4POAA

Mycobacterium tuberculosis reca glycerol bound low temperature structure iic-bn
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
327
structure length
309
Chain Sequence
b'TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 89
structure length 309
sequence length 327
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4poaA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4poaA01
2ZI5A 1IOZA 3S1AB 1W2HA 3ND9A 2ZAOA 2ZJ5A 4ASUD 1QRAA 4M1YA 5JHHB 5KUTA 1UADA 2OBLA 1QHHB 1XTRA 2ZRKA 1OV4A 2ERYA 5IDVA 3UANA 4JT4A 1KNQA 2ASEA 1NVVQ 3BBPA 4XH9B 3T61A 1ANKA 1GDDA 2ZU0C 2QUZA 2OM2A 3U60B 2ZYWX 3MSXA 4TSFD 2ZRGA 2BKEA 1DG3A 2AN9A 4M1TA 5JI3E 1IJFA 1WRBA 3FMFA 4PANA 4HLCA 2P6RA 4RD0A 3RLFA 4A6XA 4DLVA 1P9WA 5JI2E 4TTPA 4RD1A 4PHFA 2DWQA 1IXSB 2ORVA 2OBMA 1E2MA 2WIAA 4JLAA 3CW2A 5JJKA 1P2VA 2D2FA 3P32A 1T4GA 2R6AA 4AURA 3Q85A 5J4KA 4ASUA 3OF5A 2FJUA 1XWIA 5FOSA 3MWJA 1YHNA 3GD7A 4EKDA 3EASA 4DLTA 5LBIA 4O0MA 1EK0A 4PHHA 4MKFA 3DHWC 1NSFA 1KOFA 4Q4LA 4JYBA 1CJMA 1ZC4A 1IJEA 3DKPA 1R8SA 1Z28A 1II8A 1NBMD 4TSFA 5DI3A 3QF4A 4NCHA 5G3ZA 5DSZA 4O3MA 3CRQA 3DDCA 3AKDA 3E1SA 4TMKA 3TAHA 2CVHA 2QPOA 1V5WA 3I72A 2O8FA 1UM8A 3PUZA 2G88A 3PCRB 4P32A 3GP8A 2H1LA 2G3YA 2X77A 3VKHA 3EWSA 3HU1A 3TMKA 2B7BA 3AKCA 3AF1A 3SHWA 1SGWA 1D2NA 2UZIR 4E07A 5B57C 2HCJB 4PC2A 4L5BA 3ZIAD 2V1XA 2BMEA 5DO9A 2JLRA 3LD9A 1KK1A 1DVRA 1Z2CA 3QXHA 4OHYA 4QM6A 1NBMA 4AKIA 2R44A 4TLAA 2ZRAA 5EZ6B 2OHFA 1QVRA 5CIWA 1FP6A 5GJCA 2PJRA 3JVVA 1P62B 3A1VA 1WQ1R 3BH0A 4Q9IA 4PC7A 2ORIA 4TYQA 3GJXC 2ZVQX 2UKDA 1TMKA 1YZLA 4BUJA 3VKWA 1NP6A 1KIMA 2Q9AA 1R6BX 4M9SA 3UK6A 1UKEA 2AFIE 3TQFA 4M9XA 4PPNA 2ZVPX 4KLNA 1TUIA 1NIJA 1HA3A 1HT2E 4D82A 4C0BA 2WZQA 3ZIAA 1TADA 5CB8A 1O3YA 3TUIC 4C0LA 1E0JA 3CB4A 4HLUA 2DFNA 5FL3A 5KPDA 3TQCA 3SFZA 2F9MA 2WM9B 1ZM9A 4Q1EA 4UNNA 4L4UA 1G19A 4Q7KA 1E9DA 3QENA 3AVOA 2WJVA 2ZTSA 3AF3A 4OHXA 4TTQA 1L8QA 3OZXA 3T5GA 4B2IA 1GP2A 4QL3A 5EUQB 1EX7A 4Q7LA 5FBRB 2VHTA 1SXJC 3DVLA 4E03A 4GZMA 4FI3C 2A30A 4IDPA 1CR4A 3SU8A 4DEXA 3AVWA 2OEPA 1P9RA 1UBEA 3T06B 3AB3A 1E9SA 3CNLA 5L3SA 2WMNB 4PC1A 1TQ6A 4BLTA 4DCTA 3IEVA 2Z4SA 1GKYA 3WRYC 4P31A 1FFHA 1II8B 1L4UA 3CWZA 1E2PA 4LV5B 2CLSA 3QF4B 4TQ9A 5DGXA 2WJHA 4NPHA 4GOKA 5DI3B 3SR0A 1VCIA 4FXPA 1S9DA 1P5ZB 2VA8A 1KY2A 5HR5A 1JBKA 1D5CA 1UBCA 4C0JA 4QHTA 3ZQJA 4DKXA 2CMKA 2EQBA 3FKSD 1S1MA 1XEWX 4IVQA 3RDPA 1HUQA 4RZ3A 2WWGA 3FPAA 4R98A 1R5NA 1KDPA 1E0SA 2Z43A 3C5CA 4I1SA 3T15A 3W6PA 1XB2A 2GETA 1N6LA 1EGAA 5ELXA 2A5GA 1KDTA 1W36D 8OHMA 1R4AA 2YC2C 2CBZA 3K8YA 1K5GA 4N0EA 4CEHA 1KMHA 3VX4A 3M6AA 3T1QA 3U3RA 3CONA 5G41A 3WYFA 1CJTC 4HLUC 1V43A 1FNMA 3L0IB 3MAAC 4WAUA 2W00A 2HCBA 3AF0A 4XWOA 4TL7A 2WAYA 2FX3A 3ADDA 1Q12A 4RKFA 4O2RA 4LPSA 2NPIA 4DSUA 3FKSA 4NYIQ 2H18A 4OHWA 2QTVB 3OIUA 4QFMA 3THYA 3OIVA 4YLGA 2CVFA 3CIOA 1W4RA 3FGNA 3BWDD 2OCYC 3MMPA 3KKMA 4TYNA 5FOXA 3PUXA 4II7A 3X1ZA 3GJ4A 2ZJAA 4Q9HA 1E2KA 4Q02A 1XTQA 2WWIA 1JJ7A 2NIPA 1E9EA 4JVSB 1OB2A 4PR0A 4XVQA 4OL0A 2WWXA 3FWYA 5AR1A 1ZIPA 1HURA 2IA5A 4G0NA 3AUXA 3TW4A 2A5FA 4NCIA 2FSFA 2BMJA 2BEKA 4MYCA 2QTFA 2ERXA 2HT6A 3TE6A 5BYKA 2RHMA 4Z8XA 3LFUA 2XB4A 3FKQA 4FWTA 5DI9A 2H5EA 2YZ2A 3D3QA 4CF7A 4NH0A 2DWPA 1S3GA 1SVIA 2YOGA 2DY1A 2VHUA 1VMAA 1G5TA 2WVJA 1K8RA 4A0RA 5JEEA 1Z3IX 5EXXA 1YZUA 3EX7C 3IGFA 5GJBA 4GRAA 2N42A 2PCJA 2XZOA 1U8AA 1Q44A 4Q01A 2H57A 4G3XA 5L3SB 4BLSA 1T3SA 1ZD9A 3NTUA 2ZETA 3M1IA 5JHGB 1II0A 1NN3A 3NXSA 1G3QA 5G53C 3B1YA 3VHLB 4R2HA 4PAQA 3M0EA 1GKIA 2Z83A 4PQRA 1XZPA 1VHTA 4CT5A 1QZXA 1FPMA 1MKYA 2PH1A 3P26A 4EPVA 1ZNXA 4M2LA 2EWWA 5KHOC 2GCPA 3DOEA 4UJ3A 1LV7A 3ZZTA 4KLZA 4OK5A 4EUNA 1G7CA 4KFUA 2VSXA 3BJIC 1X3SA 3B1ZA 1YZGA 2V9PA 3AUYA 1JQLB 1GFIA 3QNUA 2IYYA 2Z4RA 4JVMA 4MGIR 2ZROA 3ASYA 4LHZA 1XTJA 3CNNA 1M7GA 4WIAA 1XTKA 2JCSA 1NF3A 4GL2A 1A1VA 2V6IA 4QBIA 1CR1A 3TUZC 1E9RA 3PEWA 1SKQA 3LLMA 4PSAA 3PEYA 1G3IA 4OQMA 2REOA 3EZ7A 1P4SA 3SNHA 4BLRA 1TEXA 4OK3A 1B0UA 4LRWA 4V03A 4LJ5A 4QG7A 4QJ4A 5DYIA 4TLDA 3PXGA 1Z0DA 1H8HD 2ZYUX 4TTRA 5TV2A 4AWXA 3AVTA 4OBEA 2I3BA 3O47A 1RFLA 1WA5A 3AV0B 2VIIA 5H68A 5JSZA 3GLHE 4A15A 2NGRA 2QSYA 2ZSAA 2FFHA 4Q4HA 2BM0A 3BFKA 1W36B 2HJGA 2ZRDA 3OAAD 1F2UA 4KFSA 1UBGA 3K9GA 1BYIA 1KI6A 3I3SR 1OKKD 4JKIA 4MGZR 3CPEA 5EXSA 2ZR9A 4MRNA 4D4LA 2FZLA 2IT1A 2LKDA 4HUTA 1E79D 5LDDC 2GRJA 1RRPA 5FI0B 4RVCA 1F5NA 4CIDA 3TJZA 1DAKA 2IEYA 1CLUA 1NVVR 1H8HA 1ZC3A 2EU8A 3CH4B 3LLUA 2GXAA 4C2TA 5DLQC 5EUMA 1M1YE 5KDDA 3LAWA 5UKDA 1G3UA 4CEIA 1T0JB 2BMDA 1E0AA 5FBWB 3CX6A 3W34A 4LSGA 4K81B 4TMTA 1U9IC 4LBVA 2W2TA 3OAAA 4GOJA 4IXMA 4CYMA 5AJXA 3THXA 3MWLA 1OIXA 1OKKA 3VU9B 5DH9A 1X8JA 2C77A 1Q21A 4JYCA 1FNNA 4X8MA 5L8VA 2XZPA 2YV5A 3E70C 2KI5A 1WBDA 1E79A 2D62A 5IRCD 3LO5A 2ZI3A 2V7QD 1FW6A 3WMFA 3B7GA 3ZQ6A 4YDHB 5JECA 3I5YA 1IY2A 1VG1A 5JJLA 3ASZA 4RSGA 1YVDA 5JS7A 5M04A 4HDCA 2XGJA 3WBJA 1ONBA 3PUWA 3BS4A 2GK6A 4QGGA 2JLYA 1DAMA 1SHKA 1KMQA 2J1LA 3RRYA 4D80A 3KXLA 3EZ2A 1HEIA 2FEMA 3QY0A 3X1XA 3B1VA 3ZD6A 2XAUA 2W0MA 2ZUBA 3OFND 1CF4A 1BKDR 5SZHB 2XJ4A 5FH9A 2IK8A 1J7KA 1AZSC 