RRNA 5EE0A 3KJEA 2OFXA 2GDJA 3KJHA 1P9RA 2OV2A 5AUOB 4URZR 1UEJA 4QC2A 4AKGA 3KKNA 1CS4C 4HSEA 5KSOA 3AVPA 1U81A 1N6HA 1Z0FA 2FE4A 2IYYA 2J1LA 4R9UC 3H84A 5JSZA 1QHNA 1RRFA 1FMLA 2ZE8A 4HB4A 4HUQA 3B1VA 4PQYA 1G3IA 4ITRC 4C3ZA 3UK6A 1OXVA 4URVR 3AP3A 4B44A 1II9A 2QE7A 4FWIB 1EFCA 2C77A 2QU8A 4D81A 3EA0A 4JVLA 3CZQA 5K8UA 1EX6A 4WZBE 4HUTA 3CH4B 3RRYA 2R8RA 3VX3A 1W4BA 3L8YA 2ZSBA 1F3OA 1P75A 2DFLA 2G0NA 1AZTA 2BIFA 1JJVA 2Q21A 1RJ9A 3DM5A 4YMWA 5C18A 1KYIA 5J47A 1JECA 1L2TA 4MITA 2GZDA 1GRQA 1NY6A 2IUTA 3KKOA 5A5GA 1N6OA 1IONA 1G16A 2DBYA 2WKQA 4B6FA 1DPFA 1XCMA 2NPFA 4LSGA 5IDVA 3LO5A 3SHWA 4WAUA 2F1RA 2VQSA 1NLZA 1N5LA 1FTSA 2QPAA 2VF7A 1JALA 2MSEB 1XEWY 2VHJA 1S0UA 2LWIA 2ZTSA 2WPDD 1UJ2A 3KB1A 4RKFA 4JJZA 4LPSA 2VP2A 1XD2A 5FBVB 1HEIA 3HWSA 1JAIA 3IO3A 3RSOA 4FINA 5C4MA 3K8YA 2YWGA 1NP6A 3X1DA 1E2EA 2BC9A 3W6OA 3FDIA 4POAA 3VX4A 3EZ9A 1VCMA 2IHBA 4PC6A 2J5XA 2O8EB 1II0A 4ZI3A 1AN0A 4DSUA 3AF2A 1OYWA 1TQDA 2JDIA 5F9HA 3AM1A 1P2TA 5EQTA 4Z54A 2REOA 3KFVA 4AYWA 4OJQA 3QXJA 3ZJYA 4JKYA 3LBIA 4RSGA 3B8HA 3HYRA 2QROA 2F7SA 2FZ4A 4P3YA 2GJKA 1WCV1 2EWWA 2ZYVX 2Q3FA 3NBFA 3U3KA 1WRBA 2FFAA 3SYKA 4LJ4A 4HLQB 4LJ7A 2VA8A 4X8LA 5FBLB 3I4LA 1SQ5A 3NWJA 2X2EA 2LCFA 5JJIA 2WWFA 3QEJA 3ICQB 3NBXX 3TE6A 5E7MA 3C14C 3HU1A 3Q5EA 4ARZB 2V3CC 2REXB 3CUEF 4JKIA 2HDNB 4WOPA 3AF4A 5EP1A 2GF0A 4JVMA 5EZ6B 3EASA 4AKHA 2ZRKA 3EPLA 1PUIA 3HP1A 4HAVA 1ZM2A 3T35A 4Q1AA 1NBMA 3K70D 1CIPA 2QY9A 4XTRA 4V0KA 2IWRA 2AR7A 4LYJA 1PJRA 3LY5A 5CYOA 4OQNA 1KDPA 4WA7A 5GJVC 2CE7A 2JLZA 3ADDA 1DE0A 3U5ZB 2O0KA 2F3TA 2VSFA 2GVZC 4UNQA 3B7GA 1YVDA 4PZZA 1WMSA 2TMKA 5CYPA 4RFSA 2QGNA 1LW7A 2OCPA 5IRCD 4NU0A 3E2IA 3K0EA 4DLWA 4QBFA 1I4TD 2OAQ1 3I73A 1KI9A 3ZLJA 2O8DB 3MG9A 4YONB 1NIJA 2FNAA 3AKCA 3RWMB 4C2UA 1SXJA 2YWHA 3RAPR 2BM0A 2YNMA 1RC8A 1G21E 3F3YA 4KFSA 5AJYA 1GP2A 1Z0IA 2B7BA 5FUWA 4A0RA 3AP1A 4KFRA 5KSYA 1ESMA 1OFUX 4M9SA 1Q44A 4G5OA 4DEYA 2EU8A 4HDCA 1RRCA 3WBKA 4WW0A 3LAWA 4M21A 2VH5R 1KMHA 3LX5A 4DLVA 3DPUA 1ZVQA 3VNUA 2ZRBA 1I4LD 2PL3A 2CJWB 3AVWA 1MKYA 4CEHA 4QOSA 1UBCA 2D7CA 1GKIA 2V54A 5CK4A 5EE9A 2H92A 1VG9B 4MGYR 2EFGA 3K70C 4CVNA 5JHHB 4EQ6B 3GJ5A 3IHWA 2BM1A 5C1BA 2XXAB 4RD6A 1FQJA 4GMXA 2F6RA 3KJGA 3A4NA 3GD7A 4AG5A 1HV8A 5EXXA 2FX3A 1ZNWA 1GNQA 2RGEA 3B5JA 4A15A 1KO5A 3BB3A 2BCGY 4CT5A 2EYQA 3EPKA 1O3YA 3CRVA 2JJ2D 3AF3A 1Z0DA 2PEZA 2WWXA 2R2AA 5CB6A 3HJNA 4L16A 1II8B 5IHPA 1FQKA 1QHGA 1W0JD 4A0FA 1XWIA 3MGCA 3QE0A 4MRNA 1IBRA 3RHFA 3ZD7A 2ZJ5A 3GEIA 3SU8A 5FPKA 1JB1A 2HCJB 3IPYA 4M9QA 4Y0AA 5C46F 2IF0A 1S9DA 5M04A 5J4KA 3GLFA 3QVUA 3KDSE 3KUCA 5CM9C 1Z22A 2N46A 3CX8A 3L0PA 4CW7A 3VNVA 1T5IA 2B7CA 1ZYUA 1GKYA 3RS2A 1AIPA 1JXOA 1OPXA 2F9MA 2KWIA 2ZRJA 4K8OA 2W2TA 1FW6A 3P32A 3KFXA 4HAZA 3EC1A 4BRWA 5HKKA 1MO5A 1DADA 3KX2A 3LH5A 5SZIA 4B73A 1P72A 2DFKB 3T5DA 3ND8A 3WXMA 2B6HA 3EXAA 5TMPA 1N5IA 3THXA 3MAAC 4M8NE 1AQUA 1PZNA 3K0CC 4I1UA 1XXHE 4LX0A 1P60A 4ASUD 3RLFA 4BFZA 1DVRA 2BBOA 3UMRA 1MV5A 2E87A 5GJWC 2OCYC 2NPIA 4BFTA 5C2JB 1OH6A 1P9WA 3CONA 2P0EA 5SZKB 3IHLA 2D74A 3BERA 5JEDA 1G41A 1P2UA 3SJBA 4AKIA 2GCOB 4FN5A 4O25A 4P4TA 4A8JA 4D26A 1KDRA 2O8FA 4DIDA 1D2NA 4RCZA 4US0R 4U00A 4DDTA 1JR3E 3K53A 3TK1A 2J0SA 3S1AB 2QTHA 3A1UA 3TW8B 3ZVNA 1XP8A 3IEUA 4OQFA 4IDOA 3TAHA 3VKHA 3AVQA 2QAJA 4E03A 2RB4A 4B3CA 2YC2C 3GJ0A 1HE8B 2ZJ2A 1U9IC 2QAGA 1KAOA 4UJ5A 1QRAA 4B3FX 3A6PC 2DYKA 1S3GA 2ZJZA 3BH7A 3VR3A 1QVAA 2WWGA 2ERYA 1U2RA 2IA5A 2QRNA 1QVRA 4QNMA 3TW4A 2FFQA 4EJSC 4P4UA 5FOUA 2ZU6A 2RKOA 4N1AA 2ZAMA 1OB2A 4LJ5A 1HH4A 4EJSB 2QM8A 1KI1A 1OXXK 2BBSA 4XH9B 1M2OB 1JXMA 2W2XA 1JEDA 1CRQA 4Q7JB 3Q3JB 4TLCA 2QP4A 2AKAB 2D7DA 4EPXA 3NG1A 4D4KA 4ZKEA 2OHFA 1T3SA 1T8UA 3U4QB 1OV4A 2VO1A 4GL2A 1US8B 3EA5A 3DO6A 1TADA 4D4JA 1M74A 1CLUA 3B2EA 1XEFA 2Q3MA 5G3ZA 4FI3C 5H8WA 4LC0A 1KO1A 4OHWA 1K6MA 3BB4A 3GLGB 2F1HA 4UXJA 3X2SA 3QPUA 3OAAA 2HCBA 5GJBA 4TLAA 1TF7A 2X19A 4X8MA 4P0TA 1QG4A 3QKSB 5KOYA 2CHGA 1IN5A 5CITA 2VP5A 