4POAA

Mycobacterium tuberculosis reca glycerol bound low temperature structure iic-bn
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
327
structure length
309
Chain Sequence
TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Protein RecA, 1st part, 2nd part
total genus 89
structure length 309
sequence length 327
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4poaA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4poaA01
1Z6XA 3I72A 2GDJA 3QEOA 1PZNA 2GXUA 2PH1A 5TY0A 1OIVA 3DOFA 2CCJA 5BYKA 4JLNA 2FSGA 5JBQA 3AVQA 5IF9A 4EFNA 4X8MA 4EUNA 2HEIA 4LBZA 4QFMA 3PVSA 2GVZC 4JLBA 4M9ZA 3AF1A 1P2SA 4ZCMA 4CEJB 1G21E 4AKGA 1Z2AA 1NL3A 3PEUA 1QRAA 2ZRBA 3ZVNA 2CNWD 2AK3A 2ATVA 2IS6A 2JLUA 1G8PA 4JL5A 2TMKA 1IAQA 3QY0A 2ZE8A 1YZLA 4N0EA 1P2UA 4BLOA 2FX3A 1LFDB 3B13B 4ON9A 1OXSC 5C1BA 4M0LA 1G7TA 3QKSB 4DCVA 2ZM5A 2OT3B 2FFBA 1AS0A 1JALA 3RYTC 3K70D 4TLEA 3LO5A 2FNAA 1HQYE 4QGGA 5JSZA 4IDQA 1XD9A 3SJCA 1E0SA 2C9OA 2O0JA 4XOIA 3MCAA 3TRFA 2W2TA 3A8TA 4RD2A 4V02A 1OHHD 4DDTA 1FP7A 1KK2A 5J4LA 3BJIC 2K5UA 1AN0A 3QXSA 2QPOA 3EAQA 4UKDA 1NSFA 4BLQA 4XIGS 2KJQA 3TVTA 1T5LA 4Q7KA 3ZYCA 1G16A 1FL9A 1XTKA 2P0EA 1E6CA 1SXJD 1M7BA 2OBNA 1TQ4A 4CEIA 2MMCA 2QPAA 5IT5A 4TTQA 3DM5A 2C2HA 1OPXA 1COWD 1RJ9A 5J47A 2D4HA 1GITA 4PPFA 1BH2A 1XJ0A 2OEPA 3NVAA 4HAXA 4Q66C 3DHWC 4E03A 1KAGA 1UEIA 1OE0A 1XEWX 3U3KA 5JCZA 2BEJA 1KAOA 1X6VA 2OUKA 1FTSA 4OI4A 1KI6B 2C98A 4R2HA 5TV2A 4M9SA 1NG9A 3NEJA 3U4QB 3J81k 2O8BA 1AKEA 4B74A 1QG4A 1RJ9B 2OV2A 4DB2A 2FFAA 2GBLA 3Q72A 2QA5A 2ZRAA 2EYQA 4KBGA 4DXAA 1Z22A 4QM7A 3V4FA 2J45A 1ZP6A 4B44A 1SXJC 4P4UA 2XB2A 1N0VC 1MO4A 3LQRA 2O5VA 4NONA 2BEKA 4A15A 2D2EA 2G6BA 2CHQA 4CVNA 2Q0HA 2J0UB 3EARA 2F7SA 5FI0B 2G0TA 2ZETA 3RABA 4Q1EA 1CJVC 2J7PA 3K70C 2AWOA 3VR3A 1IHUA 2WWXA 2AL7A 4AYWA 4CEHA 3CZPA 1TF2A 3C4JA 3BERA 5AJYA 2ZUCA 3TLXA 1FX0A 3WBJA 4US0R 1DBSA 4M1KA 1Z63A 3IBGA 3PCRB 4WZ6A 2BBOA 5K8LA 4TL9A 5G40A 4KODA 2BM0A 1R8QA 1MR3F 1CRQA 4O25A 2GCOB 1GILA 3T1VA 1SZPA 1XPUA 3IGFA 1J8MF 4JLMA 2DFTA 1E2PA 2W2XA 4YDSA 1T9HA 2GEVA 4HZIA 2ZRIA 3K0FB 1TQ6A 1W4RA 4DT1A 1EFUA 1QHSA 1XTSA 1LF5A 4C2UA 5EZ6B 3TAHA 4LCBA 1W1WA 1CR2A 2PMDA 3AVYA 3W8NA 3C5CA 4Q9LA 3QEJA 4MGKR 4TLBA 4KFRA 4KVAA 5EE1A 4B3CA 4WZAE 2OESA 2WIAA 4TQUS 1KO5A 5C4MA 1W0JD 3AP3A 2OFOA 1UKVY 1KSHA 3SJAA 3WP0A 1X3SA 4FCVA 1U98A 2QMHA 1OLOA 2HJGA 4KI0A 1NI3A 3FGNA 3RSOA 1HEIA 2GAOA 3QF4B 3TUJC 4B3FX 3SQWA 3D7MA 3A1VA 5CDFE 2IYYA 2DB3A 2GJ8A 2HJVA 3SJZA 3LXRA 2J5XA 2WJVA 2G1JA 1X86B 2RAPA 4TLDA 4LX0A 2V6JA 5BYJA 3SC3A 3EPJA 5E3HA 4TWZA 2QU8A 3D6TB 3HPRA 4PX9A 4PQRA 4ITRC 4Q4JA 1U90A 1QVAA 3IPXA 3T61A 3PUWA 4TYNA 3GEEA 2GJ9A 3CF6R 2P3SA 2QT0A 2KBFA 4MH0R 4DIDA 4LYAA 3IO3A 1K5GA 3HYTA 3GLIA 4A6XA 3FMIA 1G8GA 2FN4A 3W90A 1XB2A 3CZQA 4A2QA 4QBGB 2GZHA 3P1JA 4GRAA 4D2IA 4F4JA 1JNYA 1YR8A 5C46F 2Z4RA 3U7GA 1R0ZA 1KY2A 1XEXA 4NBSA 3EC1A 4DLXA 4LWZA 4HUTA 4QG7A 4NCNA 5K8TA 3B1VA 2HCBA 1F6BA 4NCJA 5FL7D 5DYIA 3B82A 1II8B 3CPEA 4LJ4A 2A5DA 1OFTA 1XMSA 3I73A 1YQTA 3Q3JB 4LHZA 4C30A 5J4HA 4Q9IA 1IN6A 2XITA 3U44A 4UXJA 1DEKA 4Y0VA 2ZI5A 3BS4A 1E0JA 3O8BA 5CDFA 2D7CA 2FA9A 2YWHA 4HB2A 3UWOA 4HB3A 1CIPA 2WOOA 2CEAA 1G5TA 1N5LA 1N5IA 4LGMA 5EE0A 1J2JA 2R65A 4C0AC 1XP8A 5FTNA 2FU5C 2J0UA 4C9BA 4U02A 3I61A 4MDFA 2P5SA 1NLZA 1W4CA 2JLZA 4B3DA 5JI2E 4ESHA 1ZUIA 3GLFB 4Q4AA 3ASYA 1Z0DA 1GDDA 3B85A 1BMFA 2WZQA 4TLCA 5EUMA 2EWVA 3IEVA 2ZSAA 3OE7D 2R62A 4PHHA 2FDCA 1A2BA 3RS4A 1NIPA 3V00A 1WP9A 5TB5A 5BN3A 2ZRPA 4NCIA 3I5XA 4LJYA 2L0XA 4B3GA 4C0KA 1SXJB 2UVQA 2A5YB 3QXXA 2ZJZA 2QE7A 3FKSD 4ZCLA 3BWDD 2RGEA 1CR4A 1VIYA 1Z8FA 3MWLA 3R8CA 2QM7A 1OH7A 4OKSA 2QROA 2BDTA 3G0HA 2FH5B 4WAUA 2XJ4A 2R6AA 2VP2A 1I4TD 1U0JA 1OB2A 1J90A 2VHUA 3K09C 5EP3A 1FX0B 1JXOA 2FE4A 4DLVA 3AGQA 3EX7C 4AD8A 2PCJA 5KO2A 4ZDIA 2O8EA 4QKQA 1SKYB 2O52A 3HU1A 3LA6A 4A0RA 3EZ6A 3BIFA 4DJTA 2I4IA 4ILEA 3IDQA 1J99A 5KSOA 1DG3A 3QKSA 4OHWA 4IW3B 3DPUA 3KX2A 3CUEF 5KSZA 3EIEA 2C04A 4A2PA 1PJRA 4TT3A 2FPKA 2ATXA 1GM5A 4B34A 4IOJA 4LJ6A 2ZR0A 4ZKEA 2BJVA 4BZXA 3R9XA 2H8KA 2Q9CA 2VHJA 1DAHA 4B32A 5DNYB 4RZUA 4C0HA 5AR1A 2HUPA 4TMVA 2F1JA 1IBRA 1GFIA 5KNCA 2BVNA 821PA 2YYZA 1GNPA 4HYYA 1E2JA 1M1YE 2ZU6A 4CEJA 3NDBB 4LC0A 5K8UA 2WM9B 5KDOA 3DOEA 3OHMA 4ZI3A 1GVNB 2XXAB 2GESA 3IBYA 3Q7QA 3NWJA 4RJLA 1FPMA 4LY6A 4W5JA 3BRWD 4WA7A 3VU9B 4HDQB 4RKEA 3SNHA 1HT1E 1ZAKA 2GK7A 5D3MA 4MUAA 4A8JA 1QHGA 3DDCA 3CO5A 3W3AA 3KKNA 5FOVA 1LB1B 4XWOA 2IC5A 2YOGA 1OV4A 4MGZR 2NPFA 2JA1A 3D8BA 2VIIA 1SQ5A 1VTKA 1XMIA 4ASUA 3U3RA 2J9RA 4QM6A 4NL4H 4D82A 3OEEA 3MWKA 1OSNA 4PPGA 1EK0A 4I99A 4NZYA 4DCUA 5FBQB 2CHVA 1NVWQ 4MQBA 3PUXA 4TTRA 1OYWA 4TZ6A 2FGKA 4N1AA 2WWYA 2GEDA 3LBHA 1VCIA 1YRAA 2WWWA 3TIFA 4ZPXA 4IEEA 3M4YA 2FMXA 1QG2A 1AA9A 4PZYA 5B58C 4QJ5A 4DLRA 3FTQA 5KHOC 2WKRA 4Q5IA 4BFSA 1R0XA 1D9ZA 1UPTA 4PSVA 3EZ2A 1IY1A 2OBLA 2C03A 2WKQA 3TH5A 1NNEA 3U5ZB 2CHGA 2IHYA 1SVWA 3AKDA 1N5KA 4LHWA 2QAGC 4JLKA 3GLGB 1AM4D 1HY3A 4JVMA 2R6GA 2MSDB 3K0AA 1DARA 1N6IA 4D0NA 1DAFA 2Q21A 2QL6A 4JZKA 3A4MA 4M22A 1TU3A 4UQOA 1A7JA 1VMAA 