4POBA

Crystal structure of a thioredoxin rv1471 ortholog from mycobacterium abscessus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
DHATVTVTDDSFQEDVVSSNKPVLVDFWATWCGPCKMVAPVLEEIAKDHGEALTIAKLDVDANPETARAFQVTSIPTLILFQNGEATKRIVGAKSKSALLRELDGVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a thioredoxin Rv1471 ortholog from Mycobacterium abscessus
rcsb
molecule keywords Thioredoxin
molecule tags Oxidoreductase
source organism Mycobacterium abscessus
total genus 32
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4pobA00
2KLXA 4NHWA 5G30A 2F8AA 1JZOA 2HT9A 2LRNA 4EC0A 1VF4A 1WE0A 5CYYA 4F0CA 5IMZA 4OFMA 1FG4A 3FYGA 3G7IA 2L5LA 4IW9A 1A0RP 1EZKA 3P8WA 1AXDA 3KD0A 1GUHA 3TCOA 3CRUA 1EEJA 2H01A 3BJ5A 5A4UA 4I5QA 3GMFA 4JU5A 4D73B 3UVHA 2H1AA 3F4TA 2YWOA 4KCEA 4HUAA 4BWSA 2VM1A 4I2UA 1TKDB 3QDNA 3LG6A 1E2YA 3DEXA 4AGSA 5DAKA 1SKRB 3FEUA 1HQOA 2B5EA 5KEJA 4TXOB 1GL8A 4TVEA 3E9JB 5F06A 1T00A 3WGDA 2GLRA 4GWRA 3L4NA 3ZIVA 1MEKA 3APOA 3QMXA 1JZRA 1YY7A 2IMKA 3P2AA 3G7YA 1M2BA 3W8SA 5ECQB 1PRXA 3LXTA 2C3QA 2ZCTA 2GSQA 2GSTA 2X8HA 2GSSA 3KEBA 4O92A 3GIXA 2FD3A 1V57A 3IOSA 3D22A 4GSNA 3TJKA 4K7OA 2DJJA 2YWIA 5D9XA 1EP8A 2IMEA 4V2LA 1AAZA 1BG5A 2C0FA 3DWVA 3GH6A 5D93A 3BBYA 1IYIA 3IK7A 3LGCA 4POBA 2OBIA 6GSUA 4EF0A 4O32A 2VCVA 4K2DA 1Z5YE 1HD2A 4EDZA 3F4SA 2LQQA 2ZUPA 1F9MA 3EURA 2BTOT 1GTUA 5KN1A 1H4OA 4X0XA 4JZQA 4MH3A 2HRNA 4ML6A 2YV7A 4IJIA 2R3XA 2YPMA 2M46A 1AUCA 1Z9HA 3HHVA 3ERWA 5CRGA 5ECMB 2DC5A 2NDOA 3C7MA 4ID0A 5CRWA 2M80A 1OE8A 2A4VA 4HU7A 2OE3A 2VM2A 2C3NA 2GVPA 1XPVA 2WJUA 4KGIA 2QC7A 1SK1A 4MF5A 4GRFA 3A3TA 2XHFA 3A5WA 1GUMA 3GTUB 3J7Yk 3TJGA 1AQXA 2AB6A 1SKWB 2F3MA 2B3SA 2C0DA 3KH7A 3GN3A 1B9YC 2F8FA 3U6VA 4LL1B 4OO5A 2H0GA 1DBYA 3N5OA 3M8NA 3O76A 3DD3A 2HYXA 3TKSC 1BYEA 1C72A 1PMTA 4TOPA 3NIVA 4XRDA 2C3TA 4MPFA 2I81A 1FB0A 2WGRA 4OO4A 3ZMKA 2LNSA 4PXOA 1THXA 5JWRB 1B4QA 1LU4A 2REMA 4GCIA 1CQGA 3CMIA 2C8UA 2KOKA 2FA8A 1GH2A 4ISDA 5G5FA 4ECJA 1M0UA 1SJIA 1MD4A 2N5FA 1G6WA 1ERVA 1J0FA 3U5RE 2GQLA 1KBNA 2GTUA 1XBSA 4CHSA 4J57E 1X5EA 4EKZA 4DSRA 5J9BA 5INYA 3TRQA 1ERUA 3RPPA 1QUWA 1GSDA 3IXRA 3IK9A 4PQ1A 3O6TA 2LJRA 2H6YA 4RI7A 3GSTA 2V6KA 3CYNA 4ZXGA 1V2AA 3UMAA 5G1KA 4BVYA 1X5CA 4GTUA 2M72A 4X43A 2JSZA 4NXIA 1TU7A 2XBIA 1ACVA 5AIXA 2HFDA 1WWJA 1QK8A 5CREA 5CNWA 2G0FA 1FB6A 1YKAA 1U87A 2WDUA 1LBKA 1AQVA 2VO4A 2E7PA 1SL1B 5EVOA 1X0RA 2YWMA 3TOUA 4LL4B 3DXBA 4L8EA 4WXTA 3GX0A 2VUPA 5C00A 1SD8A 1SL0B 2V6OA 1URMA 1WIKA 3V1WA 4GF0A 5JWOB 1SK2A 1OC9B 1X9WB 5E4WA 4TR0A 4DSSA 2AYTA 2GQKA 2X64A 4AJ8A 6GSXA 1XWGA 2TIRA 4WKWA 16GSA 1OC8A 3A2VA 3FR6A 3KJYA 2FY6A 5ECPB 2FWEA 3IC4A 4KDYA 3ZITA 1DUGA 1QQ2A 4KSMA 1TTZA 6GSYA 1KEBA 1XCCA 1PX7A 1MDIA 1TJDA 3GL5A 3IR4A 2H6ZA 4FO5A 5HR0A 4NPBA 3ISOA 3UL3A 5IOXA 3QD9A 1S3AA 1K0NA 2YNXA 1S3DA 4OD7A 3TRXA 4MABA 5LNKe 2H72A 1Z7PA 1V40A 2PVQA 5DJLA 1BX9A 5GSTA 2IJYA 3EVIA 2YZHA 2DJ0A 1JZDA 1R4WA 1J08A 1MDKA 1NW2A 3UOMA 2H1BA 1OAZA 3C71A 3W6GA 2NBSA 3VWWA 1VRSD 3IE3A 4KDXA 4NV5A 4TR1B 3KM6A 2F9SA 4EO3A 2L6DA 5IMDA 5AGYA 3VLNA 5IMCA 1GLQA 5B8AA 2HRFA 3QFAC 3F8UA 3HKRA 3C1RA 3MAKA 1R5PA 3TJFA 3EE2A 3UARA 4YAPA 3IBHA 3HJMA 1EGOA 3KIJA 5AN1A 1T4ZA 1GSFA 3TGZA 2LS5A 1MTCA 4PQIA 3EYTA 2Z9SA 2AJQB 4OCEA 3I9V2 3GKMA 3G9BA 1DE1A 4HZ4A 2CVBA 3D21A 1XVWA 14GSA 1Z3EA 2R6KA 2WS2A 4ML1A 1T8EB 2JADA 3GURA 1W4VA 1M99A 3LJRA 4MCUA 5LD0A 4XCSA 4DSQA 1GTIA 4ZB9A 2O87A 3D6IA 3FR3A 1YEPA 1O85A 3HVSA 1K0DA 2OACA 2VLVA 1M9AA 2LRTA 4FYBA 2DIYA 5H5RA 1O7UA 1ZZYA 4ECCA 3CXGA 4O5RA 4F03A 4JR4A 2GT5A 1GWCA 1OKTA 1M7TA 2P0GA 4OWYA 1JFUA 6GSVA 3F63A 5COHA 1X9SB 2MMNA 5H5QA 5HQPA 4XS4A 4JEDA 4PX1A 1SENA 4WBRD 1SD9A 4ZIJA 1PD21 3A2XA 4ECIA 5E59A 4NMUA 1A2LA 4MJCA 4TR4A 2L4QA 3F6DA 3FK8A 2DBCA 4Z7XA 1EWXA 3KMOA 1PKZA 3DIEA 3TKSA 1PA3A 2R5GA 1GTBA 3C1SA 3BOAA 5ENUA 1QGVA 2CX4A 2KHPA 5IM9A 4FIWA 4XS6A 2OE0A 1XZOA 2J9HA 2C0GA 5DVBA 2RIIA 5DJMA 1A23A 5AISA 2IMIA 2VCXA 4N11A 4N0VA 2IL3A 22GSA 4MA9A 4QQ7A 5J4UA 1Q98A 5F8BA 2E2MA 2V41A 1HNAA 1FHEA 20GSA 1ZYEA 5CRDA 2O7KA 3CBUA 1B8XA 1FAAA 1U3IA 2AAWA 1Z7RA 3GKKA 3QR6A 1TRUA 5J41A 4TRXA 7GSSA 4N30A 5ECOB 1GUKA 4POMA 4NV2A 2HSHA 4K7NA 4MJEA 2RM6A 1T7PB 1FW1A 2GZYA 1XXUA 1BEDA 1ERTA 2E0QA 2YANA 2QKEA 1FVJA 5LCZA 4I6XA 5DQYA 3DVXA 5CAXA 3C8EA 3EU4A 1FO5A 3M0FA 4QL7A 4EVMA 2NPBA 1HYUA 3HYPA 2WB9A 2ALBA 1O8XA 3TUEA 4MZWA 5HR2A 2EIRA 2ON5A 2MMZA 2VAFA 2XPEA 2E2GA 2LEGA 2OKAA 2L6CA 5IOWA 3HD5A 1EP7A 3GX8A 1B4PA 2WZ9A 3BCIA 3IV4A 3UBKA 5DALA 1QFNA 3IHQA 3TKRA 2QSIA 4ZBDA 3VFIA 3UEMA 4MF7A 3M9KA 3GKXA 3DYRA 4OMVA 2LV3A 5JWQB 4LA1A 2IFQA 3GL3A 3F4RA 1EV4A 2H1GA 2LTKA 1WP0A 1BJXA 4EE0A 4V1Ap 1JHBA 3HVXA 5GAND 1E6BA 2HZEA 4EL1A 2IN3A 1THOA 3QAVA 3TOTA 3GA4A 3ZLPA 2C1YA 1GULA 2DJKA 5A4VA 2GT6A 2IWTA 5D9VA 2YWNA 3WT2A 3ZREA 2PUKC 5F07A 2JZTA 4L5LA 4EDYA 4G19A 3C73A 2RUFA 1ZGNA 5B6MA 4MH2A 4JE1A 1PGTA 3GH9A 1XWAA 2CQ9A 1ST9A 1F37A 5AIVA 1T3BA 1TI1A 4AJ6A 3S9FA 2VL3A 1TK0B 1O73A 2NVLA 4MLYA 4FYUA 4MZCA 3R2QA 1XW5A 5A4WA 2C0EA 2I3YA 3Q6OA 3NZNA 3CRTA 4KA0A 4IQAA 2H19A 2FGXA 1U88A 2K18A 5FT3A 1Z6NA 2VL9A 1ZOFA 4D73A 5G2ZA 2JL4A 3FZ5A 2H70A 5KN0A 2HNLA 3KH9A 3VPQA 3A2WA 4TKYA 3MSZA 1GSUA 2A2SA 2QGVA 1FVKA 3UAPA 4PNFA 3M3MA 5C04A 1VGLA 3I6AA 3RPNA 1XFLA 4DVCA 1A8YA 2VCTA 3CTFA 1Y6EA 4WETA 1GNWA 2K8SA 2GS3A 2JACA 3DGQA 1G7OA 1V58A 3DVWA 3FZ9A 4O7HA 4RQXA 4WBJA 3LFLA 1PL2A 5IMFA 3VWUA 4LMWA 2BJXA 4POKA 3SWLA 2DSAA 2N5BA 3H8QA 4V1Ag 4KH7A 4HJ2A 2B5YA 2GZPA 3UIWA 1DSBA 4GSSA 1XWBA 1AQWA 1HNBA 1NM3A 1TK5B 2YP6A 1G7EA 2HE3A 2I1UA 2VOCA 5ID2B 5JCUA 5JCWA 1K3YA 5EPFA 3TJJA 2VCZA 3H4KA 4J56E 4ZL8A 4K9ZA 4CDOA 2PBJA 4Q5FA 3WYWA 1EGRA 1WOUA 3RDWA 1RW1A 5J3RA 3IRAA 5HFKA 3ERGA 3IPZA 2L59A 4GQCA 3RAZA 2CVKA 5GSSA 4WF4A 4ZBBA 3L0HA 3TKQA 5IMVA 1KTEA 3GYKA 2YV9A 3ZIJA 2AUVA 3ZVJA 3HZ8A 2FA4A 5CRHA 1Z6MA 1X9MB 2HI7A 4AJ7A 5F0GA 3BCKA 3HDCA 3NOFA 2CVDA 3DRNA 3FKFA 1ABAA 2H74A 2PERA 1TRVA 3KP8A 5CP1A 2HSYA 2H73A 4K0NA 5G5EA 2OE1A 4G9HA 1LJRA 1YJ6A 3TRPA 2CZ3A 2RUEA 4ZL7A 1RK4A 5DAKB 2K9FA 1I5GA 4YQUA 4IN0A 4MP4A 6GSTA 1WPIA 4ZB6A 2FWFA 2TRCP 3BD2A 5IPGA 3VI7A 2LSTA 1TRWA 2CAIA 4GSTA 3OR5A 1XOBA 3CSHA 2H76A 5CO3A 4BWQA 1TU8A 1UA5A 1ZMAA 4K1FA 2OADA 3D5JA 2H30A 1FOVA 2EIOA 1QMVA 1YF1A 4IVFA 3TDGA 2XC2A 5ECSA 3O3TA 3GKNA 4KSOA 4ECBA 1OE7A 1OYJA 3LXZA 3ZZXA 3LYKA 1F3BA 2VLTA 5ECLB 5H5SA 5ECRB 4EUYA 2DMLA 2FNOA 2FCHA 2OBKA 4IGJA 3VURA 1R7HA 1TP9A 1TOFA 1GSSA 2O8VB 3RHBA 3ME7A 1ZYQB 4HQZA 3F0IA 1UC7A 1VF3A 3PH9A 4XRAA 4BPYA 2WFCA 3FR9A 5DALB 2LQOA 1IYHA 5DCHA 3G7JA 3VWXA 4F82A 3GRXA 11GSA 18GSA 2P31A 4KCAA 1WMJA 3CSJA 4GXZA 1GSQA 1SKSB 3ZFLA 3KXOA 3EMPA 2H0HA 4WR4A 4MMMA 1YF0A 1RQMA 5HFGA 4MJBA 5G31A 3W8JA 2L4CA 1I9DA 5IIZA 2H75A 3HJOA 1TK8B 3LSZA 2PVOC 1A2JA 4OFTA 4Q5RA 3HY2A 3TB2A 2ON7A 5DQSA 3EINA 4HOJA 2HZEB 4OFNA 1EOGA 3ED3A 4FH8A 2FWGA 4RUVA 2VL2C 4QL9A 3WGEA 3APQA 4HDEA 1YZXA 1OC9A 3QOUA 4ZBAA 2I4AA 4EXJA 2LJAA 3P7XA 1ML6A 3FRCA 1XVQA 4L0WA 3KCMA 1QXHA 1K0MA 2G2QA 3ERFA 2VD0A 5DDLA 2XPDA 4HZ2A 2GSRA 2R37A 1HNCA 3KMNA 2D2ZA 4YQVA 3Q19A 1XWKA 3GFKA 4KDUA 1ZL9A 2RM5A 4Q5NA 2AHEA 5ELGA 4XHMA 2P5QA 2GDRA 3WGXA 1CQHA 1BQ7A 1F3AA 2X8GA 3IAM2 5A5KA 1G6YA 5KN3A 4IS0A 1XOAA 4HU9A 2H6XA 10GSA 2YZUA 3LWAA 4PUAA 1K3OA 3CTGA 2B1KA 4MDCA 4XTSA 1A24A 5HR1A 1U3AA 5FWGA 1K0CA 1XWCA 2VIMA 3H79A 2PMTA 3GNJA 5G1LA 1JZWA 2DJ2A 2OA7A 3FY7A 1ILOA 4BVXA 5FHIA 2K8VA 1A2MA 1PN9A 4IQ1A 2PPTA 4K0GA 2DMMA 2PN8A 4FYCA 1TW9A 13GSA 3UBLA 4WEYA 2MMAA 2B7KA 2YN1A 3FW2A 4TR1A 3H93A 4J2FA 2DJ1A 1KNGA 1B9XC 2MBSA 1USBA 2PWJA 9GSSA 1DE2A 4WF5A 5EY6A 2VCWA 1EEMA 3ME8A 3MDKA 5F05A 2IMDA 5D8IA 2PU9C 4KAEA 4DSSB 4E8HA 5B6NA 1R26A 4V2MA 2KUCA 4N10A 4MPGA 1VF1A 5ECIB 1M2AA 3WT1A 2LRCA 1PKWA 2DJ3A 4NHZA 4XIHA 1PX6A 1SU9A 2FHEA 2XBQA 4K7IA 1JLWA 1T1VA 1XW9A 5DCGA 4MF6A 1M2DA 3IDVA 4L5OA 2GZZA 3J7Yb 2P5RA 3GV1A 3VK9A 2RLIA 2IPAA 2LJKA 3P90A 5DBQA 4PQHA 4ACSA 3M9JA 3FHKA 2MBTA 4YAVA 4PURA 3D4MA 2TRXA 1Y25A 1F6MC 5J9CA 2AV4A 4ZILA 1YEXA 4KNDA 1TRSA 4TXVA 1AIUA 4G2EA 3E3EA 2VCQA 1K0BA 2CX3A 2LKUA 4LLRA 1V98A 2FLSA 3LYPA 5HR3A 17GSA 4LMVA 2GGTA 4V2NA 1AC1A 1GSYA 4IP6A 2CAQA 1GP1A 3JCML 3GUSA 4ZB8A 3HCZA 19GSA 1F2EA 2MZCA 2CV4A 1SK0A 2ES7A 1GNEA 2VD1A 4KX4A 2PGTA 3VPTA 1A8LA 2H0IA 2JSYA 2HLSA 3EU3A 3RHCA 5D96A 3SBCA 4HEA2 4K8MA 4JRRA 4RQRA 4KE3A 1S3CA 3HXSA 3L9SA 4F0BA 4PGTA 3D4TA 1GLPA 3HJPA 12GSA 3L78A 3Q18A 2YJHA 4IHUA 3GHAA 3HZ4A 5GZZB 1BAYA 1ERWA 2YCDA 2B7JA 3PGTA 3K8NA 3N9JA 1K0AA 4WR5A 4TXOA 4MJAA 2VLUA 3EMXA 3KTLA 4I2TA 2V1MA 1NHYA 4YQMA 4E8EA 3HA9A 3ZRDA 1AW9A 4F2IA 5JCGA 5KN2A 3I43A 2N5AA 5IPHA 2ZNMA 5ECHB 2C80A 3E0UA 4NWYA 4HI7A 4POLA 2H8LA 1G0TA 3QPMA 1N2AA 1ZCPA 4BA7A 4P3YB 1MD3A 5D9TA 2H1DA 4H86A 3QFBC 1OVNA 4L0UA 4CW9A 3I69A 1OKDA 5ECNB 4XS4B 3ZYWA 1SJ6A 2IMFA 5L71A 1OC3A 1YDKA 4TN8A 2KP2A 1O8WA 1B48A 2WCIA 2VL2A 1TDIA 3LEFA 2I9HA 2HXKA 2IIYA 3LQ7A 1UVZA 4RI6A 3MWHA 1M9BA 3QAGA 5J5NA 4ILFA 1EV9A 3GSSA 4G10A 4K6XA 3KTBA 2V2GA 4Q5QA 6GSSA 6GSWA 4IELA 2C4JA 1TI3A 3IA1A 3FZAA 3ZTLA 4OCFA 2BMXA 4DEJA 2K6VA 1GRXA 3RBTA 3WD6A 4NAXA 2J23A 1SL2B 5ECKB 3ZFBA 2V32A 3MNGA 4YH2A 2LUSA 4KB3A 2B5XA 2X99A 5ABRA 1J9BA 2YJ7A 2F51A 3KGKA 2LNTA 1H75A 3DKSA 1O6JA 2CA8A 4N0ZA 3KZQA 1R5AA 3GTUA 3F6FA 3D0ZA 1PL1A 3F3RA 4X1UA 3M1GA 3DMLA 2MMOA 4MK3A 5IQYA 3UJ1A 4IJ3A 3APSA 1SYXA 3AY8A 1X5DA 1U6TA 3EC3A 3PR8A 3F3QA 2WRTA 1GTAA 4TW5A 2L5OA 1WRYA 4PNGA 4GLTA 2HZFA 2A2RA 3QCPA 3VWVA 3TJBA 1ON4A 1SYRA 4HJMA 3ZL5A 4ULXA 1NHOA 1VF2A 2R2JA 1JLVA 2FWHA 4F9ZA 1GSEA 3EWLA 2WULA 5GAPD 1K0OA 2DIZA 1YQ1A 3L9UA 4TR3A 4I97A 4IP1A 3TKPA 1W89A 3FZ4A 8GSSA 2X8CA 1PSQA 3QAWA 4MZBA 2GQMA 2EC4A 1PQNA 2JZRA 4IBPA 5IO0A 1O81A 2B1LA 3PINA 4XS1A 1Q4JA 3Q74A 2O85A 2H71A 4JR6A 3ZVJD 2IFQB 1XIYA 4KUNA 4IKHA 5EL8A 3L9VA 1YKCA 3TKSE 1K3LA 4HS1A 2DLXA 3F9UA 4ZL9A 1EOHA 4HQSA 2KP1A 3CSIA 4KW6A 1MDJA 5D73A 5B7CA 2NTOA 4JBBA 1V9WA 1A0FA 2YOIA 2CZ2A 3VI5A 4AF2A 5ID2A 1TXXA 1SJZA 3IAS2 2MYGA 2L57A 4BL7A 1T4YA 1UN2A 4I8BA 5B8BA 5D9WA 2B6MA 2H66A 5IMAA 2FUG2 2R4VA 3LORA 3ZMLA 4GQFA 4PUFC 2EIQA 2OJLA 1N8JA 1XW6A 3HVVA 5IO2A 2JU5A 1WJKA 2CT6A 3H1NA 5ELAA 3KP9A 5HFIA 1NSWA 3UVTA 3US3A 2JZSA 2O89A