1FNMA 3OIUA 4G1UC 4NYJQ 3R9WA 4JL8A 1CEEA 2A5FA 1ZUNB 1M7BA 2GZAA 5KTYA 2RGBA 5DGXA 1E96A 3OFNA 4KXFB 5JWOA 3QY0A 4QBIA 5FPSA 2BMEA 2RGXA 1AJEA 4C4PA 2XTZA 1YZUA 3LW7A 3L0OA 4JLMA 4WXPA 3U3MA 5DNYB 3AKEA 4TYNA 4M9ZA 3U2QA 4JBWA 3PEVA 2W6JA 3PQCA 4BLRA 2FSIA 3O8DA 4FCVA 4DB2A 3SFZA 4AIIA 1RVDA 3CZPA 3T1VA 2OLKA 2EVWX 2PX3A 2BOVA 3M4YA 2VP9A 3FTQA 4BZQA 1G5TA 3AGQA 2D62A 3RS4A 4OQMA 1HE1C 3W6NA 1WXQA 4G5GA 1ZAKA 4ESHA 2ODNA 1LV7A 4Q47A 3ZH9B 1B23P 1KI8A 2CLDX 3K9GA 4RD0A 3AVVA 3NHAA 2ZI6A 1Q21A 1Z2AA 4RVCA 2PMDA 4C0KA 2ZR7A 3SEAA 2UKDA 2ZIAA 1KKMA 1ZBDA 3CW2A 5G3YA 1NN0A 3LXRA 3U3OA 5JSZB 1WB9A 3QPVA 4A92A 1G6HA 4HUQB 2QP3A 2ZVPX 3CPHA 4A9AA 1NBME 4MRVA 5AJZA 1S1MA 3FMFA 2DWQA 1TUIA 3PITA 2ZUCA 3T34A 5TV2A 1A5TA 3UMSA 5JS8A 2AD1A 4DWJA 3B13B 1KI4A 1EWQA 1T3LA 2J46A 3I92A 4Q18A 1JPJA 5J5CA 2Z43A 3PUZA 2ZROA 4LJYA 1OFTA 2QQEA 4OI4A 3EZ7A 1SKYB 2IYTA 2IYZA 2QTFA 3L43A 1OFIA 2DY1A 3TGPA 1D8TA 1E2GA 1U8YA 3AKDA 2GCPA 3BS4A 1U8AA 3CF2A 3NDPA 3I5YA 2GZHA 4UQOA 3CBQA 4WXRA 3U60B 1G7SA 1XF9A 4UKDA 2KJQA 4CRWB 1R10A 2KB0A 3MWKA 1FX0B 4RD2A 3U3JA 1TEVA 2AWNA 2Z83A 1SXJE 3SHFA 3CNNA 3DOFA 4OYHA 2V55B 2ZRNA 1S1CA 2NIPA 2NO6A 2NG1A 3CX6A 2HUPA 2IC5A 4KJZA 1JEEA 3H86A 4Q48A 4E22A 821PA 2GCNA 4OQXA 2WMNB 1IM2A 4TT3A 2FOLA 1XX6A 3BE4A 3SYNA 1Q1ZA 2IYXA 1M34E 1W36D 1QG2A 2ECKA 2GNOA 5FTLA 4TYQA 4UNPA 4DUGA 4XWOA 2IYUA 3LW8A 4HYYA 4S35A 2GHIA 2L0XA 2WM9B 4LCBA 4HZIA 5BYJA 4B3XA 1TQ6A 4MYTA 4IVRA 2CJWA 4IJMA 1TPZA 1MABA 1T0HB 1XTQA 2GESA 1Q12A 2PT5A 2OLJA 3QNUA 2XZLA 1J90A 1UEIA 2MSDB 2VHUA 3B78A 2FU5C 4JSTA 1BYIA 2ZETA 1E4VA 3FFBA 4EQ6A 2EFCB 2XXAA 4RKEA 1XD9A 2ZE6A 2G0TA 1X8KA 4G5QA 2JIZD 2ZI9A 3K09C 5DH9A 4HAYA 5JJKA 3OESA 4X8OA 1NMYA 5LPNA 3I72A 1OXUA 1KY2A 2DB3A 3ZIAD 2NGRA 2IUUA 1M7GA 5TY0A 2WJYA 5DIFA 4P4SA 3TH5A 3EARA 3FMOB 2WKRA 4GFDA 3QKRA 4AC9A 1LB1B 3B9PA 4LYFA 2YOFA 2R6CA 1CJTC 2WICA 3C16C 4DDUA 3IO5A 1D2EA 1G6OA 1E0AA 3IPXA 3B1YA 2P2LA 1P61B 2FEOA 1E1RD 1S8FA 5JI2E 1DAGA 5LD2C 1LTQA 4LUCA 1FUUA 2FDCA 2CBZA 3NXSA 4ON9A 1G17A 4CEIA 4FMCB 4BLTA 1XJQA 3DM9B 1B0UA 1FZQA 2C9YA 1Q1BA 1Q3TA 5LD2B 4IHQA 1CXZA 1Z83A 3PUVA 1IXRC 1NSFA 5DN6D 1DAFA 2IS6A 3F0TA 1E9RA 3DKPA 2GRJA 2W6IA 4DT1A 4HDOB 4KYUA 2QUZA 2O0JA 2PZEA 4RFSB 2CHQA 2HF9A 2JLVA 1J8YF 4PO8A 4TL6A 4B3DA 1OE0A 1Z0AA 1BMFA 1IN8A 2A5YB 1R0XA 3CPEA 1GRNA 3B82A 4YMSA 3X1WA 5G41A 1PUJA 4PHHA 3T15A 2QMEA 3MMPA 1RW4A 5L8VA 3B1XA 4LYAA 3ZQ6A 4EDHA 2GCOA 3KZ1E 3K0CA 4U5XA 5HE8A 3VU9B 4LBWA 1XBTA 3ECCA 4PSAA 1YRBA 4R98A 5DI3A 2O5VA 5FTNA 1J70A 1NMZA 4D0GA 3C7KA 3K9LA 1XTSA 1KJYA 4UNSA 4QHSA 3P1JA 1R5BA 2PT7A 2OG2A 2QRZA 2ZUDA 4X8HA 3A1TA 1XFAA 4FMBB 4GI7A 3NDBB 4FCWA 4CEHB 1VIAA 3KUDA 1RE0A 1LF0A 1ZINA 1Z29A 4BRUA 5FFMA 4Q9KA 1H8HA 2BEJA 1U9IA 4PC2A 3GEEA 3MRSA 2WJVA 4Q03A 2QSYA 1G7CA 3I5XA 3SI7A 1W46A 3HYTA 2Z0MA 3JVVA 4HB3A 1VHLA 3KXKA 5DYGA 4EJSA 4B47A 1EFRD 2VHTA 4A0HA 1ZM7A 3PR1A 1Z6YA 2UZIR 4R2HA 1W4AA 1YR7A 2ERXA 1OH7A 2AN9A 3EW9A 4KCGA 5K8TA 1WA5A 1T4GA 3LLMA 4R2IA 3TUJC 3K0SA 1Z3IX 1VIYA 2WBLC 5EXPA 4ASUA 4DLZA 4FWTA 4WZ6A 3ZS8A 4MH0R 3M0EA 3GLFB 3CPJB 4RZUA 1BIFA 2FF7A 2Q6TA 1R0YA 3RC8A 1E2DA 4A1FA 5P21A 4KBFA 4FCTA 3C5CA 4M2LA 2GJ9A 3RS0A 1XPRA 2QMHA 3AGPA 4W5HA 3BJIC 5FPHA 1FP6A 1KO8A 2YJTD 4Q1FA 4UJ3A 3U6BA 4A6XA 2BCJQ 1IY1A 2HT6A 1E9DA 3CRW1 4A36A 3C8UA 4ACAA 3THXB 2OCBA 4MGIR 1ZJ6A 4JYCA 2OFWA 5B30A 4CYMA 3UANA 4B74A 4B33A 1XZQA 4A8JC 2LKCA 5IF9A 1N6NA 1KAGA 3TUZC 1DEKA 3A37A 3KJIA 1E3MA 4M1WA 1OIXA 1JI0A 1E2JA 3SQXA 2ONJA 2EFDB 2XB4A 4QM6A 2OAP1 4JLAA 1S9HA 4DLTA 4A8JB 1BYUA 3FVQA 2O8FB 5AUPB 4PHTA 2HEIA 4MDFA 3N5CA 1HT2E 2J0QA 3BXZA 1W0KD 4LGMA 1SVIA 1F6BA 3IDQA 2WTUA 3R8CA 3R9XA 4IVQA 4BASA 2ZJYA 5L3VA 1W47A 1VG8A 3B6EA 1YZQA 3CWZA 2QAGB 1KDOA 1CR2A 2JJ8A 4Q1EA 2BEKA 4Q4AB 1KI6A 3FOZA 1KGDA 1CTQA 5KUTA 2XNSA 3DKVA 3L0SA 1XCGB 1CBUA 1VTKA 3WNCA 5D3MB 2JCSA 3U7EB 2J7KA 2RGAA 2RGNA 4HEJA 2A7QA 2R65A 2EQBA 4C0QC 5FL3A 5JS7A 2R44A 4TSFD 5CLLA 