2QAJA 4Q1BA 2QM8A 1DAGA 1VYTA 4OK6A 4AYTA 1E2DA 4QBFA 4UJ5A 5DI3A 3S1AA 4B76A 5CLLA 3H2YA 2OM2A 3NXSA 4IVPA 2QAGA 3ZZTA 1N6RA 4DB4A 2J0SA 4X8HA 2O8CA 4I1VA 2YC2C 3I3SR 4LK2A 2QGZA 4JVSB 2H57A 4FWTA 3SJBA 2AHOA 1Q1ZA 2ERXA 1N0WA 1NN3A 2NPIA 3BORA 2JGNA 1RRPA 2FPLA 5BW8A 4UNRA 1E9CA 2MSCB 3EPHA 1B23P 2O8DB 2WJIA 2R2AA 3RLFA 1KO4A 2ZS8A 4L5BA 2R6DA 5BN5A 1LF0A 1M7GA 3F3YA 5FOXA 2GZDA 4LJAA 3SBDA 1NIJA 1Z0IA 2R44A 2OSBA 1F2TB 1F48A 2Q9BA 3B1XA 4RFSA 3PEWA 3G5UA 2JLRA 4P4SB 3TQCA 4BFTA 4BZPA 2ZRHA 4PZZA 1L7VC 4IDPA 3OIWA 1E96A 2YZ2A 3LDAA 3NC0C 4RZ2A 3X1WA 2YVUA 4LOAA 1N6NA 2RB4A 2WOJA 4MA4A 2QTFA 4PAMA 3QE0A 3OZXA 2IXFA 1VG1A 3IEUA 2OCPA 1S4QA 4P4SA 3UMSA 4EDHA 4PPQA 1X1RA 4RD1A 4M53A 1GRNA 2ZYUX 2RKOA 4XSGA 2QP3A 3SEAA 2NO9A 4DLYA 2IW3A 1NJFA 1P9RA 1TAGA 1US8A 2VF7A 4XD7D 5KNBA 3GD7A 4OQMA 4F93B 3IHLA 2ZREA 2O8DA 3VNVA 5JEEA 1KI3A 3AF2A 5EP2A 4LBWA 4BFXA 3CWZA 1TUEA 5AJXA 3MAAC 2IA5A 4IXNA 1S9DA 3TMKA 2HF8A 4IDHA 1S1MA 4G3XA 4U00A 2ZVQX 2ZYWX 4ZIRA 1NVXQ 3FMPB 2REXB 1CTQA 1VCOA 2V54A 4PFSA 3GJ3A 3JVUA 1FUKA 5F3WB 1XFAA 1KI2A 2WWIA 3QXHA 2FFHA 2DFLA 1NBME 1W4AA 1KTVA 3VX4A 2CBZA 2PEZA 4XJXA 4ZIRB 3FOZA 1R0YA 1P6XA 4YMWA 4D4LA 3MUFA 2QTVB 1RKBA 1US8B 3AVUA 5LPNA 5EE5B 5EXTA 4XVRA 1CJKC 1CBUA 2ODNA 1ZNXA 2XSZA 3Q8XB 3KFXA 3HU3A 3R8FA 2IYZA 2H7VA 3K9LA 4E22A 1X8JA 1Q0UA 3KFVA 1ZJ6A 2NQ2C 4OYHA 4DSOA 4MITA 3BH7A 3GLGA 5JWHA 1G9XA 1S0UA 4TMXA 1GKYA 3KXIA 4I1UA 4D81A 5EXPA 4TMWA 4LHVA 5H70A 2QUZA 3N5CA 4H9GA 3RVBA 5JI3E 1XCMA 3HU2A 2V6IA 4JSYA 4Q01A 3R9IA 1KI1A 1KO8A 1U0HC 3K09A 2BBTA 4DEYA 4IKEA 1I4DD 4GI7A 4QGAA 4LDJA 1QHYA 4PC7A 4NCHA 2AD5A 2EU8A 3B78A 3T1OA 3W8RA 3ZS8A 3UXMA 5SZJA 2JLXA 3Q5DA 2W6JA 3U44B 1HTWA 3UKDA 3I8SA 1JAHA 1IN4A 1VKJA 3LX8A 4TYYA 2X2EA 2Q9AA 4NPHA 3NBFA 1RYFA 2C77A 4CW7A 1E9SA 4HSEA 2F6RA 2ZIAA 4CRWB 1L4YA 2GEUA 1L2TA 2QE7D 2V1XA 1II8A 4K8OA 3RAPR 3THOA 3CF2A 2F43A 2EQBA 1Q1QA 2ANBA 1C4OA 2GCPA 3T1TA 1CLUA 2NO0A 2BBWA 4PANA 1M7HA 2YV5A 1W7AA 1BIFA 2KSQA 4AURA 3C8UA 2YWEA 5CB6A 4OK5A 1DPFA 2H1LA 3LQQA 4TN1A 2ZJBA 1KMHB 3P27A 1E4YA 2D74A 1JPJA 3C14C 3KKMA 4Q4HA 2IL1A 1LTQA 3W5JA 3U6KA 3SZRA 2G83A 4DLSA 1E1QA 2CNWA 1YZNA 5GVSA 4Q1CA 1KI6A 2GILA 2OLJA 1N25A 3QPVA 3L0IB 5FBRB 1KKMA 2OFXA 3EA5A 2J3EA 3VFDA 2BC9A 3BXZA 4JJKA 1YZUA 4JYBA 1R5OA 3PIRA 4LV5B 3GLIE 1ZBDA 3K0FA 1B0UA 4M1WA 1JJ7A 3TSZA 2FEMA 1HT2E 2B92A 2N1BA 2W6IA 1A82A 3CNOA 4JMPA 3TUIC 1CJTC 1G4AE 3I1FA 1IY0A 4NU0A 2G1KA 3NBZC 4F4CA 3O47A 2KBEA 1UADA 1ESNA 2HLDD 2ZI9A 4GZLA 5L3QB 3PJRA 3CX6A 4OHYA 3THYA 3X1YA 2I3BA 2IYSA 2AKYA 2RHMA 5FL7A 3N2IA 1E9DA 1XPOA 3CR7A 2P67A 3EASA 3U2QA 3RSLA 1T5IA 4W5HA 1KSFX 3IHWA 5AUOB 3EG5A 4PC1A 2XTNA 3CBQA 1I2MA 3AGPA 5EJEA 3T1QA 1S3SA 4DHEA 4LPKA 5GJVC 3B6EA 3PEVA 4EJSA 3ADKA 1YRBA 3Q9LA 4OQFA 3WHKA 4BGDA 4UNPA 1GG2A 4XTCS 4ACAA 4A8JB 4OI0A 1X8LA 3GLFE 4DLWA 1Q20A 3AVOA 1GNRA 1OXVA 4BLTA 5E7JA 5CB8A 2IS1A 2LKCA 2ZE7A 4JKIA 3WYFA 3K0CA 1Q21A 3PR1A 1TQ2A 2H92A 1U8AA 2NGRA 4NDZA 2VHTA 3ZGXA 4GT1A 1DAMA 4M4SA 3DZ8A 1U94A 1D9XA 2ZU0C 1XTJA 3K9NA 1XEXB 1G19A 3AH8A 3HR7A 1E0AA 3AB3A 3SQXA 4IHQA 2GF0A 3LAWA 4O2LA 3MWJA 1JAIA 2J7KA 1VCNA 3MLEA 4OHZA 3T15A 4CF7A 4TL6A 1Z3IX 2VO1A 4Q9JA 3QBVA 2AR7A 4BRWA 3K9HA 4RCYA 1TNDA 4US2R 1EFHA 1T3HA 5E4FA 2ZJ8A 4V0LA 1UKZA 2VP4A 1JR3D 4HDOB 2OO7A 4U7DA 2VP6A 4RFVA 3QG5A 1CR1A 1S1CA 1NN0A 1VYUA 2XEXA 1G7CA 3UG6A 1EWQA 3U4QA 4HAUA 5F98A 4CDGA 3UANA 1F5NA 1SXJA 2F9MA 1XMJA 1ZYUA 2BM1A 1N6HA 1XCGB 2E1RA 3F5FA 1KK0A 4IFBA 3TE6A 4A1FA 1U2RA 4BWYA 3O8RA 3CRQA 3QF4A 4DWJA 3K0CC 3LRPA 4NYJQ 4Q19A 4UJ3A 4MYTA 4LUCA 1HYQA 1VDZA 3LD9A 4Q9HA 1DOAA 3SS8A 3GLHA 5DSZA 1Q3HA 2KB0A 1MV5A 3MG9A 4JBXA 5L3QA 5FUWA 1GUAA 1D2MA 5KDLA 1T4GA 1T3LA 2DPXA 1S3GA 1TQDA 3BOSA 1G5RA 3PFIA 4Q7JB 3AKEA 4KSCA 4QXAA 4JLJA 1D2EA 2A5FA 2OXRA 3TNFA 3A1TA 1Q22A 2QNRA 3B1YA 2PZGA 2RGCA 4AG6A 2ORIA 3K8YA 1XEWY 3RDPA 4U5XA 3ASZA 3W34A 3GJXC 5IHPA 2PT5A 4IVRA 4GOXA 1OH6A 3QIAA 2OAQ1 2VQSA 1DAIA 1ESMA 4JVLA 1TPZA 4TL8A 1GL7A 2GCNA 2REBA 3CONA 4Z51A 2UZ3A 2B8WA 3OAAD 3QXCA 3K0AB 1GKIA 3I62A 5L3SB 3B9QA 2Q3HA 4PSAA 5FBVB 4BE7B 1N6LA 2G3YA 4JIMA 3FKSA 5GADl 5G41A 3NTUA 1AQUA 4C0JA 1D6JA 4DVGA 3CWQA 3FE2A 4HUQB 1T0HB 4M2LA 2XZLA 1F2TA 1NKSA 1OF1A 4QJ4A 4AC9A 1EFRD 1JI0A 2H5EA 1T8UA 4IVQA 3B7GA 5JHHB 1EXMA 4URVR 2PL3A 4PHGA 2NZJA 2OXCA 5KSYA 5CIWA 1VHLA 4DSTA 4TMTA 3BFKA 1ANKA 1LW7A 1PUIA 2NG1A 3VR2A 2IXEA 4ARZB 1G6OA 2XZOA 2C99A 4TTPA 1E2NA 2W6JD 3AF3A 2ZE6A 5FL3A 2IYUA 4D4MA 1KOFA 1Q44A 3GCGA 3OIYA 4Z1MD 4JLVA 1J7KA 2V8OA 2R6CA 5FPTA 1J8YF 4RD3A 2WBLC 1P62B 3B2EA 3K1JA 2YWFA 3S1AB 3TBKA 4FWIB 4M9QA 4QJ3A 2B6HA 4C0QC 3VR6A 1P73A 3SYLA 1NSTA 2W0SA 4BLRA 3CIOA 1PLKA 5A0FA 3A4NA 2QI9C 1KYIA 4UXIA 5HE9A 1AS2A 4QGHA 2AXPA 1JECA 3RRMA 2XOKA 5JCPA 4M8NE 3K0SA 1E94E 1DADA 1W36B 4AI6A 3AEZA 4NKRA 4KSBA 4DBLC 4HLDA 3KQLA 4NTZA 2BCJQ 1DVRA 2B7CA 2WMOB 3KJEA 5AJVB 4WIAA 5GJBA 2WICA 4KO8A 2ZJ2A 5DISB 2HXYA 1YZGA 1S8FA 3E70C 1F2UA 1XF9A 5TDHA 4GOJA 2AK2A 1WB9A 1W5SA 4A8JC 3L0SA 5DHAA 1KJYA 1WQ1R 1A5TA 1NF3A 1OKKA 3CB4A 1DG1G 2QQEA 3U6BA 4QOSA 