4OHZA 1DOAA 3TH5A 5G3YA 1E1RD 1SKYE 2RAPA 4LUCA 2ZANA 3W5JA 1NSTA 4TLCA 2V7QA 4O25A 2FSGA 5TXGA 2V3CC 1MO4A 3TSOA 3QKSA 4FMBB 3ADBA 4TWZA 4UXHA 2NZ8A 2ZYTX 5JSZB 1S0UA 4KAXA 2PLFA 4Q4HB 1MV5A 5FR2A 5K8TA 2DFTA 1T3LA 5KSPA 3NDPA 2C9YA 1F2UB 3TBKA 1KI6B 4Q1FA 4M1SA 3CWQA 4XIGS 3KZ1E 1XPOA 1OXUA 5J4HA 4FINA 3OFNA 2F1IA 1W5TA 1XDBA 2J5XA 4Q9LA 4Z8YA 5DE3A 4OK6A 3W90A 4DB4A 2NG1A 1GTVA 4PPQA 2H17A 1E1RA 3ZH9B 4Q5IA 4YC7A 1M74A 4NCKA 4JVLA 3AP2A 4DLYA 4B35A 3QXSA 4DIEA 1W7AA 2ZI7A 1Z6TA 3Q72A 2A5JA 4IOLA 4CEIB 4NBSA 3CR8A 4US0R 1NMXA 1E98A 3ZVLA 4FWIB 3CKLA 2AL7A 5AUOB 1TU4A 3THXB 4KI0A 5EE9A 2R65A 1GSIA 2DWOA 1DAEA 1XTIA 4IW3B 3TUJC 1VCNA 3AH8A 2NTYC 4Q48A 4M21A 3ZDQA 1YJ5A 1G5RA 5KNDA 1G16A 4JLKA 1KSJA 1MABA 1CKEA 3C5HA 4HLDA 4M4SA 2WSMA 2EWVA 3GFPA 3Q7PA 2PMKA 1WF3A 2EW1A 1FX0A 2P0EA 1SVWA 3K9NA 3SHFA 1KK2A 3D31A 3QVUA 4BLPA 1AZTA 2FFAA 2ZPTX 5J5CA 3CZQA 1CU1A 2J45A 4XVUA 2KE5A 2JIZD 2JLQA 4NCJA 2D74A 1Q3HA 4F4CA 4ZIRA 4LJYA 1KO8A 1Z0IA 3FFAA 4KHZA 2RGNA 2FPLA 1RRCA 3WMGA 4D4MA 4W7SA 2IS4A 5KNBA 4G5SA 2I1QA 4QNMA 4UQOA 4A8JA 2VPPA 3MLEA 3NBFA 1E2NA 1J8MF 1TPZA 2P5TB 3IEUA 1G7SA 2ZSBA 4GBMA 4JJKA 4FN5A 4QRHA 2OV2A 5C46F 1P2TA 2QPAA 2VP5A 2YWHA 4JSTA 2FPMA 4ZCLA 3F3YA 2EYQA 4B3FX 2QNRA 4IRUB 2J59A 3WP0A 3PIRA 4PQYA 1WBBA 1X6VA 3HYTA 3BB3A 1Z6AA 3VR1A 3CRW1 5J4VA 1BH2A 2KJQA 1M7BA 4C0SA 3QKSB 4UXIA 1XZQA 1RC8A 2WJGA 2JIZA 3OIWA 4A2QA 2R6DA 2DB3A 1ZM2A 5GJVC 4PFSA 5KDLA 5LD2C 2G1KA 3E2IA 5LB4A 1EFCA 4MRPA 5KU1A 1G8YA 1KJYA 2ONKA 2BV3A 2X2EA 3CF0A 1XEWY 1MO5A 1AA3A 1TU3A 4QOSA 3WHLA 3KQHA 3RC8A 4LJAA 1E0KA 3B60A 2OUKA 2AD1A 1OYWA 1NIPA 2P6UA 5HPYB 4NYIR 3KUDA 1ZUIA 4PHGA 1NN1A 1D2EA 2QRZA 2FDCA 4TYPA 2RMKA 1NVXQ 1JR6A 2PZEA 2IUTA 2Q9CA 2XSZD 1Z29A 2JLUA 1R5OA 2HYDA 3QXXA 2QM8A 1T91A 5C4GB 4P4UA 3BERA 4C0AC 1OYYA 3SEAA 2RCNA 2OXRA 1F48A 4MQBA 3IBGA 2DYKA 3BIFA 4R2IA 2WJJA 1E2HA 3QE0A 2AK2A 3SJBA 3IBYA 2VHCA 1XJCA 5EJEA 2ECKA 2QT0A 2UVQA 3P4YA 5KSYA 1E94E 5FOVA 4N1AA 2WPDD 2RGNC 3IIMA 4GP6A 2QP3A 4A8JC 1Q1ZA 2D4HA 1MABB 3U2QA 5L3QA 1W49A 4PPFA 4ACAA 1FX0B 2QAJA 1G8HA 3QJYA 1W2GA 2CLDX 2QP9X 1D8TA 5FUXA 2XSZA 5AWFC 1JXMA 3B1WA 4M1OA 1KKLA 4GOXA 4UNPA 1RKBA 2VQSA 4G5GA 4OI0A 5FUYA 1ZM3A 121PA 2PJZA 1LW7A 2J0SA 2A78A 1DO0A 1GNQA 1J8YF 2P2LA 3FHCB 2IYZA 4NONA 1XU4A 2GF9A 5GVSA 3L8YA 4LZZA 2ZRIA 5FUVA 3IO5A 2CXXA 4A8JB 3Q7QA 1IONA 4ACBA 1JXOA 3D6TB 4LYFA 1Q22A 3TAUA 2ZYVX 4GSYA 3VR3A 1T6NA 3GLFB 4AKHA 1YZTA 1RIFA 3AM1A 1NN5A 2P65A 2I1VB 1MR3F 1NMYA 3L43A 3L8ZA 2R6GA 2IYRA 1PUJA 5F3WB 4YMUA 4EPWA 3SI7A 1J2JA 3A6PC 4CRWB 1E2QA 1XD8A 1U90A 2ZE5A 5E95A 1KI9A 2P3SA 1NLYA 1RYFA 2X8AA 3R8CA 5SZIA 3MJRA 2BEJA 2IWRA 1N5JA 4G1UC 4DDTA 3E5HA 1N5KA 1Z6XA 4WZ6A 3AKEA 4Q1CA 3T1VA 2PBRA 3PITA 1II9A 4Q00A 1T9HA 2QG6A 1NMZA 1VG0B 2HEIA 2QQEA 2V1UA 2VHQA 3W3AA 4FCTA 2YKGA 2C04A 2P67A 3WMEA 2OT3B 4ZPXA 3N2EA 4BLQA 2ZM5A 2OXCA 5AUNB 1G8FA 2GXSA 2OILA 4YMWA 1E9CA 3GCGA 2GILA 4LJ4A 3BB4A 1JB1A 5JRZA 2W83A 1XPRA 2VRWA 1QHYA 4B32A 2CNWD 5K8LA 2A3RA 1SXJD 2R2AA 3GLFE 3FOZA 5KNCA 2ZAMA 2XOKD 2B8WA 1D9XA 3K9LA 2XTNA 1Z47A 2IC5A 4IXNA 2O5VA 2QN6A 3ZVRA 1HYQA 3SFVA 4AIIA 5L3QB 2BCJQ 1W1WA 4KXFB 4PAOA 3I61A 1N6PA 2GJSA 2QM7A 1QBKC 2AXPA 2RGAA 3AGQA 3OEED 4V0OA 1E2EA 1JAIA 1SVSA 3EPLA 1K5DA 3DEFA 2OESA 3NBXX 4ILEA 4HDQB 4NU0A 3W6NA 4ZKDA 3QOFA 4ZDWA 1KJZA 1KDRA 4B75A 4Q1DA 521PA 2BJWA 4OYHA 5F98A 4A6PA 2YJTD 3JZMA 1SQ5A 2CNWA 1SXJA 2VP6A 3A1SA 3LX5A 2IX3A 2XOKA 3QPUA 4IOKA 2O8DA 2IYWA 2Q0HA 1YRBA 1Z0FA 1Q0UA 5HE8A 3T5DA 221PA 2X1VA 4MA4A 4ZCIA 3NHBA 5C18A 4A0FA 3RSLA 4QHSA 1PLJA 3LH5A 1W5SA 1SVKA 2CCGA 5A5GA 2F3RA 3OEEA 4UXJA 4EFNA 4QHYA 5EE5B 4D25A 2IYXA 3Q9LA 1KYIA 2GJAA 3PUYA 3KKNA 2G83A 2ONJA 3B78A 1OXTA 1CR2A 2FNAA 3B1XA 4QBHA 4QJ3A 3PENA 1LF5A 3IHLA 3QQ5A 5SZJA 2ZRLA 1G9XA 1T5IA 3VNVA 4PO8A 3ZLJA 3CX7A 2RGBA 3C4JA 2NO0A 4XTCS 2YNMA 1NNEA 1DPFA 1XEXA 3I73A 1D6JA 1TEVA 2NPFA 3O8CA 3UMFA 1BYUA 3IPYA 4A0HA 3KKPA 4LOAA 2NQ2C 3P27A 1I4LD 2OO7A 2ZS9A 2JLVA 4HZIA 2HLDD 2FEOA 1KI1A 3SYLA 2R9VA 4X8HA 4XWAA 1MT0A 3RVBA 3VNUA 1G20E 1JQJC 2HF8A 1LNZA 2VP4A 2AHOA 1GL9B 2KSQA 4MYTA 4IKEA 3ECCA 3TRFA 2KBFA 3A8TA 1P6XA 4JMPA 4PZYA 4UNQA 2AX4A 1XCGB 4U5XA 1W4CA 4TQAA 2HXYA 4F4IA 2RHDA 4L16A 1VHLA 4HSEA 4G01B 3EIEA 2ZXUA 5L3RA 2PZGA 4PSVA 1K6MA 4W9MC 3ONWA 3O8BA 2RH5A 1MRSA 1Y3AA 2QGNA 4FW9A 3P1JA 1FTSA 2VBCA 2V54A 4CGZA 4X8OA 3GLHA 4EPRA 1XBTA 2YHSA 3TSZA 1JPJA 2HLDA 4LJ7A 3LY5A 1L2TA 1DG1G 5J4LA 5KTYA 2IXEA 1LTQA 1E9BA 5E7IA 2IHYA 1SXJB 3GEIA 4BFXA 1EWRA 1UKVY 2ZRHA 1F60A 4TLBA 4URVR 1BO6A 1VTKA 4LJ9A 3H84A 4Q18A 2O8DB 2ZE7A 1GUAA 3AVYA 1XMIA 3EZ6A 3KXIA 4FCWA 2CDNA 4PC6A 3DZ8A 4DJTA 4ZDIA 1RE0A 2FGKA 3ICQB 2Q9BA 5JWHA 2ZRJA 4HYYA 1IN4A 2QY9A 1GOTA 2ZRNA 2F43A 4LPKA 5EE1A 4GFDA 3SQXA 3KKQA 3PUVA 1U8ZA 4KJZA 4B48A 2ZJOA 2JATA 5J4YA 3FHTA 3FMOB 3HWSA 2Q3FA 1XCPA 3WXMA 3AVPA 2CHQA 1GILA 1L4YA 5F9FA 2W2XA 2GJ9A 3K09A 3SYNA 2W0SA 2QPTA 4K8OA 5LPNA 4JBWA 4IFEA 1S2MA 4Q21A 1RPZA 4DLSA 3VAAA 1XEXB 1E32A 4Y0VA 2ZJ2A 1ZMXA 3DZDA 4EPXA 1VDZA 4LYJA 3QSYA 4HAXA 2GJKA 4KBFA 3WNDA 3QKUA 