chains in the Genus database with same CATH superfamily
2KLXA 4NHWA 5G30A 2F8AA 1JZOA 2HT9A 2LRNA 4EC0A 1VF4A 1WE0A 5CYYA 4F0CA 5IMZA 4OFMA 1FG4A 3FYGA 3G7IA 2L5LA 4IW9A 1A0RP 1EZKA 3P8WA 1AXDA 3KD0A 1GUHA 3TCOA 3CRUA 1EEJA 2H01A 3BJ5A 5A4UA 4I5QA 3GMFA 4JU5A 4D73B 3UVHA 2H1AA 3F4TA 2YWOA 4KCEA 4HUAA 4BWSA 1M3JA 2VM1A 1XG8A 4I2UA 1TKDB 3QDNA 3LG6A 1E2YA 3DEXA 4AGSA 5DAKA 1SKRB 3FEUA 1HQOA 2B5EA 5KEJA 4TXOB 1GL8A 4TVEA 3E9JB 5F06A 1T00A 3WGDA 2GLRA 4GWRA 3L4NA 3ZIVA 1MEKA 3APOA 3QMXA 1JZRA 1YY7A 2IMKA 3P2AA 3G7YA 1M2BA 3W8SA 4USSA 5ECQB 1PRXA 3LXTA 2C3QA 2ZCTA 2GSQA 2GSTA 2X8HA 2GSSA 3KEBA 4O92A 3GIXA 2FD3A 1V57A 3IOSA 3D22A 4GSNA 3TJKA 4K7OA 2DJJA 2YWIA 5D9XA 1EP8A 2IMEA 2X49A 4V2LA 1AAZA 1BG5A 2C0FA 3DWVA 3GH6A 5D93A 3BBYA 1IYIA 3IK7A 3LGCA 4POBA 2OBIA 6GSUA 4EF0A 4O32A 2VCVA 4K2DA 1Z5YE 1HD2A 4EDZA 3F4SA 2LQQA 2ZUPA 4X4JA 1F9MA 3EURA 2BTOT 1GTUA 5KN1A 1H4OA 4X0XA 4JZQA 4MH3A 2HRNA 4ML6A 2YV7A 4IJIA 2R3XA 2YPMA 2M46A 1AUCA 1Z9HA 3HHVA 3ERWA 5CRGA 5ECMB 2DC5A 2NDOA 3C7MA 4ID0A 5CRWA 2M80A 1OE8A 2A4VA 4HU7A 2OE3A 2VM2A 2C3NA 2GVPA 1XPVA 2WJUA 4KGIA 2QC7A 1SK1A 4MF5A 4GRFA 3A3TA 2XHFA 3A5WA 1GUMA 3GTUB 3J7Yk 3TJGA 1AQXA 2AB6A 1SKWB 2F3MA 2B3SA 2C0DA 3KH7A 3GN3A 1B9YC 2F8FA 3U6VA 4LL1B 4OO5A 2H0GA 1DBYA 3N5OA 3M8NA 3O76A 3DD3A 2QA2A 2HYXA 3TKSC 1BYEA 1C72A 1PMTA 4TOPA 3NIVA 4XRDA 2C3TA 4MPFA 2I81A 1FB0A 2WGRA 4OO4A 3ZMKA 2LNSA 4PXOA 1THXA 5JWRB 1B4QA 1LU4A 2REMA 4GCIA 1CQGA 3CMIA 2C8UA 2KOKA 2FA8A 1GH2A 4ISDA 5G5FA 4ECJA 1M0UA 1SJIA 1MD4A 2N5FA 1G6WA 1ERVA 1J0FA 3U5RE 2GQLA 1KBNA 2GTUA 1XBSA 4CHSA 4J57E 1X5EA 4EKZA 4DSRA 5J9BA 5INYA 3TRQA 1ERUA 3RPPA 1QUWA 1GSDA 3IXRA 3IK9A 4PQ1A 3O6TA 2LJRA 2H6YA 4RI7A 3GSTA 2V6KA 3CYNA 4ZXGA 1V2AA 3UMAA 4K5SA 5G1KA 4BVYA 1X5CA 4K2XA 4GTUA 2M72A 4X43A 2JSZA 4NXIA 1TU7A 2XBIA 1ACVA 5AIXA 2HFDA 1WWJA 1QK8A 5CREA 5CNWA 2G0FA 1FB6A 1YKAA 1U87A 2WDUA 1LBKA 1AQVA 2VO4A 2E7PA 1SL1B 5EVOA 1X0RA 2YWMA 3TOUA 4LL4B 3DXBA 4L8EA 4WXTA 3GX0A 2VUPA 5C00A 1SD8A 2QA1A 1SL0B 2V6OA 1URMA 3MIXA 1WIKA 5BMUA 3V1WA 4GF0A 5JWOB 1SK2A 1OC9B 4PTSA 1X9WB 5E4WA 4TR0A 4DSSA 2AYTA 2GQKA 2X64A 4HSCX 4AJ8A 6GSXA 1XWGA 2TIRA 4G0IA 4WKWA 16GSA 1OC8A 3A2VA 4O5UA 3FR6A 3KJYA 2FY6A 5ECPB 2FWEA 3IC4A 4KDYA 3ZITA 1DUGA 1QQ2A 4KSMA 1TTZA 4G0KA 6GSYA 1KEBA 1XCCA 1PX7A 1MDIA 1TJDA 3GL5A 3IR4A 2H6ZA 4FO5A 5HR0A 4NPBA 3ISOA 3UL3A 5IOXA 3QD9A 1S3AA 1K0NA 2YNXA 1S3DA 4OD7A 3TRXA 4MABA 5LNKe 2H72A 1Z7PA 1V40A 2PVQA 5DJLA 1BX9A 5GSTA 2IJYA 3EVIA 2YZHA 2DJ0A 1JZDA 1R4WA 1J08A 1MDKA 1NW2A 3UOMA 2H1BA 1OAZA 3C71A 3W6GA 2NBSA 3VWWA 4BVXB 1VRSD 3IE3A 4KDXA 4NV5A 1PFOA 4TR1B 3KM6A 2F9SA 4EO3A 2L6DA 5IMDA 5AGYA 3VLNA 4K5RA 5IMCA 1GLQA 5B8AA 2HRFA 3QFAC 3F8UA 3HKRA 3C1RA 3MAKA 1R5PA 3R3EA 3TJFA 3EE2A 3UARA 4YAPA 3IBHA 3HJMA 1EGOA 3KIJA 5AN1A 1T4ZA 2HSMA 1GSFA 2HRAA 3TGZA 2LS5A 1MTCA 4PQIA 3EYTA 2Z9SA 2AJQB 4OCEA 3I9V2 3GKMA 3G9BA 1DE1A 4HZ4A 2CVBA 3D21A 1XVWA 14GSA 1Z3EA 2R6KA 2WS2A 4ML1A 1T8EB 2JADA 3GURA 1W4VA 1M99A 3LJRA 4MCUA 5LD0A 4XCSA 4DSQA 4Z2RA 1GTIA 4A5PA 3A5IA 4ZB9A 2O87A 3D6IA 3FR3A 1O85A 1YEPA 3HVSA 1K0DA 2OACA 2VLVA 1M9AA 2LRTA 4FYBA 2DIYA 5H5RA 1O7UA 1ZZYA 4ECCA 3CXGA 4O5RA 4F03A 4JR4A 2GT5A 1GWCA 1OKTA 1M7TA 2P0GA 4OWYA 1JFUA 6GSVA 3F63A 5COHA 1X9SB 2MMNA 5H5QA 5HQPA 4XS4A 4JEDA 4PX1A 1SENA 4WBRD 1SD9A 4ZIJA 1PD21 3A2XA 4ECIA 5E59A 4NMUA 1A2LA 2R0GA 4MJCA 4TR4A 2L4QA 3F6DA 3FK8A 2DBCA 4Z7XA 1EWXA 3KMOA 1PKZA 3DIEA 3TKSA 1PA3A 2R5GA 1GTBA 3C1SA 3BOAA 5ENUA 1QGVA 2CX4A 2KHPA 5IM9A 4FIWA 4XS6A 2OE0A 1XZOA 2J9HA 4CY6A 2C0GA 5DVBA 2RIIA 5DJMA 1A23A 5AISA 2IMIA 2VCXA 4N11A 4N0VA 2IL3A 22GSA 4MA9A 4QQ7A 5J4UA 1Q98A 5F8BA 2E2MA 2V41A 1HNAA 1FHEA 20GSA 1ZYEA 5CRDA 2O7KA 3CBUA 1B8XA 1FAAA 1U3IA 2AAWA 1Z7RA 3GKKA 3QR6A 1TRUA 5J41A 4TRXA 7GSSA 4N30A 5ECOB 1GUKA 4POMA 4NV2A 2HSHA 4K7NA 4MJEA 4BVYB 2RM6A 1T7PB 1FW1A 2GZYA 1XXUA 1BEDA 1ERTA 2E0QA 2YANA 2QKEA 1FVJA 5LCZA 4I6XA 5DQYA 3DVXA 5CAXA 3C8EA 3EU4A 1FO5A 3M0FA 4QL7A 4EVMA 2NPBA 1HYUA 3HYPA 2WB9A 2ALBA 1O8XA 3TUEA 4MZWA 5HR2A 2EIRA 2ON5A 2MMZA 1M3IA 2VAFA 2XPEA 2E2GA 2LEGA 2OKAA 2L6CA 5IOWA 3HD5A 1EP7A 3GX8A 1B4PA 2WZ9A 3BCIA 3IV4A 3UBKA 5DALA 1QFNA 3IHQA 3TKRA 2QSIA 4ZBDA 3VFIA 3UEMA 4MF7A 3M9KA 3GKXA 3DYRA 4EIPA 4OMVA 2LV3A 5JWQB 4LA1A 2IFQA 3GL3A 3F4RA 1EV4A 2H1GA 2LTKA 1WP0A 1BJXA 4EE0A 4V1Ap 1JHBA 3HVXA 5GAND 1E6BA 2HZEA 4EL1A 2IN3A 1THOA 3QAVA 3TOTA 3GA4A 3ZLPA 4Z2UA 2C1YA 1GULA 2DJKA 5A4VA 2GT6A 2IWTA 5D9VA 2YWNA 3WT2A 3ZREA 2PUKC 5F07A 2JZTA 4L5LA 4EDYA 4G19A 3C73A 2RUFA 1ZGNA 5B6MA 4MH2A 4KF9A 4JE1A 1PGTA 3GH9A 1XWAA 2CQ9A 3EPTA 1ST9A 1F37A 5AIVA 1T3BA 1TI1A 4AJ6A 3S9FA 2VL3A 1TK0B 1O73A 2NVLA 4CY8A 4MLYA 4FYUA 4MZCA 3R2QA 1XW5A 5A4WA 2C0EA 2I3YA 3Q6OA 3NZNA 3CRTA 4KA0A 4IQAA 2H19A 2FGXA 1U88A 2K18A 5FT3A 1Z6NA 2VL9A 1ZOFA 4D73A 5G2ZA 2JL4A 3FZ5A 2H70A 5KN0A 2HNLA 3KH9A 3VPQA 3A2WA 4TKYA 3MSZA 1GSUA 2A2SA 2QGVA 1FVKA 3UAPA 4PNFA 3M3MA 2R0CA 5C04A 1VGLA 3I6AA 3RPNA 1XFLA 4DVCA 1A8YA 2VCTA 3CTFA 1Y6EA 4WETA 1GNWA 2K8SA 2GS3A 2JACA 3DGQA 1G7OA 1V58A 3DVWA 3FZ9A 4O7HA 4RQXA 4WBJA 3LFLA 1PL2A 5IMFA 3VWUA 4LMWA 2BJXA 4POKA 3SWLA 2DSAA 2N5BA 3H8QA 4V1Ag 4KH7A 4HJ2A 4YKGA 2B5YA 2GZPA 3UIWA 1DSBA 4GSSA 1XWBA 1AQWA 1HNBA 1NM3A 1TK5B 2YP6A 1G7EA 2HE3A 2I1UA 2VOCA 5ID2B 5JCUA 5JCWA 1K3YA 5EPFA 4BL7B 3TJJA 2VCZA 3H4KA 4J56E 4ZL8A 4K9ZA 4CDOA 2PBJA 4Q5FA 3WYWA 1EGRA 1WOUA 3RDWA 1RW1A 5J3RA 3IRAA 5HFKA 3ERGA 3IPZA 2L59A 4GQCA 3RAZA 1S3RA 2CVKA 5GSSA 4WF4A 4ZBBA 3L0HA 3TKQA 5IMVA 1KTEA 3GYKA 2YV9A 3CQFA 2X4AA 3ZIJA 2AUVA 3ZVJA 3HZ8A 2FA4A 5CRHA 1Z6MA 1X9MB 2HI7A 4AJ7A 5F0GA 3BCKA 3HDCA 3NOFA 2CVDA 3DRNA 3FKFA 1ABAA 2H74A 2PERA 1TRVA 3KP8A 5CP1A 2HSYA 2H73A 4K0NA 5G5EA 2OE1A 4G9HA 1LJRA 1YJ6A 3TRPA 2CZ3A 2RUEA 4ZL7A 1RK4A 5DAKB 2K9FA 1I5GA 4YQUA 4IN0A 4MP4A 6GSTA 1WPIA 4ZB6A 2FWFA 2TRCP 3BD2A 5IPGA 3VI7A 2LSTA 1TRWA 2CAIA 4GSTA 3MYDA 3OR5A 1XOBA 3CSHA 2H76A 5CO3A 4BWQA 1TU8A 1UA5A 1ZMAA 4K1FA 2OADA 3D5JA 2H30A 1FOVA 2EIOA 1QMVA 1YF1A 4IVFA 3TDGA 2XC2A 5ECSA 3O3TA 3GKNA 2DKHA 4KSOA 4ECBA 4EIQA 1OE7A 1OYJA 3LXZA 5KOWA 3ZZXA 3LYKA 5KOXA 1F3BA 2VLTA 5ECLB 5H5SA 5ECRB 4EUYA 2DMLA 2FNOA 2FCHA 2OBKA 4IGJA 3VURA 1R7HA 1TP9A 1TOFA 1GSSA 2O8VB 3RHBA 3ME7A 1ZYQB 4HQZA 3F0IA 1UC7A 1VF3A 3PH9A 4XRAA 4BPYA 2WFCA 3FR9A 5DALB 2LQOA 1IYHA 5DCHA 3G7JA 3VWXA 4F82A 3GRXA 11GSA 18GSA 2P31A 4KCAA 1WMJA 3CSJA 4GXZA 1GSQA 1SKSB 3ZFLA 3KXOA 3EMPA 2H0HA 4WR4A 4MMMA 1YF0A 1RQMA 5HFGA 4MJBA 5G31A 3W8JA 2L4CA 1I9DA 5IIZA 2H75A 3HJOA 1TK8B 3LSZA 2PVOC 1A2JA 4OFTA 4Q5RA 3HY2A 3TB2A 2ON7A 5DQSA 3IC8A 3EINA 4HOJA 2HZEB 4OFNA 1EOGA 3ED3A 4FH8A 2FWGA 4RUVA 2VL2C 4QL9A 3WGEA 3APQA 4HDEA 1YZXA 1OC9A 4G0LA 3QOUA 4ZBAA 2I4AA 4EXJA 2LJAA 3P7XA 1ML6A 3FRCA 1XVQA 4L0WA 3KCMA 1QXHA 1K0MA 2G2QA 3ERFA 2VD0A 5DDLA 2XPDA 4HZ2A 2GSRA 2R37A 1HNCA 3KMNA 2D2ZA 4YQVA 3Q19A 1XWKA 3GFKA 4KDUA 1ZL9A 2RM5A 4Q5NA 2AHEA 5ELGA 4XHMA 2P5QA 2GDRA 3WGXA 1CQHA 1BQ7A 1F3AA 2X8GA 3IAM2 5A5KA 1G6YA 5KN3A 4IS0A 3IHGA 1XOAA 4HU9A 4O5QA 2H6XA 10GSA 2YZUA 3LWAA 4PUAA 1K3OA 3CTGA 2B1KA 4MDCA 4XTSA 1A24A 5HR1A 1U3AA 5FWGA 1K0CA 1XWCA 2VIMA 3H79A 4YKFA 2PMTA 3GNJA 5G1LA 1JZWA 2DJ2A 2OA7A 3FY7A 1ILOA 4BVXA 5FHIA 2K8VA 1A2MA 1PN9A 4IQ1A 2PPTA 4K0GA 2DMMA 2PN8A 4FYCA 1TW9A 13GSA 3UBLA 4WEYA 2MMAA 2B7KA 2YN1A 3FW2A 4TR1A 3H93A 4J2FA 2DJ1A 2R0PA 1KNGA 1B9XC 2MBSA 1USBA 2PWJA 2A4HA 9GSSA 1DE2A 4WF5A 5EY6A 2VCWA 1EEMA 3ME8A 3MDKA 5F05A 2IMDA 5D8IA 2PU9C 4KAEA 4DSSB 4E8HA 5B6NA 1R26A 4V2MA 2KUCA 4N10A 4MPGA 1VF1A 5ECIB 1M2AA 3WT1A 2LRCA 1PKWA 2DJ3A 4NHZA 4XIHA 1PX6A 1SU9A 2FHEA 2XBQA 4K7IA 1JLWA 4ICYA 1T1VA 4FQUA 1XW9A 5DCGA 4BIKA 4MF6A 1M2DA 3IDVA 4L5OA 2GZZA 3J7Yb 2P5RA 3GV1A 3VK9A 2RLIA 2IPAA 2LJKA 3P90A 5DBQA 4PQHA 4ACSA 3M9JA 3FHKA 2MBTA 4YAVA 4PURA 3D4MA 2TRXA 1Y25A 1F6MC 5J9CA 2AV4A 4ZILA 1YEXA 4KNDA 1TRSA 4TXVA 1AIUA 4G2EA 3E3EA 2VCQA 1K0BA 2CX3A 2LKUA 4LLRA 1V98A 2FLSA 3LYPA 5HR3A 17GSA 4LMVA 2GGTA 4V2NA 1AC1A 1GSYA 4IP6A 2CAQA 1GP1A 3JCML 3GUSA 4ZB8A 1ZYPA 3HCZA 19GSA 1F2EA 2MZCA 2CV4A 1SK0A 2ES7A 2A2PA 1GNEA 2VD1A 5BRTA 4KX4A 2PGTA 3PPUA 3VPTA 1A8LA 2H0IA 2JSYA 2HLSA 3EU3A 3RHCA 5D96A 3SBCA 4HEA2 4K8MA 4JRRA 4RQRA 4KE3A 1S3CA 3HXSA 3L9SA 4F0BA 4PGTA 3D4TA 1GLPA 3HJPA 12GSA 3L78A 3Q18A 2YJHA 4IHUA 3GHAA 3HZ4A 5GZZB 1BAYA 1ERWA 2YCDA 2B7JA 3PGTA 3FMWA 3K8NA 3N9JA 1FOHA 1K0AA 4WR5A 4TXOA 4MJAA 2VLUA 3EMXA 3KTLA 4I2TA 2V1MA 1NHYA 4YQMA 4E8EA 3HA9A 3ZRDA 1ZYNA 1AW9A 4F2IA 5JCGA 5KN2A 4MNNA 3I43A 2N5AA 5IPHA 2ZNMA 5ECHB 2C80A 3E0UA 4NWYA 4HI7A 4POLA 2H8LA 1G0TA 3QPMA 1N2AA 1ZCPA 