1VCMA 4BFWA 2WSSA 2VP0A 1KNQA 2VHCA 5GJCA 2QORA 4DKXA 2NMVA 3H0KA 3VKHA 2A5JA 1ZNWA 2Z83A 5G3ZA 4JLPA 1NY6A 4ZKDA 1G4UR 2ASEA 2JJ2A 3LY5A 3PUYA 1JQJC 4FINA 4R2IA 1ZD1A 2RGNC 1AK2A 1PLJA 3SBEA 1MABA 1ETUA 1P2TA 2CVFA 2IYQA 1KDTA 4I4LA 4JSTA 3UG7A 4M21A 1E2FA 4UNSA 3KQUA 4HUQA 2ZQ5A 4B75A 2JJ8A 2JJ1D 1TU4A 1ZC4A 3KTAB 4I1SA 4LV8B 5EZ5A 1TF5A 2IYXA 3CM0A 2IHBA 1E79D 1ZCBA 2IK8A 2FG5A 1HE8B 1SVMA 3H86A 3KXLA 1PLLA 1TMKA 2O0KA 1HUQA 1K5DA 1Z83A 4IDNA 4D0LB 3RRNA 1NKTA 2F9LA 2F3RA 2PZFA 2RGXA 5FR1A 2G77B 1M74A 1JPNA 3ZVMA 5EXSA 3MGCA 1G64A 2QENA 4LC1A 3GEIA 3ZH9B 1II9A 4Q48A 4H1UA 4GZMA 5FTMA 1OB5A 1RZ3A 3CPJB 1F60A 5SZKB 4HEJA 4KITB 2FOLA 3NHAA 1E1RA 2V1UA 3VU9A 4IRUB 3E1SA 4G01B 2WJYA 4OJQA 4CIDA 3IUYA 1BYIA 3TVDA 3OESA 2AX4A 1A2KC 2XTMA 3N70A 3OEHD 3LFUA 2ZRGA 3EC2A 3IKJA 1U81A 4JBWA 1S2MA 2J87A 2ZS9A 3QOFA 3THWB 3HWSA 2NOAA 2QMOA 1ZNZA 3GJ6A 4E07A 4W5WA 1EX7A 1GTVA 3QXJA 5A5GA 3OIVA 2HCJB 2EW1A 2ZEJA 5LBIA 2JDID 1R5NA 4EKDA 1S96A 5IDVA 2PZEA 2ZROA 3UPUA 4KFSA 1H65A 3WY9A 2H17A 1ZNYA 2W58A 4OHXA 3IIKA 5H1YA 2FSFA 2B7BA 1YR6A 3QBTA 4JYCA 1MT0A 3WMFA 1N6PA 1QZXA 2J7PD 3GFPA 5GVRA 1E2IA 3RC8A 2A30A 1P4SA 2XTZA 3VHXA 1RE0A 4KLNA 2BV3A 1ZU5A 1U9IA 2FF7A 3TK1A 2OE2A 4V03A 5KNDA 1JR6A 5DO9A 2BMJA 3FHOA 1W48A 3RS2A 1OH5A 2CXXA 4B6EA 3ZLJA 4D4KA 1A1VA 1XCPA 5AJZA 3QQ5A 3REGA 3GJ4A 1ONBA 3W5IA 4L15A 5HKKA 4KVGA 4D0GA 2VL7A 2GJKA 4BRUA 4L8GA 5FH9A 1G8YA 1KZGB 2JEOA 2W83A 1KJWA 4TYPA 2UKDA 1EFCA 2ZRJA 4B3BA 5FBWB 1GL9B 3BD9A 3L2OB 3A1WA 4A92A 1R7RA 2IUTA 4EAQA 4A0GA 4YC7A 3VNUA 5AUPB 1OIXA 1LV7A 3X1XA 1QHHB 3ZZUA 5KDDA 3LW8A 2UZIR 3NH6A 3T34A 2ZAMA 1WDTA 3LVQE 2ZRDA 1ZIOA 4K81B 4CZ2A 4NYMQ 3LXXA 3IIJA 4XSHA 5FTKA 5HTKA 2EVWX 5ELXA 2IEYA 4XVUA 1IN5A 5L8VA 2WAXA 4MRNA 3X2SA 4C0SA 3SYNA 3EPKA 4RD4A 2C78A 4LSGA 2FZLA 4P4TA 2FPMA 2LWIA 4FMBB 4PAOA 4IEIA 1OJLA 1P9NA 4PO8A 1N3BA 2FSHA 2OCBA 4P3YA 1GRQA 4DDUA 5DN6A 1P2VA 3ZVRA 4PR0A 4LV6A 3ZIAA 1OIWA 3UMFA 4KFTA 4B2IA 1YR9A 5H68A 1H8HD 3GJ5A 1MO6A 3VQTA 4ZI2A 2VBCA 3OF5A 3PQCA 2CCKA 3W6PA 1SGWA 4CT4B 2P65A 4ERNA 1GRRA 2QBYA 4KLZA 4HAYA 5HZHA 1YZTA 3DVLA 4B33A 1XXHA 3B60A 2FFQA 3QI2A 3CF0A 5B30A 4AY2A 3DZDA 2IF2A 2CVHA 4JT4A 5LD2C 1MH1A 2LKDA 3BFVA 2RGBA 5FUYA 4MGIR 1AKYA 2WJHA 2QRZA 2VPPA 4TMZA 4DLTA 3SDZA 4RFSB 4B43A 1JR3E 2ORWA 4DLUA 4US1R 3A58B 5EP4A 1SKYE 4MDEA 2CLDX 2MSEB 2ZSFA 3SR0A 4ABYA 1U8YA 2OCAA 1Z06A 2EFCB 3P20A 1M6NA 1Z2CA 5DYGA 3MRSA 1JXMA 5CITA 1CRPA 2O8EB 1UKYA 2PJZA 4N3NA 1M2OB 2GXQA 5DE3A 1P3JA 4CGZA 3HDTA 2EWWA 1YKSA 3RS0A 3CRMA 4NE2A 2R9VA 3DL0A 1VPLA 4GL2A 2ZRKA 1JEEA 4PO1A 2A7QA 2OBMA 4QL3A 5DI3B 4KU4A 2YC4C 2XXAA 1EG7A 2OILA 1XXHB 1Z6AA 2D06A 2ZR9A 1JBKA 1QHIA 1NBMA 2BKEA 3HJNA 4D4JA 4DSUA 3WNDA 1P60A 3CRW1 2E9SA 1MOZA 2QTHA 4TYWA 2CL7X 4C2TA 1KY3A 2IYLD 3UIEA 1G41A 1J70A 3KZ1E 4C0BA 4OJKA 2A78A 4QBIA 2IUUA 2IS2A 4DCSA 2CL0X 2QQ0A 3CW2A 1XPRA 1E79A 3NBXX 1GWNA 1EESA 1Z6GA 5EP1A 3ZVLA 4R71A 3FFBA 3MJRA 4LI0A 5TXGA 3U7FB 3OFND 2GCOA 1KNXA 3CNNA 4QNMA 3VTKA 1U0LA 1U9IC 3VAAA 2ZXUA 2JJ2D 1UBCA 4Q02A 4QRHA 5CYOA 4BASA 5KSPA 4MRVA 3U61B 3SFZA 4X8OA 2QMUA 2VEDA 1Z29A 4P0TA 4LHYA 1ZC3A 3B1WA 3IPYA 2VF8A 3PV0A 3UMRA 1RRGA 2WTUA 3MSXA 4S35A 2DWOA 2GJAA 1NY5A 2C5LA 4LJ7A 4XWAA 1YU9A 3DEFA 1W2HA 1R10A 4Y0AA 1GKUB 1PV4A 1R5BA 2GTPA 1RRFA 4B71A 1FZQA 3FWYA 4TLAA 5TMPA 4C0LA 5DH9A 4IOLA 1QDEA 1RPZA 4FI3C 3BE4A 4H1VA 4CEHB 4JT2A 2OFWA 3ICEA 4YQFA 4MKHA 5DLQC 5L3SA 1FQJA 1N6KA 4XWKA 5IK2A 1HA3A 2CK3D 2OZEA 1UM8A 4LYHA 4RVCA 1K6MA 4M1SA 3TJZA 2FGJA 4IOMA 3A1UA 2P6RA 4L4UA 2OLKA 2BMDA 2DR3A 4Q00A 5FOUA 1UKEA 2WWGA 3C41J 1YZQA 3ADDA 4MKIA 3GPLA 3TKLA 1CF4A 4MRSA 4GDFA 1DAKA 2NO1A 3I32A 2G9NA 3VR4A 2ZR7A 3TGPA 3QKRB 3E5HA 3GJ0A 4JS0A 2ZE5A 721PA 5KPJA 1T6NA 2PX0A 2GXSA 1Z0JA 4ZDWA 2ORVA 1OKKD 2IXGA 2RGGA 4L16A 4WVFA 5DGXA 1FOEB 2ZI7A 4Q4HB 1E2MA 2A5GA 2V3CC 2P6NA 4EJSC 2AFIE 2DHRA 2FZ4A 2B21A 3KL4A 5SZIA 2J46A 3T5GA 4JKYA 4Q7LA 4A0HA 2V4ZA 3GP8A 1XMVA 4MYUA 4MGYR 4RY2A 3ZD6A 1V5WA 3QVVA 2HYDA 4TL7A 2NO6A 4JJZA 5EXXA 1UBFA 4M9XA 2WWHA 1TX4B 4BFZA 1E98A 1TTTA 2BCGY 2RMKA 3EWSA 4Q9KA 3GLFA 3FYHA 1E1RD 4DDVA 4PSKA 1R2QA 4OK3A 1XTQA 1VG8A 1CR0A 4KJZA 2QGNA 3R9WA 3X1DA 5KYKA 1L8QA 4MUBA 4HDCA 3RS7A 2XB4A 2IF0A 2ZJYA 2ZYVX 1MABB 3CX8A 4M1TA 4NHOA 1EX6A 2F3TA 3TSWA 4A2WA 2ZI4A 3ETLA 3CH5A 3L82B 4RD0A 4Q4AB 3ECCA 4M1YA 1KJZA 1WRBA 1R0WA 2ZI6A 2DY1A 4KCGA 2QN6A 1E2HA 5JWOA 2PMKA 3A6PC 3N2EA 4KV9A 1R6BX 4HLUC 1XJQA 1G8HA 3SOPA 3WYAA 1XZPA 5B2ZA 4JVNA 3ADCA 3B9PA 2HV8A 1KI7A 1E9RA 2YOFA 2DWQA 2W2VA 3TAUA 1E2LA 2O8BB 1IXZA 2GA8A 1YVDA 4QHSA 4XH9B 1DTSA 2IYRA 5EE9A 1VYVA 1NJGA 4URYR 2XZPA 4DZZA 2X1VA 1MRNA 4AKEA 1NP6A 1E9EA 1KIMA 3QKUA 621PA 5F9HA 5BN4A 2ZRMA 4CT5A 5GJWC 1SVOA 3MMPA 3ZIAD 4KAXA 4URWR 1BMFD 2BMEA 5E95A 3GMTA 2ZSBA 2KE5A 1TEXA 2OCYC 1IOZA 2AXNA 3CRVA 3OAAA 2I1QA 3FKQA 1AA3A 1KI4A 4EQ6A 2V7QA 4PQFA 4NMMA 3ICQB 4OBEA 2VTKA 1F3OA 3F0TA 2V7QD 1NLFA 2ODWA 2YNMA 2DFNA 4HAVA 3CRRA 5FBLB 2YOHA 3AVPA 1KDPA 2E87A 2JIZD 3SHFA 4ACBA 5C2JB 1ZW6A 5KUTA 2CDNA 4BFYA 4DUGD 3CKLA 2ZS7A 2EFEB 3U3JA 1N0UA 4BZQA 