1NJGA 2ZJYA 5FPKA 1LS1A 3B9PA 1EWQA 1SXJE 1KK0A 3Q5EA 2YYZA 4J0QA 5CB6A 4I1VA 5G40A 2C96A 2GWHA 2VYFA 3L2OB 4H1UA 2GAAA 1C4OA 3VTKA 2D3WA 4G5RA 3A37A 2ZJBA 4MRRA 1AGPA 3TK1A 1UJ2A 4LX0A 3ZZ0A 3KQLA 4LHVA 2FV8A 2ZEJA 1CP2A 2J0UB 4WA7A 4DLUA 3RS2A 1S8FA 3SC3A 1Q1EA 1G8PA 1W48A 2IBMA 2JJ2D 1YR8A 3C16C 3K0AB 4PZZA 4C0HA 4QJ5A 5B2ZA 4S35A 1PVOA 2BMFA 1BMFD 3R20A 4WOPA 4DLRA 4WXRA 1G8GA 4DB2A 3PVSA 5C4MA 3VU9A 3GLHB 1KI7A 5TDHA 4JBYA 5JJIA 2R8RA 3H4MA 5F2EA 3R7WB 1FOEB 3ZYCA 3TGPA 3NEJA 3REFA 4B2LA 1TF7A 3AP3A 1NKTA 2FFBA 2YC4C 3EC2A 3NH9A 1UFQA 4A82A 4U7DA 4GPTA 1HE1C 2R6CA 4R9UC 3AEZA 2E87A 3RRMA 4B71A 3HR8A 1IQPA 4GZLA 2IYTA 4JJZA 1ZUHA 1VPLA 1ZU5A 3GFTA 2F55A 3BXZA 1HQYE 5CDFE 3NC0C 5FTNA 2JJ2A 4LYAA 2ODEA 2AWOA 2WWFA 4NHOA 3U4QA 3SQWA 4NYMQ 3SS8A 1G41A 3K09C 4WBSA 3SJAA 1U9IA 2BBSA 5CLQA 1QHNA 4Q1BA 1H8ED 1Z83A 4GP7A 1G1MA 4M1KA 1BMFA 1ZBDA 1G3MA 4UNRA 5AUQA 1ZM7A 3ZJYA 4ESHA 3DMNA 1VYVA 3KKOA 3BH6A 1YZKA 5EZ5A 1WE2A 1OPXA 4LHYA 4Q1AA 4BASA 1XJQA 4B2PA 2E9SA 4AYXA 4ESVA 2F43B 3RWOA 3V9PA 4R71A 2QORA 1OB5A 3PJRA 2GAOA 2W6ID 2ATVA 1XP8A 3U7FB 1ELOA 4AK9A 2GVZC 1IHUA 4LV8B 2YWFA 2O8EA 2PLRA 1AA9A 4F4JA 4POAA 1AIPA 2PT7A 1G5PA 3IIJA 3NBZC 5BYJA 1NRJB 1TQ2A 1Z0JA 3EW9A 4IJMA 3EA0A 3LX8A 3EPJA 3V4RA 4OHVA 5KOYA 3TKLA 3P20A 5D3MA 1NG9A 1JPNA 2VSFA 4JL8A 2ZRMA 3FB4A 1H8EA 1JALA 1T0HB 3EZFA 1F2TA 4DWJA 1Q3TA 3UKDA 4TYWA 5BN4A 1U99A 3FDIA 4AD8A 1KHTA 4FMDF 2IYVA 1YZNA 4DSOA 1N5LA 1DADA 1EG7A 4TMWA 4YDSA 1NLZA 1GNRA 4LHWA 4AY2A 2LKCA 3EAQA 3UIEA 5IHPA 1Q1QA 4QC2A 2VEDA 2FE4A 3L0OA 4MUAA 3ZZUA 3W8RA 2AWNA 4P33A 2UZ3A 1NVWQ 1HTWA 2B7CA 5GJWC 2QSZA 2V4ZA 5ANRB 4V0LA 1YR7A 4YMVA 4JVNA 3BGWA 5JEDA 4LBWA 2AD5A 2XTMA 4L9SA 5AJVB 1D9ZA 4D0NA 4Y0AA 2WKPA 2WJYA 3OIYA 1J90A 1SKYB 5FPYA 5FBLB 3QEOA 3NG1A 4V0ME 4BRUA 1GNPA 1N0WA 1OE0A 1R7RA 3U44A 2ZJZA 3SJCA 5H70A 4B3BA 1DELA 1QF9A 2Y8EA 2QA5A 4I4LA 5AK0A 1TX4B 3LVRE 1NJFA 3C8UA 2XNSA 3AQ4A 4B34A 2JGNA 1U0HC 4DIDA 2A9KA 2CE7A 2GNOA 2ZI4A 4FCVA 4KVAA 4DEYA 3CH5A 4OJKA 4F7WA 1TF5A 1KI2A 4M1WA 4RKEA 3RC3A 2GDJA 1XD9A 1U94A 2ZR0A 1KO1A 3A58B 2G0TA 1P61B 4PSKA 3U4QB 4QM7A 2F3TA 3TVTA 2HYIC 4JBXA 1CEEA 4LY6A 3QEJA 5CLLA 721PA 4UNSA 2C98A 1EFRD 1VCOA 3QG1A 3D7MA 4JLMA 1LF0A 1NY6A 4JLJA 1DO2A 5HTKA 2IUUA 1SZPA 4JS0A 3CRRA 4KU4A 2QEQA 2GXQA 3KQKA 1AJEA 1XEFA 1CRQA 4LJ8A 4P4SB 5HCNA 4B3CA 5HZHA 2F1JA 3AVXA 5TMPA 2O8EB 4RD3A 3WHKA 4URXR 4V0KA 3TR0A 2XNDD 3QG5A 1LB1B 5CIQA 2GEDA 2OBNA 1FQJA 1KY3A 3AF4A 4EPTA 2NO6A 4AG5A 5D3MB 3K0FA 5CJPA 4DXAA 2NMVA 2EFEB 4NL4H 1AS0A 1XMVA 3LQQA 3K0CA 1OFTA 1IBRA 1F2TB 2BHRA 2BKUA 3EXAA 3KJHA 2BWJA 4B76A 4DCNA 1QHGA 3WY9A 4YXWD 5CM8B 4Z1MD 2IS6A 4L8GA 1JR3D 2QROA 2D7DA 1EFRA 1IY1A 1E2LA 1R0ZA 5DHAA 5JRJA 4HB4A 4MRSA 1XRJA 4DDUA 1KJWA 1N2CE 3EA5A 4GMXA 3SBDA 2EVWX 2Z5FA 4D2IA 4DVGA 3TIFA 3RRNA 1AK2A 1FZQA 4OKSA 1XXHA 4HB3A 4S2EA 2ZITA 1T8TA 5DYGA 3A4MA 3RS0A 4ABYA 2XNDA 1TTTA 3WRXC 4QGAA 3HPRA 5JCZA 3CPHA 1G3RA 1EFHA 2R6FA 1R2QA 4U02A 4OQFA 3TNFA 4RFSB 2WKQA 4LV6A 4HATA 1N6KA 4DUGD 2QAGC 4I1UA 2GA8A 4V02A 1YQTA 3KB2A 4LHXA 5E7JA 5GADl 1AQUA 3U44B 1VCMA 3C41J 4YXWA 2FA9A 4Z1MA 1XMJA 1JR3A 3MRSA 1PJRA 3FYHA 5FTMA 4AI6A 3I8XA 1GAJA 3NBYC 1N6HA 4A1FA 1ZD1A 4GT1A 3I4LA 5CYOA 1KTVA 2ORWA 4YMSA 3BRWD 4Q66C 3X2SA 1KAGA 4IDQA 2QI9C 4C30A 2XZLA 1GG2A 3CR7A 2YOFA 4EJSC 3VFDA 2HXSA 2QU8A 4DT1A 3IQWA 3LW7A 4F38A 3FMPB 2QMHA 1JNYA 4CZ2A 1Q20A 3ZD7A 2IW3A 3THOA 1LVGA 2OFOA 1Z6GA 3NEYA 2BDTA 3NDBB 4BLOA 2ZJ8A 2IXGA 3K53A 4DUGA 1KSGA 2ZUCA 3RS7A 3BB1A 3K0CC 4DRZA 5CK5A 2ZUDA 3VKGA 4I81A 2WMOB 1OIWA 4FD2A 3MFYA 2C9OA 2OFWA 1I2MA 2J87A 1AN0A 3GLFA 2P5SA 3LNCA 3OHMA 3CBQA 4YQFA 2D06A 3QBVA 2QT1A 1ZINA 1RRFA 1E1QD 3CO5A 3O8RA 4HB0A 2G1JA 3X1YA 3THWA 4WZAE 6Q21A 1T3HA 2FSIA 2ZSFA 5J47A 1FUKA 3CF2A 2CCJA 2VH5R 1AKEA 3KTAB 3Q5DA 3K0FB 3H1TA 1N5IA 1TQ4A 1FUUA 1MRNA 4PQFA 4LC0A 2WBLC 3U61B 4DHEA 4C9BA 3UATA 2ZRPA 5EP4A 5FL7D 4BQSA 5JMTA 4N0DA 3B5JA 4ZCMA 3U5ZB 3KUCA 4DCSA 4KYUA 2P6NA 4HI0E 4KITB 4PPGA 3SE0A 3CUEF 1S1CA 5DIFA 1XXHB 1E1QA 4FMDB 2PMDA 3UWKA 1NL3A 1ESMA 2ATXA 5LD2B 2FU5C 1OIVA 2XJ9A 1G64A 1DBSA 2WOOA 4JIMA 1UKYA 3SJZA 3H86A 3ADKA 3TLXA 4CEJA 3QIAA 4RZUA 4NDZA 3FE2A 1ZIOA 1GWNA 5FOWA 5FL7A 3JVUA 1N25A 1CTQA 1X1SA 2GCOA 3NIBA 1ZVQA 2OSBA 3B13B 4B43A 1E69A 2A5DA 1GZSA 3IHWA 1RRGA 5FPTA 1R0XA 4YMTA 2DPXA 3GQBA 3KFXA 2VF8A 4CT4B 3REGA 4DT1B 2KWIA 4C7OA 3U6BA 1UPTA 4XSGA 4JKYA 3TW8B 1KDOA 3A1TA 4LBYA 2YOHA 2AKAB 3OESA 4F93B 2OCAA 5CYPA 4X8LA 3HU3A 3QKRB 4IEEA 3AVUA 1JJVA 4B44A 5FPHA 2CK3D 2OAQ1 4G5OA 2F6RA 4EQ6A 2MSDB 1ZYUA 3UG6A 4OQXA 2FPKA 4TL9A 5TB5A 2H92A 2WPDA 3EG5A 5FBVB 1XXHE 4MH0R 3SN6A 3UWOA 4LJ6A 5BN3A 3H0KA 3DM9B 1YR6A 1ZD8A 1W0JD 5F9HA 5BXQC 1UDXA 3IQXA 4PHTA 2RKOA 2HJVA 3K70D 4PO9A 1COWD 1N6NA 1UEIA 3PEUA 1NG1A 3TR5A 2IEZA 3THWB 3FTQA 2TMKA 1O87A 4PX9A 1MH1A 2OG2A 1P3JA 4A92A 1KNXA 2B92A 4TMZA 4E5UA 5EP3A 1JR3E 3GLGB 2EFCB 3LXXA 3MWKA 1OXVA 3ZVMA 3HU2A 1YU9A 4D26A 3D8BA 2HT1A 3WBKA 1IN7A 1GM5A 3RRZA 2CK3A 1Z2AA 2EYUA 2O8CA 2VP9A 3T1OA 3AVQA 2FOLA 1WP9A 5IK2D 2B21A 4ARZB 