4BA7A 4P3YB 1MD3A 5D9TA 2H1DA 4H86A 3QFBC 1OVNA 4L0UA 4CW9A 3I69A 1OKDA 5ECNB 4XS4B 3ZYWA 1SJ6A 2IMFA 5L71A 1OC3A 1YDKA 4TN8A 2KP2A 1O8WA 1B48A 2WCIA 2VL2A 1TDIA 3LEFA 2I9HA 2HXKA 2IIYA 3LQ7A 1UVZA 4RI6A 3MWHA 1M9BA 3QAGA 5J5NA 4ILFA 1EV9A 3GSSA 4G10A 4K6XA 3KTBA 2V2GA 4Q5QA 6GSSA 6GSWA 4IELA 2C4JA 1TI3A 3IA1A 3FZAA 3ZTLA 4OCFA 2BMXA 3HVNA 4DEJA 2K6VA 1GRXA 3RBTA 3WD6A 4NAXA 2J23A 1SL2B 5ECKB 3ZFBA 2V32A 3MNGA 4YH2A 2LUSA 4KB3A 2B5XA 2X99A 5ABRA 1J9BA 2YJ7A 2F51A 3KGKA 2LNTA 1H75A 3DKSA 1O6JA 2CA8A 4N0ZA 3KZQA 1R5AA 3GTUA 3F6FA 3D0ZA 1PL1A 3F3RA 4X1UA 3LW9A 3M1GA 3DMLA 2MMOA 4MK3A 5IQYA 3UJ1A 4IJ3A 3APSA 1SYXA 3AY8A 1X5DA 1U6TA 3EC3A 3PR8A 3F3QA 2WRTA 1GTAA 4TW5A 2L5OA 1WRYA 4PNGA 4GLTA 2HZFA 2A2RA 3QCPA 3VWVA 3TJBA 1ON4A 1SYRA 1PN0A 4HJMA 3ZL5A 4ULXA 1NHOA 1VF2A 2R2JA 1JLVA 2FWHA 4F9ZA 1GSEA 3EWLA 2WULA 5GAPD 1K0OA 2DIZA 2HRKA 1YQ1A 3L9UA 4TR3A 4I97A 4IP1A 3TKPA 1W89A 2UZ8A 3FZ4A 8GSSA 2X8CA 1PSQA 3QAWA 4MZBA 2GQMA 2EC4A 1PQNA 2JZRA 4IBPA 5IO0A 1O81A 2B1LA 4Z2TA 3PINA 4XS1A 1Q4JA 3Q74A 2O85A 2H71A 4JR6A 3ZVJD 2IFQB 1XIYA 4KUNA 4IKHA 5EL8A 3L9VA 1YKCA 3TKSE 1K3LA 4HS1A 2DLXA 3F9UA 4ZL9A 2DKIA 1EOHA 4HQSA 2KP1A 3CSIA 4KW6A 1MDJA 5D73A 5B7CA 2NTOA 4JBBA 1V9WA 1A0FA 2YOIA 2CZ2A 3VI5A 4AF2A 5ID2A 1TXXA 1SJZA 3IAS2 2MYGA 2L57A 4BL7A 1T4YA 1UN2A 4I8BA 5B8BA 5D9WA 2B6MA 2H66A 5IMAA 2FUG2 2R4VA 3LORA 3ZMLA 4GQFA 4PUFC 2EIQA 2OJLA 1N8JA 1XW6A 3HVVA 5IO2A 2JU5A 1WJKA 2CT6A 3H1NA 5ELAA 3KP9A 5HFIA 1NSWA 3UVTA 3US3A 2JZSA 2O89A
chains in the Genus database with same CATH topology
2KLXA 4NHWA 5G30A 2F8AA 1JZOA 2HT9A 2LRNA 4EC0A 1VF4A 1WE0A 5CYYA 4F0CA 5IMZA 4OFMA 1FG4A 3FYGA 3G7IA 2L5LA 4IW9A 1A0RP 1EZKA 3P8WA 1AXDA 3KD0A 1GUHA 3TCOA 3CRUA 1EEJA 2H01A 3BJ5A 5A4UA 4I5QA 3GMFA 4JU5A 4D73B 3UVHA 2H1AA 3F4TA 2YWOA 4KCEA 4HUAA 4BWSA 2VM1A 4I2UA 1TKDB 3QDNA 3LG6A 1E2YA 3DEXA 4AGSA 5DAKA 1SKRB 3FEUA 1HQOA 2B5EA 5KEJA 4TXOB 1GL8A 4TVEA 3E9JB 5F06A 1T00A 3WGDA 2GLRA 4GWRA 3L4NA 3ZIVA 1MEKA 3APOA 3QMXA 1JZRA 1YY7A 2IMKA 3P2AA 3G7YA 1M2BA 3W8SA 4USSA 5ECQB 1PRXA 3LXTA 2C3QA 2ZCTA 2GSQA 2GSTA 2X8HA 2GSSA 3KEBA 4O92A 3GIXA 2FD3A 1V57A 3IOSA 3D22A 4GSNA 3TJKA 4K7OA 2DJJA 2YWIA 5D9XA 1EP8A 2IMEA 2X49A 4V2LA 1AAZA 1BG5A 2C0FA 3DWVA 3GH6A 5D93A 3BBYA 1IYIA 3IK7A 3LGCA 4POBA 2OBIA 6GSUA 4EF0A 4O32A 2VCVA 4K2DA 1Z5YE 1HD2A 4EDZA 3F4SA 2LQQA 2ZUPA 4X4JA 1F9MA 3EURA 2BTOT 1GTUA 5KN1A 1H4OA 4X0XA 4JZQA 4MH3A 2HRNA 4ML6A 2YV7A 4IJIA 2R3XA 2YPMA 2M46A 1AUCA 1Z9HA 3HHVA 3ERWA 5CRGA 5ECMB 2DC5A 2NDOA 3C7MA 4ID0A 5CRWA 2M80A 1OE8A 2A4VA 4HU7A 2OE3A 2VM2A 2C3NA 2GVPA 1XPVA 2WJUA 4KGIA 2QC7A 1SK1A 4MF5A 4GRFA 3A3TA 2XHFA 3A5WA 1GUMA 3GTUB 3J7Yk 3TJGA 1AQXA 2AB6A 1SKWB 2F3MA 2B3SA 2C0DA 3KH7A 3GN3A 1B9YC 2F8FA 3U6VA 4LL1B 4OO5A 2H0GA 1DBYA 3N5OA 3M8NA 3O76A 3DD3A 2QA2A 2HYXA 3TKSC 1BYEA 1C72A 1PMTA 4TOPA 3NIVA 4XRDA 2C3TA 4MPFA 2I81A 1FB0A 2WGRA 4OO4A 3ZMKA 2LNSA 4PXOA 1THXA 5JWRB 1B4QA 1LU4A 2REMA 4GCIA 1CQGA 3CMIA 2C8UA 2KOKA 2FA8A 1GH2A 4ISDA 5G5FA 4ECJA 1M0UA 1SJIA 1MD4A 2N5FA 1G6WA 1ERVA 1J0FA 3U5RE 2GQLA 1KBNA 2GTUA 1XBSA 4CHSA 4J57E 1X5EA 4EKZA 4DSRA 5J9BA 5INYA 3TRQA 1ERUA 3RPPA 1QUWA 1GSDA 3IXRA 3IK9A 4PQ1A 3O6TA 2LJRA 2H6YA 4RI7A 3GSTA 2V6KA 3CYNA 4ZXGA 1V2AA 3UMAA 4K5SA 5G1KA 4BVYA 1X5CA 4K2XA 4GTUA 2M72A 4X43A 2JSZA 4NXIA 1TU7A 2XBIA 1ACVA 5AIXA 2HFDA 1WWJA 1QK8A 5CREA 5CNWA 2G0FA 1FB6A 1YKAA 1U87A 2WDUA 1LBKA 1AQVA 2VO4A 2E7PA 1SL1B 5EVOA 1X0RA 2YWMA 3TOUA 4LL4B 3DXBA 4L8EA 4WXTA 3GX0A 2VUPA 5C00A 1SD8A 2QA1A 1SL0B 2V6OA 1URMA 3MIXA 1WIKA 5BMUA 3V1WA 4GF0A 5JWOB 1SK2A 1OC9B 4PTSA 1X9WB 5E4WA 4TR0A 4DSSA 2AYTA 2GQKA 2X64A 4AJ8A 6GSXA 1XWGA 2TIRA 4G0IA 4WKWA 16GSA 1OC8A 3A2VA 4O5UA 3FR6A 3KJYA 2FY6A 5ECPB 2FWEA 3IC4A 4KDYA 3ZITA 1DUGA 1QQ2A 4KSMA 1TTZA 4G0KA 6GSYA 1KEBA 1XCCA 1PX7A 1MDIA 1TJDA 3GL5A 3IR4A 2H6ZA 4FO5A 5HR0A 4NPBA 3ISOA 3UL3A 5IOXA 3QD9A 1S3AA 1K0NA 2YNXA 1S3DA 4OD7A 3TRXA 4MABA 5LNKe 2H72A 1Z7PA 1V40A 2PVQA 5DJLA 1BX9A 5GSTA 2IJYA 3EVIA 2YZHA 2DJ0A 1JZDA 1R4WA 1J08A 1MDKA 1NW2A 3UOMA 2H1BA 1OAZA 3C71A 3W6GA 2NBSA 3VWWA 4BVXB 1VRSD 3IE3A 4KDXA 4NV5A 4TR1B 3KM6A 2F9SA 4EO3A 2L6DA 5IMDA 5AGYA 3VLNA 4K5RA 5IMCA 1GLQA 5B8AA 2HRFA 3QFAC 3F8UA 3HKRA 3C1RA 3MAKA 1R5PA 3R3EA 3TJFA 3EE2A 3UARA 4YAPA 3IBHA 3HJMA 1EGOA 3KIJA 5AN1A 1T4ZA 2HSMA 1GSFA 2HRAA 3TGZA 2LS5A 1MTCA 4PQIA 3EYTA 2Z9SA 2AJQB 4OCEA 3I9V2 3GKMA 3G9BA 1DE1A 4HZ4A 2CVBA 3D21A 1XVWA 14GSA 1Z3EA 2R6KA 2WS2A 4ML1A 1T8EB 2JADA 3GURA 1W4VA 1M99A 3LJRA 4MCUA 5LD0A 4XCSA 4DSQA 4Z2RA 1GTIA 4A5PA 3A5IA 4ZB9A 2O87A 3D6IA 3FR3A 1O85A 1YEPA 3HVSA 1K0DA 2OACA 2VLVA 1M9AA 2LRTA 4FYBA 2DIYA 5H5RA 1O7UA 1ZZYA 4ECCA 3CXGA 4O5RA 4F03A 4JR4A 2GT5A 1GWCA 1OKTA 1M7TA 2P0GA 4OWYA 1JFUA 6GSVA 3F63A 5COHA 1X9SB 2MMNA 5H5QA 5HQPA 4XS4A 4JEDA 4PX1A 1SENA 4WBRD 1SD9A 4ZIJA 1PD21 3A2XA 4ECIA 5E59A 4NMUA 1A2LA 2R0GA 4MJCA 4TR4A 2L4QA 3F6DA 3FK8A 2DBCA 4Z7XA 1EWXA 3KMOA 1PKZA 3DIEA 3TKSA 1PA3A 2R5GA 1GTBA 3C1SA 3BOAA 5ENUA 1QGVA 2CX4A 2KHPA 5IM9A 4FIWA 4XS6A 2OE0A 1XZOA 2J9HA 4CY6A 2C0GA 5DVBA 2RIIA 5DJMA 1A23A 5AISA 2IMIA 2VCXA 4N11A 4N0VA 2IL3A 22GSA 4MA9A 4QQ7A 5J4UA 1Q98A 5F8BA 2E2MA 2V41A 1HNAA 1FHEA 20GSA 1ZYEA 5CRDA 2O7KA 3CBUA 1B8XA 1FAAA 1U3IA 2AAWA 1Z7RA 3GKKA 3QR6A 1TRUA 5J41A 4TRXA 7GSSA 4N30A 5ECOB 1GUKA 4POMA 4NV2A 2HSHA 4K7NA 4MJEA 4BVYB 2RM6A 1T7PB 1FW1A 2GZYA 1XXUA 1BEDA 1ERTA 2E0QA 2YANA 2QKEA 1FVJA 5LCZA 4I6XA 5DQYA 3DVXA 5CAXA 3C8EA 3EU4A 1FO5A 3M0FA 4QL7A 4EVMA 2NPBA 1HYUA 3HYPA 2WB9A 2ALBA 1O8XA 3TUEA 4MZWA 5HR2A 2EIRA 2ON5A 2MMZA 2VAFA 2XPEA 2E2GA 2LEGA 2OKAA 2L6CA 5IOWA 3HD5A 1EP7A 3GX8A 1B4PA 2WZ9A 3BCIA 3IV4A 3UBKA 5DALA 1QFNA 3IHQA 3TKRA 2QSIA 4ZBDA 3VFIA 3UEMA 4MF7A 3M9KA 3GKXA 3DYRA 4EIPA 4OMVA 2LV3A 5JWQB 4LA1A 2IFQA 3GL3A 3F4RA 1EV4A 2H1GA 2LTKA 1WP0A 1BJXA 4EE0A 4V1Ap 1JHBA 3HVXA 5GAND 1E6BA 2HZEA 4EL1A 2IN3A 1THOA 3QAVA 3TOTA 3GA4A 3ZLPA 4Z2UA 2C1YA 1GULA 2DJKA 5A4VA 2GT6A 2IWTA 5D9VA 2YWNA 3WT2A 3ZREA 2PUKC 5F07A 2JZTA 4L5LA 4EDYA 4G19A 3C73A 2RUFA 1ZGNA 5B6MA 4MH2A 4KF9A 4JE1A 1PGTA 3GH9A 1XWAA 2CQ9A 3EPTA 1ST9A 1F37A 5AIVA 1T3BA 1TI1A 4AJ6A 3S9FA 2VL3A 1TK0B 1O73A 2NVLA 4CY8A 4MLYA 4FYUA 4MZCA 3R2QA 1XW5A 5A4WA 2C0EA 2I3YA 3Q6OA 3NZNA 3CRTA 4KA0A 4IQAA 2H19A 2FGXA 1U88A 2K18A 5FT3A 1Z6NA 2VL9A 1ZOFA 4D73A 5G2ZA 2JL4A 3FZ5A 2H70A 5KN0A 2HNLA 3KH9A 3VPQA 3A2WA 4TKYA 3MSZA 1GSUA 2A2SA 2QGVA 1FVKA 3UAPA 4PNFA 3M3MA 2R0CA 5C04A 1VGLA 3I6AA 3RPNA 1XFLA 4DVCA 1A8YA 2VCTA 3CTFA 1Y6EA 4WETA 1GNWA 2K8SA 2GS3A 2JACA 3DGQA 1G7OA 1V58A 3DVWA 3FZ9A 4O7HA 4RQXA 4WBJA 3LFLA 1PL2A 5IMFA 3VWUA 4LMWA 2BJXA 4POKA 3SWLA 2DSAA 2N5BA 3H8QA 4V1Ag 4KH7A 4HJ2A 4YKGA 2B5YA 2GZPA 3UIWA 1DSBA 4GSSA 1XWBA 1AQWA 1HNBA 1NM3A 1TK5B 2YP6A 1G7EA 2HE3A 2I1UA 2VOCA 5ID2B 5JCUA 5JCWA 1K3YA 5EPFA 4BL7B 3TJJA 2VCZA 3H4KA 4J56E 4ZL8A 4K9ZA 4CDOA 2PBJA 4Q5FA 3WYWA 1EGRA 1WOUA 3RDWA 1RW1A 5J3RA 3IRAA 5HFKA 3ERGA 3IPZA 2L59A 4GQCA 3RAZA 2CVKA 5GSSA 4WF4A 4ZBBA 3L0HA 3TKQA 5IMVA 1KTEA 3GYKA 2YV9A 2X4AA 3ZIJA 2AUVA 3ZVJA 3HZ8A 2FA4A 5CRHA 1Z6MA 1X9MB 2HI7A 4AJ7A 5F0GA 3BCKA 3HDCA 3NOFA 2CVDA 3DRNA 3FKFA 1ABAA 2H74A 2PERA 1TRVA 3KP8A 5CP1A 2HSYA 2H73A 4K0NA 5G5EA 2OE1A 4G9HA 1LJRA 1YJ6A 3TRPA 2CZ3A 2RUEA 4ZL7A 1RK4A 5DAKB 2K9FA 1I5GA 4YQUA 4IN0A 4MP4A 6GSTA 1WPIA 4ZB6A 2FWFA 2TRCP 3BD2A 5IPGA 3VI7A 2LSTA 1TRWA 2CAIA 4GSTA 3MYDA 3OR5A 1XOBA 3CSHA 2H76A 5CO3A 4BWQA 1TU8A 1UA5A 1ZMAA 4K1FA 2OADA 3D5JA 2H30A 1FOVA 2EIOA 1QMVA 1YF1A 4IVFA 3TDGA 2XC2A 5ECSA 3O3TA 3GKNA 2DKHA 4KSOA 4ECBA 4EIQA 1OE7A 1OYJA 3LXZA 5KOWA 3ZZXA 3LYKA 5KOXA 1F3BA 2VLTA 5ECLB 5H5SA 5ECRB 4EUYA 2DMLA 2FNOA 2FCHA 2OBKA 4IGJA 3VURA 1R7HA 1TP9A 1TOFA 1GSSA 2O8VB 3RHBA 3ME7A 1ZYQB 4HQZA 3F0IA 1UC7A 1VF3A 3PH9A 4XRAA 4BPYA 2WFCA 3FR9A 5DALB 2LQOA 1IYHA 5DCHA 3G7JA 3VWXA 4F82A 3GRXA 11GSA 18GSA 2P31A 4KCAA 1WMJA 3CSJA 4GXZA 1GSQA 1SKSB 3ZFLA 3KXOA 3EMPA 2H0HA 4WR4A 4MMMA 1YF0A 1RQMA 5HFGA 4MJBA 5G31A 3W8JA 2L4CA 1I9DA 5IIZA 2H75A 3HJOA 1TK8B 3LSZA 2PVOC 1A2JA 4OFTA 4Q5RA 3HY2A 3TB2A 2ON7A 5DQSA 3IC8A 3EINA 4HOJA 2HZEB 4OFNA 1EOGA 3ED3A 4FH8A 2FWGA 4RUVA 2VL2C 4QL9A 3WGEA 3APQA 4HDEA 1YZXA 1OC9A 4G0LA 3QOUA 4ZBAA 2I4AA 4EXJA 2LJAA 3P7XA 1ML6A 3FRCA 1XVQA 4L0WA 3KCMA 1QXHA 1K0MA 2G2QA 3ERFA 2VD0A 5DDLA 2XPDA 4HZ2A 2GSRA 2R37A 1HNCA 3KMNA 2D2ZA 4YQVA 3Q19A 1XWKA 3GFKA 4KDUA 1ZL9A 2RM5A 4Q5NA 2AHEA 5ELGA 4XHMA 2P5QA 2GDRA 3WGXA 1CQHA 1BQ7A 1F3AA 2X8GA 3IAM2 5A5KA 1G6YA 5KN3A 4IS0A 3IHGA 1XOAA 4HU9A 4O5QA 2H6XA 10GSA 2YZUA 3LWAA 4PUAA 1K3OA 3CTGA 2B1KA 4MDCA 4XTSA 1A24A 5HR1A 1U3AA 5FWGA 1K0CA 1XWCA 2VIMA 3H79A 4YKFA 2PMTA 3GNJA 5G1LA 1JZWA 2DJ2A 2OA7A 3FY7A 1ILOA 4BVXA 5FHIA 2K8VA 1A2MA 1PN9A 4IQ1A 2PPTA 4K0GA 2DMMA 2PN8A 4FYCA 1TW9A 13GSA 3UBLA 4WEYA 2MMAA 2B7KA 2YN1A 3FW2A 4TR1A 3H93A 4J2FA 2DJ1A 2R0PA 1KNGA 1B9XC 2MBSA 1USBA 2PWJA 2A4HA 9GSSA 1DE2A 4WF5A 5EY6A 2VCWA 1EEMA 3ME8A 3MDKA 5F05A 2IMDA 5D8IA 2PU9C 4KAEA 4DSSB 4E8HA 5B6NA 1R26A 4V2MA 2KUCA 4N10A 4MPGA 1VF1A 5ECIB 1M2AA 3WT1A 2LRCA 1PKWA 2DJ3A 4NHZA 4XIHA 1PX6A 1SU9A 2FHEA 2XBQA 4K7IA 1JLWA 4ICYA 1T1VA 4FQUA 1XW9A 5DCGA 4MF6A 1M2DA 3IDVA 4L5OA 2GZZA 3J7Yb 2P5RA 3GV1A 3VK9A 2RLIA 2IPAA 2LJKA 3P90A 5DBQA 4PQHA 4ACSA 3M9JA 3FHKA 2MBTA 4YAVA 4PURA 3D4MA 2TRXA 1Y25A 1F6MC 5J9CA 2AV4A 4ZILA 1YEXA 4KNDA 1TRSA 4TXVA 1AIUA 4G2EA 3E3EA 2VCQA 1K0BA 2CX3A 2LKUA 