1WBBA 1U99A 1G3QA 1XMIA 2DFTA 1ZUHA 1E9CA 4NCIA 5AK0A 4DKXA 1XEXB 5IK2A 1P62B 4D4MA 4F38A 1LY1A 3CR7A 3OF5A 4NDZA 2FSFA 5DE3A 1PLLA 1YZNA 4QJ5A 2PEYA 1AGPA 4QM7A 4MYCA 1FX0A 2G88A 1OSNA 2QG6A 2XB2A 1SHZA 2C9OA 2GXUA 1VYVA 4N3NA 4J0QA 4NPHA 3OEEA 2VF8A 1GL9B 2AFIE 1GVNB 4M1OA 4MRRA 4BEBA 4LZZA 2Z4SA 3F8TA 5HZHA 4MYUA 4RZXA 2F55A 1R8QA 5SZHB 4XTCS 1XB2A 2X77A 4I1SA 1AZSC 1SVSA 4D25A 4P31A 1JR6A 3UPUA 1DAEA 5FPYA 2C04A 1RKBA 4B43A 5CDFE 4DBLC 1CU1A 4RY2A 5FBRB 4DEXA 1GILA 2IYSA 3K9NA 3ADCA 5KNDA 1CJUC 1Y3AA 1Q22A 2DHRA 1U94A 2WIAA 4HB2A 2KE5A 5JEEA 4QNRA 1NVUQ 1X86B 3D31A 2FPKA 2VTKA 3OEHD 3IBGA 2PBRA 3K09A 4ZIRA 4PC7A 3KQLA 2ZRDA 2C8VA 3VAAA 5BW8A 3K0AA 1W49A 5FPTA 1L4YA 1KK0A 2IUSA 4BFSA 4DB4A 1AS3A 2V7QD 1HTWA 2I3BA 3E5HA 3GLHA 4I1OA 4KAXA 4M22A 5F98A 1KKLA 1P4SA 3Q85A 3ZVMA 2BBTA 1QHXA 4MKHA 4PZLA 4W9MC 1F5NA 1KY3A 5EUQB 1KK2A 1UDXA 2Z5FA 3CKLA 3THYA 1BKDR 3ZYCA 5J4HA 4B2PA 3K9HA 1C4OA 2JEOA 1A7JA 2OM2A 4II7A 2RGCA 4LK2A 4IW3B 1KOFA 1R5NA 2QNRA 2XNDD 3N70A 3QXSA 421PA 1E32A 2NO9A 1NG9A 4UNRA 5JRJA 2FA9A 4BUJA 3PEYA 3O47A 4WIAA 2JLRA 2G1JA 3G5UA 1Q0UA 1IN6A 1PLJA 5TARA 1E69A 2NO1A 4F4CA 2D06A 4A4DA 1MH1A 6Q21A 1SVMA 1EFUA 4B3BA 4KHZA 2OT3B 1DS6A 2J7PD 5JMTA 3B85A 4DZZA 2IYLD 1C1YA 2W2VA 3B1WA 3VU9A 1TU4A 4ZCLA 4LC1A 1GM5A 2WWHA 2G6BA 3D7MA 3SR0A 1Z6AA 5JRZA 1Z5ZA 2CNWD 1MRNA 3X1ZA 1KSFX 3W90A 1GKUB 4Q7KA 2C95A 1E1QA 2XTMA 5HPYB 2AK3A 1MABB 5DI9A 3V9PA 2JA1A 3CNLA 4NCJA 4HDQB 2OBMA 1KO4A 5IT5A 1ZW6A 2MMCA 2YKGA 2YZ2A 1UBFA 1QHSA 2BMDA 2VBCA 1E1RA 1IN4A 3QPWA 4KSCA 2VP4A 4IOKA 2QEQA 4ZO4A 3WMFA 1GDDA 1ZU5A 1AKEA 3EPHA 1W1WA 2XTNA 5A0FA 4URWR 3PEWA 2A5DA 3SS8A 2R62A 3K70B 1NKTA 4GZMA 3LBNA 5CJ2A 1E6CA 1HQCA 1XTIA 4Q4LA 3OE7D 3ADKA 4CZ2A 1SVWA 4P4SB 4BWYA 4HLCA 2AX4A 2ZI4A 4LY6A 3LRPA 4NMMA 3GP8A 3PEUA 2IX3A 2FH5B 5DN6A 4G5SA 3QKRB 3QQ5A 2W0SA 2CL0X 1NY5A 1JPNA 3U44B 1W2HA 2FFBA 2CHVA 3Q7QA 4HB0A 3A4LA 1L8QA 521PA 2JJ1D 5JWRA 2GAOA 1ZNYA 3LDAA 1DG1G 4CEIB 1WDTA 5JWHA 3Q8XB 3GLGE 3LFUA 1P9NA 1SVOA 5GVRA 3SOPA 3ZGXA 3VFDA 4DJTA 1E99A 3Q9LA 4LHWA 5DSZA 1KNXA 3GQBA 1R6BX 2BV3A 4TLDA 1G291 5G53C 4DT1B 5EE1A 4BQSA 1QHIA 2RAPA 4D80A 5F9FA 1QBKC 3SN6A 1R5OA 2Y8EA 3NH6A 1G4UR 3CO5A 3R20A 4BFYA 4CT4B 1VMAA 5L3QA 3W3AA 4HLDA 1W5TA 2IEZA 3NTUA 4V0MA 2FV8A 4C0BA 4ACBA 3I3SR 3QENA 1S4QA 1HY3A 5H68A 3W34A 2HLDD 2ZRAA 2I1QA 4B71A 3KXIA 4DRZA 2CCJA 2WSMA 5DI3B 1NF3A 3MCAA 4NZYA 4FMDB 3MSXA 2FPLA 4IOMA 2X2FA 2NMVA 4NYJR 2V4ZA 5EE5B 1CULC 3I62A 3RVBA 4Y0VA 4Q1BA 4C9BA 3VKWA 1U0LA 1ZNXA 3KXLA 4Q4AA 2ZSFA 1AQYA 2KBFA 4MRSA 4GNKA 3PUXA 2OSBA 1FMJA 3B60A 3AH8A 4Q01A 1OB5A 2MSCB 2VHCA 3LV8A 3WY9A 3IIKA 4GPTA 2IS2A 3EWSA 721PA 2H5EA 4U02A 5D3MA 3VKGA 1U0JA 4GMDA 2JLWA 1VHTA 4JLJA 3AF0A 4IDQA 4Q5IA 2IYWA 3W8RA 1KDTA 4KITB 5FTKA 121PA 1G3RA 2CL7X 2J41A 4FXPA 3IIMA 2H1LA 2ZRIA 4JLOA 3NKVA 1SKYE 1TMKA 4HLUC 4LV5B 5KSPA 2FMXA 4QGAA 2AK2A 1P3JA 3PENA 3EIQA 5TDHA 3PG5A 3DEFA 5ELXA 4OI0A 1XEXA 1SZPA 2ZRPA 3ZDQA 1DELA 3JZMA 3C5HA 1ZIPA 4YDHB 3IEVA 4Z8XA 1JR3D 4FMCF 1VCIA 4TQUS 2CK3A 2PLRA 4DCSA 2D4HA 4BE7B 1D9ZA 2QMOA 3OIWA 1C9KA 2A78A 3BK7A 1NVWQ 1J7KA 3T12A 4B6EA 2NQ2C 2FPMA 1NI3A 4H1VA 1E0SA 3LVRE 1UAAA 3FE2A 4UNNA 1VKJA 3TIFA 4CGZA 4HAWA 221PA 2YV5A 5DHAA 3QUSA 1YE8A 3VTKA 3CF6R 1E2PA 3TRFA 5B64A 2VL7A 4EPYA 2WZQA 3BIFA 3GJ6A 2GILA 1SULA 4ZPXA 5G40A 4JZKA 5FOVA 4Q4JA 3P4XA 1GZSA 1CKEA 1XJCA 4EIWA 4PHFA 2WMOB 4YDSA 3WP1B 5FL7D 5BWMA 2WJIA 1XU4A 2N1BA 2CXXA 3THWB 1IXSB 5HCNA 1W4CA 4QHYA 1G1MA 1G9XA 2NTYC 4PXAA 4LRWA 1WF3A 1LVGA 3P26A 1BS1A 2XX3A 2I1VB 5LB4A 2OILA 3CWQA 3FMPB 1Z8FA 1HA3A 3FB4A 1KI7A 3T1OA 4TSFA 3TSWA 2IS1A 2OZEA 3CX7A 5C4GB 2BMFA 2HYDA 2R9VA 1KI6B 4EPWA 2IW3A 4EFNA 4BFVA 3C15C 4M1MA 2RGNC 1KSGA 1NMXA 2Q0HA 1P5ZB 4TMKA 1XTKA 2FN4A 2B92A 4QXAA 2ZRCA 3GEHA 5AJVB 4TYWA 4C0JA 2SHKA 3H2YA 4PX9A 2EYUA 3UG7A 3MD0A 4M1YA 3VR6A 4ZDIA 2WPDA 1NVVQ 3JVUA 1LS1A 2R6FA 4BLQA 2RCNA 1NKSA 1TF5A 1X8JA 1CR1A 2JDID 5B57C 