2ZRFA 3QNUA 2D7DA 1W4BA 3LX5A 3SN6A 2BKUA 1O3YA 2QMEA 3OIUA 4R7ZA 4UNNA 2WPDA 3CH4B 3U60B 4L9SA 1Q57A 4TMKA 3WYGA 1G3IA 2J0QA 1Z28A 2V55B 5JSZB 1KHTA 1G8FA 2Y8EA 3AKCA 1OXXK 1RC8A 3QF7A 3R20A 4PC3A 3NG1A 4GP7A 5LB4A 1BO6A 2P2LA 3NDPA 1HE1C 4F38A 2RCNA 2WPDD 3QG1A 5JHGB 1OHHA 3C15C 1Z0FA 3KKOA 5C18A 5BWMA 2R6FA 2GJSA 4OI1A 5IK2D 3GLHB 2WJJA 2XNDD 4WXPA 1OFHA 3BGWA 5FPSA 2CE2X 3ZD7A 1A4RA 1QHNA 5F2EA 4LPSA 4R9UC 2CCGA 1ZD8A 1GOTA 3NIBA 4PPNA 2CL6X 1BKDR 4G1UC 2NO7A 1UFQA 4QHTA 3ZQJA 1G17A 4QHYA 2ONJA 521PA 5HZKA 1UF9A 3RS5A 1BS1A 3DKVA 2ODEA 1E9FA 3JZAA 1E69A 4YLGA 2PX3A 5F9FA 3MFYA 4HLUA 4YONB 2FSIA 2DBYA 2GK6A 5EE3A 5J40A 4POAA 1MO3A 4B2PA 4F4IA 4RSGA 3KJGA 4LHXA 4R98A 2IYTA 4ZDJA 4M1MA 3EXAA 1XNJA 4PXAA 2ONKA 1T8TA 2BJWA 1UDXA 3L8YA 4IXMA 3UATA 1WE2A 3DM9B 2PT7A 3FHTA 5CLQA 4KXFB 5AJWA 3BB4A 3W6OA 5KOYA 2ZPTX 5JWRA 2JDIA 1E4VA 2GAAA 2N42A 3AQ4A 3MWYW 3FFAA 3BB3A 4BLPA 1HV8A 5JJKA 3NC1C 3PUZA 3FVQA 3D31A 3ZS9A 4JL8A 5CYPA 2XJ9A 1F2UB 4G5GA 2ZAOA 4FN5A 1KMQA 1ZM3A 1LS1A 3M6AA 2X19A 3L43A 2BOVA 1G7RA 1ODFA 4A9AA 1S9HA 4MYCA 2QSZA 4OL0A 1IQPA 4TSFD 5FFMA 2BHRA 2D62A 221PA 1KMHA 4WXRA 6Q21A 3QPWA 2Z0MA 1IN8A 1JR3A 1NVVR 3EW9A 1KSGA 3KUDA 4IDOA 2RHDA 1G3UA 3V4RA 2JLVA 2W6ID 3BH0A 1M8PA 5IRCD 3ZZ0A 4Q21A 2H16A 1G18A 2YINC 4LJ8A 1ZUHA 2G0NA 1MKYA 1MRSA 4KHZA 2O8CB 1FMLA 2AN9A 2QAGB 5CM9C 3RRYA 1U99A 3W3ZB 1T91A 1WBBA 1PUJA 1HH4A 1NG1A 3ND8A 4A36A 3VR1A 2ZSEA 4LRWA 1W46A 2J0VA 2WKPA 4AKHA 4D80A 1CULC 4LBYA 4MRRA 2JLWA 4A82A 3KQKA 1IXSB 3Q85A 4ZCIA 2IS4A 3KKPA 1R8SA 1CS4C 1UDWA 1OXUA 1FNMA 1G20E 1O87A 3LBNA 4YDHB 2ECKA 4BFVA 1DO0A 4G5QA 3PENA 3LV8A 1NN5A 5HCNA 2HDNB 2GF9A 1N2CE 3IIMA 4I81A 3PEYA 3B5JA 1JQLB 1QBKC 1ZVQA 4BFUA 1G3QA 1U8ZA 4PTLA 1Z0KA 3AF0A 3U3OA 1C1YA 1RYHA 3L0PA 3T35A 4KYIB 4CYMA 2CJWB 4NH0A 1ZRHA 1GNQA 3P4XA 1FUUA 2JATA 3KJIA 4HLQB 2JLYA 3AVXA 2ZRLA 2ZTSA 4OHVA 5K8IA 4GSYA 5E7IA 4FD2A 1ZIPA 1CJUC 1X1SA 5JEDA 4BECA 1NVUQ 3EIHA 4RZXA 2JAQA 1KI8A 1XEFA 4TT3D 1NMYA 4WOPA 3I92A 3ONWA 4Z8XA 3BC1A 3M1IA 1XU4A 2J1LA 3MJHA 5JJLA 1P9WA 4EFMA 4X8LA 2GRJA 3G82C 3T12A 2H18A 2X8AA 3HYRA 2A3RA 2ZVPX 3EZ7A 3LLMA 1KK3A 3AP1A 1Z6YA 2BMFA 3CPHA 4XTRA 5KPDA 1N5JA 3T5DA 3AVWA 1EGAA 2QP9X 2AKAB 1E2EA 2YJTD 5G3YA 2XX3A 1KO1A 4Q7MB 1P72A 4HATA 1AJEA 5HKKD 1ZM4A 2VRWA 1SVLA 5FPYA 3VMFA 3DMDA 3NH9A 3ZQ6A 2CMKA 2YWGA 2HXSA 3K0EA 4IFEA 2WHXA 3VHLB 2A9KA 3RWOA 2C9CA 1NVVQ 5E7MA 4BEJA 2ZANA 4XVQA 1FFHA 3TR0A 1Z07A 3EIQA 3SI7A 3U7EB 2XNDA 1Z6TA 2C96A 4FCTA 2VHQA 2HT1A 3TW4A 2WVJA 1T3SA 5DHFA 5JZVA 2Q3MA 4AWXA 2O8FA 2IWRA 4FXPA 4UXHA 2Z6VA 2GKSA 2XNSA 2ZITA 2ZJAA 3BBPA 5A4JA 3GFTA 2GHIA 5FTLA 1RW4A 3RANA 3KUCA 1CP2A 3KB2A 1H8EA 1HURA 1QHHA 1ZM7A 2WMNB 1IJFA 2AD1A 5ANRB 4F92B 3SHWA 2NZ8A 1OT3A 3TSOA 3Q7PA 2OG2A 1AS3A 1IXRC 4JLOA 4M1OA 1E32A 3C7KA 4P32A 3TUZC 5JJIA 1YE8A 4HAWA 5CK5A 4PAQA 4Q1AA 3EPLA 1G6HA 1JJVA 4GOKA 1UJ2A 2ZI3A 4DUGA 5FPHA 2RH5A 1IJEA 1KDRA 1WMSA 3KQNA 2YKGA 1IONA 4K46A 2JIZA 3AUXA 5HR5A 3WXMA 3BAFA 1G3MA 3GFOA 5JLJA 4DDWA 1W0KD 5JS8A 1AIPA 2V9PA 4WZBE 3M0EA 1XXHE 4A4DA 2XSZD 4LZZA 1KKLA 1XDBA 4MKGA 3WMEA 4EFLA 2WJGA 1H8HA 2YHSA 3VKWA 3K70B 1D5CA 1KK1A 2BIFA 5HE8A 3WP1B 3R7WB 3HPQA 4O2RA 1ZM2A 5LB2A 4PO9A 2WIBA 2ZUDA 3AUYA 2AWNA 4A0FA 1AZSC 5HCIA 3PUVA 2J41A 2D3WA 1Z47A 2F1IA 2GETA 4YMSA 1ZINA 2GXAA 4AKIA 1XX6A 3NHBA 1W36D 3REFA 4J0QA 3MD0A 1GZSA 4B35A 1SVSA 3WRYC 1E2GA 3NEYA 5J5CA 1II0A 1IY2A 1G7SA 1D2NA 3IILA 4Z54A 4TYQA 3AF4A 1Q12A 4FCWA 2A2ZA 3FMOB 3SFVA 2FJUA 3WMGA 4Q4LA 1G291 1Q1EA 4ZDKA 4JL6A 5TARA 4EPYA 2EFGA 3X1ZA 4JLAA 3U7HB 1E2QA 1OFUX 3LNCA 2PEYA 4B2LA 4F91B 3E2IA 4YXWA 3VR5A 4LJ9A 1Y3AA 2EYUA 4C3ZA 2G88A 4TQAA 1Q3TA 3A1SA 2KWIA 2GBLC 5JS7A 2MMGA 3QJYA 5UKDA 421PA 4I1OA 2NTYC 2QSYA 3K9GA 1IN7A 3P26A 4GPTA 1COWA 5EQTA 4DC9A 3GLGE 1GL6A 2VLIA 4Q03A 4TSFA 2QP4A 4FMDF 3SU8A 2F55A 2O0HA 4V0NA 5AK0A 1SULA 2P6UA 1P61B 1P75A 4UNQA 2PBRA 4DCNA 3UK6A 3L8ZA 1HQCA 1VG0B 1D8TA 3DMNA 3TR5A 8OHMA 2OHFA 4TQ9A 2QZ4A 3TQFA 1H8ED 1QVRA 4HLCA 4EPTA 1DELA 1W2GA 3AKYA 3CNLA 4ZO4A 5C4GB 4QGFA 3IO5A 4Z1MA 4Z8YA 5LDDC 3U3MA 1TF7A 3ADBA 1KGDA 1QF9A 3BK7A 2HYIC 2XAUA 4ARZA 2JJ1A 2Q6TA 1E2KA 3CR8A 1GSIA 4GFDA 4NYMR 5EUQB 4LYFA 1DE0A 1DS6A 2VP5A 2QPTA 2ZSDA 3KJHA 4NYIQ 2LCFA 5FOWA 1DAEA 5D3QA 1FP6A 1PVOA 3D3QA 3C5HA 4FMCB 4ZV4A 3ZJYA 3ZDQA 1NBMD 5JMTA 3QKTA 4WBSA 1GIAA 1SKQA 2W0MA 1XD2A 3QVUA 2CLCX 1XWIA 2CK3A 3RHFA 4EPRA 5JFGA 4YMUA 1CJMA 4OQNA 5FUVA 3LVRE 1V43A 2PLRA 2Z43A 5L3RA 2KI5A 4IJMA 3BB1A 1JB1A 3KTAA 5B64A 2DFKB 3FMFA 4V0MA 4B48A 3QKRA 1AZTA 2EFDB 4EPXA 4EIWA 3WRXC 4JLDA 3GLHE 3FDIA 3LW7A 1CKEA 3Q5EA 1YHNA 5CIQA 5DI9A 3KKQA 4TZ0A 3A36A 4L9WA 1P5ZB 4AG5A 1ZU4A 3EZFA 5J4YA 1WA5A 1E99A 1N6OA 4O3MA 2VSFA 5JECA 2PLFA 1RFLA 1LVGA 3FHCB 3I8XA 3RRZA 5L3VA 2Q3FA 3AP2A 4RCZA 3LLUA 4PC2A 1FNNA 4B47A 1NMZA 2J59A 1KO7A 5CM8B 2JLSA 4G5SA 4RD6A 4ASUD 2VYFA 2B8TA 2C8VA 2P5TB 1BOFA 2QT1A 1R4AA 2VSOA 5AUQA 3OFNA 5KTYA 4OQXA 1YZKA 2CJWA 2ZUBA 4HAZA 4QC2A 5JRZA 1I4LD 2QEQA 1W49A 2BWJA 2C95A 2Z4SA 3CX7A 1KI9A 3P4YA 4NCKA 5J4KA 3K53A 2WSSD 4RKFA 4E5UA 