4Z51A 5HE9A 1Z0KA 2JLXA 1W0JA 4NKRA 2MSEB 1OJLA 4XD7D 4B33A 2ZRFA 2A7QA 3IIKA 4MKGA 3RABA 2BM1A 3H2YA 3LBIA 3SYKA 1COWA 1HV8A 2G77B 4HUQA 1BIFA 5JWOA 2DBYA 3RS4A 5B58C 4IHQA 2ZE6A 2OCPA 4WXPA 1VG8A 4TMVA 4B6FA 3AF2A 4HAYA 1R0WA 4DLWA 1FTNA 1CRPA 2IF0A 3T34A 2GBLC 1Z63A 2F1HA 1UEJA 4CW7A 2Z6VA 1KK3A 5SZKB 3AGPA 4CEJB 5KPJA 5KO2A 5E3HA 4IDOA 5EXTA 4UJ5A 3UMRA 5KSZA 4B73A 2FGJA 5BN5A 2GCOB 5IK2A 2IYLD 1ZAKA 4KSBA 2BJVA 3KJEA 3GLIE 1E99A 1Q57A 3C15C 3GLGE 2ZQ5A 4XD7A 2IWHA 3QXJA 4OI1A 4XWKA 2V6JA 1EESA 2FG5A 1DTSA 3L0SA 4C7OB 1M7HA 2IXFA 1M8PA 1ZUNB 4BWYA 4IDNA 2O8BB 5FUWA 4I99A 1E2GA 1Z08A 2OLJA 4B3DA 4EPYA 4KSCA 1MO6A 2N1BA 1NKSA 3VHXA 1GKUB 4EQ6B 1CJKC 2QTHA 4IDHA 2V8OA 2BBTA 3DL0A 4HAVA 3WNCA 3KQUA 4DZZA 3J81k 3T1TA 1ZW6A 1I2DA 3GJ5A 4JLDA 1DE0A 4OI2A 1YZQA 3WP1B 1KI4A 2C78A 4PXAA 4Q4AB 4WVFA 2AXNA 2X2FA 2VHJA 3BOSA 1ZU4A 4RCZA 1A2BA 2VF7A 1W47A 2H8KA 1Z6YA 4DSNA 3K70C 4IVRA 3W6OA 3U3OA 1N0VC 3MGCA 1G4UR 3BK7A 2ZU6A 4LDJA 2J0VA 4DSTA 4A9AA 4A2PA 4E09A 3EWAA 5KYKA 4ERNA 1GRQA 1MO3A 2FF7A 3CLVA 4TN1A 2O52A 3RS3A 2O8CB 3WYGA 4RY2A 1CJUC 1RJ9A 2LCFA 4G5QA 4URWR 5K8IA 2XX3A 3A4NA 1N6IA 3AKYA 4B6EA 2F7SA 1N3BA 1TL7C 1NY5A 4ZKEA 5JZVA 2QBYA 4GDFA 3QPWA 4DBLC 5CDFA 1UAAA 3K70B 3QF7A 2AKYA 2IL1A 2VTKA 4HUQB 4XVRA 4GNKA 1GRRA 1X8KA 5B30A 5EE0A 2WJIA 4JL5A 5FR1A 4HEJA 1OXSC 2YINC 4JLOA 2QL6A 5K8UA 5A4JA 4MKHA 1XMSA 4JLVA 5KDOA 4BEBA 1LS6A 3B2EA 4C0KA 5AJWA 5CK4A 1E96A 1XNJA 3IUYA 3V4FA 3U3MA 2J0UA 3VR4A 4D4KA 2J3EA 2JEOA 1GITA 3ZGXA 3N2IA 1IY0A 1SULA 1KI8A 3K0AA 1ZRHA 3VR6A 4GMDA 3I5XA 2QP4A 1D2MA 1JECA 1FMLA 4B3GA 4ITRC 3R9WA 3GMTA 5JLJA 4C2UA 1Z06A 2WKRA 4MUBA 3CF6R 4B47A 5B64A 2FH5B 2K5UA 3W5IA 4CVNA 1KO7A 1XCMA 3LBNA 2WV9A 1A7JA 2GF0A 3R7WA 4Q7JB 4I1OA 2QGZA 4XOIA 4GI7A 4AKGA 3DKVA 5DNYB 2J41A 2WHXA 3K9HA 1IXZA 2SHKA 1P7CA 4FMCF 4PAMA 2XTZA 1I4TD 2NOAA 1NN0A 1LFDB 1M2OB 2F1RA 5AJZA 2GVDC 3GEHA 2H16A 2FWRA 3LV8A 4IVPA 621PA 2B6HA 2X19A 3A36A 3K1JA 4BZPA 4OQLA 4E22A 1DAHA 2R62A 2JLZA 3GJ6A 1JEEA 4Q7MB 2J46A 2PX0A 4MGYR 2CJWA 5FOTA 1CJVC 4OQNA 3W9YA 1G4AE 1R5BA 2BBWA 3IPXA 1ZNZA 1EX6A 5AUPB 2IYQA 4MITA 2JLSA 4TLEA 1ZNYA 4TQUS 1T5LA 2O8FB 5CM9C 2EFHB 2JLWA 3OEHD 3M4YA 4KV9A 1GL6A 4V0MA 2N46A 1Y63A 5E7MA 4ZV4A 4B3XA 1R10A 1XTSA 1TQDA 3W8NA 2WWYA 2RGGA 3R9IA 2HUPA 4DCUA 4AG6A 2GK7A 3MD0A 1KZ7B 5DHFA 1YRAA 1VIYA 2ANBA 3U6KA 1W4AA 2ZR7A 2WTUA 3FMIA 2W6JD 2H7VA 2D7CA 1WCV1 4JLNA 1RJ9B 4MGKR 4RD2A 5FFMA 3RHFA 3IDQA 4RD4A 2OE2A 4TL6A 1OH5A 2C99A 1OSNA 1VYTA 2GHIA 2PCLA 4L9WA 3MCAA 2J0QA 1TUEA 2QBYB 1E9AA 2C5LA 2MMGA 3ND8A 5JFGA 2C95A 3QPVA 2GZAA 3U7EB 1JEDA 1KKMA 1AGRA 1YR9A 2B8TA 4KODA 2QMEA 4URUR 3R9XA 3OEHA 1DAGA 1QVAA 3B8HA 3BORA 4TL8A 2ZSEA 1W46A 3IO3A 2OLKA 1XPUA 3QUSA 4ZI3A 3MWYW 3KL4A 3B82A 3CRMA 3CX8A 2E1RA 2OAP1 3GJ3A 5CJ2A 5LB2A 1E3MA 2VL7A 4BFWA 1HH4A 2CCKA 4BECA 2W6JA 4IEIA 1M6NA 4KCGA 4AKEA 2BC9A 2O0HA 4BFYA 2GEVA 4A0GA 2GESA 2GEUA 3L0PA 1XX6A 4DDWA 5DN6D 4MDEA 1GRNA 2JA1A 2ZI9A 1W4BA 3BC1A 2G9NA 3KFVA 3CZPA 2C8VA 1G291 1OFIA 1OF1A 1OFHA 1GVNB 1SHZA 3HPQA 3IKJA 2YWEA 3QBTA 3VQTA 1OW3B 5C1BA 1SVMA 2IYUA 4P4TA 4Q47A 1VG9B 4M53A 1GIAA 3LXRA 4OJQA 4NYJQ 3HYRA 1FL9A 1KO4A 2OFXA 2ZE8A 4BZQA 2Z0MA 2ZIAA 4EFLA 3WNBA 1DEKA 1U0JA 2Q21A 3BAFA 3QVVA 3KB1A 4NP6A 4RJLA 3EIQA 3Q3JB 1NBME 1CXZA 3N70A 5HZKA 1IN8A 1PLLA 4DLZA 1KI3A 5EP2A 3X1WA 4MDFA 3BE4A 1AS2A 3ZVNA 4M1MA 1N0UA 3RSOA 3F0TA 4NMMA 4KO8A 4QBFA 2CJWB 5DN6A 1ZCAA 2J9RA 4BRWA 4C4PA 2RGEA 1AQYA 1S3SA 1U8YA 2ZS7A 4DLXA 4D0LB 1HT1E 4US1R 4BGDA 4AYWA 1P73A 2PEZA 3UXMA 3DM5A 3AP1A 2VO1A 5EE3A 2IHBA 3SOPA 3DPUA 4IOMA 1AS3A 4HAZA 2ODWA 2JAQA 3KXKA 3JZAA 3W3ZB 4P4SA 1CBUA 4OI4A 3U3JA 1IM2A 2IS2A 2EFDB 2JASA 2Q3HA 1ZM4A 3L82B 4HB2A 2HF9A 4Q9JA 1G7RA 2NO9A 5DISB 4WZBE 5H1YA 2ZRCA 3EZ9A 5HKKD 1M34E 4CEHB 1KMHB 3LQRA 1W36C 2ZRBA 1J99A 3BH7A 4H9GA 5EP1A 3AVVA 1UBFA 1J70A 3X1DA 2XB2A 3NC1C 3RYTC 3MUFA 4BEJA 2W58A 4MKIA 5IT5A 4LC1A 1ZNWA 1XD2A 4LI0A 1S96A 4K46A 2HDNB 4JLBA 5KSOA 1ETUA 2W6IA 3BD9A 1P2UA 1C9KA 1XF9A 2XEXA 2IUSA 4XJXA 1XJ0A 3THYB 3B85A 4EIWA 4HZUA 1SVOA 5CITA 4RZXA 4LGMA 1E2JA 4XSHA 3ADCA 1ZCBA 2VSOA 3QXCA 4LYHA 4MYHA 2WSSD 1NLFA 3I62A 3GJ8A 4RFVA 3C7KA 4RFSA 1E2FA 4RCYA 5HKKA 3GEEA 1TF2A 2XXAA 3I8SA 3NVAA 2WWHA 1OHHD 2FZ4A 4BE7B 2FFQA 1A2KC 1R8QA 1Z8FA 1P2SA 2VP2A 4PO1A 3A1UA 4D6PA 2KB0A 4PC3A 2XITA 1XFAA 1AM4D 1ESNA 4V0NA 1US8A 2ZSDA 4AYTA 4JLPA 1N6OA 3RWMB 1A5TA 4C0QC 2V55B 4HDOB 2FN4A 5JCPA 2ZS8A 4D0GA 4F92B 2GCNA 1WXQA 2WSSA 421PA 3EC1A 2QAGA 3I92A 4LWZA 4M9QA 2PZFA 2LWIA 1ODFA 3Q8XB 2BCGY 4FMCB 3ICEA 1P72A 1X8LA 5JBQA 4D4JA 1F3OA 3NH6A 3NKVA 3NWJA 2MSCB 2CHGA 4HAWA 4KFTA 1OHHA 4A2WA 3ETLA 4DC9A 4JZKA 3QKTA 2CLCX 1E9FA 3NHAA 1I4DD 4W5JA 2JJ8A 1FP7A 2YVUA 3KJIA 5FTJA 3ZS8A 1W44A 3FVQA 1CS4C 2WOJA 4Q4JA 4EJSA 3TSWA 5L3VA 2Q6TA 4M8NE 5A0FA 2J7PD 3EPKA 1RZ3A 2RGDA 1E2DA 2ZI6A 3UPUA 5TARA 2GKSA 3KTAA 1E2IA 1P9NA 5JWRA 3KX2A 2BVNA 3PG5A 1KGDA 1U98A 2NO1A 3EARA 4EDHA 4YONB 1WB9A 2QRNA 2RGXA 3HDTA 3KJGA 3G82C 4Q19A 4BFZA 3LWNA 1DAFA 4BPBA 2WWWA 2FSHA 3MJHA 1LY1A 3B6EA 1NVUQ 