2GF9A 4JSYA 4RFVA 4NONA 2FWRA 4KFTA 4PAQA 2QPTA 5E7JA 3KB2A 2WWIA 2ZYTX 1NLFA 4RD1A 4QJ3A 4PFSA 2A5GA 4O2RA 3KKPA 3OIVA 1CRPA 3QKUA 2ZJ8A 3BFXA 2OUKA 4ILEA 2G3YA 2J45A 3KL4A 2ZITA 3U3RA 5EE3A 3WYFA 4OK5A 5A4JA 4AYTA 1N0VC 5HTKA 1CR0A 1VG0B 2GTPA 3IBYA 1NSTA 4ZDWA 4OBEA 4FD2A 4YXWD 4Q9HA 2HYIC 4K81B 4KLNA 3TQCA 3TQFA 2ZR0A 4YMTA 1U98A 5H1YA 5JFGA 4L8GA 4HI0E 1NBMD 4F4JA 5JBQA 2HJVA 1N6RA 3QI2A 4TMZA 2DWOA 2F9LA 3T61A 1YQTA 4PSKA 1GITA 4O0MA 5J4VA 1UM8A 4H9GA 3IILA 2GK7A 5AUQA 1G3MA 2QTVB 3LBHA 1G3UA 3TR5A 2IHYA 3QXCA 1MO4A 2CLCX 4KODA 2CMKA 1DOAA 3DL0A 2ANBA 3PIRA 2Q3HA 1DTSA 5HZKA 2V7QA 3FMIA 3LQRA 4OK6A 4DLSA 1E2IA 2V8OA 2GWHA 4DXAA 2AD5A 1AM4D 2GXQA 3CRMA 1XJ0A 2CVFA 4DLYA 1JQJC 3PJRA 2WIBA 4ZIRB 3SNHA 1G7TA 2IL1A 2VLIA 4N0EA 5F3WB 1QZXA 2ZAOA 5KYKA 2VEDA 4JT4A 1SXJD 4U7DA 3BRWD 1AA9A 5FTMA 2XNDA 4YQFA 1W48A 1MO6A 5TXGA 3GJ3A 3U44A 3K0AB 1MRSA 5FR2A 4E07A 4IVPA 1G5PA 2J0UA 1YHNA 4QGFA 4XOIA 4BEJA 4GBMA 5BYKA 2XITA 4M4SA 4BGDA 5KDDA 2GXSA 1DO2A 5LDDC 3HDTA 1OW3B 4LBYA 3GLHB 4W5WA 2ZJOA 3GLFE 4LJ6A 4MGKR 4NYIQ 4DC9A 5KNCA 3KKQA 4IXMA 4DLRA 4TTQA 4TL7A 1W36C 1E94E 2XJ9A 5CB8A 2UVQA 2BBWA 4LHYA 2EFEB 1ZC4A 3TUIC 1IN7A 3THYB 4AWXA 2WAXA 4TMWA 2VP0A 2XSZD 3O8RA 1R7RA 4LHVA 3RRMA 3N2EA 1U0HC 1GWNA 1HURA 4AURA 3BORA 1W36B 2CNWA 4HATA 5GVSA 3OZXA 2BVNA 1KK1A 3CM0A 2OESA 1Q20A 1U90A 3LQQA 3C41J 4LV6A 2GKSA 3VR2A 4IEEA 1A1VA 2VPPA 2ZSDA 3PFIA 4H1UA 4EAQA 4L15A 3IKJA 2RH5A 1Z07A 1OKKD 4V0ME 3FPAA 2V1UA 4Q21A 3SJCA 3KKMA 3QF7A 4PTLA 2ZE7A 3PVSA 4TL9A 1CJVC 5BN4A 4URYR 4LWZA 1NN1A 1MT0A 4L9SA 5CLQA 1Z0KA 1E9FA 2V1XA 3CH5A 5B2ZA 3J81k 4G3XA 2ATXA 4LDJA 3LLUA 4A2PA 3R8FA 2H17A 2Q9CA 2JJ2A 4BLSA 1T91A 3V4RA 1HUQA 5DYIA 5J4YA 1N3BA 3GJ4A 3GFPA 4AY2A 1ETUA 1RYHA 1UKVY 4TLBA 4LHXA 5JECA 1W0JA 3BB1A 3BD9A 2JLYA 2NOAA 3AVXA 1FUKA 1T0JB 1GL7A 4O2LA 2JJ1A 1N6PA 1Z63A 3DMNA 4PQFA 1KI3A 1NG1A 1W44A 1LFDB 4JL6A 1Z28A 2P5TB 1W7AA 2WJGA 3IUYA 1GIAA 1KK3A 2GK6A 1TL7C
chains in the Genus database with same CATH superfamily
4TMYA 1J8VA 1L7VC 1N2HA 2B2CA 1EIZA 2HL6A 3BBPA 3NHBA 3AETB 1JBKA 5B7GA 4BNTA 1YE5A 1LK5A 4P98A 2Q2NA 3DW3X 1TZKA 1XZDA 1Q57A 3AKYA 2Y2UA 3ZZUA 4KR3A 1YJXA 2H4WA 1J9EA 2HK8A 4DNOA 1I32A 1QQBA 5HR5A 5KO2A 1CF4A 2PUCA 3H19A 3C6QA 3IEPA 3A9TA 1RD4A 1HQKA 2XAUA 4MW2A 5LB2A 1LW6E 3TZHA 3WDMA 5CEJA 2PUBA 3WK7A 2ZANA 4KMSA 5JCXA 1GSAA 4YRFA 4XA8A 4ABYA 3TNYA 2OUIA 4BP8A 1J1UA 1CJMA 4C4AA 4JBXA 2BR3A 3F3KA 4I9GA 3H7IA 1ZCBA 4I4IA 2H29A 4WWHA 4ZVTA 3OZFA 2PTGA 2WD8A 2O2GA 1USGA 2I80A 4MB6A 4CGYA 5CEFA 1IHUA 4GVPA 1RCFA 4KQEA 3HA5A 2NUTB 4BQPA 1L1QA 1YL5A 1QS0A 1MNQA 1F2DA 2HRZA 2XT6A 3H83A 4RENA 3RC2A 4BC1A 4DIFA 4PRZA 2VWPA 5IXYA 2YVKA 4XVQA 4CQMA 4AI6A 1EI9A 5TPWA 4DFDA 4YJDA 2AMFA 3TZCA 3KVYA 3GRAA 1E3DA 4RJLA 3E3NA 1C8BA 4DA4A 2NQ8A 2X4LA 4A8PA 4IH1A 2F1JA 1MEOA 3B9BA 1RIFA 3R7FA 3RABA 3VUEA 4FQ8A 1KQ3A 2OXEA 5IAJA 3TL2A 4R0MA 5D3ZA 4GE0A 1ZP6A 1TUBA 1R16A 3DNFA 3T4EA 1E4EA 3G7UA 5AVWA 1QYVA 2FG6C 2G40A 4P7BA 1T4BA 5KX5F 1BN6A 1JVBA 3SOOA 3SE7A 4IRUB 3RHSA 1AA6A 2Q6VA 1JG6A 1EUZA 2YWRA 3V34A 3KKKA 2IUEA 3DJFA 4Z4FA 4NMLA 4K9LA 3S81A 4LMPA 2VJKA 4W5TA 5JSUA 2AFHE 4A2CA 4KUHA 2R6DA 2IBMA 4JASB 3JY6A 4EG3A 4DIOA 3A9CA 1Q0ZA 2FB9A 4BZPA 5TVKA 2DU8A 4ZCMA 1QRRA 3EZ2A 5AVXA 2HM7A 2IRWA 1UBGA 3CZCA 1PV2A 1S7GA 4YAIA 3OWOA 1FL9A 3P2MA 4QYSA 3OFJA 1EB8A 3ORFA 1RQGA 4UEQA 2CXNA 4AY4A 4YUVA 3PUHA 4QELA 3TKLA 4EKYA 1BU5A 3N2LA 4ZOQI 1Q0SA 1SVLA 4FBLA 2HPHA 4PSUA 5B1HA 1CY7A 4ND4A 5A05A 3EEBA 3A0UA 3S2SA 2PAFA 1R4MB 1TW3A 3OHSX 2LV8A 2IW1A 3NFRA 1LQTA 3DMGA 4R8MA 4XQGA 2CXSA 2YWEA 2ZSEA 3N8KA 1FXUA 2XOKD 5C0OE 3OCYA 2XUGA 4KSYA 1EDZA 3Q8KA 1U6IA 2Y1WA 3F6EX 3L1JA 3KAKA 3QVTA 1MCZA 2CLEB 4HDRA 2PBFA 2E9SA 2R1ZA 3V42A 2C03A 4FD3A 4J0JA 1H0SA 4KWTA 2J3DA 2QNIA 2ZBDA 3BH6A 3DZBA 4L7QA 2KSQA 1DKLA 3QX9A 3UC5A 3CKYA 4D3YA 4XVCA 3OQ1A 4JUCA 5BSRA 4J7UA 3RS9A 2BJVA 1NR5A 5IMBA 3A8TA 3PP8A 4HPWA 4L5BA 1H3FA 4M55A 2RHRA 3ZDXB 