1FQKA 1NLYA 2VP9A 1G1MA 2FV8A 2WSMA 1EWRA 4PHFA 3OE7A 3TW8B 2FEOA 5LD2B 4EJSB 3EA0A 2C9YA 4GMDA 1XJCA 1XD2B 1G3RA 5BXQC 4G5RA 1T0JB 4OQLA 5G53C 5B57C 5DN6D 5CJ2A 3IQWA 1SVKA 4HZUB 3C16C 1OXTA 1I2DA 1W47A 4BLSA 3BFXA 4KBFA 4N0DA 3PITA 1TL7C 4FMDB 1VG9B 1AQYA 3FPAA 2X77A 3ND9A 4P33A 3CLVA 2SHKA 4WW0A 3WNCA 5J4VA 3THXA 1SVIA 4W9MC 2JASA 1Q1BA 1E9BA 1OYYA 3QENA 5M04A 1UBGA 1Z08A 2BBSA 5HPYB 1GP2A 4V0ME 1TUIA 3T06B 4AYXA 1QHXA 2XOKD 4DEXA 3B8HA 4LBVA 1AGRA 3O8CA 3KQHA 4BQSA 2ZRCA 3HP1A 2N46A 1FMJA 3AM1A 3HR8A 3W9YA 1AGPA 4C7OA 1XBTA 1RIFA 2ZJ5A 4AIIA 3QUSA 3EZ9A 1W44A 3F8TA 5FR2A 4PC6A 1XD8A 4BUJA 4YMTA 3KB1A 2QBYB 2QG6A 4URXR 4KYUA 3A37A 3KDSE 1IM2A 4EQ6B 1P7CA 4D26A 1KDOA 3GQBA 4YMVA 3NKVA 4MRPA 2IX3A 5TVKA 4ESVA 2WWFA 3QPUA 4XD7A 3AV0B 4MYHA 1XTRA 1EFRA 1K8RA 3BH6A 4P31A 1SHZA 4F7WA 3I5YA 3H84A 1NMXA 2IUSA 3RNLA 3H4MA 3B1ZA 2REOA 1KZ7B 5JRJA 3DKPA 2PCLA 3KXKA 4PZLA 3IQXA 4NP6A 1W36C 2JLQA 4AK9A 4FW9A 1EFTA 4S2EA 2RGDA 1WF3A 4LYJA 3RWMB 3AVTA 2ANCA 1ZM9A 2IBMA 4B6FA 1Z5ZA 1RVDA 4PHTA 3V9PA 4BPBA 1UEJA 2HT6A 3O8DA 4FIDA 2CE7A 2WAYA 4Q4JB 5FTJA 3WHLA 2CLSA 2F1HA 3QSYA 4DT1B 1TEVA 2NIPA 2GVDC 1OH8A 2XGJA 4C7OB 1L4UA 4RZ3A 1WXQA 4QBHA 3GEHA 5AWFC 3W6NA 3OEHA 4W7SA 1E1QD 3RC3A 4C4PA 1SXJE 3R7WA 4E09A 3PG5A 5H8WA 4OI2A 5FUXA 4HB4A 3A4LA 1LY1A 3GJ8A 1CXZA 2IEZA 4D25A 1E9AA 1XRJA 2FWRA 1ZCAA 1Y63A 3AVVA 3DO6A 1X8KA 3WNBA 3GLIB 1OW3B 4D6PA 3VKGA 121PA 1C9KA 4YXWD 1CEEA 1YR7A 1UAAA 3FB4A 4GMXA 2ERYA 3THYB 4DSNA 3L0OA 1XZQA 4G0NA 4DRZA 1Z0AA 2AFHE 3THXB 2DCUA 5CJPA 1M34E 1W5TA 2VA8A 4O0MA 4Q18A 3PXGA 5SZHB 1ZMXA 1JEDA 1E0KA 2DYKA 4Q47A 2WV9A 3THWA 1MO5A 2ODBA 1FTNA 4Q1DA 4II7A 2EFHB 2IWHA 2D2FA 5D3MB 5KU1A 4HZUA 3VX3A 3OEED 1WCV1 3RS3A 3UWKA 2GZAA 2ZJOA 3LBIA 4KFUA 2VSXA 3EWAA 2HLDA 1CU1A 1LNZA 2PJRA 4B3XA 2OAP1 4MKFA 4IOKA 1DO2A 5DIFA 2QRNA 2IT1A 3P32A 2GWHA 5FI1B 3SYKA 3WBKA 1ELOA 2VH5R 4V0KA 1VHTA 4CEIB 2DWPA 4LJ5A 2IYWA 2QY9A 4GNKA 5P21A 1FW6A 1NN1A 1YJ5A 4GBMA 1WBDA 2JCSA 2O8FB 4DLZA 2Z5FA 1GAJA 4Q1FA 3SE0A 2GNOA 4HI0E 3I4LA 1TADA 1BYUA 4BEBA 4V0OA 1UBEA 1RRCA 1W0JA 5FOSA 5AUNB 4FMCF 4B73A 2RGAA 1VIAA 2RGNA 4QNRA 2ZRNA 1W0KA 3H1TA 3JZMA 1E3MA 5FPKA 1NRJB 4PQYA 2X2FA 2F43B 1SHKA 3NBYC 4NYIR 1KSJA 2F1RA 5BQ5A 1G5PA 4NYJR 4JBYA 4A6PA 1VECA 2R8RA 5CK4A 4GP6A 3JVVA 4EPWA 1XTIA 1ZUNB 4HB0A 3LWNA 4G5OA 2ZYTX 4DCTA 4DIEA 1LS6A 3GJ7A 4URUR 5FOTA 1OFIA 1ZD9A 2HF9A 2W00A 4URZR 4EPVA 2IYVA 3LH5A 2I1VB
chains in the Genus database with same CATH superfamily
2JGDA 3MJCA 1DCFA 2Y1XA 3EBLA 2JBAA 2A0WA 2YWDA 3FBWA 3JVDA 3QEOA 4U7JA 3SS7X 3ZK8A 4C6SA 2NSLA 1YT5A 2JRLA 3U7IA 2X5JO 4L0MA 3EVBA 5TY0A 4QRIA 3T95A 3R7BA 2PIAA 2DKOA 3LK7A 3AVQA 4D8UA 3ONVA 4HKTA 1M8GA 4IZIA 1FP2A 3SC6A 4HDNB 3WL3A 2RBEA 4EUNA 8ATCA 4NATA 3BUSA 1XK7A 3PVSA 5I7VA 3K1ZA 3EVFA 1A8IA 1IPEA 1YCFA 1L5VA 4AZ0A 2XIQA 1BXZA 3CS3A 3AF1A 3GZNA 3AKZA 4ZCMA 1ZA2A 3JPYA 4CEJB 2JKZA 1SIOA 1Z2AA 2VDRB 2YUTA 1X7WB 3MWEA 5EXEA 4GGPA 5ARCA 3ZVNA 3E6AA 2XLCA 3A1EA 1JEOA 1JIVA 1J00A 1JLLB 2QN2A 1G8PA 3HWX1 1D6MA 2TMKA 3R5JA 4IJ5A 4JL5A 5EWJA 2AF4C 2ZE8A 1YZLA 1ISGA 4XOUA 1JQ3A 4AKSA 1WMBA 4Z4FA 4XW2A 4QQ8A 4BLOA 1LFDB 3L84A 3QVMA 3DCYA 3L8GA 4M0LA 3UWDA 4F5EA 4O08A 4E88A 4U4AA 3U17A 2FFBA 1AS0A 3INGA 1N4DA 3KSDO 5C8XA 5LQJA 2Z2IA 2AZXA 3AQIA 3TLJA 4I1PA 4TLEA 3R0XA 3VPXA 5L40A 2OO5A 4WNIA 3VR6H 1T36B 4BWVA 1QTIA 5JSZA 4PGHA 3KALA 1E0SA 4OA8A 3SYMA 4HGYA 1MQ8B 3F3MA 3IAHA 3TRFA 2W2TA 4V02A 4ZOLB 3UJ8A 2X1HA 3GX1A 3GJQA 3U81A 3BJIC 1N9GA 2K5UA 5LQDA 4Z9BA 1AN0A 2JFPA 1X42A 3WX0A 5H7XA 3GRYA 4BLQA 1SK9A 2ATIA 2HY7A 2W2LA 1U1DA 2KJQA 2PD6A 3NT2A 2QXUA 3O2SB 3EVAA 4LOKA 4MR9A 1HI9A 4Q7KA 2H9YA 4NNJA 4OQEA 1BMTA 4IZ6A 1ABFA 5K6AC 5ER6A 2ZJ0A 1KVRA 3ZYCA 1FL9A 2B4QA 2R97A 3PJDA 2WZBA 2WTMA 4M46A 1UK7A 1KZ9A 1G42A 4CEIA 3DLTA 2MMCA 3CVXA 1TKRA 4G97A 4JXZA 3DM5A 2IY9A 4WWHA 1AA6A 1OPXA 2PUAA 2D4HA 4ENUA 3NVAA 4JBGA 1VPTA 4RQBA 2NSYA 1UEIA 3RBZA 3DONA 5A1TA 1XEWX 1Z18A 3U3KA 5JCZA 3FHJA 3PP8A 5C1PA 3PYLA 1FTSA 1HT3A 1OX6A 4OI4A 4R2HA 3S5UA 3BTUA 1XA0A 1I2AA 1W4LA 3AR2A 1GPWB 1HE3A 2OGTA 1QG4A 1KS2A 1HT0A 2H1VA 3QWBA 4G2TA 1R64A 2FFAA 1B6TA 2YXEA 5H4GA 2X8JA 2QA5A 1WEHA 2ECQA 3HGTA 4UU8A 4DMUB 2ZIVB 4IDDA 4DXAA 1Z22A 2HBYA 4WNAA 2B30A 4X1IA 3V4FA 2J45A 4B44A 1SXJC 1N0VC 1U2GA 2JFWA 3DR5A 2BEKA 4L4RA 2H29A 1NI4A 1J0EA 1U8UA 2CW5A 2W93A 4A15A 2WLSA 4QXMA 1B26A 2QF7A 4KW7A 4RMIA 1PU2A 4Y2QA 1TM3E 1M34A 1NTOA 2TSYB 2RGUA 4PNZA 4GF5A 5CDUA 1CJVC 4NABA 2J7PA 3K70C 2GO1A 5HEKA 1H05A 3F8WA 1Q7TA 4FUQA 3CZ5A 4L7VA 5K03A 1GDTA 2JHPA 3LIPA 3TSYA 3CZPA 1L5WA 3CUVA 4PPYA 2CLIB 4O4JB 3NCHA 1YS7A 5CVUA 2IPAB 5AJYA 3F6CA 3TLXA 1SH7A 3RU3A 1BDHA 2EIHA 2IEIA 3AJEA 4US0R 3JRXA 3VC3A 4GLBA 4Z0NA 3C5VA 1NC1A 4X3CA 3DQQA 4GHWA 3S2IA 3ZDDA 4TL9A 1IE3A 2CHEA 1LBTA 5BVGB 4EG7A 3BSSA 5CDGA 5IANA 1THMA 2GAIA 2NUBA 1CRQA 1Y1PA 3TRIA 1SOVA 1EFVB 1GILA 1QZ3A 2GBPA 1O57A 2LZ0A 2WP0A 3ANLA 3IGFA 1MIOA 1T9DA 2Z4TA 1T8SA 2DFTA 1XPUA 2D0DA 1NT4A 5CTJA 5D3KA 4XIYA 2II6A 2GEVA 4CKWA 5HK9A 1N8KA 1IVSA 3ZWYA 2ZRIA 3LVBA 4V1CB 3A32A 