4LLRA 1V98A 2FLSA 3LYPA 5HR3A 17GSA 4LMVA 2GGTA 4V2NA 1AC1A 1GSYA 4IP6A 2CAQA 1GP1A 3JCML 3GUSA 4ZB8A 1ZYPA 3HCZA 19GSA 1F2EA 2MZCA 2CV4A 1SK0A 2ES7A 2A2PA 1GNEA 2VD1A 5BRTA 4KX4A 2PGTA 3PPUA 3VPTA 1A8LA 2H0IA 2JSYA 2HLSA 3EU3A 3RHCA 5D96A 3SBCA 4HEA2 4K8MA 4JRRA 4RQRA 4KE3A 1S3CA 3HXSA 3L9SA 4F0BA 4PGTA 3D4TA 1GLPA 3HJPA 12GSA 3L78A 3Q18A 2YJHA 4IHUA 3GHAA 3HZ4A 5GZZB 1BAYA 1ERWA 2YCDA 2B7JA 3PGTA 3FMWA 3K8NA 3N9JA 1FOHA 1K0AA 4WR5A 4TXOA 4MJAA 2VLUA 3EMXA 3KTLA 4I2TA 2V1MA 1NHYA 4YQMA 4E8EA 3HA9A 3ZRDA 1ZYNA 1AW9A 4F2IA 5JCGA 5KN2A 4MNNA 3I43A 2N5AA 5IPHA 2ZNMA 5ECHB 2C80A 3E0UA 4NWYA 4HI7A 4POLA 2H8LA 1G0TA 3QPMA 1N2AA 1ZCPA 4BA7A 4P3YB 1MD3A 5D9TA 2H1DA 4H86A 3QFBC 1OVNA 4L0UA 4CW9A 3I69A 1OKDA 5ECNB 4XS4B 3ZYWA 1SJ6A 2IMFA 5L71A 1OC3A 1YDKA 4TN8A 2KP2A 1O8WA 1B48A 2WCIA 2VL2A 1TDIA 3LEFA 2I9HA 2HXKA 2IIYA 3LQ7A 1UVZA 4RI6A 3MWHA 1M9BA 3QAGA 5J5NA 4ILFA 1EV9A 3GSSA 4G10A 4K6XA 3KTBA 2V2GA 4Q5QA 6GSSA 6GSWA 4IELA 2C4JA 1TI3A 3IA1A 3FZAA 3ZTLA 4OCFA 2BMXA 4DEJA 2K6VA 1GRXA 3RBTA 3WD6A 4NAXA 2J23A 1SL2B 5ECKB 3ZFBA 2V32A 3MNGA 4YH2A 2LUSA 4KB3A 2B5XA 2X99A 5ABRA 1J9BA 2YJ7A 2F51A 3KGKA 2LNTA 1H75A 3DKSA 1O6JA 2CA8A 4N0ZA 3KZQA 1R5AA 3GTUA 3F6FA 3D0ZA 1PL1A 3F3RA 4X1UA 3LW9A 3M1GA 3DMLA 2MMOA 4MK3A 5IQYA 3UJ1A 4IJ3A 3APSA 1SYXA 3AY8A 1X5DA 1U6TA 3EC3A 3PR8A 3F3QA 2WRTA 1GTAA 4TW5A 2L5OA 1WRYA 4PNGA 4GLTA 2HZFA 2A2RA 3QCPA 3VWVA 3TJBA 1ON4A 1SYRA 1PN0A 4HJMA 3ZL5A 4ULXA 1NHOA 1VF2A 2R2JA 1JLVA 2FWHA 4F9ZA 1GSEA 3EWLA 2WULA 5GAPD 1K0OA 2DIZA 2HRKA 1YQ1A 3L9UA 4TR3A 4I97A 4IP1A 3TKPA 1W89A 2UZ8A 3FZ4A 8GSSA 2X8CA 1PSQA 3QAWA 4MZBA 2GQMA 2EC4A 1PQNA 2JZRA 4IBPA 5IO0A 1O81A 2B1LA 4Z2TA 3PINA 4XS1A 1Q4JA 3Q74A 2O85A 2H71A 4JR6A 3ZVJD 2IFQB 1XIYA 4KUNA 4IKHA 5EL8A 3L9VA 1YKCA 3TKSE 1K3LA 4HS1A 2DLXA 3F9UA 4ZL9A 2DKIA 1EOHA 4HQSA 2KP1A 3CSIA 4KW6A 1MDJA 5D73A 5B7CA 2NTOA 4JBBA 1V9WA 1A0FA 2YOIA 2CZ2A 3VI5A 4AF2A 5ID2A 1TXXA 1SJZA 3IAS2 2MYGA 2L57A 4BL7A 1T4YA 1UN2A 4I8BA 5B8BA 5D9WA 2B6MA 2H66A 5IMAA 2FUG2 2R4VA 3LORA 3ZMLA 4GQFA 4PUFC 2EIQA 2OJLA 1N8JA 1XW6A 3HVVA 5IO2A 2JU5A 1WJKA 2CT6A 3H1NA 5ELAA 3KP9A 5HFIA 1NSWA 3UVTA 3US3A 2JZSA 2O89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLX A;  4NHW A;  5G30 A;  2F8A A;  1JZO A;  2HT9 A;  2LRN A;  4EC0 A;  1VF4 A;  1WE0 A;  5CYY A;  4F0C A;  5IMZ A;  4OFM A;  1FG4 A;  3FYG A;  3G7I A;  2L5L A;  4IW9 A;  1A0R P;  1EZK A;  3P8W A;  1AXD A;  3KD0 A;  1GUH A;  3TCO A;  3CRU A;  1EEJ A;  2H01 A;  3BJ5 A;  5A4U A;  4I5Q A;  3GMF A;  4JU5 A;  4D73 B;  3UVH A;  2H1A A;  3F4T A;  2YWO A;  4KCE A;  4HUA A;  4BWS A;  2VM1 A;  4I2U A;  1TKD B;  3QDN A;  3LG6 A;  1E2Y A;  3DEX A;  4AGS A;  5DAK A;  1SKR B;  3FEU A;  1HQO A;  2B5E A;  5KEJ A;  4TXO B;  1GL8 A;  4TVE A;  3E9J B;  5F06 A;  1T00 A;  3WGD A;  2GLR A;  4GWR A;  3L4N A;  3ZIV A;  1MEK A;  3APO A;  3QMX A;  1JZR A;  1YY7 A;  2IMK A;  3P2A A;  3G7Y A;  1M2B A;  3W8S A;  5ECQ B;  1PRX A;  3LXT A;  2C3Q A;  2ZCT A;  2GSQ A;  2GST A;  2X8H A;  2GSS A;  3KEB A;  4O92 A;  3GIX A;  2FD3 A;  1V57 A;  3IOS A;  3D22 A;  4GSN A;  3TJK A;  4K7O A;  2DJJ A;  2YWI A;  5D9X A;  1EP8 A;  2IME A;  4V2L A;  1AAZ A;  1BG5 A;  2C0F A;  3DWV A;  3GH6 A;  5D93 A;  3BBY A;  1IYI A;  3IK7 A;  3LGC A;  4POB A;  2OBI A;  6GSU A;  4EF0 A;  4O32 A;  2VCV A;  4K2D A;  1Z5Y E;  1HD2 A;  4EDZ A;  3F4S A;  2LQQ A;  2ZUP A;  1F9M A;  3EUR A;  2BTO T;  1GTU A;  5KN1 A;  1H4O A;  4X0X A;  4JZQ A;  4MH3 A;  2HRN A;  4ML6 A;  2YV7 A;  4IJI A;  2R3X A;  2YPM A;  2M46 A;  1AUC A;  1Z9H A;  3HHV A;  3ERW A;  5CRG A;  5ECM B;  2DC5 A;  2NDO A;  3C7M A;  4ID0 A;  5CRW A;  2M80 A;  1OE8 A;  2A4V A;  4HU7 A;  2OE3 A;  2VM2 A;  2C3N A;  2GVP A;  1XPV A;  2WJU A;  4KGI A;  2QC7 A;  1SK1 A;  4MF5 A;  4GRF A;  3A3T A;  2XHF A;  3A5W A;  1GUM A;  3GTU B;  3J7Y k;  3TJG A;  1AQX A;  2AB6 A;  1SKW B;  2F3M A;  2B3S A;  2C0D A;  3KH7 A;  3GN3 A;  1B9Y C;  2F8F A;  3U6V A;  4LL1 B;  4OO5 A;  2H0G A;  1DBY A;  3N5O A;  3M8N A;  3O76 A;  3DD3 A;  2HYX A;  3TKS C;  1BYE A;  1C72 A;  1PMT A;  4TOP A;  3NIV A;  4XRD A;  2C3T A;  4MPF A;  2I81 A;  1FB0 A;  2WGR A;  4OO4 A;  3ZMK A;  2LNS A;  4PXO A;  1THX A;  5JWR B;  1B4Q A;  1LU4 A;  2REM A;  4GCI A;  1CQG A;  3CMI A;  2C8U A;  2KOK A;  2FA8 A;  1GH2 A;  4ISD A;  5G5F A;  4ECJ A;  1M0U A;  1SJI A;  1MD4 A;  2N5F A;  1G6W A;  1ERV A;  1J0F A;  3U5R E;  2GQL A;  1KBN A;  2GTU A;  1XBS A;  4CHS A;  4J57 E;  1X5E A;  4EKZ A;  4DSR A;  5J9B A;  5INY A;  3TRQ A;  1ERU A;  3RPP A;  1QUW A;  1GSD A;  3IXR A;  3IK9 A;  4PQ1 A;  3O6T A;  2LJR A;  2H6Y A;  4RI7 A;  3GST A;  2V6K A;  3CYN A;  4ZXG A;  1V2A A;  3UMA A;  5G1K A;  4BVY A;  1X5C A;  4GTU A;  2M72 A;  4X43 A;  2JSZ A;  4NXI A;  1TU7 A;  2XBI A;  1ACV A;  5AIX A;  2HFD A;  1WWJ A;  1QK8 A;  5CRE A;  5CNW A;  2G0F A;  1FB6 A;  1YKA A;  1U87 A;  2WDU A;  1LBK A;  1AQV A;  2VO4 A;  2E7P A;  1SL1 B;  5EVO A;  1X0R A;  2YWM A;  3TOU A;  4LL4 B;  3DXB A;  4L8E A;  4WXT A;  3GX0 A;  2VUP A;  5C00 A;  1SD8 A;  1SL0 B;  2V6O A;  1URM A;  1WIK A;  3V1W A;  4GF0 A;  5JWO B;  1SK2 A;  1OC9 B;  1X9W B;  5E4W A;  4TR0 A;  4DSS A;  2AYT A;  2GQK A;  2X64 A;  4AJ8 A;  6GSX A;  1XWG A;  2TIR A;  4WKW A;  16GS A;  1OC8 A;  3A2V A;  3FR6 A;  3KJY A;  2FY6 A;  5ECP B;  2FWE A;  3IC4 A;  4KDY A;  3ZIT A;  1DUG A;  1QQ2 A;  4KSM A;  1TTZ A;  6GSY A;  1KEB A;  1XCC A;  1PX7 A;  1MDI A;  1TJD A;  3GL5 A;  3IR4 A;  2H6Z A;  4FO5 A;  5HR0 A;  4NPB A;  3ISO A;  3UL3 A;  5IOX A;  3QD9 A;  1S3A A;  1K0N A;  2YNX A;  1S3D A;  4OD7 A;  3TRX A;  4MAB A;  5LNK e;  2H72 A;  1Z7P A;  1V40 A;  2PVQ A;  5DJL A;  1BX9 A;  5GST A;  2IJY A;  3EVI A;  2YZH A;  2DJ0 A;  1JZD A;  1R4W A;  1J08 A;  1MDK A;  1NW2 A;  3UOM A;  2H1B A;  1OAZ A;  3C71 A;  3W6G A;  2NBS A;  3VWW A;  1VRS D;  3IE3 A;  4KDX A;  4NV5 A;  4TR1 B;  3KM6 A;  2F9S A;  4EO3 A;  2L6D A;  5IMD A;  5AGY A;  3VLN A;  5IMC A;  1GLQ A;  5B8A A;  2HRF A;  3QFA C;  3F8U A;  3HKR A;  3C1R A;  3MAK A;  1R5P A;  3TJF A;  3EE2 A;  3UAR A;  4YAP A;  3IBH A;  3HJM A;  1EGO A;  3KIJ A;  5AN1 A;  1T4Z A;  1GSF A;  3TGZ A;  2LS5 A;  1MTC A;  4PQI A;  3EYT A;  2Z9S A;  2AJQ B;  4OCE A;  3I9V 2;  3GKM A;  3G9B A;  1DE1 A;  4HZ4 A;  2CVB A;  3D21 A;  1XVW A;  14GS A;  1Z3E A;  2R6K A;  2WS2 A;  4ML1 A;  1T8E B;  2JAD A;  3GUR A;  1W4V A;  1M99 A;  3LJR A;  4MCU A;  5LD0 A;  4XCS A;  4DSQ A;  1GTI A;  4ZB9 A;  2O87 A;  3D6I A;  3FR3 A;  1YEP A;  1O85 A;  3HVS A;  1K0D A;  2OAC A;  2VLV A;  1M9A A;  2LRT A;  4FYB A;  2DIY A;  5H5R A;  1O7U A;  1ZZY A;  4ECC A;  3CXG A;  4O5R A;  4F03 A;  4JR4 A;  2GT5 A;  1GWC A;  1OKT A;  1M7T A;  2P0G A;  4OWY A;  1JFU A;  6GSV A;  3F63 A;  5COH A;  1X9S B;  2MMN A;  5H5Q A;  5HQP A;  4XS4 A;  4JED A;  4PX1 A;  1SEN A;  4WBR D;  1SD9 A;  4ZIJ A;  1PD2 1;  3A2X A;  4ECI A;  5E59 A;  4NMU A;  1A2L A;  4MJC A;  4TR4 A;  2L4Q A;  3F6D A;  3FK8 A;  2DBC A;  4Z7X A;  1EWX A;  3KMO A;  1PKZ A;  3DIE A;  3TKS A;  1PA3 A;  2R5G A;  1GTB A;  3C1S A;  3BOA A;  5ENU A;  1QGV A;  2CX4 A;  2KHP A;  5IM9 A;  4FIW A;  4XS6 A;  2OE0 A;  1XZO A;  2J9H A;  2C0G A;  5DVB A;  2RII A;  5DJM A;  1A23 A;  5AIS A;  2IMI A;  2VCX A;  4N11 A;  4N0V A;  2IL3 A;  22GS A;  4MA9 A;  4QQ7 A;  5J4U A;  1Q98 A;  5F8B A;  2E2M A;  2V41 A;  1HNA A;  1FHE A;  20GS A;  1ZYE A;  5CRD A;  2O7K A;  3CBU A;  1B8X A;  1FAA A;  1U3I A;  2AAW A;  1Z7R A;  3GKK A;  3QR6 A;  1TRU A;  5J41 A;  4TRX A;  7GSS A;  4N30 A;  5ECO B;  1GUK A;  4POM A;  4NV2 A;  2HSH A;  4K7N A;  4MJE A;  2RM6 A;  1T7P B;  1FW1 A;  2GZY A;  1XXU A;  1BED A;  1ERT A;  2E0Q A;  2YAN A;  2QKE A;  1FVJ A;  5LCZ A;  4I6X A;  5DQY A;  3DVX A;  5CAX A;  3C8E A;  3EU4 A;  1FO5 A;  3M0F A;  4QL7 A;  4EVM A;  2NPB A;  1HYU A;  3HYP A;  2WB9 A;  2ALB A;  1O8X A;  3TUE A;  4MZW A;  5HR2 A;  2EIR A;  2ON5 A;  2MMZ A;  2VAF A;  2XPE A;  2E2G A;  2LEG A;  2OKA A;  2L6C A;  5IOW A;  3HD5 A;  1EP7 A;  3GX8 A;  1B4P A;  2WZ9 A;  3BCI A;  3IV4 A;  3UBK A;  5DAL A;  1QFN A;  3IHQ A;  3TKR A;  2QSI A;  4ZBD A;  3VFI A;  3UEM A;  4MF7 A;  3M9K A;  3GKX A;  3DYR A;  4OMV A;  2LV3 A;  5JWQ B;  4LA1 A;  2IFQ A;  3GL3 A;  3F4R A;  1EV4 A;  2H1G A;  2LTK A;  1WP0 A;  1BJX A;  4EE0 A;  4V1A p;  1JHB A;  3HVX A;  5GAN D;  1E6B A;  2HZE A;  4EL1 A;  2IN3 A;  1THO A;  3QAV A;  3TOT A;  3GA4 A;  3ZLP A;  2C1Y A;  1GUL A;  2DJK A;  5A4V A;  2GT6 A;  2IWT A;  5D9V A;  2YWN A;  3WT2 A;  3ZRE A;  2PUK C;  5F07 A;  2JZT A;  4L5L A;  4EDY A;  4G19 A;  3C73 A;  2RUF A;  1ZGN A;  5B6M A;  4MH2 A;  4JE1 A;  1PGT A;  3GH9 A;  1XWA A;  2CQ9 A;  1ST9 A;  1F37 A;  5AIV A;  1T3B A;  1TI1 A;  4AJ6 A;  3S9F A;  2VL3 A;  1TK0 B;  1O73 A;  2NVL A;  4MLY A;  4FYU A;  4MZC A;  3R2Q A;  1XW5 A;  5A4W A;  2C0E A;  2I3Y A;  3Q6O A;  3NZN A;  3CRT A;  4KA0 A;  4IQA A;  2H19 A;  2FGX A;  1U88 A;  2K18 A;  5FT3 A;  1Z6N A;  2VL9 A;  1ZOF A;  4D73 A;  5G2Z A;  2JL4 A;  3FZ5 A;  2H70 A;  5KN0 A;  2HNL A;  3KH9 A;  3VPQ A;  3A2W A;  4TKY A;  3MSZ A;  1GSU A;  2A2S A;  2QGV A;  1FVK A;  3UAP A;  4PNF A;  3M3M A;  5C04 A;  1VGL A;  3I6A A;  3RPN A;  1XFL A;  4DVC A;  1A8Y A;  2VCT A;  3CTF A;  1Y6E A;  4WET A;  1GNW A;  