3GJ7A 1NI3A 1XD2B 5C2JB 2IYSA 2RB4A 3PFIA 5FPSA 5FBQB 4A36A 4TMXA 3R8FA 3BFVA 4WW0A 2MMCA 3UMSA 4HZUB 1H65A 4BFTA 2J7PA 2FMXA 1OXXK 1OH6A 2WAXA 1ZP6A 3A4LA 2GXUA 1G18A 2WICA 2JJ1D 4JSYA 2KBEA 2WIBA 5J40A 5HCIA 2CL6X 4M9ZA 5FTLA 1OH7A 4A4DA 4RZ2A 1CR0A 2XXAB 3P4XA 2IS1A 1RW4A 4CDGA 1E4YA 2BBOA 3PQCA 3I32A 2DCUA 5AJYA 4KYIB 4TT3D 1G17A 1QHXA 2O0JA 3PR1A 1T8UA 1TNDA 4ZO4A 5FTKA 1G7TA 1US8B 3G0HA 2DR3A 4TZ6A 3VMFA 4NTZA 4FIDA 2BOVA 1F6BA 4F91B 2W2VA 1G6OA 2ANCA 4R7ZA 1Z0AA 4MRVA 1A82A 4ZDKA 2IF2A 1R0YA 1YKSA 2A2ZA 4W5HA 1Z22A 2G0NA 3T12A 3TVDA 1PZNA 1IN6A 3LBHA 4AC9A 3MG9A 1HE8B 1X86B 2DFLA 4D81A 4KFRA 2QAGB 2JJ1A 1JAHA 2ODBA 3F8TA 1FQKA 2L0XA 3QKRA 1CIPA 1QG4A 1RYHA 3CM0A 3HJNA 2QENA 5P21A 3O8DA 1KAOA 3CRVA 1P75A 4QGHA 2DHRA 4EFMA 2AR7A 4TT3A 4U00A 1S4QA 3LDAA 2CEAA 4NE2A 4MYUA 1E4VA 5E4FA 3PEVA 1YE8A 2RGCA 1QDEA 3HR7A 4Q4JB 1C1YA 1EXMA 3V00A 3EPHA 2GJ8A 2CE2X 4EJSB 3VX3A 4L15A 4LBZA 4M22A 4BFSA 2JDID 2PL3A 4QGFA 3K0SA 1FMJA 1OLOA 1SVLA 3DOFA 3HP1A 3GPLA 2AK3A 3GLGA 3GLIA 4H1VA 5IF9A 1U0LA 4KVGA 5GVRA 1CULC 1HY3A 4O2LA 1G6HA 1U2RA 2HV8A 2CHVA 5JS8A 4ZDJA 2I4IA 2BIFA 1JI0A 1UF9A 4B74A 1KO5A 2PX3A 4BFUA 1S9HA 3SDZA 3CNOA 4XTRA 5TVKA 4QNRA 4UKDA 4ARZA 3K0EA 3I1FA 1KSHA 1AKYA 3WYAA 2CL7X 1QHIA 2QMOA 5EQTA 1UDWA 1HQCA 2GZHA 1VECA 2PEYA 3U7GA 3U3KA 3F5FA 1Z5ZA 3SBEA 4US2R 1L7VC 1QG2A 1DAIA 4LK2A 2OCBA 2QE7D 2JDIA 3ZS9A 3GFOA 2NZJA 3A1WA 2J7KA 4JL6A 2A5YB 3S1AA 5EXPA 4C3ZA 4QKQA 3GJ0A 1BOFA 2ODNA 1PUIA 1QHHA 1ZJ6A 3IILA 1OH8A 2ZREA 1N6RA 1Z07A 4DCVA 4URYR 3VR5A 5BW8A 2F9LA 1BS1A 4M0LA 2QMUA 1G21E 1KSFX 3LW8A 2CL0X 2C03A 2C2HA 2NO7A 2EFGA 1W0KD 4P0TA 1DARA 1A4RA 1DS6A 5H8WA 1QHSA 4IOJA 4JT2A 4QBGB 4URZR 3SZRA 4PTLA 3UG7A 2O8BA 2QE7A 3KDSE 3VR2A 1OT3A 4NZYA 4ON9A 2DFKB 3B9QA 4N3NA 3RS5A 1OFUX 4QXAA 2GBLA 1U81A 4KBGA 821PA 2Q3MA 3LVQE 3OE7D 4LCBA 1IAQA 4NYJR 3U7HB 3RNLA 1WDTA 4BFVA 1VIAA 5FOUA 3QI2A 3N5CA 3LRPA 1IXRC 1WMSA 2YWGA 3FFBA 5BWMA 4TYYA 1B23P 2C9CA 4Q4AA 1P60A 4P3YA 2REBA 5BQ5A 4RD6A 3RAPR 4NYMR 4ZI2A 3EIHA 4Q03A 1GL7A 1W0KA 1RVDA 1EFUA 4ZIRB 5D3QA 1X1RA 5FI1B 4TZ0A 1PLKA 2QZ4A 1VKJA 3LA6A 3GLIB 4W5WA 3FHOA 4HLQB 3RANA 2REXB 2AFHE 1UKZA 1KZGB 2GTPA 1E6CA 4PZLA 3OE7A 1EFTA 2G6BA 4IFBA 5TY0A 2VLIA 4BZXA 3BFXA 1TAGA 1PV4A 3T35A 3DMDA 2D2EA 4HAUA 2GZDA 2QQ0A 2VP0A 4EAQA 3CPJB 1IN5A 2O0KA 4Q9KA 1Q1BA 1VYUA 4NCNA 3KQNA 3PV0A 3C14C 3G5UA 4DDVA 2OZEA 3DO6A 1MOZA 2PT5A 4Z54A
chains in the Genus database with same CATH superfamily
3BG5A 1C4XA 3NBQA 3F6CA 4J4HA 3DHYA 3QFCA 1U4NA 4IAOA 4KH1A 4UBLA 2LDYA 4R0MA 1T5SA 3ND9A 2X6QA 4FSXA 5K3BA 5F33A 2AQHA 2ALJA 2ID8A 4OPMA 3WSTA 2APJA 4LGCA 4JT4A 3RUIA 2C2MA 2PT9A 1H0RA 1KNQA 4DREA 3BBPA 3D3WA 3BXGA 2NP6A 3T61A 1FA9A 3CG4A 1CQJA 2I4MA 5CRIA 2ZYWX 5ALHA 3DS8A 3P94A 2ZRGA 2XCQA 4BXOA 2XWJI 1BDBA 4P2GA 3HFJA 3L1KA 4RXUA 2P6RA 2NU6B 1D0VA 2WT9A 2EGGA 2PY6A 2X8LA 5C1PA 1U0FA 2IEIA 5JI2E 4EZIA 1NRXA 4RD1A 4TTPA 5FV7A 4JLAA 2JIPA 5B1IA 2AG1A 2DPHA 2VUTA 4N54A 4LWPA 3TOXA 5J4KA 4K6KA 3K15A 1UCFA 4GMFA 4MJXA 4ASUA 3DVAA 1IZYA 1XWIA 4A10A 2I55A 2DPMA 2QVBA 1CV2A 1PS8A 1YHNA 4Q3EA 1KZHA 1Z4KA 4RKYA 3EASA 4JA0A 1G5FA 4D3YA 2QRMA 1T8YA 1D1SA 5B1EA 1WSAA 2JI6A 4O0MA 1XQWA 4GVLA 1ZVMA 2HPZA 1Y4DE 5LBIA 3VUEA 3DHWC 3G9TA 3QVGB 4Q4LA 5ADVA 4JYBA 3W78A 4WLEA 1WXDA 3I0MA 4KIJA 4H1TA 1NBMD 4TSFA 4TWBA 5FDFA 1I94B 1OX4B 5JDIA 4Q15A 2OCGA 5JYCA 5DSZA 3CISA 3Q7TA 4KXVA 4DV1B 4Z3OA 2VBIA 1BDHA 2ZR8A 2CVHA 3LU1A 3R5JA 1Z7WA 2QPOA 2I6FA 4AP9A 1XEAA 2ZT7A 4LVUA 2ZCUA 1HLGA 1MW9X 1Q7RA 1WABA 2IXDA 4P32A 3BKXA 3SF0A 1X70A 2E85A 2FK8A 3ELDA 1BN7A 1LBHA 1L5VA 4JJFA 1B0ZA 3DFIA 2QRKA 3AKCA 4I7EA 1V9SA 3DVQX 2UZIR 5B57C 1NXQA 2F59A 4AJKA 1TJ5A 2EZ9A 2I33A 2ZSHA 3ZIAD 1PR3A 1EXWA 3CLHA 2DAPA 4GPAA 2X13A 3B53X 4HUJA 5DO9A 1YKGA 2FW9A 2WHRA 3LD9A 1KK1A 4MVJI 1Z2CA 3RVSA 3VJLA 5K3EA 1JTEA 3WK8A 3NGXA 1VLJA 5CB4A 5LNK6 2OHFA 1MW8X 2AJCA 1JQKA 3MPUA 1XVAA 4I9FA 4WX2B 4L3VA 2L42A 5GJCA 2RHGB 2TECE 3NMUF 1DTEA 3JVVA 3MRXA 1BXGB 3C2QA 1ODLA 1WQ1R 1I2BA 3OCJA 2JIOA 3O75A 3I05A 4PHCA 2FCAA 4AY3A 5L95A 2E49A 5BNTA 1ULAA 2QTCA 3IV9A 4XGRA 3VKWA 2HI0A 4MKZA 1YJQA 1KIMA 1P0CA 1RBZA 2AF4C 5H80A 4NBUA 4DWWA 3RS9A 2XMSA 4M9XA 3W8DA 2ADMA 1NF8A 4RA6A 3G0OA 2ATIA 1NIJA 5DULA 1BWSA 5FO1A 3CLUC 4D82A 4W5TA 2E4WA 2WZQA 4FKMA 2X2OA 5JCXA 1H0SA 5CB8A 3Q9UA 3FJOA 4PZAA 4C0LA 4OX9Y 5BSUA 1PFWA 1D07A 1FP1D 2A0XA 2V7EA 4KR2A 3IUJA 2DETA 2VRNA 3C48A 3PDJA 3WDKA 5JDIC 2WM9B 4Q1EA 2XBMA 3RHTA 2BELA 1YAHA 1M0TA 1TVKB 2XIJA 2WILA 4OQEA 3VZBA 4ZOQI 4RTRA 2WIGA 1XAGA 1E9DA 3K5IA 2RKBA 3PFWO 3QENA 3AF3A 4PIMA 4TTQA 1DAOA 2J9ZB 4TN5A 5EUQB 5C7OO 2K7FA 4Q7LA 3OQIA 3R7FA 4G0UA 1XT6A 2I6UA 5CDGA 3BSYA 4DEXA 4OB7A 2CHUA 2ZT5A 2G08A 2PL5A 2CXUA 3HZHA 3WXBA 5IZCC 2YXLA 2HA0A 4NK5A 1K0UA 1U2EA 3CUVA 2O2GA 2WMNB 5J9FA 4YFYA 4PC1A 3C8ZA 1P80A 1GXSB 1Z5NA 3KQPA 5AKHA 1Z75A 5AKYA 5ESXA 1HDRA 1JFFA 1YIDA 3B20A 3WRYC 3EUEA 2X0JA 4MMYB 2DSTA 3GXOA 1E2PA 5DGXA 2AN4A 3QF4B 5B7PA 2CLMB 2P68A 3AMVA 1IH8A 4WXYB 4G1VA 4FXPA 3OZ7A 1C0LA 3KKZA 1PFVA 3PXBA 1XDUA 2PE5A 1SEVA 