1TQ6A 1W4RA 2H3EA 2ZIXB 6ABPA 3IJPA 1F4VA 1LF5A 1WUTA 5LP6F 4B7UA 2DMRA 3TDMA 4WY2A 3AVYA 4NBVA 2C3UA 3IAEA 2ST1A 4Q9LA 2WA2A 3MERA 4DNXA 3KEOA 1NDHA 2ODTX 5A4KA 4BFCA 1F1JA 3O8QB 1T8RA 3R5SA 1YULA 2VAMA 5DTQA 5EE1A 4B3CA 4DWVA 1HKHA 4YUAA 3AP3A 1JA9A 2SKEA 4MVYA 2W2QA 4RXMA 1OTHA 1BVUA 3NUZA 4ML3A 1KSHA 3D0KA 4QYIB 4Y8VA 5DSTA 3SJAA 3T3PB 3WP0A 2G71A 1U98A 2VJMB 1OLOA 5FO1A 1UMCB 2IGBA 1RPTA 3FGNA 5AT1A 3KSAC 4DA6A 4B3FX 5AHOA 1OWLA 4H7IA 2Q3JA 1M2FA 1RPAA 1S3FA 1PJ4A 1SR8A 1LDYA 5CDFE 1C9JA 2GFQA 1IEWA 1M6VA 4R51A 2PUGA 2QQGA 3LTEA 5BYJA 3USES 4BQIA 1ZGBA 1Q16A 2UDPA 2Z2XA 4OGLA 5E3HA 5JOQA 2Q5JA 3MCZA 2W9XA 3SS9X 1G98A 4PQRA 1O95C 1PT8A 1REQA 4PNPA 3GYGA 1DCKA 4LC9A 4FGLA 4Q4JA 3DCNA 2J3IA 3LSYA 3PUWA 4X44A 4TYNA 3KPWA 1XNGA 3FR8A 3GEEA 2GJ9A 3CF6R 1CD5A 2FG6C 1GTMA 3I9JA 4UASA 3H87A 2IHVA 2DPHA 4YO7A 5A3SA 4BLWA 1QIDA 3AX6A 3F46A 3HBAA 3IO3A 3NNSA 4MWCA 5EYPB 5ITSA 3RNOA 4ZHQF 4KTVE 2Z56A 2FN4A 3L6UA 4H7FA 2DKNA 4YPOA 4A2QA 4WK2B 4AUMA 2RJOA 4MO9A 3TOVA 1CZLA 2PSJA 1JNYA 3U7GA 2BTOA 1AXGA 1R0ZA 1YQGA 1GA4A 2O7VA 4WN9A 4NBSA 5C80A 1HM5A 1JSXA 3EC1A 4FZ3A 1Q0TA 1NP3A 3BWYA 4NCNA 2PNJA 4NICA 3R5TA 1F6BA 2IYPA 3AETB 2WF5A 3EYWA 5LDHA 2HNKA 1JN0A 1VKHA 4LJ4A 5JYEA 3D8HA 1EYZA 1QQBA 4WCVA 1EWVA 3DOJA 3MWDA 3NBUA 1UJMA 4LXHA 4YJKA 3VPSA 1YQTA 1NXXA 4XWGA 1QYDA 4ZO8A 2BFDA 4P08A 3NYQA 3G2JA 3NZEA 3PXUA 4NECA 1MUUA 1Y4AE 3TI7A 2NU7A 3KYCA 4RCVA 1UODA 2ZI5A 3QEAZ 4I0WB 4FZJA 4JX8A 4AY4A 4K6OA 4LOIA 1V3UA 2ZSHA 2PBLA 3V8PA 1LBIA 2PXAA 1AE1A 1CIPA 2CEAA 4KQJA 4RVSA 4WINA 4LGMA 4BNWA 3TCNA 4UNIA 3BE6A 2JVKA 4WXYB 4RHTA 4GKAA 1GA6A 5EJMA 2R65A 1R4ZA 4I46A 4C0AC 3F6EX 3CLUC 5FTNA 5E9JA 3I45A 5HFNA 4EMBA 3M49A 3WK6A 1W4ZA 3OOWA 4MDFA 3D2LA 2A35A 4DR3B 4F4HA 2PL1A 2HX1A 3IVRA 4EY8A 4ESHA 4P92A 4QU9A 5EMLA 4R0NA 2YIJA 3OFVA 2G82A 1FFDA 2XUQA 1EAMA 3OZAA 1RLOA 3R6LA 4LDRA 2DQZA 1NQ5A 4U2FA 4DPLA 1KQPA 4MI3A 2Y2UA 1E7QA 3OE7D 1IUKA 5HFAA 2AJLI 4JVOA 3DTNA 2ORYA 5TB5A 2PMWB 2ZRPA 3I5XA 4I4CA 2L0XA 5JD6A 1CLEA 1JT9A 2FWPA 3MTBA 4K6HA 4WKGA 3PNBA 2IE8A 1HDOA 4C0KA 2UVQA 2A5YB 4KVZA 3VPHA 3FKSD 3K6SB 2ZBVA 4JQSA 1PFWA 2ZBGA 4RH1A 2DY0A 1VIYA 1Z8FA 3R8CA 1JDVA 2O7SA 1OH7A 2L17A 1AVTA 1D1PA 2QROA 1ZS9A 5J1SB 4JYMA 2WABA 4R3WA 5EHQA 1VBNA 1OB2A 3BTSA 2VHUA 2VUIB 4RDXA 4D6XA 1ATZA 1ZLYA 3EX7C 2I4LA 4X61A 4FNOA 2YRWA 2O52A 2ISSD 4AECA 4UU7A 3L6BA 1TM5E 1N34B 1LDMA 4R8MA 1I7PA 1SQ0A 1VBMA 2ZWVA 4DJTA 2ZBQA 3NEPX 2IITA 3NYWA 3LDUA 4N47A 3IDQA 4DTCA 5JAMA 4KR6A 1J99A 4MUYA 1GKKA 3U9SA 4OHWA 4IW3B 5KHLB 3KU1A 3NNNA 2IPNA 2LCIA 2MTBA 2C04A 3EIEA 5BT9A 3VMMA 1PJRA 2PVPA 4X60A 1U31A 3VDRA 4A2PA 5A9RA 1L7EA 2ATXA 1N3IA 1BRTA 3H1GA 4YUWA 2ZR0A 4CCYA 1W73A 3QVTA 2BJVA 2JGJA 5E6RA 4BZXA 2OP1A 3OP4A 1DAHA 3TOCA 4I8XA 1ZL0A 4UUMA 2PA0A 4XI9A 5F7JA 1B16A 5KX5B 1S7GA 2OECA 3INYA 5CP8A 3WK5A 1GFIA 1JTEA 4Q4CA 2A1UB 5C81A 2YYZA 4MB6A 4HYYA 1M1YE 4CEJA 3WLIA 3RBXA 1C1XB 2WM9B 5K8UA 1M5RA 3I9KA 2V96A 4EOGA 1V4NA 4WZAA 3J81A 3MTGA 1QH1B 1YOVA 1ZVMA 2XXAB 4KRFA 3IHKA 1LLCA 2GESA 3IBYA 1ORDA 2BEWB 2G04A 1V1MA 1A4IA 3ABOB 5K4AA 4ER3A 2C5SA 2R7KA 1CS0A 4PICA 5AOBA 2VKTA 3MVEA 4B87A 3VU9B 4HDQB 3SNHA 4P9NA 4CKZA 3M3DA 1HT1E 2GK7A 3FUUA 1UT5A 4ZZIA 1XKXA 1C1XA 1QGDA 3CCCA 4HYQA 4QUBA 1RLIA 3WWDA 4GS5A 2C92A 4XWOA 1XRLA 4DM4A 5BWLA 4FNAA 2YOGA 3EHEA 1B8NA 4EBFA 3H7AA 1AKQA 8GPBA 2JA1A 3IV6A 4JQCA 4DYHA 3U3RA 4QM6A 5K5EA 4NL4H 5AW0A 3UCFA 3ZLUA 5FWXB 1OSNA 1V6CA 2ILVA 3MRXA 4KPEC 1K3TA 4NZYA 1C8BA 5FBQB 3L8DA 4B0PA 1NVWQ 4QEDA 3TZEA 4YJGB 2O7NA 5CVDA 4TTRA 1OYWA 2UYGA 3ANSA 3LBHA 5DX0A 4X64B 1YRAA 4K6KA 1PL7A 2QTVA 2R8YA 3N59A 4LVOA 5CFOA 5EFOA 3M4YA 1WIWA 3EA4A 4Y7DA 4BL5A 1A9OA 1QB8A 3HUTA 1MZVA 3BULA 3BSWA 3FTQA 3GMDA 3RS9A 3MT0A 2EKPA 4Q5IA 4BFSA 1WCIB 3DDNA 3RC2A 4DMRA 3K72B 2UVPB 2Q3LA 3M1LA 4MAMA 3QVGB 1NHGA 1TPYA 2C03A 1WXDA 1KEUA 3BPSA 3C7AA 4AFNA 1NNEA 2JFFA 1K2VN 1TK2A 1DHRA 1GLNA 4B84A 3AKDA 2R84A 1FDIA 4YUZA 4DNPA 2DM6A 2A9FA 3QWIA 3B6MA 3GLGB 1EB9A 1XZKA 3DZFA 3ETJA 3M5CA 2MSDB 3AHJA 4J4TA 3QPAA 4NE9A 4BO9A 3VZDA 1SMKA 1ZA1A 3OPYI 1M2OA 1EP2B 2MYNA 4JZKA 1MB4A 4M22A 1TU3A 4J1TC 1A7JA 3MJDA 2IIVA 1VYTA 2QB5A 5FX2A 4CM7A 1WEKA 4PRLA 3AHEA 4AYTA 5C1DA 1IUNA 5AK4A 1CRLA 5CLLA 3LZCA 3HY6A 3R44A 4PFKA 5T8KC 4DILA 4LE2A 5A9SB 2IZ0A 5IF3A 5CNKA 7REQB 2O8CA 2QVGA 2Y9MB 4I1VA 3ZEIA 3TEFA 5FBHA 2P41A 3OIGA 4OFWA 1K66A 3NHLA 2AHOA 2ERXA 2HJHA 3IHTA 5PGMA 1N0WA 1NN3A 3T52A 3BRSA 1QV9A 4XIIA 4MV7A 2VZEA 1NVTA 3EZNA 2J5KA 3L8EA 4YRNA 2HJWA 3AG5A 2KLHA 1RYMA 1WXIA 4U7FA 4CLEA 4DR7B 1UBJS 2ZS8A 1BX0A 1XDSA 3PTAA 2R6DA 1OD6A 5BN5A 1XZDA 1LF0A 1T8PA 2VYNA 1C30B 3HDVA 2OSBA 3CLKA 4AX8A 1JXAA 1EMDA 3B1XA 3F74A 4IY1A 2BCEA 3LUHA 2QT9A 4BFTA 3G2LA 4NDAA 4C7KA 3F5QA 3Q8WA 4IUDS 4O4JA 2H63A 4G23A 1I01A 4BZPA 2Y1EA 1O9GA 2ETVA 4IDPA 3LDAA 4Q3AA 4J0JA 3RJTA 1N6NA 2RB4A 4NBWA 3FNBA 4BO1A 2BZ1A 3C1UA 4J0KA 3KOMA 1JG4A 4HS9A 1YIDA 3RK1A 5AXAA 5NULA 2OHJA 1E59A 4NZOA 3UMSA 3CURA 3OWHA 3BXOA 4LZLA 1D1TA 4ARUA 2Y77A 3PGVA 3RYHA 4M53A 3I2KA 2RKOA 3K2EA 2V7PA 4XSGA 4NARA 5DBEX 4K9NA 2QJFA 2FXIA 