2K8S A;  2GS3 A;  2JAC A;  3DGQ A;  1G7O A;  1V58 A;  3DVW A;  3FZ9 A;  4O7H A;  4RQX A;  4WBJ A;  3LFL A;  1PL2 A;  5IMF A;  3VWU A;  4LMW A;  2BJX A;  4POK A;  3SWL A;  2DSA A;  2N5B A;  3H8Q A;  4V1A g;  4KH7 A;  4HJ2 A;  2B5Y A;  2GZP A;  3UIW A;  1DSB A;  4GSS A;  1XWB A;  1AQW A;  1HNB A;  1NM3 A;  1TK5 B;  2YP6 A;  1G7E A;  2HE3 A;  2I1U A;  2VOC A;  5ID2 B;  5JCU A;  5JCW A;  1K3Y A;  5EPF A;  3TJJ A;  2VCZ A;  3H4K A;  4J56 E;  4ZL8 A;  4K9Z A;  4CDO A;  2PBJ A;  4Q5F A;  3WYW A;  1EGR A;  1WOU A;  3RDW A;  1RW1 A;  5J3R A;  3IRA A;  5HFK A;  3ERG A;  3IPZ A;  2L59 A;  4GQC A;  3RAZ A;  2CVK A;  5GSS A;  4WF4 A;  4ZBB A;  3L0H A;  3TKQ A;  5IMV A;  1KTE A;  3GYK A;  2YV9 A;  3ZIJ A;  2AUV A;  3ZVJ A;  3HZ8 A;  2FA4 A;  5CRH A;  1Z6M A;  1X9M B;  2HI7 A;  4AJ7 A;  5F0G A;  3BCK A;  3HDC A;  3NOF A;  2CVD A;  3DRN A;  3FKF A;  1ABA A;  2H74 A;  2PER A;  1TRV A;  3KP8 A;  5CP1 A;  2HSY A;  2H73 A;  4K0N A;  5G5E A;  2OE1 A;  4G9H A;  1LJR A;  1YJ6 A;  3TRP A;  2CZ3 A;  2RUE A;  4ZL7 A;  1RK4 A;  5DAK B;  2K9F A;  1I5G A;  4YQU A;  4IN0 A;  4MP4 A;  6GST A;  1WPI A;  4ZB6 A;  2FWF A;  2TRC P;  3BD2 A;  5IPG A;  3VI7 A;  2LST A;  1TRW A;  2CAI A;  4GST A;  3OR5 A;  1XOB A;  3CSH A;  2H76 A;  5CO3 A;  4BWQ A;  1TU8 A;  1UA5 A;  1ZMA A;  4K1F A;  2OAD A;  3D5J A;  2H30 A;  1FOV A;  2EIO A;  1QMV A;  1YF1 A;  4IVF A;  3TDG A;  2XC2 A;  5ECS A;  3O3T A;  3GKN A;  4KSO A;  4ECB A;  1OE7 A;  1OYJ A;  3LXZ A;  3ZZX A;  3LYK A;  1F3B A;  2VLT A;  5ECL B;  5H5S A;  5ECR B;  4EUY A;  2DML A;  2FNO A;  2FCH A;  2OBK A;  4IGJ A;  3VUR A;  1R7H A;  1TP9 A;  1TOF A;  1GSS A;  2O8V B;  3RHB A;  3ME7 A;  1ZYQ B;  4HQZ A;  3F0I A;  1UC7 A;  1VF3 A;  3PH9 A;  4XRA A;  4BPY A;  2WFC A;  3FR9 A;  5DAL B;  2LQO A;  1IYH A;  5DCH A;  3G7J A;  3VWX A;  4F82 A;  3GRX A;  11GS A;  18GS A;  2P31 A;  4KCA A;  1WMJ A;  3CSJ A;  4GXZ A;  1GSQ A;  1SKS B;  3ZFL A;  3KXO A;  3EMP A;  2H0H A;  4WR4 A;  4MMM A;  1YF0 A;  1RQM A;  5HFG A;  4MJB A;  5G31 A;  3W8J A;  2L4C A;  1I9D A;  5IIZ A;  2H75 A;  3HJO A;  1TK8 B;  3LSZ A;  2PVO C;  1A2J A;  4OFT A;  4Q5R A;  3HY2 A;  3TB2 A;  2ON7 A;  5DQS A;  3EIN A;  4HOJ A;  2HZE B;  4OFN A;  1EOG A;  3ED3 A;  4FH8 A;  2FWG A;  4RUV A;  2VL2 C;  4QL9 A;  3WGE A;  3APQ A;  4HDE A;  1YZX A;  1OC9 A;  3QOU A;  4ZBA A;  2I4A A;  4EXJ A;  2LJA A;  3P7X A;  1ML6 A;  3FRC A;  1XVQ A;  4L0W A;  3KCM A;  1QXH A;  1K0M A;  2G2Q A;  3ERF A;  2VD0 A;  5DDL A;  2XPD A;  4HZ2 A;  2GSR A;  2R37 A;  1HNC A;  3KMN A;  2D2Z A;  4YQV A;  3Q19 A;  1XWK A;  3GFK A;  4KDU A;  1ZL9 A;  2RM5 A;  4Q5N A;  2AHE A;  5ELG A;  4XHM A;  2P5Q A;  2GDR A;  3WGX A;  1CQH A;  1BQ7 A;  1F3A A;  2X8G A;  3IAM 2;  5A5K A;  1G6Y A;  5KN3 A;  4IS0 A;  1XOA A;  4HU9 A;  2H6X A;  10GS A;  2YZU A;  3LWA A;  4PUA A;  1K3O A;  3CTG A;  2B1K A;  4MDC A;  4XTS A;  1A24 A;  5HR1 A;  1U3A A;  5FWG A;  1K0C A;  1XWC A;  2VIM A;  3H79 A;  2PMT A;  3GNJ A;  5G1L A;  1JZW A;  2DJ2 A;  2OA7 A;  3FY7 A;  1ILO A;  4BVX A;  5FHI A;  2K8V A;  1A2M A;  1PN9 A;  4IQ1 A;  2PPT A;  4K0G A;  2DMM A;  2PN8 A;  4FYC A;  1TW9 A;  13GS A;  3UBL A;  4WEY A;  2MMA A;  2B7K A;  2YN1 A;  3FW2 A;  4TR1 A;  3H93 A;  4J2F A;  2DJ1 A;  1KNG A;  1B9X C;  2MBS A;  1USB A;  2PWJ A;  9GSS A;  1DE2 A;  4WF5 A;  5EY6 A;  2VCW A;  1EEM A;  3ME8 A;  3MDK A;  5F05 A;  2IMD A;  5D8I A;  2PU9 C;  4KAE A;  4DSS B;  4E8H A;  5B6N A;  1R26 A;  4V2M A;  2KUC A;  4N10 A;  4MPG A;  1VF1 A;  5ECI B;  1M2A A;  3WT1 A;  2LRC A;  1PKW A;  2DJ3 A;  4NHZ A;  4XIH A;  1PX6 A;  1SU9 A;  2FHE A;  2XBQ A;  4K7I A;  1JLW A;  1T1V A;  1XW9 A;  5DCG A;  4MF6 A;  1M2D A;  3IDV A;  4L5O A;  2GZZ A;  3J7Y b;  2P5R A;  3GV1 A;  3VK9 A;  2RLI A;  2IPA A;  2LJK A;  3P90 A;  5DBQ A;  4PQH A;  4ACS A;  3M9J A;  3FHK A;  2MBT A;  4YAV A;  4PUR A;  3D4M A;  2TRX A;  1Y25 A;  1F6M C;  5J9C A;  2AV4 A;  4ZIL A;  1YEX A;  4KND A;  1TRS A;  4TXV A;  1AIU A;  4G2E A;  3E3E A;  2VCQ A;  1K0B A;  2CX3 A;  2LKU A;  4LLR A;  1V98 A;  2FLS A;  3LYP A;  5HR3 A;  17GS A;  4LMV A;  2GGT A;  4V2N A;  1AC1 A;  1GSY A;  4IP6 A;  2CAQ A;  1GP1 A;  3JCM L;  3GUS A;  4ZB8 A;  3HCZ A;  19GS A;  1F2E A;  2MZC A;  2CV4 A;  1SK0 A;  2ES7 A;  1GNE A;  2VD1 A;  4KX4 A;  2PGT A;  3VPT A;  1A8L A;  2H0I A;  2JSY A;  2HLS A;  3EU3 A;  3RHC A;  5D96 A;  3SBC A;  4HEA 2;  4K8M A;  4JRR A;  4RQR A;  4KE3 A;  1S3C A;  3HXS A;  3L9S A;  4F0B A;  4PGT A;  3D4T A;  1GLP A;  3HJP A;  12GS A;  3L78 A;  3Q18 A;  2YJH A;  4IHU A;  3GHA A;  3HZ4 A;  5GZZ B;  1BAY A;  1ERW A;  2YCD A;  2B7J A;  3PGT A;  3K8N A;  3N9J A;  1K0A A;  4WR5 A;  4TXO A;  4MJA A;  2VLU A;  3EMX A;  3KTL A;  4I2T A;  2V1M A;  1NHY A;  4YQM A;  4E8E A;  3HA9 A;  3ZRD A;  1AW9 A;  4F2I A;  5JCG A;  5KN2 A;  3I43 A;  2N5A A;  5IPH A;  2ZNM A;  5ECH B;  2C80 A;  3E0U A;  4NWY A;  4HI7 A;  4POL A;  2H8L A;  1G0T A;  3QPM A;  1N2A A;  1ZCP A;  4BA7 A;  4P3Y B;  1MD3 A;  5D9T A;  2H1D A;  4H86 A;  3QFB C;  1OVN A;  4L0U A;  4CW9 A;  3I69 A;  1OKD A;  5ECN B;  4XS4 B;  3ZYW A;  1SJ6 A;  2IMF A;  5L71 A;  1OC3 A;  1YDK A;  4TN8 A;  2KP2 A;  1O8W A;  1B48 A;  2WCI A;  2VL2 A;  1TDI A;  3LEF A;  2I9H A;  2HXK A;  2IIY A;  3LQ7 A;  1UVZ A;  4RI6 A;  3MWH A;  1M9B A;  3QAG A;  5J5N A;  4ILF A;  1EV9 A;  3GSS A;  4G10 A;  4K6X A;  3KTB A;  2V2G A;  4Q5Q A;  6GSS A;  6GSW A;  4IEL A;  2C4J A;  1TI3 A;  3IA1 A;  3FZA A;  3ZTL A;  4OCF A;  2BMX A;  4DEJ A;  2K6V A;  1GRX A;  3RBT A;  3WD6 A;  4NAX A;  2J23 A;  1SL2 B;  5ECK B;  3ZFB A;  2V32 A;  3MNG A;  4YH2 A;  2LUS A;  4KB3 A;  2B5X A;  2X99 A;  5ABR A;  1J9B A;  2YJ7 A;  2F51 A;  3KGK A;  2LNT A;  1H75 A;  3DKS A;  1O6J A;  2CA8 A;  4N0Z A;  3KZQ A;  1R5A A;  3GTU A;  3F6F A;  3D0Z A;  1PL1 A;  3F3R A;  4X1U A;  3M1G A;  3DML A;  2MMO A;  4MK3 A;  5IQY A;  3UJ1 A;  4IJ3 A;  3APS A;  1SYX A;  3AY8 A;  1X5D A;  1U6T A;  3EC3 A;  3PR8 A;  3F3Q A;  2WRT A;  1GTA A;  4TW5 A;  2L5O A;  1WRY A;  4PNG A;  4GLT A;  2HZF A;  2A2R A;  3QCP A;  3VWV A;  3TJB A;  1ON4 A;  1SYR A;  4HJM A;  3ZL5 A;  4ULX A;  1NHO A;  1VF2 A;  2R2J A;  1JLV A;  2FWH A;  4F9Z A;  1GSE A;  3EWL A;  2WUL A;  5GAP D;  1K0O A;  2DIZ A;  1YQ1 A;  3L9U A;  4TR3 A;  4I97 A;  4IP1 A;  3TKP A;  1W89 A;  3FZ4 A;  8GSS A;  2X8C A;  1PSQ A;  3QAW A;  4MZB A;  2GQM A;  2EC4 A;  1PQN A;  2JZR A;  4IBP A;  5IO0 A;  1O81 A;  2B1L A;  3PIN A;  4XS1 A;  1Q4J A;  3Q74 A;  2O85 A;  2H71 A;  4JR6 A;  3ZVJ D;  2IFQ B;  1XIY A;  4KUN A;  4IKH A;  5EL8 A;  3L9V A;  1YKC A;  3TKS E;  1K3L A;  4HS1 A;  2DLX A;  3F9U A;  4ZL9 A;  1EOH A;  4HQS A;  2KP1 A;  3CSI A;  4KW6 A;  1MDJ A;  5D73 A;  5B7C A;  2NTO A;  4JBB A;  1V9W A;  1A0F A;  2YOI A;  2CZ2 A;  3VI5 A;  4AF2 A;  5ID2 A;  1TXX A;  1SJZ A;  3IAS 2;  2MYG A;  2L57 A;  4BL7 A;  1T4Y A;  1UN2 A;  4I8B A;  5B8B A;  5D9W A;  2B6M A;  2H66 A;  5IMA A;  2FUG 2;  2R4V A;  3LOR A;  3ZML A;  4GQF A;  4PUF C;  2EIQ A;  2OJL A;  1N8J A;  1XW6 A;  3HVV A;  5IO2 A;  2JU5 A;  1WJK A;  2CT6 A;  3H1N A;  5ELA A;  3KP9 A;  5HFI A;  1NSW A;  3UVT A;  3US3 A;  2JZS A;  2O89 A; 
#chains in the Genus database with same CATH topology
 2KLX A;  4NHW A;  5G30 A;  2F8A A;  1JZO A;  2HT9 A;  2LRN A;  4EC0 A;  1VF4 A;  1WE0 A;  5CYY A;  4F0C A;  5IMZ A;  4OFM A;  1FG4 A;  3FYG A;  3G7I A;  2L5L A;  4IW9 A;  1A0R P;  1EZK A;  3P8W A;  1AXD A;  3KD0 A;  1GUH A;  3TCO A;  3CRU A;  1EEJ A;  2H01 A;  3BJ5 A;  5A4U A;  4I5Q A;  3GMF A;  4JU5 A;  4D73 B;  3UVH A;  2H1A A;  3F4T A;  2YWO A;  4KCE A;  4HUA A;  4BWS A;  1M3J A;  2VM1 A;  1XG8 A;  4I2U A;  1TKD B;  3QDN A;  3LG6 A;  1E2Y A;  3DEX A;  4AGS A;  5DAK A;  1SKR B;  3FEU A;  1HQO A;  2B5E A;  5KEJ A;  4TXO B;  1GL8 A;  4TVE A;  3E9J B;  5F06 A;  1T00 A;  3WGD A;  2GLR A;  4GWR A;  3L4N A;  3ZIV A;  1MEK A;  3APO A;  3QMX A;  1JZR A;  1YY7 A;  2IMK A;  3P2A A;  3G7Y A;  1M2B A;  3W8S A;  4USS A;  5ECQ B;  1PRX A;  3LXT A;  2C3Q A;  2ZCT A;  2GSQ A;  2GST A;  2X8H A;  2GSS A;  3KEB A;  4O92 A;  3GIX A;  2FD3 A;  1V57 A;  3IOS A;  3D22 A;  4GSN A;  3TJK A;  4K7O A;  2DJJ A;  2YWI A;  5D9X A;  1EP8 A;  2IME A;  2X49 A;  4V2L A;  1AAZ A;  1BG5 A;  2C0F A;  3DWV A;  3GH6 A;  5D93 A;  3BBY A;  1IYI A;  3IK7 A;  3LGC A;  4POB A;  2OBI A;  6GSU A;  4EF0 A;  4O32 A;  2VCV A;  4K2D A;  1Z5Y E;  1HD2 A;  4EDZ A;  3F4S A;  2LQQ A;  2ZUP A;  4X4J A;  1F9M A;  3EUR A;  2BTO T;  1GTU A;  5KN1 A;  1H4O A;  4X0X A;  4JZQ A;  4MH3 A;  2HRN A;  4ML6 A;  2YV7 A;  4IJI A;  2R3X A;  2YPM A;  2M46 A;  1AUC A;  1Z9H A;  3HHV A;  3ERW A;  5CRG A;  5ECM B;  2DC5 A;  2NDO A;  3C7M A;  4ID0 A;  5CRW A;  2M80 A;  1OE8 A;  2A4V A;  4HU7 A;  2OE3 A;  2VM2 A;  2C3N A;  2GVP A;  1XPV A;  2WJU A;  4KGI A;  2QC7 A;  1SK1 A;  4MF5 A;  4GRF A;  3A3T A;  2XHF A;  3A5W A;  1GUM A;  3GTU B;  3J7Y k;  3TJG A;  1AQX A;  2AB6 A;  1SKW B;  2F3M A;  2B3S A;  2C0D A;  3KH7 A;  3GN3 A;  1B9Y C;  2F8F A;  3U6V A;  4LL1 B;  4OO5 A;  2H0G A;  1DBY A;  3N5O A;  3M8N A;  3O76 A;  3DD3 A;  2QA2 A;  2HYX A;  3TKS C;  1BYE A;  1C72 A;  1PMT A;  4TOP A;  3NIV A;  4XRD A;  2C3T A;  4MPF A;  2I81 A;  1FB0 A;  2WGR A;  4OO4 A;  3ZMK