5LA6B 2RH4A 5AM5A 3SYRA 1YR6A 1SUSA 4JBLA 4HZUA 4TTTS 4ROSA 2HHHB 1SUIA 3DMDA 4MTLA 4JYZA 2J3LA 2Z57A 3ZE6A 2NTJA 1UJ4A 4KYIB 1CUAA 1DT3A 1NIPA 3B3JA 3K4QA 4JUFA 2N1MA 4HQRA 3D8BA 1F48A 1J2JA 2CCGA 2X9LA 3A70A 3O8LA 2F2TA 2H9YA 1MLDA 2HR1A 3COYA 4JK3A 2DCUA 1ESCA 1WU8A 1YZHA 2OD2A 2FKAA 2VBFA 3INRA 4XDYA 2EZ4A 2R0QC 4I3HA 2GXAA 3PJDA 3R6TA 5T3YA 4ENTA 1KH3A 1Z2DA 3N1UA 4G4IA 4J03A 4ZGGA 5KJ6A 1COWD 1UXHA 2SNIE 4FOOA 4UD6A 3NEYA 5JXJA 3OKAA 5EEGA 4DCMA 4OIFA 3KJQA 3ZX4A 2AWOA 3UGKA 1D2MA 2XADA 1OTHA 1CWUA 1KMQA 2B0CA 3NYRA 4KN5A 4LNUA 3MFYA 1CY1A 1EQ2A 1RM0A 1VJ1A 1DGQA 3NXKA 1V5FA 3EBOA 4MINA 1N2IA 1T36A 1Z74A 3AI2A 3IJ5A 3TQQA 2WJHA 4FYKA 3O3MB 1VRVA 2DPGA 3EAFA 3FMGA 1WZCA 3E70C 3LF2A 4FYJA 4NECA 1OPRA 3PC3A 4BCBA 2YQZA 1OJLA 1UBKS 3H8WA 5KNBA 3TM5A 4D41A 5DEIA 4ZAFA 2C7QA 1UADA 2EHJA 3D1VA 2ECQA 1GPNA 4F4IA 1UK8A 3MOGA 3OZVA 5BN5B 4BFXA 3PNVA 1IJEA 3HK2A 1J42A 1N5MA 1CR4A 2AT1A 2EGHA 2EX4A 3AUTA 2BKXA 3PTLA 1ZJZA 4F3CA 3DQQA 5H5JA 1GA1A 1V3VA 3H11B 4G0ZA 3W3ZB 4GKJB 1BWPA 4GOXA 4BO6A 4HXEB 2PU7A 5TMEA 5ALRA 1HDZA 4KRGA 4HVCA 1WV1A 3AR4A 1WQ3A 4LJ8A 2PAAA 3M3PA 1F8GA 1SZJG 1QZ3A 4R0NA 1N2CA 4M1KA 3M8KA 2MTBA 4RXTA 1B41A 1HYGA 3HB7A 2AUNA 2IZ5A 2O7NA 3AT1A 1GG2A 2B25A 3HN7A 3DBLB 2PWAA 1XA3A 1RAHA 2P9QA 3EZ6A 1OF1A 1ECLA 3JZDA 3NO4A 5G4LA 4M0FA 5B53A 3TAUA 3H2HA 1NN5A 2O2SA 2Q28A 1ZU4A 2R68A 5FOSA 4AY5A 1A2BA 3N5KA 3ERCA 1SUBA 4JVNA 2PWBA 3FDZB 1QO9A 5EP2A 2Q46A 1E1KA 5KDLA 4QL3A 1BMTA 5TRTA 3B8EA 3VR6H 1C2YA 1G8PA 2ZB2A 5CK5A 3WWDA 4WECA 5CFMA 3QNWA 4BVJA 2QXUA 4LQ4A 2C98A 3BQMB 4L3WA 5JE8A 4AF6A 4LBZA 2R6AA 5AK3A 2HSEA 4G1VA 4B4OA 3OQNA 2M2IA 3G5MA 3W5HA 4MDYA 3EGCA 4BUZA 1KETA 1EFLA 1RAIA 3EEFA 3SZGA 2PZGA 4DANA 3OBBA 1N0UA 2JAXA 2JIZA 2I67A 5B58C 1UFQA 2O8BA 1Z0JA 3ICEA 1JQDA 1JHUA 2I4TA 1ESDA 2ERCA 2O23A 3ZCSA 3ZIAA 4EG8A 5JD4A 2OWEA 1LDYA 4Q4CA 4KXXA 3RT9A 4JITA 3NOVA 4KIUA 4ZYYA 1JH9A 1O58A 4C0HA 4I1VA 4OX9Y 4RHXA 3SYLA 3T9CA 5JR3A 1D4AA 2BP7A 2IP2A 5FWXB 2A94A 4GPBA 4GP6A 1RHJA 4PVCA 1P91A 5F23A 3VDQA 1KSHA 1HT1E 2CBGA 2D2FA 5IKPA 1WKCA 2RSLA 2XXJA 3EXFA 3JQBA 4WZAE 3OQIB 2BUCA 2BH2A 3ND6A 3JQGA 2X86A 3HKCA 3V9AA 5AVUA 5JNWA 2W6ID 5JW6A 3OZGA 1C3XA 3N8HA 4X6UA 2WTMA 2DLDA 4TKUB 3O1IC 1M34A 2BMJA 2RG1A 2BEUB 4F2WA 5LNK1 5AM0A 2YASA 3ZD8A 3GCGA 3Q0TA 1VMEA 3E2PA 4NEQA 4Q00A 4X24A 4RABA 1WPQA 1QBGA 4QU0A 1FMFA 2BRUC 4QDJA 4GQBA 3KT0A 5LIRA 1ECFA 2XSZA 1YQ9A 5CT5A 1WETA 1L5VA 1T29A 3BYZA 5EXTA 1ZOLA 1VHJA 3HKBB 3JZAA 3PC4A 4NICA 3REFA 2XF8A 3FWYA 5EJ8A 1C1XB 1Q7BA 2A1UB 2J0UB 3H5WA 5HFAA 4IEIA 5HIAA 3S0JA 2QP9X 2P2DA 3U62A 2RGDA 1HDYA 3WYEA 4MWZA 4L27A 2NO0A 4EQZA 3SOZA 3SS9X 1LBIA 1JLKA 3E53A 4WUTA 5CXQA 1A4RA 3T3IA 1AX9A 1YKFA 3EIEA 2F1OA 3H18A 4PPGA 3AYZB 3HH8A 4P32A 3ZZMA 3AF1A 1WMEA 1Z3CA 4PN3A 2RGGA 3MWLA 3OFSA 3E81A 4XB1A 4FK8A 3JRWA 1LNZA 2Q6IA 1K4MA 2Y1CA 3K30A 3WL3A 3EYAA 2PUHA 2R25B 5KNCH 3T9FA 1UXKA 3TQRA 4P36A 1X1BA 2WP0A 2DR3A 4DCUA 3BHMA 3IPCA 3TSYA 4EB3A 2XMBA 4G01B 5AHKA 1BDIA 2CWDA 5TQ0A 3ZK7A 4ARSA 5MGNA 3VKVA 3C7AA 4UBNA 3U49A 4KWCA 5B58T 4PZUA 3QMMA 5HQJA 3SQDA 3KZCA 3W8FA 4F4HA 4YJFA 3T9DA 1Z73A 5KMGB 1ISMA 4HFNA 4M3NA 5T6BA 3FFAA 4FPXA 2ATCA 1DJLA 4RXUA 2ONKA 1INLA 1E6UA 1IZZA 3AZQA 4MWTA 5C7LO 1HDRA 2P4QA 1G5RA 1U5BB 1MOPA 2H16A 4DM4A 5HP4A 1K2VN 2Z6QA 4G0VA 1SCJA 3WRWA 2J87A 2JL1A 2R87A 5CFQA 3RUAA 1Y6FA 2QQ5A 5IW8A 1VGRA 1XVAA 2VTBB 1VI5A 4NATA 3KQUA 1NUQA 3IUNA 1PT8A 5K2OA 3D02A 2KBEA 1KEKA 1M5RA 3KWMA 4RF5A 4H59A 4NFSA 3R76A 1TUGA 1N6KA 1K3FA 1APBA 3S1SA 3F2IA 3BJZA 5KTRA 4YO8A 3KV3O 3INTA 4A0GA 2HF8A 3IFSA 3RLIA 4KQJA 1Z18A 1H6BA 3A1WA 4EKGA 4V0RA 5KS2A 4WXYB 5IN4A 1GPMA 3F5FA 3M6WA 1G21B 1CQXA 3B9QA 4R8KA 4OK3A 3ZDFA 4PC1A 2L18A 3T0FA 2Z6VA 1LUAA 1KSJA 4BO2A 4Z2YA 4DMRA 1T2FA 1BE8A 3INYA 2DPHA 4HH3C 3RGWS 3WMEA 2WWYA 2FGKA 4Q39A 2ZR9A 3G8DA 4Q1CA 3TSCA 1NBWB 2GCEA 4F7WA 4WFKA 1EX1A 5LDGA 1P0IA 1OC4A 1QRUA 2OE2A 2G8LA 3P9NA 4HAUA 2C9CA 3QRWA 4PBRA 1KNQA 