2IW3A 1GN9A 4DLYA 2UZAA 4RKWA 1Q7EA 1XMPA 4FHZA 3PX2A 1GCOA 3I5MA 2O8DA 3VNVA 2PLWA 1B1CA 1KI3A 2ZYAA 5D84A 5EP2A 4PYJA 4G1CA 4INOA 4G8CA 3W05A 2PWZA 5AJXA 2AZ4A 2IA5A 3RTDA 4C1BA 1WV0A 3IQDB 2V6FA 1MQ9A 1SB9A 1U3GA 3GK3A 1SVUA 4XGKA 2HF8A 4W1SA 5ETJA 4D4IA 4F9EA 3UMYA 4IDHA 2W6PA 5LKAA 1S1MA 4G3XA 5EWLB 3LQ4A 4HN2A 4FYWA 1EK2A 3G9ZA 4X85A 1NVXQ 3FMPB 4NMHA 1N7IA 2REXB 1DKNA 3SQOA 4ND8A 1W5BA 2K2WA 2D1TA 1FUKA 5F3WB 1KI2A 2QRGA 3Q8MA 1JZTA 4MV1A 4P86A 3ETDA 1FK8A 1FXUA 1XZCA 2JLCA 3EGWA 2DFLA 1ZY2A 4DR6B 4IINA 3QU5A 3TKYA 5TE9A 3RYCA 3Q40A 1P6XA 2ZTMA 2OKGA 3MUFA 4PIVA 5ULLA 2FMHA 3V1MA 4FYPA 1RKBA 3E3MA 5EXTA 1JLHA 2YNMD 4BAUA 3ZWXA 4ZPJA 4E6EA 2ODNA 1A9RA 3OZIA 3R8FA 5EN4A 4IF6A 4B8ZA 1EKXA 2H7VA 3GNLA 3FBGA 5AI5A 1C80A 2VJQA 3OCWA 4H6WA 4J7UA 5KWVA 3JVEA 5CG1A 4Z53A 3K3PA 1ZJ6A 1XA4A 4DSOA 2VC2B 4CETA 2IHNA 5B4UA 5JWHA 4TMXA 3MTJA 1GRVA 3GJTA 4PG6A 3OQJA 1PWYE 3FR7A 4LHVA 5DBIA 5E7QA 3ZKWB 4KUHA 5AKIA 5IM5A 4WI1A 1GY8A 2GHRA 4AT1A 5BMVF 2WA1A 4W5QA 2ZYDA 1DC3A 2BDEA 5AVXA 3FOZA 2XVXA 4DEYA 1I6LA 3JYOA 5GP1A 1EGHA 3PI7A 4IKEA 1O0SA 1UC4B 2OBYA 4GI7A 4LDJA 4PC7A 3MHPA 1U2QA 2XGOA 3RYIB 3A6EA 1C7RA 2CL5A 2EU8A 5G4KB 3T1OA 3U48A 1QH9A 1AO0A 4EI7A 3Q5DA 2B3TA 2D7JA 3WLEA 1IN4A 2PX2A 2H1IA 2X2EA 2YWJA 1JG6A 1NOKA 4NZPA 5ALOA 1W8DA 1XTZA 3HMKA 2BPOA 5B1HA 5JANA 2HW8A 3QW4B 2C77A 4RV5A 1JEYB 2ZIAA 6GPBA 4CRWB 3SY8A 1L4YA 1PTKA 1YSCA 3L7IA 1V7ZA 2I55A 2J3JA 4FI3F 4UEQA 2QE7D 1II8A 3RAPR 4F21A 3I2IA 2EQBA 3A1CA 1C4OA 3BMCB 1RLJA 1CLUA 3GWZA 4FGWA 1C3OB 4XASA 4RVOA 1J22A 5F77A 4AURA 2AJDA 2PRZA 1EDEA 2YY6A 3BCHA 2YWEA 4BDTA 1JBEA 4NFHA 1YL6A 1ZOPA 3LQQA 1I7DA 4LF8B 2YBDA 2ZJBA 3P27A 4KGVA 1NXOA 4GWGA 5D2CA 1JPJA 4NV0A 5CXXA 2KPOA 2PRIA 2IL1A 1LTQA 3HA7A 3L49A 2G83A 5CFPA 4ESEA 1E1QA 1K98A 5A6VA 3BIOA 4Q1CA 1R6DA 1ENYA 5DM4A 1KOJA 4O2AF 3NP7A 2OBFA 5JXIA 5CPFA 1SG9A 2J5QA 3VV2A 1AURA 1LDEA 3VFDA 2BE9A 2H2DA 4EBBA 3K6SA 4JYBA 3GLIE 3PIRA 5E8RA 2XECA 1ZBDA 1OWNA 4U8GA 3PNQA 3L4JA 4ZZ0A 3NP9A 4M1WA 3UFXA 3H9UA 2FEMA 1VHDA 4QTUB 2AFIA 4LZAA 2Y1LA 3CNOA 3SSAA 1YB5A 1RNLA 1OBCA 3ETNA 1WPQA 4CIBA 2G1KA 2VT2A 4W8OA 2Q1XA 4AY3A 1XQXA 1JS1X 1QIIA 1U6IA 3ITDA 3K1TA 4OBXA 5M3BA 3UM9A 3IP3A 1E1KA 1IM5A 5GONF 3ET4A 2HA3A 2R6HA 1HFEL 3CX6A 4U2BA 3THYA 1EX1A 1AN9A 1L7BA 1SZDA 2AKYA 2BGNA 2I3BA 2IELA 5EESA 2JLAA 1Y4UA 3B38A 5CXUA 4K6CA 5M2QA 1KSFX 3FYUB 5AUOB 4YCAA 1A7KA 1LSSA 2JCYA 2XMPA 4PC1A 3WGVA 1Y1RA 1Z5VA 2QN9A 4JCOA 3UF0A 5HW0A 1UP7A 3L9XA 1K8ZB 3T1QA 1S3SA 1CRZA 1QGOA 3DMYA 1MC4A 1UPAA 3B6EA 3PEVA 5HRCA 1YRBA 1V2HE 1CE8B 3B9BA 1VKRA 4O4IF 1LPSA 1VFPA 1UKAA 3Q0IA 4G5HA 5EG5A 5FYQA 2XYVA 3MQ2A 4UNPA 3O5AA 4A0QA 2IH4A 1GG2A 3V7UA 4RHFA 3D4BA 1QHFA 2QJOA 2I6QA 1Q20A 2VTDA 1CUZA 5HJ2A 5C31A 2D1YA 2P9QA 2D1QA 4DLWA 3O0DA 1CB0A 2B7LA 3FLAA 3UT5B 1U5AA 1RE1A 1RP1A 4BNJA 4L3WA 1TQ2A 5DM60 4EL5A 5FUQA 1U8AA 3ORQA 3IVCA 3T7AA 1VL1A 4Z9XA 3ZY5A 5CNJA 5D7BA 3J7TA 1A4XA 3SF8B 3E84A 4M4SA 3ONDA 2VNJA 4E5SA 3OZEA 1U94A 1R6TA 4WLEA 2O54A 4D9EA 1BX3A 3O8LA 4OX9B 1G19A 3AH8A 1G8MA 1T9BA 1NM5C 3HR7A 2QX6A 3T4XA 1E7WA 3IH5A 4Y2SA 5I45A 3H9QA 5JE8A 1UBOS 1Q7GA 3Q88A 2G09A 3GIWA 4GR5A 5DBOA 3R7FA 4BGEA 1QFJA 3MWJA 2V4UA 2OC4A 2JA2A 1RWQA 3GBPA 3MJTA 3N0VA 4OHZA 3M5DA 3T15A 3W2TA 5AVZA 2I29A 3UB4A 2OCKA 2VO1A 3O26A 9ATCA 2AR7A 2XQVA 3K9HA 4I36A 3WXBA 4UHCA 3QVGA 1UKZA 2VP4A 1MPTA 1GV1A 2QVXX 4HDOB 4BZZA 1E5LA 3V2GA 2JI6A 4QXPA 4UFOA 5LLDA 2OB2A 1CR1A 2X5XA 3OJXA 2OCIA 2XEXA 1G7CA 4L0QA 3KOWA 1T35A 1QIJA 4HAUA 3BVPA 4J76A 1D6SA 3D0OA 3MJFA 3N05A 3IERA 5I4IA 2BM1A 4WZBA 2E1RA 4F9TA 1KK0A 3WV5A 2C5HA 4J2TA 6YASA 4YPVA 1RI2A 5I9SA 4HVAA 1CFZA 4KI7A 2RJ3A 4Q24A 4NYJQ 2DUNA 2AC2A 4LUCA 1HYQA 1VDZA 4MYTA 3RV3A 1OROA 4YCLA 1P4AA 2BFCB 3MG9A 1D2MA 5JFOA 1KFKB 2O0LA 2ZIWB 3G6KA 5H9VA 1B7GO 1S3GA 1NUQA 1TQDA 1RJFA 1TK3A 1ZMBA 4UVDA 4YALA 1AHHA 3PFIA 3UMMA 2A92A 1AO3A 4I08A 4KSCA 2HSZA 2HTFA 4ZV7A 3ZN2A 4YHHB 4PRYA 4LF7B 2JGLA 4KNYA 1EXDA 4V0QA 2WHEA 1JG7A 4KLRA 3RDPA 4BWGA 2GEBA 2XWSA 1VPEA 3OF2A 1PW7A 4GOXA 2OAQ1 2VQSA 2HDWA 1DAIA 1ESMA 1VMKA 3HADA 2ZDGA 4K28A 2REBA 1M2EA 3GMIA 3OAAD 4M1ZA 5ENDA 3VPBA 2C2GA 1F8UA 3HCAA 1YBAA 5EKSA 2IDZA 3AUTA 3L41A 1LPAB 2R1VB 2MWMA 2XUKA 2G3YA 1J5XA 4FFNA 4JIMA 3KBBA 5DTMA 2B82A 1D6JA 5C8YF 2MSLA 2CV1A 4DVGA 2OXIA 3RO7A 4HUQB 1T0HB 1XKLA 2FP4A 1NKSA 1YOBA 1E61A 3AHDA 4H4EA 4C88A 5FWNA 3B7GA 4FB5A 1HX7A 3BF8A 2E6UX 4B45A 3W4IA 5KSYA 4CF6A 3E4CA 5JNVA 3G2MA 3I9LA 3RSGA 1H9AA 3UCXA 1C50A 3KXDA 3NTVA 4K6MA 4ZAGA 3SXPA 2IXEA 1DQNA 2P5UA 3UYKA 1H0KA 1S4MA 1AUXA 1IIRA 3CZ4A 3G1UA 2C99A 3LOUA 3N86A 1EINA 4MIKA 2EG9A 4N82A 4TTPA 5CDYA 3MUNA 2CXQA 3M3HA 1Q44A 5CVVA 1INLA 5CJJA 4P83A 1DRVA 2JFXA 2P62A 1J7KA 4LWPA 1H0SA 3ORFA 3ZG6A 2WBLC 1AZLA 4I9HA 4LFBB 3B2EA 4B83A 4YJ2B 4BS9A 4J4BA 5M7EA 4CLOB 2B99A 4RU1A 4KIUA 1P73A 3L0CA 3REQA 3ZHYA 2W0SA 1PLKA 3SF0A 5JPCA 1NJ6A 2Q0SA 3A4NA 2P11A 4NLLA 4EATA 5BPFA 4DXDA 4NFYA 2YN2A 2NZUG 3VOTA 1I6MA 5JCPA 5IDQA 3K0SA 1QQ5A 2WUEA 4DMGA 1F7VA 1HZZC 4AI6A 1J07A 5FNZA 3AEZA 1X15A 2H2HA 3DFMA 4DUPA 4OB6A 1LH0A 