A;  2LNS A;  4PXO A;  1THX A;  5JWR B;  1B4Q A;  1LU4 A;  2REM A;  4GCI A;  1CQG A;  3CMI A;  2C8U A;  2KOK A;  2FA8 A;  1GH2 A;  4ISD A;  5G5F A;  4ECJ A;  1M0U A;  1SJI A;  1MD4 A;  2N5F A;  1G6W A;  1ERV A;  1J0F A;  3U5R E;  2GQL A;  1KBN A;  2GTU A;  1XBS A;  4CHS A;  4J57 E;  1X5E A;  4EKZ A;  4DSR A;  5J9B A;  5INY A;  3TRQ A;  1ERU A;  3RPP A;  1QUW A;  1GSD A;  3IXR A;  3IK9 A;  4PQ1 A;  3O6T A;  2LJR A;  2H6Y A;  4RI7 A;  3GST A;  2V6K A;  3CYN A;  4ZXG A;  1V2A A;  3UMA A;  4K5S A;  5G1K A;  4BVY A;  1X5C A;  4K2X A;  4GTU A;  2M72 A;  4X43 A;  2JSZ A;  4NXI A;  1TU7 A;  2XBI A;  1ACV A;  5AIX A;  2HFD A;  1WWJ A;  1QK8 A;  5CRE A;  5CNW A;  2G0F A;  1FB6 A;  1YKA A;  1U87 A;  2WDU A;  1LBK A;  1AQV A;  2VO4 A;  2E7P A;  1SL1 B;  5EVO A;  1X0R A;  2YWM A;  3TOU A;  4LL4 B;  3DXB A;  4L8E A;  4WXT A;  3GX0 A;  2VUP A;  5C00 A;  1SD8 A;  2QA1 A;  1SL0 B;  2V6O A;  1URM A;  3MIX A;  1WIK A;  5BMU A;  3V1W A;  4GF0 A;  5JWO B;  1SK2 A;  1OC9 B;  4PTS A;  1X9W B;  5E4W A;  4TR0 A;  4DSS A;  2AYT A;  2GQK A;  2X64 A;  4HSC X;  4AJ8 A;  6GSX A;  1XWG A;  2TIR A;  4G0I A;  4WKW A;  16GS A;  1OC8 A;  3A2V A;  4O5U A;  3FR6 A;  3KJY A;  2FY6 A;  5ECP B;  2FWE A;  3IC4 A;  4KDY A;  3ZIT A;  1DUG A;  1QQ2 A;  4KSM A;  1TTZ A;  4G0K A;  6GSY A;  1KEB A;  1XCC A;  1PX7 A;  1MDI A;  1TJD A;  3GL5 A;  3IR4 A;  2H6Z A;  4FO5 A;  5HR0 A;  4NPB A;  3ISO A;  3UL3 A;  5IOX A;  3QD9 A;  1S3A A;  1K0N A;  2YNX A;  1S3D A;  4OD7 A;  3TRX A;  4MAB A;  5LNK e;  2H72 A;  1Z7P A;  1V40 A;  2PVQ A;  5DJL A;  1BX9 A;  5GST A;  2IJY A;  3EVI A;  2YZH A;  2DJ0 A;  1JZD A;  1R4W A;  1J08 A;  1MDK A;  1NW2 A;  3UOM A;  2H1B A;  1OAZ A;  3C71 A;  3W6G A;  2NBS A;  3VWW A;  4BVX B;  1VRS D;  3IE3 A;  4KDX A;  4NV5 A;  1PFO A;  4TR1 B;  3KM6 A;  2F9S A;  4EO3 A;  2L6D A;  5IMD A;  5AGY A;  3VLN A;  4K5R A;  5IMC A;  1GLQ A;  5B8A A;  2HRF A;  3QFA C;  3F8U A;  3HKR A;  3C1R A;  3MAK A;  1R5P A;  3R3E A;  3TJF A;  3EE2 A;  3UAR A;  4YAP A;  3IBH A;  3HJM A;  1EGO A;  3KIJ A;  5AN1 A;  1T4Z A;  2HSM A;  1GSF A;  2HRA A;  3TGZ A;  2LS5 A;  1MTC A;  4PQI A;  3EYT A;  2Z9S A;  2AJQ B;  4OCE A;  3I9V 2;  3GKM A;  3G9B A;  1DE1 A;  4HZ4 A;  2CVB A;  3D21 A;  1XVW A;  14GS A;  1Z3E A;  2R6K A;  2WS2 A;  4ML1 A;  1T8E B;  2JAD A;  3GUR A;  1W4V A;  1M99 A;  3LJR A;  4MCU A;  5LD0 A;  4XCS A;  4DSQ A;  4Z2R A;  1GTI A;  4A5P A;  3A5I A;  4ZB9 A;  2O87 A;  3D6I A;  3FR3 A;  1O85 A;  1YEP A;  3HVS A;  1K0D A;  2OAC A;  2VLV A;  1M9A A;  2LRT A;  4FYB A;  2DIY A;  5H5R A;  1O7U A;  1ZZY A;  4ECC A;  3CXG A;  4O5R A;  4F03 A;  4JR4 A;  2GT5 A;  1GWC A;  1OKT A;  1M7T A;  2P0G A;  4OWY A;  1JFU A;  6GSV A;  3F63 A;  5COH A;  1X9S B;  2MMN A;  5H5Q A;  5HQP A;  4XS4 A;  4JED A;  4PX1 A;  1SEN A;  4WBR D;  1SD9 A;  4ZIJ A;  1PD2 1;  3A2X A;  4ECI A;  5E59 A;  4NMU A;  1A2L A;  2R0G A;  4MJC A;  4TR4 A;  2L4Q A;  3F6D A;  3FK8 A;  2DBC A;  4Z7X A;  1EWX A;  3KMO A;  1PKZ A;  3DIE A;  3TKS A;  1PA3 A;  2R5G A;  1GTB A;  3C1S A;  3BOA A;  5ENU A;  1QGV A;  2CX4 A;  2KHP A;  5IM9 A;  4FIW A;  4XS6 A;  2OE0 A;  1XZO A;  2J9H A;  4CY6 A;  2C0G A;  5DVB A;  2RII A;  5DJM A;  1A23 A;  5AIS A;  2IMI A;  2VCX A;  4N11 A;  4N0V A;  2IL3 A;  22GS A;  4MA9 A;  4QQ7 A;  5J4U A;  1Q98 A;  5F8B A;  2E2M A;  2V41 A;  1HNA A;  1FHE A;  20GS A;  1ZYE A;  5CRD A;  2O7K A;  3CBU A;  1B8X A;  1FAA A;  1U3I A;  2AAW A;  1Z7R A;  3GKK A;  3QR6 A;  1TRU A;  5J41 A;  4TRX A;  7GSS A;  4N30 A;  5ECO B;  1GUK A;  4POM A;  4NV2 A;  2HSH A;  4K7N A;  4MJE A;  4BVY B;  2RM6 A;  1T7P B;  1FW1 A;  2GZY A;  1XXU A;  1BED A;  1ERT A;  2E0Q A;  2YAN A;  2QKE A;  1FVJ A;  5LCZ A;  4I6X A;  5DQY A;  3DVX A;  5CAX A;  3C8E A;  3EU4 A;  1FO5 A;  3M0F A;  4QL7 A;  4EVM A;  2NPB A;  1HYU A;  3HYP A;  2WB9 A;  2ALB A;  1O8X A;  3TUE A;  4MZW A;  5HR2 A;  2EIR A;  2ON5 A;  2MMZ A;  1M3I A;  2VAF A;  2XPE A;  2E2G A;  2LEG A;  2OKA A;  2L6C A;  5IOW A;  3HD5 A;  1EP7 A;  3GX8 A;  1B4P A;  2WZ9 A;  3BCI A;  3IV4 A;  3UBK A;  5DAL A;  1QFN A;  3IHQ A;  3TKR A;  2QSI A;  4ZBD A;  3VFI A;  3UEM A;  4MF7 A;  3M9K A;  3GKX A;  3DYR A;  4EIP A;  4OMV A;  2LV3 A;  5JWQ B;  4LA1 A;  2IFQ A;  3GL3 A;  3F4R A;  1EV4 A;  2H1G A;  2LTK A;  1WP0 A;  1BJX A;  4EE0 A;  4V1A p;  1JHB A;  3HVX A;  5GAN D;  1E6B A;  2HZE A;  4EL1 A;  2IN3 A;  1THO A;  3QAV A;  3TOT A;  3GA4 A;  3ZLP A;  4Z2U A;  2C1Y A;  1GUL A;  2DJK A;  5A4V A;  2GT6 A;  2IWT A;  5D9V A;  2YWN A;  3WT2 A;  3ZRE A;  2PUK C;  5F07 A;  2JZT A;  4L5L A;  4EDY A;  4G19 A;  3C73 A;  2RUF A;  1ZGN A;  5B6M A;  4MH2 A;  4KF9 A;  4JE1 A;  1PGT A;  3GH9 A;  1XWA A;  2CQ9 A;  3EPT A;  1ST9 A;  1F37 A;  5AIV A;  1T3B A;  1TI1 A;  4AJ6 A;  3S9F A;  2VL3 A;  1TK0 B;  1O73 A;  2NVL A;  4CY8 A;  4MLY A;  4FYU A;  4MZC A;  3R2Q A;  1XW5 A;  5A4W A;  2C0E A;  2I3Y A;  3Q6O A;  3NZN A;  3CRT A;  4KA0 A;  4IQA A;  2H19 A;  2FGX A;  1U88 A;  2K18 A;  5FT3 A;  1Z6N A;  2VL9 A;  1ZOF A;  4D73 A;  5G2Z A;  2JL4 A;  3FZ5 A;  2H70 A;  5KN0 A;  2HNL A;  3KH9 A;  3VPQ A;  3A2W A;  4TKY A;  3MSZ A;  1GSU A;  2A2S A;  2QGV A;  1FVK A;  3UAP A;  4PNF A;  3M3M A;  2R0C A;  5C04 A;  1VGL A;  3I6A A;  3RPN A;  1XFL A;  4DVC A;  1A8Y A;  2VCT A;  3CTF A;  1Y6E A;  4WET A;  1GNW A;  2K8S A;  2GS3 A;  2JAC A;  3DGQ A;  1G7O A;  1V58 A;  3DVW A;  3FZ9 A;  4O7H A;  4RQX A;  4WBJ A;  3LFL A;  1PL2 A;  5IMF A;  3VWU A;  4LMW A;  2BJX A;  4POK A;  3SWL A;  2DSA A;  2N5B A;  3H8Q A;  4V1A g;  4KH7 A;  4HJ2 A;  4YKG A;  2B5Y A;  2GZP A;  3UIW A;  1DSB A;  4GSS A;  1XWB A;  1AQW A;  1HNB A;  1NM3 A;  1TK5 B;  2YP6 A;  1G7E A;  2HE3 A;  2I1U A;  2VOC A;  5ID2 B;  5JCU A;  5JCW A;  1K3Y A;  5EPF A;  4BL7 B;  3TJJ A;  2VCZ A;  3H4K A;  4J56 E;  4ZL8 A;  4K9Z A;  4CDO A;  2PBJ A;  4Q5F A;  3WYW A;  1EGR A;  1WOU A;  3RDW A;  1RW1 A;  5J3R A;  3IRA A;  5HFK A;  3ERG A;  3IPZ A;  2L59 A;  4GQC A;  3RAZ A;  1S3R A;  2CVK A;  5GSS A;  4WF4 A;  4ZBB A;  3L0H A;  3TKQ A;  5IMV A;  1KTE A;  3GYK A;  2YV9 A;  3CQF A;  2X4A A;  3ZIJ A;  2AUV A;  3ZVJ A;  3HZ8 A;  2FA4 A;  5CRH A;  1Z6M A;  1X9M B;  2HI7 A;  4AJ7 A;  5F0G A;  3BCK A;  3HDC A;  3NOF A;  2CVD A;  3DRN A;  3FKF A;  1ABA A;  2H74 A;  2PER A;  1TRV A;  3KP8 A;  5CP1 A;  2HSY A;  2H73 A;  4K0N A;  5G5E A;  2OE1 A;  4G9H A;  1LJR A;  1YJ6 A;  3TRP A;  2CZ3 A;  2RUE A;  4ZL7 A;  1RK4 A;  5DAK B;  2K9F A;  1I5G A;  4YQU A;  4IN0 A;  4MP4 A;  6GST A;  1WPI A;  4ZB6 A;  2FWF A;  2TRC P;  3BD2 A;  5IPG A;  3VI7 A;  2LST A;  1TRW A;  2CAI A;  4GST A;  3MYD A;  3OR5 A;  1XOB A;  3CSH A;  2H76 A;  5CO3 A;  4BWQ A;  1TU8 A;  1UA5 A;  1ZMA A;  4K1F A;  2OAD A;  3D5J A;  2H30 A;  1FOV A;  2EIO A;  1QMV A;  1YF1 A;  4IVF A;  3TDG A;  2XC2 A;  5ECS A;  3O3T A;  3GKN A;  2DKH A;  4KSO A;  4ECB A;  4EIQ A;  1OE7 A;  1OYJ A;  3LXZ A;  5KOW A;  3ZZX A;  3LYK A;  5KOX A;  1F3B A;  2VLT A;  5ECL B;  5H5S A;  5ECR B;  4EUY A;  2DML A;  2FNO A;  2FCH A;  2OBK A;  4IGJ A;  3VUR A;  1R7H A;  1TP9 A;  1TOF A;  1GSS A;  2O8V B;  3RHB A;  3ME7 A;  1ZYQ B;  4HQZ A;  3F0I A;  1UC7 A;  1VF3 A;  3PH9 A;  4XRA A;  4BPY A;  2WFC A;  3FR9 A;  5DAL B;  2LQO A;  1IYH A;  5DCH A;  3G7J A;  3VWX A;  4F82 A;  3GRX A;  11GS A;  18GS A;  2P31 A;  4KCA A;  1WMJ A;  3CSJ A;  4GXZ A;  1GSQ A;  1SKS B;  3ZFL A;  3KXO A;  3EMP A;  2H0H A;  4WR4 A;  4MMM A;  1YF0 A;  1RQM A;  5HFG A;  4MJB A;  5G31 A;  3W8J A;  2L4C A;  1I9D A;  5IIZ A;  2H75 A;  3HJO A;  1TK8 B;  3LSZ A;  2PVO C;  1A2J A;  4OFT A;  4Q5R A;  3HY2 A;  3TB2 A;  2ON7 A;  5DQS A;  3IC8 A;  3EIN A;  4HOJ A;  2HZE B;  4OFN A;  1EOG A;  3ED3 A;  4FH8 A;  2FWG A;  4RUV A;  2VL2 C;  4QL9 A;  3WGE A;  3APQ A;  4HDE A;  1YZX A;  1OC9 A;  4G0L A;  3QOU A;  4ZBA A;  2I4A A;  4EXJ A;  2LJA A;  3P7X A;  1ML6 A;  3FRC A;  1XVQ A;  4L0W A;  3KCM A;  1QXH A;  1K0M A;  2G2Q A;  3ERF A;  2VD0 A;  5DDL A;  2XPD A;  4HZ2 A;  2GSR A;  2R37 A;  1HNC A;  3KMN A;  2D2Z A;  4YQV A;  3Q19 A;  1XWK A;  3GFK A;  4KDU A;  1ZL9 A;  2RM5 A;  4Q5N A;  2AHE A;  5ELG A;  4XHM A;  2P5Q A;  2GDR A;  3WGX A;  1CQH A;  1BQ7 A;  1F3A A;  2X8G A;  3IAM 2;  5A5K A;  1G6Y A;  5KN3 A;  4IS0 A;  3IHG A;  1XOA A;  4HU9 A;  4O5Q A;  2H6X A;  10GS A;  2YZU A;  3LWA A;  4PUA A;  1K3O A;  3CTG A;  2B1K A;  4MDC A;  4XTS A;  1A24 A;  5HR1 A;  1U3A A;  5FWG A;  1K0C A;  1XWC A;  2VIM A;  3H79 A;  4YKF A;  2PMT A;  3GNJ A;  5G1L A;  1JZW A;  2DJ2 A;  2OA7 A;  3FY7 A;  1ILO A;  4BVX A;  5FHI A;  2K8V A;  1A2M A;  1PN9 A;  4IQ1 A;  2PPT A;  4K0G A;  2DMM A;  2PN8 A;  4FYC A;  1TW9 A;  13GS A;  3UBL A;  4WEY A;  2MMA A;  2B7K A;  2YN1 A;  3FW2 A;  4TR1 A;  3H93 A;  4J2F A;  2DJ1 A;  2R0P A;  1KNG A;  1B9X C;  2MBS A;  1USB A;  2PWJ A;  2A4H A;  9GSS A;  1DE2 A;  4WF5 A;  5EY6 A;  2VCW A;  1EEM A;  3ME8 A;  3MDK A;  5F05 A;  2IMD A;  5D8I A;  2PU9 C;  4KAE A;  4DSS B;  4E8H A;  5B6N A;  1R26 A;  4V2M A;  2KUC A;  4N10 A;  4MPG A;  1VF1 A;  5ECI B;  1M2A A;  3WT1 A;  2LRC A;  1PKW A;  2DJ3 A;  4NHZ A;  4XIH A;  1PX6 A;  1SU9 A;  2FHE A;  2XBQ A;  4K7I A;  1JLW A;  4ICY A;  1T1V A;  4FQU A;  1XW9 A;  5DCG A;  4BIK A;  4MF6 A;  1M2D A;  3IDV