4PZYA 1OT3A 1G7RA 1QC5B 3KOZA 2QTAA 4KIGA 3TNLA 4ZI2A 4MQFA 4IKPA 4F92B 1A8UA 3KVOA 4K05A 3WGHA 5A5EA 1E6WA 2HQOA 1M8FA 4D3FA 1Q3HA 3FKSD 2FRDA 3EAGA 4RY9A 1NX9A 3QIVA 5D5QA 1IOVA 4GOKA 3I0MA 1BSVA 5GZ3A 4UEOA 1PG0A 4ND3A 1B8NA 3AP2A 3I6QA 1XSEA 3R44A 4J4BA 5FUMA 1J07A 4FDLA 1QHYA 5BN1A 5HF5A 5ALMA 3JVEA 4LI0A 4E7PA 2QUIA 3LBFA 1F4VA 4AS2A 4D6PA 2HNKA 3S99A 5K3CA 1N9GB 1XMPA 4PZPA 5JSKA 1Z4OA 3VAZA 2D5IA 4NJMB 1RHUA 1NL3A 2CLLB 4QFCA 3U81A 4CCYA 5CIWA 2DSTA 1J1ZA 2QORA 3CLRC 4C4SA 1W0KA 4OL0A 4KFUA 3LKVA 4W99A 5FLXA 1YIAA 3CLVA 3G68A 3WHLA 2ON6A 3X1JA 4DDWA 4YLEA 1CY4A 1DPGA 2B4TO 2XD4A 3VU1A 1UMDB 1PU2A 1XO1A 2I29A 2IXAA 2WVGA 3GMSA 4DQDA 1WBDA 4R16A 1JL3A 4ETWA 1E4OA 2H4YA 1RMTA 2X8AA 3DFIA 4MVJP 1ICEA 1QE3A 4Z4IA 1UDCA 2QE7D 3B6IA 1T9BA 5LQSA 3B1KA 2RMKA 3OC0A 2J3IA 1THMA 5LUBA 4OB8A 1EG7A 2QJWA 3SDZA 3CKKA 1CFJA 3MJSA 4TYPA 2P90A 3P7MA 3DE7X 4G6ZA 3V48A 2O8CB 3L1IA 3L7MA 1VSQA 2B8EA 2PRIA 1EEHA 4DV3B 4QU8A 3HKEA 1N32B 1F38A 5B4UA 5IK2D 4XX0B 2ATVA 3TTYA 3DMYA 5CJPA 1A50B 4AJPA 5KYWB 1NTOA 1F60A 2AC4A 2PH5A 3NHJA 3VYVA 2L69A 1H2FA 1ID1A 2XVYA 3GLSA 5JYDA 1GEGA 1ULAA 2VC2B 3RSLA 4RM2A 4C7OB 3BZUA 2O8EA 1BOFA 4Z3OA 5BN5A 1YQWA 1YXMA 3T7CA 4ZVOA 4IMJB 3TNFA 1I4OA 3DHNA 3K20A 3SXUB 2C78A 3S2UA 4Z7QB 1Z6PA 3HDYA 1CEYA 1F9EA 1TI7A 5HGXA 2X1LA 2RGWA 4FZ5A 3BAFA 3GLHE 4KXQA 1ZLXA 3IVGA 3OEED 3PYXA 4O4LA 4A82A 1UDAA 2C4NA 3WHKA 4MKRA 2O2ZA 5A0TA 4HQ0A 4JL5A 2A84A 4FEYA 2EJWA 4MW5A 4RL4A 4RZSA 3WLPA 4DCOA 3MMXA 2OO7A 4JWTA 3SYMA 2MT9A 3ILYA 3DBLA 2Q4EA 4PLTA 3SSOA 4DQVA 4HRXA 3GGGA 1UJ6A 5HUHA 2AB0A 5HF9A 4L4RA 5A9SB 3H3JA 2WKPA 3GJTA 5C9ZA 4HH0A 3DYBA 1K27A 1SD2A 4LFCB 2B94A 1JAYA 1LKZA 4LYEA 3JXEA 5H70A 4B2IA 1L0BA 2P3SA 3A3KA 1JZSA 4HEQA 5EGSA 3UAXA 1VL8A 3VR1A 5AM1A 4C1BA 1P5JA 4EI7A 1Z7GA 3WGOA 3EZFA 1HE5A 1FRFS 3EIHA 4QEZA 5IANA 3TSZA 4F2HA 2PJUA 5DTQA 2ENUA 1E5LA 4YI3A 5B2FA 5CURA 2XUIA 2Q4TA 5JMPA 1M2FA 3S4YA 2A33A 3C1UA 3UIEA 1JI3A 3FOFC 1D09A 2ZBUA 1LLQA 1NVFA 3FPLA 4FW9A 3FF1A 1GAXA 1WXGA 1FSPA 1RJ9B 2FP3A 3AM5A 2CDNA 2CFRA 2O0HA 2O2HA 3KSZO 5FTJA 3T7EA 4RBNA 1CSEE 5JATA 1TF2A 4YRTA 3IMEA 3L7YA 1DWOA 3DONA 3K15A 1I3LA 3PJFA 2SKEA 4Q66C 1JFLA 1Z56C 1Z5OA 4FHEA 5FWXA 3ZQ4A 1RKUA 2O8DA 2G71A 2ZG6A 4OHBA 1DBSA 2AXNA 4ARBA 2B78A 4ZMSA 4H4EA 2I99A 5A62A 2WDZA 3FCYA 2JIOA 4DWOA 4GKBA 2ASEA 2J0EA 3GV0A 4KV7A 3O90A 1JQLB 2W2PA 3FH0A 4Q02A 1Z4NA 2CVZA 2HA4A 1QGAA 2QDXA 1ZIOA 1FIUA 3RF6A 3QE2A 2BEUA 2AFIA 1AQ6A 1SB8A 4M46A 1WP9A 1BW9B 2C2HA 2VN8A 3KOMA 1GCAA 1KFBB 3GAMA 1VYUA 1K5HA 1UXOA 1R2QA 2G76A 3IV6A 3QLUA 4XJXA 1XRSB 5KQRA 3CLUD 2I87A 3N6XA 3IP9A 1PJLA 3HL0A 2OENG 3FYCA 3ER6A 5M7EA 1ZCAA 1VSVA 3IAHA 2FMIA 1RWVA 2GI4A 2Q27A 2QPLA 3KB8A 3WBBA 4ALMA 3KT8A 1KJWA 2A1TS 3RANA 2H4HA 2O2JA 4JGGA 3T94A 4EA7A 2A1UA 4Z7OB 1R4AA 5JSFA 1TTHA 3HJGA 1S01A 5CXSA 1G18A 2WD7A 1BS9A 1GFWA 2ZYSA 1YKSA 3H1TA 3I2HA 1SHUX 4JR1A 4CMCA 2WM8A 3C8MA 3EF0A 3JQDA 3GDGA 1LX7A 4KAFA 1YFJA 1KAHA 2KI5A 2NZ8A 3ESQA 5K0NA 1UINA 2J0VA 4NHOA 3WOVA 3KQVA 1L9XA 4UCWA 1GNTA 5T3UA 1ZMXA 4ZYZA 3BFKA 2PZFA 3C8DA 1E1QD 1E62A 4Q4HB 3EGWA 5CA1B 1H9AA 1DRWA 3BK2A 3G85A 1IWBB 4UULA 3KQYA 3D6UA 3HCDA 5DEOA 4RZ2A 2IV7A 1P19A 4R69A 3D3NA 2W83A 4EENA 2WZBA 4RTQA 1OXSC 4KVGA 1GTVA 3IAM1 5TEWA 2ZREA 3TQTA 4MVJM 2VPYA 4P5EA 1P8JA 1RYMA 1FFHA 1WXFA 2PH1A 2X6TA 2NN3C 2FGJA 1LWNA 4KG7A 2V9ZA 2V97A 4H77A 4Z8YA 2JFVA 4Q3EA 5GQSA 2BFWA 4UPDA 4E5YA 5TB5A 1HZZC 1AS2A 4C30A 5HS6A 2OB2A 4EHKA 3KPUA 3H0KA 4IIXA 4M38A 3KLPX 2ZOSA 2I5PO 4IYJA 4X0EA 3JQ9A 5ITVA 1PR0A 1VYTA 3FLAA 2ZRHA 1J20A 5K51A 1GUAA 4BMZA 3TBFA 1VP3A 3IUJA 2JPDA 4W8GA 1IL0A 4FIDA 4KRFA 5FFFA 2BEVB 1KGSA 1RAEA 1L4UA 3CR8A 3OLVA 3IBCA 4NBRA 2RI1A 5TQ2B 2JH3A 2YNMC 4WNAA 3WBJA 4CBVA 4GBJA 1PGJA 3ZCXA 4LXUA 4BKOA 4QYIA 1NMEA 3CG4A 1TM4E 4GC9A 1C1HA 3HFSA 1TEHA 1SXJB 3H6GA 1MTZA 3SM3A 1FTNA 4JMPA 2ZBFA 4RPKA 4I6EA 4YJ2A 3BL6A 1F9AA 1G21A 2YIDA 1NI4A 1O77A 1USIA 2W0MA 4QHTA 3TYXA 5KQLA 