3EUWA 3VYUB 4OHPA 2FOIA 4NTZA 3RREA 4DC1A 2BCJQ 4DF3A 2B7CA 1Y42X 4B8YA 3V8NA 3IT3A 2QX9A 1DEOA 2HGSA 2ZYHA 4ZQCB 2ZJ2A 2HXYA 2WJWA 5F4BA 3WQSB 2IPLA 4DLLA 4N5NA 1SXQA 4B6JA 1S8FA 2VCYA 1F2UA 2OCDA 3E70C 2P9GA 4KNVA 5KTOA 5CH8A 1KWKA 2GRUA 4A8JC 1PFYA 3L0SA 1TD9A 2NYAA 4G1MB 2EJWA 2XQJA 3O1HB 2VK8A 1W96A 2BGTA 1DG1G 3CB4A 4H15A 4QOSA 1ZUD1 4LCJA 1LWNA 2AEFA 4TV9F 2W8BB 2H07A 3B6KA 2VHCA 3PJFA 2R0QC 5DXAA 4FMPA 2QZZA 4C7VA 4XPIA 3H0KA 3A9UA 2G9QA 2NU7B 2Z83A 4E1VA 4EUEA 3ET5A 2P6PA 4ZKDA 3ZHVA 4PGGA 4BYMA 4LXGA 4FINA 1Z2NX 5D5QA 4BNMA 4WOBA 5BR1A 5KYTA 3G2KA 1FQWA 1PLJA 2IYQA 1ETUA 4KE9A 1B6RA 5G0SA 2QD1A 4QBTA 1E2FA 1G21A 1MNAA 2Q0XA 4B75A 4EG3A 3VVMA 1QP7A 4ZICA 3KTAB 2VPYA 4LV8B 3CM0A 4WBNA 2IK8A 2FG5A 1PLLA 1U1CA 4W63A 3NM4A 1K5DA 1RHUA 1Y37A 1A9PA 2QTNA 3IUQA 2F9LA 2F3RA 2PZFA 2Q4TA 2RGXA 3LU1A 5B7GA 4EG5A 1JPNA 5EXSA 2DQYA 3O94A 4NR0A 3RWBA 3ZH9B 3RGGA 3I28A 2QL9A 3GELA 4Q48A 4UDOA 3SD7A 3AHIA 4GZMA 5AW4A 1OB5A 1TE2A 3BMCA 3UZUA 1RZ3A 4KN8A 1A76A 4HEJA 5SZKB 1MVNA 3NHAA 3S68A 1E1RA 3JXEA 1ISMA 1T2UA 5U1PA 3VU9A 3I30X 1GCAA 4KZPA 2V1UA 4YY3B 3EIXA 1K27A 1H85A 3U09A 5B1EA 2VHZA 2PWAA 2VDNB 4J0CA 3DE6X 4OSEA 4PYMA 2AX4A 1SOWA 1Y9ZA 3N70A 1MVLA 1QORA 3IP8A 5ALSA 2D1FA 4P3XA 3O4HA 3T3DA 2ZRGA 3LCMA 3MGAA 3QEBZ 5HGJA 4NBLA 3E7WA 1S2MA 2J87A 2GMWA 3QOFA 5JDCC 2P8JA 2NW6A 1FUIA 1MU0A 4B0OA 1ZNZA 4PG7A 3O0TA 4QWWA 5THQA 4E07A 3SXUA 3O3NB 4W5WA 1GTVA 3GP3A 1TTHA 3F6BX 4ZHQA 1F1BA 2V45A 4B6GA 4MCJA 1ODTC 1Z88A 3C5WP 2HCJB 1UBLS 2OQIA 1ZN2A 3JW8A 3KT8A 4BB6A 4DV3B 1R5NA 3L4BA 4EKDA 1HNZB 1U7PA 4FSDA 2HFJA 1FC0A 4I8IA 3Q7SA 1KS9A 3RC9A 1O94A 4OHXA 1V35A 1XDWA 2JBAB 2SNIE 3FOAA 1G55A 3FPHA 2B7BA 4Y18A 5IVDA 4GOND 5F2NA 3S40A 4O4HB 4PYOA 4K3UA 3WMFA 4ZOQI 1SG6A 2QTAA 3RC8A 2VFAA 3IMGA 4XQCA 3I6BA 2FR8A 4KLNA 2QPLA 4BJ6A 1BTOA 1EZ1A 4H6PA 2MSKA 2FF7A 3KO8A 2EATA 4HN4B 4QU0A 4TGLA 1XE3A 2OB1A 3IA7A 1DDGA 4V03A 2BMJA 1QIGA 5KNDA 1JR6A 1E3DA 3KAQA 2FEXA 2O2HA 2V98A 4FFOA 3IBFA 3ZLJA 3PQ6A 1R3DA 2Q49A 3DV0A 3N39C 3QQ5A 2CBXA 3AERB 1PJCA 3W5IA 3EH1A 4DY4A 4KVGA 4D0GA 1V95A 2J9FB 3GGOA 4MJLA 4BRUA 3UJNA 1ZGJA 3ESQA 1GTJ1 4KO4S 3C3EA 5E4JA 1I5EA 2O1WA 1OZAA 4FNGA 5FH9A 4IQGA 2I2BA 4ETWA 1MHTA 1EFCA 4CKCB 1Z7GA 4B3BA 3VKUA 3CWCA 1H9CA 5FBWB 4OOEA 3L2OB 1RAIA 2IUTA 1RABA 4YC7A 1AZWA 4HQ6A 1KJ9A 1OIXA 3OJEA 1U8FO 5HTOA 3SX2A 3NV7A 4PZAA 4I4NA 3GVCA 3WWCA 2BZSA 4Z3KA 3NH6A 1Z5OA 4LS3A 1WDTA 4K81B 4QLAA 3ROKA 4GOOD 4CZ2A 4D7AA 3GJYA 3GP5A 4TV9A 2ECPA 3E03A 1PJSA 1NGSA 1RAAA 5L8VA 1IQRA 2WAXA 4MRNA 1P0FA 1DQYA 1IPFA 3QPBA 3A7EA 1UBHS 2ZT7A 3C7TA 1I13A 4BBAA 4S3MA 4OXRA 3AFIA 3LPAA 4BEWA 4H77A 4EI2A 4DCMA 3IELA 1QQAA 2LWIA 2C3MA 1XTUA 1TLTA 4TV9B 1PJBA 5C3UA 2HU8A 2XZTA 4HNSA 1PNOA 3AJRA 4P3YA 2WTNA 1JQBA 4M54A 3W8DA 1P2VA 2J33A 4LDNA 4MWTA 3RIHA 4BDSA 3O8OB 4B2IA 4KFTA 3R7DA 1U9YA 3SC4A 1H8HD 3JWEA 4QNNA 3SPXA 3P9RA 2V6MA 3JQCA 3NNDA 4RV9A 4BJ3A 1PR5A 4J29A 5G1NA 2FP3A 1NNUA 2CCKA 3X1JA 2P65A 5AI9A 5DWVA 1N8NA 1OTXA 4LAFA 3UAOA 2YVQA 1HEYA 2J3HA 2QSJA 3SVLA 3IPAA 1XXHA 3JAMA 1W1UA 2ECOA 4D98A 3EW7A 4BY9E 2L18A 3DZDA 3UWSA 1VL8A 4CTJA 1RP7A 1AKYA 1ICIA 4HGNA 3LL4A 3Q0EA 3VO9A 4TMZA 1QBGA 2EEZA 1YQXA 4RFSB 3THSA 4DLTA 4JJ7A 4US1R 4F6CA 1KEVA 1Z0SA 4RZSA 1LSUA 3OKAA 2GT1A 1X3LA 1PFGA 1WXXA 1YJXA 1YRYE 3EFOA 4JDPA 2OCAA 4MW0A 1WVMA 3AXSA 1WMEA 1AKRA 1PFVA 2ADFA 3Q6IA 5K7SA 2EFCB 4NXNB 4D74A 1JHAA 1OX5A 4RA6A 2AN1A 2EHDA 2DHEA 4BEVA 1VM6A 3EQ7A 3Q7TA 5CITA 1JXMA 5KTPA 3BIXA 2Q2VA 5CGQB 5HUQA 3O3OB 2O8EB 1T9CA 1N1GA 1A2OA 3KTDA 1M2OB 4N3NA 4TWJA 5DE3A 3MNFA 3UY4A 3NRCA 3ZGZA 3E5RA 3RS0A 3CRMA 4YDQA 2WD9A 3QELB 5AIAA 4LY3A 5E6UA 4BXOB 2A7QA 4GI3A 2ZAYA 2UXCB 3G59A 3CTMA 4XQ0A 2YC4C 4HH0A 3A7DA 1EVKA 1UM9B 4NJOA 1UWKA 4TV8B 3SZ3A 4AO8A 1Z6AA 2D06A 2ZR9A 1JBKA 1QHIA 5LP6C 4A8PA 1L5HB 1NBMA 3A06A 1QIEA 1P60A 2JAHA 3CRW1 2QTHA 3ZU2A 4C2TA 1H1TA 1SC3A 4LOHA 3UIEA 1Y4SA 3JARB 1QVZA 1P39A 1TLLA 1CUXA 3ROTA 5BOSA 4X1YA 4QBIA 3GARA 4EJ6A 3A3NA 4XM0A 2FB9A 2XGGA 3GU3A 1ZQ1A 4TLMB 4X54A 4ZVUA 2ZIXA 3CW2A 2XYPA 4N6OA 3BILA 1GWNA 2ZWIA 3HEMA 1Z6GA 4Z9YA 3RU7A 10MHA 1VSVA 4LI0A 4EO7A 5TXGA 3VZSA 1V3VA 4QECA 3HE3A 1U0RA 3LWBA 3W0LB 1OBHA 4P5DA 3VTKA 1U0LA 1EM8A 3WRVA 4C3OB 1Y1LA 2KHZA 3FVTA 2JJ2D 2XCIA 4MMYB 4Q0MA 3A9CA 2GK4A 5LOVF 3BD7A 4YLYA 1CNEA 5IUJC 3U61B 3ZWOA 4CLRA 4IV8A 3VSCA 1VMDA 6AT1A 4U9HS 2OA0A 1JKXA 5J3JA 4P0TA 4LHYA 1ZC3A 3OX1A 3ZHZA 5TJHA 2IE0A 3UMRA 3BIWA 3ZGNA 2ZWAA 1J6UA 4DV0B 3ZWPA 4D4HA 2C5LA 2JL1A 2AEEA 2ZP1A 1YBFA 1W2HA 1LFAA 1QGAA 1YJ8A 5KJ1A 2G4LA 4LG1A 2GTPA 3JZDA 3T0FA 2RARA 1RRFA 1X94A 4RVUA 3PLAE 2FMUA 3L5KA 5GOZA 1TFRA 2XMGA 1GEGA 1SCAA 3KQPA 5K3OA 2HWKA 4KUEA 3E1KA 4IOLA 2YW9A 5AKGA 4N7BA 2AW5A 3AB8A 4CEHB 2OFWA 3IVGA 4MWZA 4MKHA 5DLQC 1EDBA 1N6KA 1NUSA 1UC5B 1Y7PA 3CBGA 5JAQA 1JJBA 3I0MA 1NWHA 2OZEA 2Y4OA 1RFGE 1NYQA 5ALPA 3I5UA 1SO8A 5DGTA 4GSLA 1WW2A 4I9GA 4TUYA 3GO4A 2IH2A 4XLLA 2AS0A 5DTRA 3WB9A 3GNQA 2EG5A 3I0NA 2I22A 3C6MA 5JU6A 1TCUA 4QD3A 3RCBA 4HRVA 4F84A 1N0HA 4JWKA 1LEHA 3INTA 1FNBA 1QO9A 1DAKA 5BRNA 5ALVA 3KVNA 2DJ5A