A;  4L5O A;  2GZZ A;  3J7Y b;  2P5R A;  3GV1 A;  3VK9 A;  2RLI A;  2IPA A;  2LJK A;  3P90 A;  5DBQ A;  4PQH A;  4ACS A;  3M9J A;  3FHK A;  2MBT A;  4YAV A;  4PUR A;  3D4M A;  2TRX A;  1Y25 A;  1F6M C;  5J9C A;  2AV4 A;  4ZIL A;  1YEX A;  4KND A;  1TRS A;  4TXV A;  1AIU A;  4G2E A;  3E3E A;  2VCQ A;  1K0B A;  2CX3 A;  2LKU A;  4LLR A;  1V98 A;  2FLS A;  3LYP A;  5HR3 A;  17GS A;  4LMV A;  2GGT A;  4V2N A;  1AC1 A;  1GSY A;  4IP6 A;  2CAQ A;  1GP1 A;  3JCM L;  3GUS A;  4ZB8 A;  1ZYP A;  3HCZ A;  19GS A;  1F2E A;  2MZC A;  2CV4 A;  1SK0 A;  2ES7 A;  2A2P A;  1GNE A;  2VD1 A;  5BRT A;  4KX4 A;  2PGT A;  3PPU A;  3VPT A;  1A8L A;  2H0I A;  2JSY A;  2HLS A;  3EU3 A;  3RHC A;  5D96 A;  3SBC A;  4HEA 2;  4K8M A;  4JRR A;  4RQR A;  4KE3 A;  1S3C A;  3HXS A;  3L9S A;  4F0B A;  4PGT A;  3D4T A;  1GLP A;  3HJP A;  12GS A;  3L78 A;  3Q18 A;  2YJH A;  4IHU A;  3GHA A;  3HZ4 A;  5GZZ B;  1BAY A;  1ERW A;  2YCD A;  2B7J A;  3PGT A;  3FMW A;  3K8N A;  3N9J A;  1FOH A;  1K0A A;  4WR5 A;  4TXO A;  4MJA A;  2VLU A;  3EMX A;  3KTL A;  4I2T A;  2V1M A;  1NHY A;  4YQM A;  4E8E A;  3HA9 A;  3ZRD A;  1ZYN A;  1AW9 A;  4F2I A;  5JCG A;  5KN2 A;  4MNN A;  3I43 A;  2N5A A;  5IPH A;  2ZNM A;  5ECH B;  2C80 A;  3E0U A;  4NWY A;  4HI7 A;  4POL A;  2H8L A;  1G0T A;  3QPM A;  1N2A A;  1ZCP A;  4BA7 A;  4P3Y B;  1MD3 A;  5D9T A;  2H1D A;  4H86 A;  3QFB C;  1OVN A;  4L0U A;  4CW9 A;  3I69 A;  1OKD A;  5ECN B;  4XS4 B;  3ZYW A;  1SJ6 A;  2IMF A;  5L71 A;  1OC3 A;  1YDK A;  4TN8 A;  2KP2 A;  1O8W A;  1B48 A;  2WCI A;  2VL2 A;  1TDI A;  3LEF A;  2I9H A;  2HXK A;  2IIY A;  3LQ7 A;  1UVZ A;  4RI6 A;  3MWH A;  1M9B A;  3QAG A;  5J5N A;  4ILF A;  1EV9 A;  3GSS A;  4G10 A;  4K6X A;  3KTB A;  2V2G A;  4Q5Q A;  6GSS A;  6GSW A;  4IEL A;  2C4J A;  1TI3 A;  3IA1 A;  3FZA A;  3ZTL A;  4OCF A;  2BMX A;  3HVN A;  4DEJ A;  2K6V A;  1GRX A;  3RBT A;  3WD6 A;  4NAX A;  2J23 A;  1SL2 B;  5ECK B;  3ZFB A;  2V32 A;  3MNG A;  4YH2 A;  2LUS A;  4KB3 A;  2B5X A;  2X99 A;  5ABR A;  1J9B A;  2YJ7 A;  2F51 A;  3KGK A;  2LNT A;  1H75 A;  3DKS A;  1O6J A;  2CA8 A;  4N0Z A;  3KZQ A;  1R5A A;  3GTU A;  3F6F A;  3D0Z A;  1PL1 A;  3F3R A;  4X1U A;  3LW9 A;  3M1G A;  3DML A;  2MMO A;  4MK3 A;  5IQY A;  3UJ1 A;  4IJ3 A;  3APS A;  1SYX A;  3AY8 A;  1X5D A;  1U6T A;  3EC3 A;  3PR8 A;  3F3Q A;  2WRT A;  1GTA A;  4TW5 A;  2L5O A;  1WRY A;  4PNG A;  4GLT A;  2HZF A;  2A2R A;  3QCP A;  3VWV A;  3TJB A;  1ON4 A;  1SYR A;  1PN0 A;  4HJM A;  3ZL5 A;  4ULX A;  1NHO A;  1VF2 A;  2R2J A;  1JLV A;  2FWH A;  4F9Z A;  1GSE A;  3EWL A;  2WUL A;  5GAP D;  1K0O A;  2DIZ A;  2HRK A;  1YQ1 A;  3L9U A;  4TR3 A;  4I97 A;  4IP1 A;  3TKP A;  1W89 A;  2UZ8 A;  3FZ4 A;  8GSS A;  2X8C A;  1PSQ A;  3QAW A;  4MZB A;  2GQM A;  2EC4 A;  1PQN A;  2JZR A;  4IBP A;  5IO0 A;  1O81 A;  2B1L A;  4Z2T A;  3PIN A;  4XS1 A;  1Q4J A;  3Q74 A;  2O85 A;  2H71 A;  4JR6 A;  3ZVJ D;  2IFQ B;  1XIY A;  4KUN A;  4IKH A;  5EL8 A;  3L9V A;  1YKC A;  3TKS E;  1K3L A;  4HS1 A;  2DLX A;  3F9U A;  4ZL9 A;  2DKI A;  1EOH A;  4HQS A;  2KP1 A;  3CSI A;  4KW6 A;  1MDJ A;  5D73 A;  5B7C A;  2NTO A;  4JBB A;  1V9W A;  1A0F A;  2YOI A;  2CZ2 A;  3VI5 A;  4AF2 A;  5ID2 A;  1TXX A;  1SJZ A;  3IAS 2;  2MYG A;  2L57 A;  4BL7 A;  1T4Y A;  1UN2 A;  4I8B A;  5B8B A;  5D9W A;  2B6M A;  2H66 A;  5IMA A;  2FUG 2;  2R4V A;  3LOR A;  3ZML A;  4GQF A;  4PUF C;  2EIQ A;  2OJL A;  1N8J A;  1XW6 A;  3HVV A;  5IO2 A;  2JU5 A;  1WJK A;  2CT6 A;  3H1N A;  5ELA A;  3KP9 A;  5HFI A;  1NSW A;  3UVT A;  3US3 A;  2JZS A;  2O89 A; 
#chains in the Genus database with same CATH homology
 2KLX A;  4NHW A;  5G30 A;  2F8A A;  1JZO A;  2HT9 A;  2LRN A;  4EC0 A;  1VF4 A;  1WE0 A;  5CYY A;  4F0C A;  5IMZ A;  4OFM A;  1FG4 A;  3FYG A;  3G7I A;  2L5L A;  4IW9 A;  1A0R P;  1EZK A;  3P8W A;  1AXD A;  3KD0 A;  1GUH A;  3TCO A;  3CRU A;  1EEJ A;  2H01 A;  3BJ5 A;  5A4U A;  4I5Q A;  3GMF A;  4JU5 A;  4D73 B;  3UVH A;  2H1A A;  3F4T A;  2YWO A;  4KCE A;  4HUA A;  4BWS A;  2VM1 A;  4I2U A;  1TKD B;  3QDN A;  3LG6 A;  1E2Y A;  3DEX A;  4AGS A;  5DAK A;  1SKR B;  3FEU A;  1HQO A;  2B5E A;  5KEJ A;  4TXO B;  1GL8 A;  4TVE A;  3E9J B;  5F06 A;  1T00 A;  3WGD A;  2GLR A;  4GWR A;  3L4N A;  3ZIV A;  1MEK A;  3APO A;  3QMX A;  1JZR A;  1YY7 A;  2IMK A;  3P2A A;  3G7Y A;  1M2B A;  3W8S A;  4USS A;  5ECQ B;  1PRX A;  3LXT A;  2C3Q A;  2ZCT A;  2GSQ A;  2GST A;  2X8H A;  2GSS A;  3KEB A;  4O92 A;  3GIX A;  2FD3 A;  1V57 A;  3IOS A;  3D22 A;  4GSN A;  3TJK A;  4K7O A;  2DJJ A;  2YWI A;  5D9X A;  1EP8 A;  2IME A;  2X49 A;  4V2L A;  1AAZ A;  1BG5 A;  2C0F A;  3DWV A;  3GH6 A;  5D93 A;  3BBY A;  1IYI A;  3IK7 A;  3LGC A;  4POB A;  2OBI A;  6GSU A;  4EF0 A;  4O32 A;  2VCV A;  4K2D A;  1Z5Y E;  1HD2 A;  4EDZ A;  3F4S A;  2LQQ A;  2ZUP A;  4X4J A;  1F9M A;  3EUR A;  2BTO T;  1GTU A;  5KN1 A;  1H4O A;  4X0X A;  4JZQ A;  4MH3 A;  2HRN A;  4ML6 A;  2YV7 A;  4IJI A;  2R3X A;  2YPM A;  2M46 A;  1AUC A;  1Z9H A;  3HHV A;  3ERW A;  5CRG A;  5ECM B;  2DC5 A;  2NDO A;  3C7M A;  4ID0 A;  5CRW A;  2M80 A;  1OE8 A;  2A4V A;  4HU7 A;  2OE3 A;  2VM2 A;  2C3N A;  2GVP A;  1XPV A;  2WJU A;  4KGI A;  2QC7 A;  1SK1 A;  4MF5 A;  4GRF A;  3A3T A;  2XHF A;  3A5W A;  1GUM A;  3GTU B;  3J7Y k;  3TJG A;  1AQX A;  2AB6 A;  1SKW B;  2F3M A;  2B3S A;  2C0D A;  3KH7 A;  3GN3 A;  1B9Y C;  2F8F A;  3U6V A;  4LL1 B;  4OO5 A;  2H0G A;  1DBY A;  3N5O A;  3M8N A;  3O76 A;  3DD3 A;  2QA2 A;  2HYX A;  3TKS C;  1BYE A;  1C72 A;  1PMT A;  4TOP A;  3NIV A;  4XRD A;  2C3T A;  4MPF A;  2I81 A;  1FB0 A;  2WGR A;  4OO4 A;  3ZMK A;  2LNS A;  4PXO A;  1THX A;  5JWR B;  1B4Q A;  1LU4 A;  2REM A;  4GCI A;  1CQG A;  3CMI A;  2C8U A;  2KOK A;  2FA8 A;  1GH2 A;  4ISD A;  5G5F A;  4ECJ A;  1M0U A;  1SJI A;  1MD4 A;  2N5F A;  1G6W A;  1ERV A;  1J0F A;  3U5R E;  2GQL A;  1KBN A;  2GTU A;  1XBS A;  4CHS A;  4J57 E;  1X5E A;  4EKZ A;  4DSR A;  5J9B A;  5INY A;  3TRQ A;  1ERU A;  3RPP A;  1QUW A;  1GSD A;  3IXR A;  3IK9 A;  4PQ1 A;  3O6T A;  2LJR A;  2H6Y A;  4RI7 A;  3GST A;  2V6K A;  3CYN A;  4ZXG A;  1V2A A;  3UMA A;  4K5S A;  5G1K A;  4BVY A;  1X5C A;  4K2X A;  4GTU A;  2M72 A;  4X43 A;  2JSZ A;  4NXI A;  1TU7 A;  2XBI A;  1ACV A;  5AIX A;  2HFD A;  1WWJ A;  1QK8 A;  5CRE A;  5CNW A;  2G0F A;  1FB6 A;  1YKA A;  1U87 A;  2WDU A;  1LBK A;  1AQV A;  2VO4 A;  2E7P A;  1SL1 B;  5EVO A;  1X0R A;  2YWM A;  3TOU A;  4LL4 B;  3DXB A;  4L8E A;  4WXT A;  3GX0 A;  2VUP A;  5C00 A;  1SD8 A;  2QA1 A;  1SL0 B;  2V6O A;  1URM A;  3MIX A;  1WIK A;  5BMU A;  3V1W A;  4GF0 A;  5JWO B;  1SK2 A;  1OC9 B;  4PTS A;  1X9W B;  5E4W A;  4TR0 A;  4DSS A;  2AYT A;  2GQK A;  2X64 A;  4AJ8 A;  6GSX A;  1XWG A;  2TIR A;  4G0I A;  4WKW A;  16GS A;  1OC8 A;  3A2V A;  4O5U A;  3FR6 A;  3KJY A;  2FY6 A;  5ECP B;  2FWE A;  3IC4 A;  4KDY A;  3ZIT A;  1DUG A;  1QQ2 A;  4KSM A;  1TTZ A;  4G0K A;  6GSY A;  1KEB A;  1XCC A;  1PX7 A;  1MDI A;  1TJD A;  3GL5 A;  3IR4 A;  2H6Z A;  4FO5 A;  5HR0 A;  4NPB A;  3ISO A;  3UL3 A;  5IOX A;  3QD9 A;  1S3A A;  1K0N A;  2YNX A;  1S3D A;  4OD7 A;  3TRX A;  4MAB A;  5LNK e;  2H72 A;  1Z7P A;  1V40 A;  2PVQ A;  5DJL A;  1BX9 A;  5GST A;  2IJY A;  3EVI A;  2YZH A;  2DJ0 A;  1JZD A;  1R4W A;  1J08 A;  1MDK A;  1NW2 A;  3UOM A;  2H1B A;  1OAZ A;  3C71 A;  3W6G A;  2NBS A;  3VWW A;  4BVX B;  1VRS D;  3IE3 A;  4KDX A;  4NV5 A;  4TR1 B;  3KM6 A;  2F9S A;  4EO3 A;  2L6D A;  5IMD A;  5AGY A;  3VLN A;  4K5R A;  5IMC A;  1GLQ A;  5B8A A;  2HRF A;  3QFA C;  3F8U A;  3HKR A;  3C1R A;  3MAK A;  1R5P A;  3R3E A;  3TJF A;  3EE2 A;  3UAR A;  4YAP A;  3IBH A;  3HJM A;  1EGO A;  3KIJ A;  5AN1 A;  1T4Z A;  2HSM A;  1GSF A;  2HRA A;  3TGZ A;  2LS5 A;  1MTC A;  4PQI A;  3EYT A;  2Z9S A;  2AJQ B;  4OCE A;  3I9V 2;  3GKM A;  3G9B A;  1DE1 A;  4HZ4 A;  2CVB A;  3D21 A;  1XVW A;  14GS A;  1Z3E A;  2R6K A;  2WS2 A;  4ML1 A;  1T8E B;  2JAD A;  3GUR A;  1W4V A;  1M99 A;  3LJR A;  4MCU A;  5LD0 A;  4XCS A;  4DSQ A;  4Z2R A;  1GTI A;  4A5P A;  3A5I A;  4ZB9 A;  2O87 A;  3D6I A;  3FR3 A;  1O85 A;  1YEP A;  3HVS A;  1K0D A;  2OAC A;  2VLV A;  1M9A A;  2LRT A;  4FYB A;  2DIY A;  5H5R A;  1O7U A;  1ZZY A;  4ECC A;  3CXG A;  4O5R A;  4F03 A;  4JR4 A;  2GT5 A;  1GWC A;  1OKT A;  1M7T A;  2P0G A;  4OWY A;  1JFU A;  6GSV A;  3F63 A;  5COH A;  1X9S B;  2MMN A;  5H5Q A;  5HQP A;  4XS4 A;  4JED A;  4PX1 A;  1SEN A;  4WBR D;  1SD9 A;  4ZIJ A;  1PD2 1;  3A2X A;  4ECI A;  5E59 A;  4NMU A;  1A2L A;  2R0G A;  4MJC A;  4TR4 A;  2L4Q A;  3F6D A;  3FK8 A;  2DBC A;  4Z7X A;  1EWX A;  3KMO A;  1PKZ A;  3DIE A;  3TKS A;  1PA3 A;  2R5G A;  1GTB A;  3C1S A;  3BOA A;  5ENU A;  1QGV A;  2CX4 A;  2KHP A;  5IM9 A;  4FIW A;  4XS6 A;  2OE0 A;  1XZO A;  2J9H A;  4CY6 A;  2C0G A;  5DVB A;  2RII A;  5DJM A;  1A23 A;  5AIS A;  2IMI A;  2VCX A;  4N11 A;  4N0V A;  2IL3 A;  22GS A;  4MA9 A;  4QQ7 A;  5J4U A;  1Q98 A;  5F8B A;  2E2M A;  2V41 A;  1HNA A;  1FHE A;  20GS A;  1ZYE A;  5CRD A;  2O7K A;  3CBU A;  1B8X A;  1FAA A;  1U3I A;  2AAW A;  1Z7R A;  3GKK A;  3QR6 A;  1TRU A;  5J41 A;  4TRX A;  7GSS A;  4N30 A;  5ECO B;  1GUK A;  4POM A;  4NV2 A;  2HSH A;  4K7N A;  4MJE A;  