3NDIA 4FT2A 3GVCA 4AMZA 2R4QA 3D0OA 5LMUB 1ZMBA 1OREA 2Q07A 1TQ2A 2G9VA 3NHWA 4JT2A 4KPFC 3TB4A 3UAVA 4G1FA 4KQMA 1SZCA 5L3RA 1SQ0A 3S70A 2ZRFA 2A3RA 2VCYA 3W05A 1WNFA 3NTQA 4KXMA 3DYIA 4EOGA 2VAPA 1VSUA 5HJEA 3EVGA 3A1SA 3VH1A 2Y6UA 3ABOB 3QJGA 1QC5A 4HY3A 1AGRA 5CLHA 5BRNA 1IIBA 4CHTA 2WU8A 5IBPA 1SKBA 2A30A 4HV4A 1R12A 2JGRA 3CNOA 2ZTUA 1DC6A 1E2LA 1HDIA 5ALOA 1OH5A 1RAAA 3RDPA 3GA7A 3RS3A 2AUMA 3L6DA 1ZOOA 2B9VA 3O8QA 3A9SA 2HMVA 5TEVA 1WW3A 1H6AA 1QF9A 2WHXA 1X7ZB 5F35A 3FCOA 1K3UB 2IZZA 3K9FC 1I3KA 2QGZA 4AF7A 3MJDA 1MW8X 2H18A 5J2TF 5D51S 2V03A 1BEZA 4KO1S 2OR3A 4JJ4A 4ZV4A 4X7PA 2FUG6 1QPBA 1F0YA 1SQFA 2FTKE 5JYCA 1XNQB 2BLNA 3P71T 3E9YA 4OXXA 4CXMA 1QP7A 2HRRA 2UUCB 1FNNA 3JASB 4P81A 3IVRA 3CXUA 3I34X 621PA 6NULA 4YV2A 4GIBA 1FCJA 4IEFB 2FZGA 1QF7A 3EC2A 4MQBA 1PV4A 1BEUB 3T1TA 1NV8A 3PC7A 1G66A 4EATA 1UMDA 3I45A 3TW6A 1MZPA 3OA2A 2YQ4A 3M6UA 4U7JA 5JY1A 1Q1QA 3GLGA 2JS7A 2Z3WA 3B1ZA 3CGWA 3PUWA 3QEOA 5IJ9B 3QBTA 3MWJA 4LJ9A 5IABA 2QL7A 3AUJB 2G1KA 3SGLA 4GL4A 1UT5A 5K0LA 1X1TA 2CN1A 4R5MA 1ZICA 1M2EA 3S1LA 4AWAA 3WAJA 2AOTA 4QBHA 4AFNA 2KM1A 4XRGA 1MD9A 1KJQA 2QT9A 4ZYUA 3NAZA 4E33A 2V6FA 4XX0A 2NTNA 2FMUA 3CB4A 2XZPA 1O6FA 4NV3A 2BKVA 2P4SA 3WRYA 4D8XA 5BNIA 3SFVA 2CK3D 4TV9B 3TZBA 4CIDA 3KSDO 2HIGA 4C7OA 4N12A 3L0ZA 3DZKA 3LLSA 2LD4A 5CCBA 4NYMR 1KU6A 3DOEA 1E2NA 2BTQB 1OTYA 2F43B 1GLVA 4MWGA 3ZEAA 1KH1A 2BFDB 2AJCA 2GOYA 2VQ6A 1CDZA 1KRXA 2B5WA 2PRYA 3M5PA 5E9JA 1T6NA 3B2QA 3HGTA 3ZW7A 2QN7A 1TJ5A 3RS7A 5J4LA 3ZCTA 1TVMA 1Z06A 2VYVD 3OH8A 3M81A 4BLVA 4QSHA 2A8YA 1COZA 4UHHA 4CQJA 2XJ4A 5TPZD 2A9OA 2WJZB 3R3XA 1U3DA 1WB4A 4G5HA 4OTZA 1S89A 3DC7A 3SVZA 3RRNA 4DMUB 5EE0A 2FRDC 2IYEA 4U8GA 4BP1A 1YACA 1YR1A 4HLNA 1F1JA 2Y9PB 4NOKA 2GDJA 3KJHA 3K5HA 5BQPA 4U2BA 3E8MA 3HC7A 2HFJA 3M49A 5DWDA 3FY4A 4EAAA 2DBZA 4MV6A 1EXDA 1X0VA 1CS4C 2IZOA 4HSEA 3E5RA 2IHTA 1Z0FA 4QYTA 3DDHA 3FYDA 2J1LA 2V6BA 4MTCA 2QMQA 1LSUA 4NDAA 1QHNA 2ZE8A 3G0BA 2HDOA 3HY6A 4HUQA 4OFZA 4RHFA 1Z4LA 2OG1A 2H0QA 4H7KA 1K5PA 4L85A 3UK6A 3KWFA 1I13A 2I78A 4KQ2A 2NPOA 3R0QA 3EW7A 3O31A 3T3NA 1OXVA 3AP3A 4B44A 3C4QA 1CJBA 2IIVA 4ODIA 4D9IA 4JVLA 3CZQA 2XKAA 4LXIA 1V25A 1V1MB 1E7RA 2QM0A 4UCFA 4CJXA 3CH4B 2FN3A 4LXGA 4E5MA 4AJNA 4AZWA 4ZOCA 4GMHA 1YTLA 1B8VA 1L8OA 2ZSBA 2OA0A 1Z88A 1AZTA 1JJVA 2DFLA 4F56A 4FWBA 1RJ9A 1K97A 3AEUB 2FYTA 1ESEA 3KKOA 4DRXB 3GT0A 1JU4A 4FYHA 3QFHA 5A3QA 3K31A 3VR0A 4KB5A 5JAIA 2DBYA 3ER8A 4B6FA 3CUTA 1XCMA 2NPFA 2MDTA 1P1IA 2ZRQA 3HMQA 2QUHA 3JS5A 1KMNA 4LDAA 1N5LA 5LXTF 1QV7A 3KU1A 4WMLA 2VF7A 3ZOKA 1FYEA 2ZSIA 5K01A 2VHJA 1HL3A 1FNBA 3MNFA 4ETNA 1YWGO 5TSDA 3RSHA 4X45A 4RKFA 2VNHA 4LPSA 5A2GA 1MF7A 4ER5A 2JGIA 2ZBEA 2IU4A 3IH5A 3IO3A 4KKVA 4DQUA 4Z5XA 2JFXA 1UQRA 5F1KA 5TGDA 1BW9A 5L4NA 5C1PA 3K8YA 1XKQA 3LGXA 4OXKA 3WJ1A 3UYLA 1QH8B 2BC9A 4KACA 2XR1A 5KWIA 4POAA 4ZYVA 5LMZA 2IHBA 5JG7A 4ZI3A 4ESEA 1X92A 1P2GA 4PCLA 2JDIA 5HDQA 3AM1A 2I03A 4YR7A 4I5GA 4D8YA 3T0IA 1L8XA 1ZKDA 2Q6KA 4RWEA 3MOSA 3V1TC 1ZNQO 5LWQA 4MI1A 5AI0A 1QRTA 3LBIA 4RSGA 1O95C 3QVLA 3ZE8A 1KR5A 4ENVA 2F7SA 4TZTA 3SZMA 4NBWA 3X1MA 1Q0PA 4JI0B 4LOIA 1Y8QB 1Z5PA 2WUFA 4PHCA 2EWWA 1PI3A 3BE8A 3FOCA 1Q1NA 2JHCA 4LZNA 4Q7QA 4LJ4A 4LJ7A 5DCYA 1MVOA 2NVUB 2QX8A 1ORHA 3PJEA 3PX2A 1LRLA 2XWBF 2QX4A 1LXCA 3GCWA 2IY7A 2WWFA 4WNCA 3UHPA 1SIWA 1EM6A 2WU1A 1C7RA 4MW0A 2BFCB 1N0IA 3ZWPA 2HDNB 4WLFA 3ZE9A 1KVRA 1WHSB 1PUIA 2B2NA 4QDXA 4RC9A 4UASA 1N77A 2QY9A 3DL2A 5JTTA 1L5QA 4V0KA 2JANA 2IWRA 1SXIA 4LYJA 4PONA 4B6SA 5A6SA 3QU9A 4F1WA 1C0EA 1ZVKA 3F78A 4WA7A 3GA5A 5GJVC 3V7WA 1T25A 3WLJA 2YWBA 2O0KA 2Z1NA 3HWWA 4PGGA 2VSFA 3BA1A 2JNWA 1YVDA 1U0FA 2TMKA 4HWSA 1S2IA 4Y1RA 4YAKA 2JVKA 3ZTTA 3WNZA 1XDWA 3KP1A 3QI7A 1O94D 4IRXA 1GGEA 3RC7A 1PS8A 1HRKA 2OAQ1 5T4FA 5AQ1A 1IUOA 2HQBA 4B5KA 5U4XA 1PVDA 4NV1A 4MZXA 3DFFA 3FWZA 1NIJA 2B61A 2FNAA 3BEOA 1YIDA 2FR8A 3AKCA 1SXJA 3KXPA 2YWHA 5JQGF 4HN4B 3OLYA 5FHQA 5T7BA 2FPIA 2J5BA 5I4BA 4CLHA 3FAZA 