2PRJA 1AHPA 4LIPD 4MS1A 5CIYA 1JBKA 1C30B 3W1EA 4EAAA 1A96A 2D5AA 5LZ9A 3GOHA 5FP0A 1EFPB 5AVJA 5DHTA 1S1MA 4PZUA 3RDPA 1CQZA 4YMHA 3UYLA 3EGXB 1R5NA 4TZTA 1ZR2A 3GA5A 5JCOA 3W6PA 3MC1A 4P1ZA 3T15A 4BV2A 4D9EA 2GETA 4LOHA 4RK7A 1Q92A 2A5GA 1HSOA 4XWYA 4EM6A 1JU9A 2YNMC 4LRSB 8OHMA 4N0EA 2JGLA 4FNAA 3VX4A 4ZN6A 2MSNA 1MUUA 5KYXA 5F1OA 3VZRA 1JHMA 3EXHA 4O29A 5G41A 1M0EA 3HUDA 3L18A 1CJTC 1L6IA 4A8PA 1YCDA 4PYOA 2E3JA 1F7VA 3DT8A 4P98A 1XQ9A 1S5PA 3L0IB 4WAUA 1YOVB 2HCBA 2W00A 4KQKA 2NAFA 4ISCA 2EQ5A 3WGMA 2OYCA 2GM4A 4LPSA 4HDSB 3FKSA 4KACA 1T3ZA 2IRWA 2RGUA 8ATCA 4MW0A 1ZQ1A 1W4RA 4BB6A 5CFMA 2OCYC 4FZ3A 3MMPA 4RZSA 4ZO9A 5FOXA 1U8XX 3X1ZA 3L6BA 2ZJAA 2HC9A 4Y6RA 1E2KA 1BCRB 2X0KA 1XTQA 1YRQA 2WWIA 4Q02A 1UP4A 2NIPA 1E9EA 2R85A 1NF9A 5FNVA 4JVSB 4PR0A 1L5FA 5FYQA 1R0KA 2WWXA 3IHKA 3FWYA 4QU9A 1GU0A 2PZAA 4R2MA 2ZUEA 1QP7A 4WNAA 4NCIA 2BF7A 3JSXA 3P45A 1JKJA 1GZHB 5JADA 1XROA 1U4SA 2YBEA 4Z8XA 1H4QA 4AJEA 3FKQA 3ETDA 1V3UA 3D43A 3TJRA 4NECA 4CF7A 5E38A 4KLCA 4O33A 1MGPA 4AJ4A 3WA7A 1S3GA 1SVIA 2DY1A 2VHUA 4PFJA 2OHXA 4ZVLA 4W9NA 1JQAA 2CDAA 2WVJA 4GLBA 4Y9DA 3WIOA 3ZHTA 5LXTF 2QLMA 3EX7C 4GRAA 4JBLA 1WXGA 2WJWA 2ZIFA 4GKJB 1NW6A 2XZOA 1Q44A 3D7RA 4MTLA 1GSOA 4ZK6A 3V9AA 3PGA1 4R05A 3WAJA 2X0IA 3AR6A 3BQ9A 3OIDA 4BYGA 2J3HA 1ZD9A 2XE6A 4YECA 1PGQA 3M1IA 2IHNA 3ENKA 1II0A 4G4SP 4L0MA 3UKOA 1J42A 4CLXA 2QKYA 2DLNA 2E4YA 2J5KA 3GWGA 1Z8DA 4EB8A 3EXHC 4JI5B 4D8WA 5C8YB 1WPQA 4OHCA 2AJDA 2CNDA 4C2BA 4F86A 4DV2B 4NV1A 2B99A 4CT5A 4XGNA 2AOXA 2HIMA 2IQ5A 2OZLA 4U7PB 4H0NA 3RNOA 3HY4A 1WG8A 2K2QB 1N78A 3STHA 3ZUGA 1NHWA 2VJCA 1X7XB 3OCXA 3E9DA 3L1UA 3DOEA 4MW1A 2Y05A 1LV7A 1IMJA 5ILQA 3C3EA 4NPAA 1ZOOA 1Y7TA 3WYNA 4EUNA 4KFUA 3W05A 3BJIC 1Z0SA 1ODIA 3B1ZA 1I2CA 1YMUA 1XRQA 2Z4RA 3CLRD 2JFZA 1JJFA 3PGJA 4MGIR 3VPGA 4BO0A 1XTJA 5HM6A 1M7GA 1M1YB 5AIAA 4WIAA 3SHQA 1YB6A 2JCSA 3I39X 4C5CA 5FF9A 1A1VA 4F5DA 3W77A 3DMGA 1IPHA 1PJZA 2CMGA 3AHHA 4N7BA 3TUZC 3DE2X 3LLMA 2IDMA 5CGZA 2REOA 2GEBA 1TEXA 4F3NA 5JASA 1TZMA 1LPNA 4LJ5A 1FVHA 1QGAA 3B51X 1VGRA 3LKBA 1N34B 4BMNA 3PXGA 1MJGA 2QT9A 2C3MA 4MUKA 1XIVA 2ZYUX 2X4LA 5TV2A 1XI2A 3ZI0A 3PHIA 4G37A 3LP6A 3GH1A 2VZ8A 2VF5X 2Q5JA 5FO0A 3CLKA 1WA5A 3B9BA 1R4MB 3AV0B 1BWRA 2VIIA 4UM5A 4W8HA 5ILGA 5BMVF 5JSZA 2ZM6B 2FFHA 4AMZA 2FPOA 3K0HA 2BM0A 1BTOA 1FIUA 5A3JA 3U3ZA 2PRIA 3T9FA 2ZBRA 2ZRDA 1F2UA 1QFYA 1UBGA 3HACA 1E6WA 1BYIA 4MGEA 4FE3A 1ECJA 1OKKD 1ZL2A 3PC4A 5D6NA 4NI5A 1WZUA 2R4UA 3CPEA 4TQGA 4ID9A 5EXSA 4MWZA 3U31A 2BGMA 4MRNA 4BMPB 4P7GA 1U0TA 1SH7A 4NOLA 1E79D 1CF2O 1B6RA 4PINA 5H3HA 1KTIA 5AFSA 2CNNA 3SOZA 1QRSA 2GD2A 4RADA 5HOQA 1DAKA 1NVVR 1Y8AA 1H8HA 2EU8A 2GN8A 3CZ4A 4WK6A 1DIGA 1QQAA 3O92A 5DCUA 5DLPA 4C05A 1B8PA 5UKDA 1G3UA 1V45E 1X0XA 3ER9A 4CEIA 2O5RA 5FBWB 3H0CA 3NP9A 2PFGA 3I58A 4NDNE 5AICA 1GY8A 1WD5A 4Q82A 2B98A 1YJXA 1N8TA 2YQZA 3PJDA 4LVNA 1FK8A 2W2TA 3OAAA 1J1ZA 3QLUA 4D8UA 5HQTA 2DQSA 5E9AA 1OIXA 2B35A 3VU9B 1EVQA 2EF0A 4MIOA 1C3EA 1X8JA 2C77A 2P9CA 2R48A 4YTEA 3W4IA 3S8YA 2FFJA 1E4OA 2H4HA 2XZPA 5J5AA 3E70C 1ZFNA 5DYWA 2D62A 2DQ4A 4DM7A 1NDUA 1WBDA 2H2HA 4GM4A 4PZPA 3COWA 5ESRA 5CA1F 5EL0A 1E58A 3EDOA 3P0JA 3IKMB 5CHYA 3FNGA 2VTEA 1GGHA 2B5VA 3B7GA 1E77A 1XR3A 4YDHB 5BXYA 2R00C 1NVBA 4LZAA 1SU7A 1Z9BA 3I5YA 3BT7A 4UU1A 2GARA 1I8TA 1LLCA 3UK2A 1D7OA 2W9XA 2R6HA 3L8HA 2GK3A 3BS4A 2VK2A 1IZ0A 2ZJ1A 3VYVA 3RRYA 1KJQA 4B3RB 3EZ2A 3KALA 3X1XA 5EVJA 1H3NA 2MU1A 1YIOA 3B1VA 3ZD6A 1RHJA 1ZEJA 1X13A 3UJ7A 4CM9A 2W0MA 1CF4A 2XE8A 2PK3A 3PCXA 2QYSA 1GU7A 3T0IA 3VPAA 4JASB 5AH0A 4Z6KA 1A7KA 1JVSA 2HGZA 3IP8A 3ZCRA 1E7RA 1Q0PA 3C1TA 2NYRA 1ZGBA 1GFSA 1NSTA 2WHEA 3TLGB 2YMPA 4O25A 5I7HA 5TXGA 1MO4A 1AY0A 2NM0A 3LK6A 3PVCA 1SNYA 2PGDA 2HQ1A 3TSOA 4GVPA 1AO3A 3VR0A 4FONA 2I7XA 4JENA 4ZRMA 3NHFA 2GO7A 4XGQA 3S28A 4UAJA 2ZIVB 1MV5A 4Q4HB 4RGQA 3PJGA 5FR2A 5K8TA 3SF8A 3RI3A 1Y8ZA 1TD9A 3FSRA 3NDPA 2C9YA 2CBXA 3AIIA 4MQEB 4PXYA 3WB1A 3R2JA 2OAGA 5AVWA 4Q1FA 5I7FA 2ZWVA 1ZISA 3PNOA 1MJ5A 3OFNA 4TS9A 2F1IA 5KNDD 1W5TA 5ALOA 2PSJA 3MJTA 1O8CA 2JJMA 3EDQA 1W88B 4Q9LA 1T0PA 5DE3A 3W90A 4G84A 5K01A 1A9YA 1XXLA 4KJXA 2NG1A 4F3CA 3SOOA 2YMQA 3ZH9B 5AVQA 4MP3A 4Q5IA 1M74A 1EJ2A 3LPAA 5A04A 4S24A 3UUFA 2ISQA 1VJGA 1Z6TA 2ZI7A 1W7AA 2A14A 3A25A 4UEJA 5CW1A 3S29A 3VSAA 1OU4A 2C58A 2GCEA 4E2FA 4YRKA 5BV1A 2O59A 2JFNA 3HMQA 3ZU6A 3JQ6A 4F8YA 4NBTA 1CUEA 3ZVLA 4FWIB 4ZKEA 2CYBA 4HRVA 2RGYA 4J7CA 5FLXA 5EE9A 3TEMA 3JYOA 2Z56A 4KSYA 4UASA 4QG3A 2I4LA 3AH8A 4RF4A 2DT5A 2EJTA 4BQNA 4XPIB 3INRA 1EKXA 4E21A 1YJ5A 1KU6A 5ALIA 4HLDA 2YJ4A 1O89A 3NASA 3RJ9A 3WL8A 3HSYA 1ZLXA 4TKVB 5IUKC 4QECA 2P0EA 1SVWA 3U13A 4U9UA 1M76A 2V6BA 1GRCA 3PSAA 4BLPA 4LTNA 1IVSA 1ZHFA 2PRKA 5AOCA 3W5HA 4EVQA 4RWZA 3CZ9A 3WYEA 4XVUA 2KE5A 4MVJF 3FHJA 2D74A 2VWGA 3WFZA 3I0NA 4ZGWA 1SAYA 2V6FA 4QYXA 4ZREA 2FRVA 5T5QA 1P1KA 2D0IA 1UXKA 3H5RA 4DQDA 1KF0A 4J1NA 4RK5A 1X92A 2DPGA 2GCGA 5IANA 5KNBA 4QNMA 2A0YA 3AI7A 3W7BA 4FHCA 2VPPA 4HL6A 5KTNA 1E2NA 3IEUA 3L93A 4JJKA 1ONNA 2Z5LA 2A67A 5EPUA 1NU8A 3EXG2 3USES 1RM3A 4QRHA 5C46F 1PTKA 