4BVY B;  2RM6 A;  1T7P B;  1FW1 A;  2GZY A;  1XXU A;  1BED A;  1ERT A;  2E0Q A;  2YAN A;  2QKE A;  1FVJ A;  5LCZ A;  4I6X A;  5DQY A;  3DVX A;  5CAX A;  3C8E A;  3EU4 A;  1FO5 A;  3M0F A;  4QL7 A;  4EVM A;  2NPB A;  1HYU A;  3HYP A;  2WB9 A;  2ALB A;  1O8X A;  3TUE A;  4MZW A;  5HR2 A;  2EIR A;  2ON5 A;  2MMZ A;  2VAF A;  2XPE A;  2E2G A;  2LEG A;  2OKA A;  2L6C A;  5IOW A;  3HD5 A;  1EP7 A;  3GX8 A;  1B4P A;  2WZ9 A;  3BCI A;  3IV4 A;  3UBK A;  5DAL A;  1QFN A;  3IHQ A;  3TKR A;  2QSI A;  4ZBD A;  3VFI A;  3UEM A;  4MF7 A;  3M9K A;  3GKX A;  3DYR A;  4EIP A;  4OMV A;  2LV3 A;  5JWQ B;  4LA1 A;  2IFQ A;  3GL3 A;  3F4R A;  1EV4 A;  2H1G A;  2LTK A;  1WP0 A;  1BJX A;  4EE0 A;  4V1A p;  1JHB A;  3HVX A;  5GAN D;  1E6B A;  2HZE A;  4EL1 A;  2IN3 A;  1THO A;  3QAV A;  3TOT A;  3GA4 A;  3ZLP A;  4Z2U A;  2C1Y A;  1GUL A;  2DJK A;  5A4V A;  2GT6 A;  2IWT A;  5D9V A;  2YWN A;  3WT2 A;  3ZRE A;  2PUK C;  5F07 A;  2JZT A;  4L5L A;  4EDY A;  4G19 A;  3C73 A;  2RUF A;  1ZGN A;  5B6M A;  4MH2 A;  4KF9 A;  4JE1 A;  1PGT A;  3GH9 A;  1XWA A;  2CQ9 A;  3EPT A;  1ST9 A;  1F37 A;  5AIV A;  1T3B A;  1TI1 A;  4AJ6 A;  3S9F A;  2VL3 A;  1TK0 B;  1O73 A;  2NVL A;  4CY8 A;  4MLY A;  4FYU A;  4MZC A;  3R2Q A;  1XW5 A;  5A4W A;  2C0E A;  2I3Y A;  3Q6O A;  3NZN A;  3CRT A;  4KA0 A;  4IQA A;  2H19 A;  2FGX A;  1U88 A;  2K18 A;  5FT3 A;  1Z6N A;  2VL9 A;  1ZOF A;  4D73 A;  5G2Z A;  2JL4 A;  3FZ5 A;  2H70 A;  5KN0 A;  2HNL A;  3KH9 A;  3VPQ A;  3A2W A;  4TKY A;  3MSZ A;  1GSU A;  2A2S A;  2QGV A;  1FVK A;  3UAP A;  4PNF A;  3M3M A;  2R0C A;  5C04 A;  1VGL A;  3I6A A;  3RPN A;  1XFL A;  4DVC A;  1A8Y A;  2VCT A;  3CTF A;  1Y6E A;  4WET A;  1GNW A;  2K8S A;  2GS3 A;  2JAC A;  3DGQ A;  1G7O A;  1V58 A;  3DVW A;  3FZ9 A;  4O7H A;  4RQX A;  4WBJ A;  3LFL A;  1PL2 A;  5IMF A;  3VWU A;  4LMW A;  2BJX A;  4POK A;  3SWL A;  2DSA A;  2N5B A;  3H8Q A;  4V1A g;  4KH7 A;  4HJ2 A;  4YKG A;  2B5Y A;  2GZP A;  3UIW A;  1DSB A;  4GSS A;  1XWB A;  1AQW A;  1HNB A;  1NM3 A;  1TK5 B;  2YP6 A;  1G7E A;  2HE3 A;  2I1U A;  2VOC A;  5ID2 B;  5JCU A;  5JCW A;  1K3Y A;  5EPF A;  4BL7 B;  3TJJ A;  2VCZ A;  3H4K A;  4J56 E;  4ZL8 A;  4K9Z A;  4CDO A;  2PBJ A;  4Q5F A;  3WYW A;  1EGR A;  1WOU A;  3RDW A;  1RW1 A;  5J3R A;  3IRA A;  5HFK A;  3ERG A;  3IPZ A;  2L59 A;  4GQC A;  3RAZ A;  2CVK A;  5GSS A;  4WF4 A;  4ZBB A;  3L0H A;  3TKQ A;  5IMV A;  1KTE A;  3GYK A;  2YV9 A;  2X4A A;  3ZIJ A;  2AUV A;  3ZVJ A;  3HZ8 A;  2FA4 A;  5CRH A;  1Z6M A;  1X9M B;  2HI7 A;  4AJ7 A;  5F0G A;  3BCK A;  3HDC A;  3NOF A;  2CVD A;  3DRN A;  3FKF A;  1ABA A;  2H74 A;  2PER A;  1TRV A;  3KP8 A;  5CP1 A;  2HSY A;  2H73 A;  4K0N A;  5G5E A;  2OE1 A;  4G9H A;  1LJR A;  1YJ6 A;  3TRP A;  2CZ3 A;  2RUE A;  4ZL7 A;  1RK4 A;  5DAK B;  2K9F A;  1I5G A;  4YQU A;  4IN0 A;  4MP4 A;  6GST A;  1WPI A;  4ZB6 A;  2FWF A;  2TRC P;  3BD2 A;  5IPG A;  3VI7 A;  2LST A;  1TRW A;  2CAI A;  4GST A;  3MYD A;  3OR5 A;  1XOB A;  3CSH A;  2H76 A;  5CO3 A;  4BWQ A;  1TU8 A;  1UA5 A;  1ZMA A;  4K1F A;  2OAD A;  3D5J A;  2H30 A;  1FOV A;  2EIO A;  1QMV A;  1YF1 A;  4IVF A;  3TDG A;  2XC2 A;  5ECS A;  3O3T A;  3GKN A;  2DKH A;  4KSO A;  4ECB A;  4EIQ A;  1OE7 A;  1OYJ A;  3LXZ A;  5KOW A;  3ZZX A;  3LYK A;  5KOX A;  1F3B A;  2VLT A;  5ECL B;  5H5S A;  5ECR B;  4EUY A;  2DML A;  2FNO A;  2FCH A;  2OBK A;  4IGJ A;  3VUR A;  1R7H A;  1TP9 A;  1TOF A;  1GSS A;  2O8V B;  3RHB A;  3ME7 A;  1ZYQ B;  4HQZ A;  3F0I A;  1UC7 A;  1VF3 A;  3PH9 A;  4XRA A;  4BPY A;  2WFC A;  3FR9 A;  5DAL B;  2LQO A;  1IYH A;  5DCH A;  3G7J A;  3VWX A;  4F82 A;  3GRX A;  11GS A;  18GS A;  2P31 A;  4KCA A;  1WMJ A;  3CSJ A;  4GXZ A;  1GSQ A;  1SKS B;  3ZFL A;  3KXO A;  3EMP A;  2H0H A;  4WR4 A;  4MMM A;  1YF0 A;  1RQM A;  5HFG A;  4MJB A;  5G31 A;  3W8J A;  2L4C A;  1I9D A;  5IIZ A;  2H75 A;  3HJO A;  1TK8 B;  3LSZ A;  2PVO C;  1A2J A;  4OFT A;  4Q5R A;  3HY2 A;  3TB2 A;  2ON7 A;  5DQS A;  3IC8 A;  3EIN A;  4HOJ A;  2HZE B;  4OFN A;  1EOG A;  3ED3 A;  4FH8 A;  2FWG A;  4RUV A;  2VL2 C;  4QL9 A;  3WGE A;  3APQ A;  4HDE A;  1YZX A;  1OC9 A;  4G0L A;  3QOU A;  4ZBA A;  2I4A A;  4EXJ A;  2LJA A;  3P7X A;  1ML6 A;  3FRC A;  1XVQ A;  4L0W A;  3KCM A;  1QXH A;  1K0M A;  2G2Q A;  3ERF A;  2VD0 A;  5DDL A;  2XPD A;  4HZ2 A;  2GSR A;  2R37 A;  1HNC A;  3KMN A;  2D2Z A;  4YQV A;  3Q19 A;  1XWK A;  3GFK A;  4KDU A;  1ZL9 A;  2RM5 A;  4Q5N A;  2AHE A;  5ELG A;  4XHM A;  2P5Q A;  2GDR A;  3WGX A;  1CQH A;  1BQ7 A;  1F3A A;  2X8G A;  3IAM 2;  5A5K A;  1G6Y A;  5KN3 A;  4IS0 A;  3IHG A;  1XOA A;  4HU9 A;  4O5Q A;  2H6X A;  10GS A;  2YZU A;  3LWA A;  4PUA A;  1K3O A;  3CTG A;  2B1K A;  4MDC A;  4XTS A;  1A24 A;  5HR1 A;  1U3A A;  5FWG A;  1K0C A;  1XWC A;  2VIM A;  3H79 A;  4YKF A;  2PMT A;  3GNJ A;  5G1L A;  1JZW A;  2DJ2 A;  2OA7 A;  3FY7 A;  1ILO A;  4BVX A;  5FHI A;  2K8V A;  1A2M A;  1PN9 A;  4IQ1 A;  2PPT A;  4K0G A;  2DMM A;  2PN8 A;  4FYC A;  1TW9 A;  13GS A;  3UBL A;  4WEY A;  2MMA A;  2B7K A;  2YN1 A;  3FW2 A;  4TR1 A;  3H93 A;  4J2F A;  2DJ1 A;  2R0P A;  1KNG A;  1B9X C;  2MBS A;  1USB A;  2PWJ A;  2A4H A;  9GSS A;  1DE2 A;  4WF5 A;  5EY6 A;  2VCW A;  1EEM A;  3ME8 A;  3MDK A;  5F05 A;  2IMD A;  5D8I A;  2PU9 C;  4KAE A;  4DSS B;  4E8H A;  5B6N A;  1R26 A;  4V2M A;  2KUC A;  4N10 A;  4MPG A;  1VF1 A;  5ECI B;  1M2A A;  3WT1 A;  2LRC A;  1PKW A;  2DJ3 A;  4NHZ A;  4XIH A;  1PX6 A;  1SU9 A;  2FHE A;  2XBQ A;  4K7I A;  1JLW A;  4ICY A;  1T1V A;  4FQU A;  1XW9 A;  5DCG A;  4MF6 A;  1M2D A;  3IDV A;  4L5O A;  2GZZ A;  3J7Y b;  2P5R A;  3GV1 A;  3VK9 A;  2RLI A;  2IPA A;  2LJK A;  3P90 A;  5DBQ A;  4PQH A;  4ACS A;  3M9J A;  3FHK A;  2MBT A;  4YAV A;  4PUR A;  3D4M A;  2TRX A;  1Y25 A;  1F6M C;  5J9C A;  2AV4 A;  4ZIL A;  1YEX A;  4KND A;  1TRS A;  4TXV A;  1AIU A;  4G2E A;  3E3E A;  2VCQ A;  1K0B A;  2CX3 A;  2LKU A;  4LLR A;  1V98 A;  2FLS A;  3LYP A;  5HR3 A;  17GS A;  4LMV A;  2GGT A;  4V2N A;  1AC1 A;  1GSY A;  4IP6 A;  2CAQ A;  1GP1 A;  3JCM L;  3GUS A;  4ZB8 A;  1ZYP A;  3HCZ A;  19GS A;  1F2E A;  2MZC A;  2CV4 A;  1SK0 A;  2ES7 A;  2A2P A;  1GNE A;  2VD1 A;  5BRT A;  4KX4 A;  2PGT A;  3PPU A;  3VPT A;  1A8L A;  2H0I A;  2JSY A;  2HLS A;  3EU3 A;  3RHC A;  5D96 A;  3SBC A;  4HEA 2;  4K8M A;  4JRR A;  4RQR A;  4KE3 A;  1S3C A;  3HXS A;  3L9S A;  4F0B A;  4PGT A;  3D4T A;  1GLP A;  3HJP A;  12GS A;  3L78 A;  3Q18 A;  2YJH A;  4IHU A;  3GHA A;  3HZ4 A;  5GZZ B;  1BAY A;  1ERW A;  2YCD A;  2B7J A;  3PGT A;  3FMW A;  3K8N A;  3N9J A;  1FOH A;  1K0A A;  4WR5 A;  4TXO A;  4MJA A;  2VLU A;  3EMX A;  3KTL A;  4I2T A;  2V1M A;  1NHY A;  4YQM A;  4E8E A;  3HA9 A;  3ZRD A;  1ZYN A;  1AW9 A;  4F2I A;  5JCG A;  5KN2 A;  4MNN A;  3I43 A;  2N5A A;  5IPH A;  2ZNM A;  5ECH B;  2C80 A;  3E0U A;  4NWY A;  4HI7 A;  4POL A;  2H8L A;  1G0T A;  3QPM A;  1N2A A;  1ZCP A;  4BA7 A;  4P3Y B;  1MD3 A;  5D9T A;  2H1D A;  4H86 A;  3QFB C;  1OVN A;  4L0U A;  4CW9 A;  3I69 A;  1OKD A;  5ECN B;  4XS4 B;  3ZYW A;  1SJ6 A;  2IMF A;  5L71 A;  1OC3 A;  1YDK A;  4TN8 A;  2KP2 A;  1O8W A;  1B48 A;  2WCI A;  2VL2 A;  1TDI A;  3LEF A;  2I9H A;  2HXK A;  2IIY A;  3LQ7 A;  1UVZ A;  4RI6 A;  3MWH A;  1M9B A;  3QAG A;  5J5N A;  4ILF A;  1EV9 A;  3GSS A;  4G10 A;  4K6X A;  3KTB A;  2V2G A;  4Q5Q A;  6GSS A;  6GSW A;  4IEL A;  2C4J A;  1TI3 A;  3IA1 A;  3FZA A;  3ZTL A;  4OCF A;  2BMX A;  4DEJ A;  2K6V A;  1GRX A;  3RBT A;  3WD6 A;  4NAX A;  2J23 A;  1SL2 B;  5ECK B;  3ZFB A;  2V32 A;  3MNG A;  4YH2 A;  2LUS A;  4KB3 A;  2B5X A;  2X99 A;  5ABR A;  1J9B A;  2YJ7 A;  2F51 A;  3KGK A;  2LNT A;  1H75 A;  3DKS A;  1O6J A;  2CA8 A;  4N0Z A;  3KZQ A;  1R5A A;  3GTU A;  3F6F A;  3D0Z A;  1PL1 A;  3F3R A;  4X1U A;  3LW9 A;  3M1G A;  3DML A;  2MMO A;  4MK3 A;  5IQY A;  3UJ1 A;  4IJ3 A;  3APS A;  1SYX A;  3AY8 A;  1X5D A;  1U6T A;  3EC3 A;  3PR8 A;  3F3Q A;  2WRT A;  1GTA A;  4TW5 A;  2L5O A;  1WRY A;  4PNG A;  4GLT A;  2HZF A;  2A2R A;  3QCP A;  3VWV A;  3TJB A;  1ON4 A;  1SYR A;  1PN0 A;  4HJM A;  3ZL5 A;  4ULX A;  1NHO A;  1VF2 A;  2R2J A;  1JLV A;  2FWH A;  4F9Z A;  1GSE A;  3EWL A;  2WUL A;  5GAP D;  1K0O A;  2DIZ A;  2HRK A;  1YQ1 A;  3L9U A;  4TR3 A;  4I97 A;  4IP1 A;  3TKP A;  1W89 A;  2UZ8 A;  3FZ4 A;  8GSS A;  2X8C A;  1PSQ A;  3QAW A;  4MZB A;  2GQM A;  2EC4 A;  1PQN A;  2JZR A;  4IBP A;  5IO0 A;  1O81 A;  2B1L A;  4Z2T A;  3PIN A;  4XS1 A;  1Q4J A;  3Q74 A;  2O85 A;  2H71 A;  4JR6 A;  3ZVJ D;  2IFQ B;  1XIY A;  4KUN A;  4IKH A;  5EL8 A;  3L9V A;  1YKC A;  3TKS E;  1K3L A;  4HS1 A;  2DLX A;  3F9U A;  4ZL9 A;  2DKI A;  1EOH A;  4HQS A;  2KP1 A;  3CSI A;  4KW6 A;  1MDJ A;  5D73 A;  5B7C A;  2NTO A;  4JBB A;  1V9W A;  1A0F A;  2YOI A;  2CZ2 A;  3VI5 A;  4AF2 A;  5ID2 A;  1TXX A;  1SJZ A;  3IAS 2;  2MYG A;  2L57 A;  4BL7 A;  1T4Y A;  1UN2 A;  4I8B A;  5B8B A;  5D9W A;  2B6M A;  2H66 A;  5IMA A;  2FUG 2;  2R4V A;  3LOR A;  3ZML A;  4GQF A;  4PUF C;  2EIQ A;  2OJL A;  1N8J A;  1XW6 A;  3HVV A;  5IO2 A;  2JU5 A;  1WJK A;  2CT6 A;  3H1N A;  5ELA A;  3KP9 A;  5HFI A;  1NSW A;  3UVT A;  3US3 A;  2JZS A;  2O89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...