5AM4A 3A6DA 1FBTA 2P9HA 1M66A 4U7WA 2BUAA 1VBMA 2Q5FA 1Z0IA 3QLUC 1DDGA 3HCWA 4MUFA 3NUQA 4RFLA 5FTWA 4NNOA 4I9UA 3EODA 3LS2A 3QP9A 4KFRA 4LX8A 4RVDA 4AP6A 3D7SA 4MCHA 2ZIEA 4DEYA 4QDUA 1NDUA 4Y2VA 4HDCA 1RYDA 2XECA 1L5KA 3O2JA 3WBKA 3ZGLA 2K7FA 2VH5R 3WSVA 1ZVQA 2ZRBA 2I7TA 4M0CA 4C7MA 2PL3A 2Z30A 3I23A 4CEHA 1KEEA 2Q1UA 3E7FA 2P6MA 2C7BA 3HB1A 1K06A 2DGDA 1UBCA 2BFAA 1N2OA 2V54A 2XUQA 4NJEA 1DG9A 3SS7X 1H23A 2EFGA 2OZPA 4BVHA 1I10A 1U0RA 3HJFA 3W4JA 3GJ5A 1NFFA 4EQ6B 2QAIA 5BR4A 4RD6A 1B0PA 3H5VA 5K45A 4GMXA 1XE3A 3PIIA 4AQDA 3JR3A 3ECAA 5BO5A 4IJ6A 5CX4A 5JH7A 1MUUA 2RGEA 2FSVC 3B5JA 4BVGA 2VT2A 3A32A 2BCGY 4CT5A 3D2LA 1O3YA 3G13A 2QR3A 2VDKB 1C9YA 3T5CA 4JNKA 2YW2A 4ENQA 1EJ2A 2NNLD 2PZLA 4M54A 1MGPA 4RE5A 3VJLA 3E0QA 4QGSA 1W6UA 5FBKA 1PVVA 4URFA 4EO9A 1W0JD 4R5HA 1GQOA 4M0UA 4UUOA 3UB3A 4JX9A 2CB9A 3I6ZA 3QX8A 3ZD7A 1XQVA 4MP6A 1XLTA 1YVEI 2PBLA 1BE6A 4JELA 3SU8A 5FPKA 4EL0A 3EZYA 1JB1A 1JF8A 1JGTA 1NVDA 1T2DA 3ZTWA 2AR0A 3QMVA 4MPTA 5L7WA 1H2AS 1S9DA 3LGSA 1WP4A 3L8FA 5FX2A 2QD5A 5CM9C 2N46A 2IOHA 4BMVA 3NOQA 4H3SA 2E3JA 2XDQB 4DC1A 1T5IA 4EHLA 4BMXA 5BQ3A 4KR2A 5E4JA 4N3GA 3UXHA 4UVEA 3H8VA 3Q3HA 2QD3A 3WQBA 4E14A 4ZHQF 4D9EA 2G4LA 2W2TA 3P32A 3EPPA 2R7MA 4LC9A 3QLVC 5T4EA 4DA6A 3VA7A 1YHZA 1MO5A 1GTRA 4B73A 4W5QA 2XUZA 4U7HA 2P7HA 1P0MA 4UCQA 1UZLA 3EXAA 3LHSA 3T95A 4EG7A 2V74B 4L22A 3ZCVA 2MR5A 4BNDB 3ZKAA 3KYJB 4LX0A 2CFTA 4BFZA 4UZFA 3UMRA 1B93A 1KZHA 2VWGA 3ETHA 3AW9A 4UNIA 1J0DA 1OGJA 1P9WA 2TECE 3DDWA 3V33A 2BTQA 1KZ9A 2D74A 2WVAA 2GNAA 2HDWA 1YR2A 5LLSA 3U7IA 1I0IA 1DI0A 1FRZA 4FN5A 4J4TA 3UK0A 2DLNA 4AS3A 4D42A 3EDQA 1KDRA 5IULC 1QIKA 4DIDA 1ZDMA 4B84A 1ZH0A 2D00A 5BWBA 3WISA 1UAYA 3HJBA 4IGKA 3TK1A 2R4TA 3A1UA 3PNBA 4RETA 1MQAA 4IZHA 3VKHA 3QU2A 3AVQA 1KOGA 1JYFA 2J85A 4E03A 2NUBA 5KC8A 3W5VA 3CTMA 3MHTA 2AV6A 5ILOA 1UFKA 3WIEA 2QAGA 4UJ5A 4E2FA 2OTCA 3ME5A 3HA3A 4M0PA 1JFRA 4ID9A 4RF4A 4UM5A 5HCUA 4TKLA 4CKXA 2DYKA 4GU5A 1QKIA 1WQ4A 1QVAA 5IT9A 8GPBA 2HMWA 1H0KA 2IA5A 1LI5A 3R09A 4GQAA 4QFDA 2FFQA 1YKGA 3TW4A 4P4UA 5CFNA 4LYDA 4PYIA 3A27A 2JIRA 2V98A 2ZWPA 3DBOB 3LC0A 3U19A 1QYCA 3OE4A 1ZN8A 1UP6A 3MTAA 2ZIGA 3BWCA 1OB2A 1J2YA 2F4VB 1E7QA 1TD1A 1HH4A 1NF2A 2OCDA 3HCBA 2A1TR 1CV2A 1ZA2A 2NO5A 1GYRA 4GEKA 6YASA 4UUQA 2PXCA 4D6YA 5AKIA 4TLCA 4S04A 3TLBA 4PO3X 3PFNA 2QL5A 2QJRA 1FXWF 5CVUA 2OHFA 5KOJB 4HDMA 3PGLA 3V8MA 1XKTA 4QQNA 1GRCA 1TJ3A 2COEA 2O3TA 4YT5A 5EL0A 3RSGA 3U4QB 2VJLA 4NPCA 1OFGA 1XZJA 1US8B 3K9QO 3EA5A 2WW8A 1YQGA 1M74A 2RH8A 1RLJA 4O4JB 5D8DA 1QNFA 3AR2A 3GW8A 3IR7A 5G3ZA 3VR5D 3FUUA 4XYEA 4BB0A 4DQXA 1KS2A 3BB4A 2EDCA 2QD1A 3KUXA 4ZOBA 4FOLA 3N8DA 1KYTA 3QPUA 5GJBA 4OO3A 2AF4C 4R05A 4WN9A 3VISA 1CPYA 2B6NA 3OZBA 4IP0A 3QKSB 1JWAB 4M98A 1XDUA 4DXHA 3IE1A 1UKAA 2HWXA 3HCAA 2ZSUA 2BFEA 3HZZA 4G1UC 4AXXA 1B42A 2FEKA 3ESRA 5KNLA 3O4RA 1QIJA 1QOPB 2DOKA 3CU5A 3ZN2A 4IO0A 1EZ1A 3JRXA 3H8SA 5EWLB 4EDFA 2N75A 2RGBA 2CW5A 5ITZB 5JYBA 2O5RA 3GJSA 4NEHB 1JU9A 3HEBA 4C4PA 1TJ4A 5DNYB 4DMGA 3L0OA 4WXPA 3U3MA 1E6EA 1LK0A 3WGZA 4S05A 4TYNA 3EFBA 4WERA 5FLEX 3PEVA 5A02A 2W6JA 4ZYWA 4DNFA 2CFOA 4RL6A 4TN5A 5BVGA 4OBBA 1LDMA 4N8EA 1Y81A 4CT0A 1STOA 1N2EA 1Z45A 3ZHQA 2PSHA 1TTPB 4GRDA 5JEDA 5CDSA 5JJ5A 4EGQA 2OLKA 2AEFA 3NHKA 1WLYA 2DWUA 5GOTA 1M67A 2V7UA 3NWBA 3AR5A 1E5VA 4IDCA 3R9XB 3QEKA 4PBSA 4AMYA 1G6KA 3AF5A 3FDXA 3U56A 4ESHA 3SBXA 2E85A 3ZH9B 4RD0A 3OPMA 3AVVA 2WU4A 4Q6BA 1F0NA 3NHAA 1CVLA 3PQ8A 2PMDA 3CSDA 2GX6A 1NTRA 3HHPA 4NESA 2R6HA 1U0SY 1ZBDA 2RGUA 1WB9A 1BS2A 1ZIYA 5ESDA 4YDQA 2C5FA 5JSZB 1ZMRA 4A92A 4TMFA 1EJ6A 2GA9A 2ZVPX 3F3SA 2AJ8A 1PTKA 2DWQA 1TUIA 2ZUCA 1JHZA 1HKUA 4Y2SA 3DTYA 2AD1A 2EJUA 4JQOA 2WSLA 3O03A 1TC1A 2J46A 5ED4A 1WEHA 1N8NA 3N0WA 4C0KA 7REQB 5HUQA 3T3PB 4C0XA 2FW0A 2ZROA 1NWCA 2QQEA 3COSA 1Y89A 3KEMA 1WSAA 2L17A 4LJYA 4UUMA 5SYMA 4B85A 3JSAA 1LJUA 4HWTA 4ZV7A 1OFIA 4N65A 1D8TA 1E2GA 2ZUSA 1KL7A 3LCCA 3VYUB 1TT5B 4BRZA 2WB4A 3BS4A 5BOSB 1U8AA