1W6UA 2VXCA 1P2TA 2VP5A 3OJEA 4JSTA 4MW4A 4DIFA 3CFYA 3F3YA 2EYQA 4ZEWA 4J0GA 4RIHA 3ZLUA 1E3IA 4MEBA 4C0XA 3QLVA 5IJZA 1WBBA 4HNUA 3WB2A 5DK4A 16PKA 2XVXA 3HYTA 4UVHA 2GN9A 2YICA 2C94A 4LKRA 1OWNA 3I28A 4YP1A 2NUAB 4W6QA 3SIRA 1EQ2A 1QOPB 2WE7A 1M7BA 1YDFA 2WF7A 1BGWA 1XZQA 1RADA 2ZTHA 3OHPA 5B1HA 5JARA 13PKA 2HMTA 2X4GA 4D9JA 1NF2A 1EVIA 1IEXA 2NTJA 5DM70 1V6AA 5CH8A 3IFSA 5AQEA 5GJVC 5MHTA 3WKEA 4PFSA 1VP3A 1FYEA 4AVYA 3K20A 3NYRA 2G1KA 5LD2C 1NPTO 3LX4A 1UJ4A 4EGFA 4JV5B 1UANA 2VA9A 2X2EA 2ILTA 4WV3A 3ZTYA 3CF0A 1K8QA 4F4FA 1QPZA 2YS7A 1TLTA 5K3FA 1XLTA 2R1VA 2XODA 3MIZA 2AD1A 3T0GA 5BMVB 1NIPA 3GEPA 3WNZA 2NNWB 2VG8A 2QVYX 4PS1A 1Y9JA 2R8EA 4BNKA 1MB2A 1S6YA 4PHGA 4QYMA 5D5HA 1NN1A 1SCUA 5F5LA 4ZA2A 5CFZA 2JVJA 2XCSB 1NVXQ 2XSZD 2IUTA 4LFAB 1F0YA 1WQ3A 1DKUA 3PX3A 4X0EA 5ICGA 3DZFA 3FLAA 2HYDA 2JLUA 4P93A 2XQJA 4YUAA 4I4IA 5AM3A 5C4GB 1FDWA 4G0MA 3BERA 4P4UA 4N03A 1OYYA 4GPBA 1UKCA 1GPH1 3M3PA 4OQQA 3LKDA 3IBGA 3ZTWA 3HWX1 5DGIA 3ZW7A 1DEOA 5B6IA 4FHGA 2P4HX 3Q7EA 3IBYA 2VHCA 4AZTA 3PZRA 4PTZA 1W8IA 1YJAA 3CSSA 3LYHA 1BJKA 4IF4A 1WCYA 1FNCA 3KOYA 1T34A 3M5PA 4QXMA 1QQTA 4C29A 1Z0UA 2Q1TA 3JQEA 3Q8KA 3GPIA 3IV6A 3U7JA 3VR3D 3WLNA 3NWOA 3BK1A 4PPFA 2IGBA 2FSVA 3OZVA 1YDMA 4YCSA 2VJMA 1BFKA 4ACAA 2CF5A 2JFHA 1VLHA 3QJYA 1QGUA 4EJFA 4S1OA 1H6BA 1X3LA 4REOA 4GOXA 2HEGA 2AFIA 3J7AC 4KV7A 4AUKA 1X9GA 5CD9A 1KYWA 2FPUA 3V80A 10MHA 2PJZA 4WFKA 1LW7A 3RTBA 4QWWA 4O4HA 3S0JA 2E4ZA 2A78A 2IEDA 1FEZA 1ZJYA 3EVCA 5J1TB 4ZQHA 1QQ5A 1EVLA 1WZCA 2ETXA 3FHCB 3HXOA 2Z9CA 3QFHA 2JG3A 4KXUA 5HUHA 1DFIA 2GMWA 1Y8RA 1JZTA 2R60A 2OQ2A 8MHTA 1ZK1A 2CXXA 5JFOA 3OJFA 4JELA 4DCCA 2AFRA 3HP7A 4M1QA 4OFWA 1JXOA 3D6TB 4UTXA 1XLTC 1YBFA 5D5PA 3MCWA 3JQ8A 3E0XA 1Q22A 4KPUA 1XVUA 4BZZA 2QDKA 2XIQA 3ZCVA 3OBIA 3G0CA 2R86A 3CVYA 1NN5A 3V42A 3L43A 5IKMA 3HXQA 1T2NA 1AOXA 1KORA 2F1OA 4MP6A 5E2BA 4EY4A 1HYEA 4F72A 2P5YA 1PUJA 3AKZA 3LRTA 2XUZA 2IY8A 4XA8A 4DCMA 4EPWA 3SI7A 4ER3A 5F3WB 2WG1A 3A6PC 4J0HA 1XD8A 4M0DA 1IQRA 4AXXA 1KI9A 2P3SA 5DGCA 1RYFA 2CJPA 1LNSA 1ZJZA 4QRIA 4IMRA 2BEJA 2IWRA 4EEKA 3FCEA 3P0EA 3BMNB 1O6BA 3E5HA 2IH2A 1N5KA 3HZRA 4W5RA 1V47A 1ZMRA 1Z6XA 5IKPA 5KNCD 3G23A 4Q1CA 4CMEA 2RH8A 4B4KA 3VYWA 3LTEA 3WAKA 1ESZA 5MN4A 4CIVA 4AQ7A 2GWRA 3EGIA 2GBGA 2QG6A 3ETCA 4MVWA 3FMVA 3T4EA 3HDHA 1BXRB 2BFOA 4W5OA 5JAZA 2HEIA 4M3NA 1EUDB 4LE1A 4LSZA 3UH0A 4ZHQA 3GZTB 1VLQA 3WL4A 4BN5A 4EHDA 3AXTA 3HNPA 3QTBA 1JSLA 2AZMA 2C2WA 3F6EX 4BLQA 3L4BA 3AHEA 1YTUA 1ZZGA 2VZLA 1N2HA 5AUNB 1G8FA 3QWIA 4WWHA 2POCA 3ETGA 1E9CA 1PO7A 2OGUA 3HDVA 3HKCA 3BB4A 4UU8A 2Z2IA 4URFA 3OPQA 1IRXA 4YRAA 1QHYA 3N7TA 1YVUA 2CNWD 3Q0EA 4L85A 4B32A 3LM8A 2R2AA 3GLFE 3IAS1 4GS5A 1PL6A 4MUYA 3TD2A 4TVBA 3WB9A 5ABPA 1X1TA 2IUEA 1N4AA 2V3WA 2FN3A 3H8WA 2UVPB 1JHZA 2ZWIA 1Z47A 2IC5A 3ETHA 1U11A 3JY6A 3K9LA 3L92A 3PB3A 2VDVE 4GEKA 1C1XA 3ZVRA 5LDDC 1E5VA 4C7MA 2YWRA 4WASA 5LOVF 1XTPA 1EVYA 2FHSA 3OWXA 3AYXB 3BKWA 1KZ6A 2A4KA 3GGDA 1JBQA 4PAOA 5A0VA 4J29A 1QBKC 3AGQA 8ABPA 5F73A 2VUUA 1K5DA 1YAJA 3GQBB 3NTOA 3T3PB 2YN4A 3FBTA 1EE1A 1SU8A 4HDQB 4NU0A 1NHGA 5G0TA 1YI0A 5JNTA 5DLEA 1R8YA 4B75A 4Q1DA 2ZBVA 4AF6A 2BJWA 4OYHA 3B89A 3MVEA 2RAVA 3VOAA 4BX9A 5JQGB 1SQ5A 3N07A 2FB9A 1SXJA 2VP6A 1M6EX 3JQ7B 3A1SA 3GLTA 3SS9X 3WKDA 2I7CA 3DV0B 3W1VA 5I8ZA 3U4MA 3PHHA 4IOKA 3FCOA 3RVJA 3E2MA 3S7ZA 2XNCA 4CMEC 2D0DA 1HXHA 1VDMA 2H48A 5LIRA 4RGYA 1ZA2A 3A3KA 2VTVA 5DBEX 3UHFA 1Q0UA 5CAEA 3ZJ4A 4OXXA 2J07A 3BHNA 3T95A 1LEHA 1H2AS 2KLBA 1PFGA 221PA 2O50A 2Q4EA 4MWCA 3KPVA 1WZNA 4TS3A 3NHBA 5CU7A 2HV9A 4NMHA 4A0FA 1BD3A 1P5JA 4FX2A 4J4BA 1Z6QA 4BIIA 4K8RB 1CZLA 4BWVA 5A5GA 1RCUA 2F3RA 5AQ1A 4UXJA 3IE0A 1JTVA 1MXFA 1PZMA 5EE5B 3UO8B 4EFNA 4UFPA 4YUXA 2IHKA 5K1ZA 4HFJA 4KN6A 2BLLA 4LNHA 1RWVA 5AVTA 4IIVA 1KYTA 3PUYA 1EXDA 5AKXA 5C5CA 4KQ6A 2ONJA 2HMVA 3B78A 1NLMA 4EKNB 3HVHA 5EWLA 1Z2DA 3PR2B 1PWXA 1TZJA 2FNAA 4QBHA 4X6UA 4FUTA 3P52A 3IAHA 2AG6A 2Q9UA 3E48A 2P3LA 2B7LA 3JQGA 4MICA 4IRXA 4PO8A 3ZLJA 4Q16A 3ZE1B 1EE2A 2Q0XA 1OI3A 3I2FA 1O9BA 3FZNA 4BNUA 2AIRA 5K0NA 4K28A 4MUJA 2IIVA 1TOAA 4G4JA 4MQFA 2NPFA 3O8CA 3UMFA 2FPGB 1YJ8A 2SICE 3NI2A 1FNBA 3H2BA 1VJ1A 3KV1A 3P27A 3ZJTA 2Q29A 3MCUA 4BCBA 1KZ1A 4KRFA 3FUCA 4E5SA 1DAPA 2WHYA 5C8XA 1KI1A 5D87A 1F38A 2JHCA 4OU4A 3SYLA 2WYOA 1MT0A 1RJEA 3VNUA 3T7JA 5CH3A 4P35A 1LNZA 3KZMA 5E1OA 1GL9B 2EFYA 2EJCA 4QFDA 5BYAA 3BTOA 4O2AB 5KS2A 4URHA 3H1EA 4FEYA 3P0RA 1L3IA 1YDHA 4UNQA 2JS7A 2OC4A 2AX4A 1NYRA 1W4CA 4U5XA 1E8NA 1OA1A 1L4BA 2HXYA 4AZVA 4UEKA 1QFMA 1PFUA 3PXAA 3EIEA 2ZXUA 1VKNA 3LNTA 5TGTA 1U2DA 4NFSA 4R68A 1K75A 1X1QA 4IIGA 3O8BA 1MRSA 4YR7A 1Y5IA 2IZZA 4YJ2A 2XCTB 4WJZA 3P1JA 2C5HA 4M9RA 4A8TA 4B5LA 4B2YA 2XQVA 3IDFA 1L4KA 3EJWA 3KOUA 5TEWA 3GLHA 4EPRA 1XBTA 2YHSA 5JALA 3BICA 2HSJA 1Q77A 1JAZA 4RPLA 4EW1A 3W2FA 2WF6A 2J6HA 4RVUA 1K2VN 3M2PA 1EGMB 2IXEA 3PRKE 2MT9A 3EMDA 2H4WA 5E7IA 2IHYA 3OEWA 1QP4A 1M54A 4RZHA 4BNMA 1XVVA 2YRWA 5EHGA 4IUBS 1DINA 3TFOA 5JISA 2IPLA 1UKVY 2C57A 2NVOA 2ZRHA 1F60A 2XYHA 5BSWA 4URVR 1BO6A 1VTKA 2O8DB 3Q3IA 4LISA 2ZE7A 5JE8A 3SQDA 1I7PA 4I55B 3W9BA 1XMIA 3EZ6A 3ZE2B 3AVYA 3JQBC 3ORHA 4PC6A 4DJTA 1J0BA 2FGKA 3JRNA 2GEKA 5DYTA 4LG1A 4OHPA 4AF7A 1X7YA 1FDOA 2H3EA 4R7TA 5JWHA 3L7KA 1V16A 3K8OE 4NE9A 4OXKA 3IR5A 3A26A 4Y1EA 3HGQA 2EBUA 1M2VA 4K0RA 1EA5A 3BWYA 1Z37A 1GNLA 4W8GA 3RBXA 3ZHVA 3U4QA 4P54A 2L2QA 4NCBA 2CZGA 1CR6A 2HRZA 4IFIA 5AI4A 5IPFA 3SM3A 1JF8A 2IYPA 1I7DA 3J81A 1L7BA 4I2NA 1GZDA 3B1JA 4CLEA 4IH1A 4KBYA 2CHQA 3K5WA 1GILA 4F8EA 4KUGA 2C84A 3N7UA 4OCZA 4RSHA 1XRNA 5F9FA 3KQSA 2WP8J 3RTEA 3U56A 4CLRB 5DSTA 2ZK7A 5CT9A 1FFCA 2ZB3A 4HEA1 1W2WB 3E8MA 3QYPA 1RPZA 2LIPA 2H1FA 3C3JA 3VAAA 1XEXB 3WWYA 1EK2A 3SX4A 4LXGA 1L7DA 4NPCA 4HQLA 3DZDA 4RANA 3HS3A 2QUHA 2GJKA 3WNDA 2WFAA 3DKIA 4P83A 2PZMA 1VGVA 3NRJA 4EFDA 5DZSA 2DPYA 5CEJA 1L1RA 4O4IA 3U7QA 1SK9A 3Q5EA 3CZMA 2FPIA 4J0QA 1EWQA 1EVKA 3UHOA 1U3TA 3L2OB 2X0EA 3ZXUB 5IDXA 3VTKA 4D45A 2D3WA 4NMXB 3A37A 2A0KA 2ZJBA 5D84A 2IV2X 1AGPA 4CTKA 5H3LA 3M6XA 2P91A 3GUHA 4LX0A 5LA6B 2FV8A 1E2BA 2BP7A 1CP2A 2QXTA 1HFKA 5TF4A 3ROGA 4HGYA 5EFOA 3NOOA 1FRZA 4F46A 2ZUTA 2XB6A 1Q1EA 4C0HA 1W48A 2IBMA 1G55A 4DA9A 4MPRA 5KB3A 4HVLA 1SG0A 5A5EA 3I1IA 2WB4A 4BNFA 1ONSA 2QJOA 3LUFA 5JR3A 4X1KB 3R20A 3QVXA 2ST1A 1G8GA 4DB2A 2DHEA 1L1QA 3PVSA 3ZV3A 2PL9A 4QUAA 5C4MA 3AY3A 1YO6A 1EGHA 6ADHA 2YDXA 1KI7A 1X87A 4D8XA 2DLDA 5CFNA 4NJEA 5LOVB 5LU8A 3REFA 4A8HA 2YFKA 2LXNA 1NKTA 2YC4C 3MYYA 2HA2A 2VAPA 5JQWA 2W4IA 3NH9A 1UFQA 5EYPA 4IY1A 4U7DA 4GPTA 3TLKA 3D7SA 1GNVA 2Q99A 3AEZA 3DE6X 3RRMA 3HR8A 1ZA1A 4CDRA 4NE7A 5EHNA 5DYYA 3OQVA 1ZUHA 1CUVA 1VPLA 3RVMA 1N57A 4M0PA 3GFTA 5TPZD 5CDFE 3QRWA 3P97A 5FTNA 3G1TA 3E9RA 4LYAA 3TD6A 2O4UX 1RAGA 2ODEA 3FPCA 1BGXT 1K2WA 2AT1A 3OA2A 4NHOA 1YBAA 3RSFA 4B4DA 3G0GA 1V8FA 4EHKA 1Z83A 2A3NA 2JZNA 4ILKA 4LSWA 1ZBDA 2G5TA 3IVMA 5LZ7A 3RFXA 2GFIA 4UNRA 1UEXC 5EZ5A 4BWGA 1S3FA 3BE8A 1XJQA 3ETNA 4JXXA 4AYXA 3FR7A 4ESVA 4N9QA 3ESZA 1NE2A 4AJNA 4R71A 1OB5A 4DZTA 3HDQA 3ZPXA 3C7TA 1FS4A 1ISGA 1XP8A 1CIJA 3AT1A 3L05A 3BYZA 4B3MB 3MCTA 1T15A 2QL9A 3CGGA 3CZAA 4AK9A 4FK8A 5C5DA 1D4FA 4LV8B 2YWFA 3M9WA 5FNZA 2Q1SA 5T67A 4BJ6A 3PJFA 2P1DA 3C6KA 3S27A 1CLEA 3WOVA 1UL1X 2PT7A 2R84A 2XUQA 1TQ2A 1F20A 3EW9A 3EA0A 2VDNB 5IKOA 2RAFA 3KQMA 4RY0A 3D8UA 4XUDA 3W7VA 1NG9A 1XKLA 2VAWA 4TXJA 1E62A 4JL8A 2ZRMA 3D81A 3FB4A 3RADC 4ARSA 3EZFA 1JALA 4DWJA 2G9UA 2J5BA 4RTPA 1Q3TA 5AHKA 3UKDA 4TYWA 1OPRA 2GZRA 4BNTA 4AD8A 4P5PA 4FMDF 1E2UA 1YZNA 4DSOA 1DADA 1EG7A 4KPGA 1IBLB 3WGGA 3QYFA 3B7PA 2HDHA 1AXEA 5FBZA 2PBLA 2HWKA 5BSRA 1AMUA 2YMLA 1RAAA 4HN9A 5ITZA 3EAQA 5IHPA 5EPEA 3VC1A 5KC8A 1U3VA 4Q3OA 5A03A 2UXBB 4B5KA 3L0OA 5H59A 4BO5A 3I53A 4XUGB 1EAYA 1H1LB 2AH5A 1AK9A 2UZ3A 1NVWQ 4I2VA 4D3SA 2EW2A 2V4ZA 3ACBA 4EA9A 1YR7A 1M1UA 2WG2A 4YMVA 4N41A 4GXRA 3BGWA 5FHRA 4BLWA 4LBWA 2XTMA 3TN7A 2CXRA 4L9SA 3V3TA 1G9TA 1ZCZA 1D9ZA 2DUNA 1V4VA 2FHPA 4QAJA 4Y0AA 4C01A 4KR0A 2DC1A 3QEOA 2PMWB 1FQOA 1ORHA 2RBGA 3LBAA 1GNPA 4YX9A 4IKOA 3KE8A 1MB9A 4YYEA 3HRHA 3WQBA 4B3BA 1CUCA 3RYCA 2ORYA 3H7IA 4KUEA 4AXBA 1ZH8A 5JSYA 3MB5A 3MPOA 1RYNA 1JEJA 3PNVA 2H1CA 3BIWA 1L7PA 4R8MA 2XNSA 2DR0A 3HBAA 2JGNA 1U0HC 4HDMB 4RE5A 3WJ2A 4R31A 4G0QA 4KVAA 2NXEA 3WSVA 1T1IA 3X44A 1L7QA 4QDZA 4OJKA 2R97A 2HXGA 3E7DA 3PT5A 4Z3DA 4BNWA 1R15A 1ZVVA 4PBSA 1KI2A 1TYDE 3IAS6 3RIHA 4RKEA 1XQXA 1YQDA 4XUCA 3E5RA 4A7PA 1KO1A 2F8MA 1V8ZA 3OP1A 1Q17A 3QKWA 1GZ5A 2YS6A 4YDQA 5ALWA 3EBOA 3ZWWA 2HYIC 1B4DA 5CX1B 4TS4A 3WJAA 1CEEA 2R1TA 3TIXB 3ZNPA 721PA 4UNSA 2OO5C 1EFRD 3HY3A 1VCOA 3P9SA 1NFFA 1TGVA 2WUVA 1SIBE 3QG1A 2R25B 4JLMA 1UBHS 3GGJA 3PXXA 2MSWA 3RS8A 3FY4A 2ZJ6A 4X00A 4HGZA 1YCFA 3PNBA 1SJ9A 5C52B 1XV5A 4YROA 3KQKA 1AJEA 2PKWA 1CRQA 4P4SB 2XA9A 2IVFA 1PJQA 5AI5A 4CIAA 1HDGO 2ACVA 2DTEA 3PK0A 3W5UA 4BOYA 3AVXA 2Y71A 1ODJA 3WHKA 3J80A 4V0KA 2QUKA 1JDJA 1I5OA 4HRAA 2EJVA 2OBNA 4L51A 5G0UA 4Z7JA 4AG5A 5D3MB 5KTSA 1TD1A 3ZN2A 2RC5A 3DV9A 4OLFA 1LX6A 2EFEB 3V55A 1AS0A 1EZ1A 1P7ZA 2QVXX 1I10A 3I45A 2QYOA 3LQQA 1GCUA 3NP7A 4O2BA 2BKUA 3KJHA 4HGNA 3UC5A 1V8OA 2BWJA 5DTMA 1QHGA 4A0SA 4B76A 5CM8B 2VDMB 4DCNA 2D7JA 2H51A 5KQMA 2D7DA 1R0ZA 5DCYA 5EERA 3H2ZA 1ZUWA 2O7QA 1XAJA 1H2EA 2J4DA 2R5NA 3JQDA 3PP8A 4YUYA 4H6XA 4MRSA 4DDUA 1N2CE 3I04M 3EA5A 3SBDA 2EVWX 2Z5FA 3D7KA 3T5CA 3TIFA 4B46A 1SZJG 5FWAA 4E33A 4Q7QA 2VQFB 4OHKA 1AK2A 3I01A 3JQ9A 2WVGA 3PWSA 3H9BA 1WUJS 1IXKA 3EDMA 1Y3DE 3GUCA 3OFJA 2I22A 4KZKA 3SKYA 1YUNA 3M4NA 4P38A 3E7WA 3V1UA 2VP3A 2GERA 4L4RA 5JCZA 5EVCA 1M2KA 3AL2A 2QS9A 2V7TA 5TF0A 1TGYA 2R6FA 1EFHA 2Z3VA 1R2QA 1PEKE 4RIFA 4RFSB 5G0SA 2RIPA 2WKQA 5DJ5A 3LVBA 4CMCA 1N6KA 3CT4A 5E7JA 3P2EA 2Z57A 4XGIA 5GADl 3FLMA 1TJ3A 5EMNA 1VCMA 3W2HA 1L8AA 4OYYA 4UHEA 4YXWA 2C42A 5T3YA 4HQFA 4UBIA 4FFSA 3U09A 1LQTA 1JR3A 2Z58A 2JZCA 1OZFA 1YJCA 2XBLA 4RPKA 1A2QA 1V3TA 4M37A 4MWOA 3C1UA 3R7BA 3LO8A 1PS0A 4LYDA 3GLKA 1N6HA 2JD1A 2OBBA 5HS6A 1KEVA 1D1TA 3EB9A 5ED0A 3X2SA 4EF6A 5EPOA 3HJTA 1QRRA 1BVHA 7REQA 2ZSKA 1PSDA 4X3CA 1TQHA 1P0QA 2O06A 4OGGA 1GG2A 2C8JA 1YU6A 5DHAA 2V7XA 3JD4A 3RRXA 4TGLA 2FX5A 1L4GA 1VQ1A 2QU8A 2W8BB 1GYRA 4DT1A 3FPFA 2YKOA 2GYYA 1DHT<