4POBA

Crystal structure of a thioredoxin rv1471 ortholog from mycobacterium abscessus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
DHATVTVTDDSFQEDVVSSNKPVLVDFWATWCGPCKMVAPVLEEIAKDHGEALTIAKLDVDANPETARAFQVTSIPTLILFQNGEATKRIVGAKSKSALLRELDGVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Crystal structure of a thioredoxin Rv1471 ortholog from Mycobacterium abscessus
rcsb
source organism Mycobacterium abscessus
molecule tags Oxidoreductase
total genus 32
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4pobA00
2H73A 3SBCA 4PGTA 5EVOA 2PN8A 2OBIA 3SWLA 4BL7A 5J5NA 3CRUA 5INYA 4POBA 2N5AA 2AV4A 2V1MA 3HVXA 5LD0A 4EDZA 1SK2A 2B5EA 4KCEA 4ACSA 2LV3A 3LEFA 5ECOB 3TKQA 2ON7A 1RW1A 2E7PA 4ECIA 2VL9A 2RM5A 4D73B 2X8CA 1AIUA 4HEA2 2CAIA 4NPBA 3LFLA 1ZGNA 2MMZA 4QL7A 4GLTA 2VLTA 2NDOA 2H75A 1MD3A 2VCTA 2LRNA 1MTCA 1GSEA 3QD9A 5B7CA 3H93A 2NVLA 1UC7A 2VD1A 1TU8A 1FVJA 4ML6A 3ERGA 5F07A 3U5RE 4AJ8A 1HQOA 6GSTA 1PX6A 1J9BA 5J3RA 2C4JA 1TOFA 2XHFA 1UN2A 4RQRA 1XZOA 2AJQB 1X5CA 4V2NA 4WEYA 5G5FA 1X9WB 2DLXA 3ZTLA 1SJIA 1QMVA 1XWCA 14GSA 5KN0A 2B3SA 4X1UA 4YAPA 2LEGA 1F6MC 2EIQA 2YZHA 4NV2A 3IAM2 3DMLA 4IW9A 3VI5A 3FZ9A 4HQSA 3HXSA 5IOXA 1YEPA 1TJDA 4ZB8A 2EC4A 4GQCA 4JR4A 4PQIA 2GS3A 2WS2A 3UMAA 1O73A 2IIYA 2FA8A 2NTOA 4MF7A 2AB6A 1MDJA 5JCGA 1OVNA 1PKWA 1A0RP 2N5BA 3G7JA 2H6YA 4K9ZA 4CW9A 4POMA 5DAKB 1SENA 5KN1A 3M8NA 5IO0A 5COHA 4GF0A 3F6FA 4OFMA 2K8SA 1K3YA 4X43A 4IJIA 2MMNA 3LXZA 3N5OA 3IXRA 2VD0A 5IQYA 4IP1A 5G1KA 1TI3A 2CVDA 4KH7A 4V2MA 3DVXA 3N9JA 1J0FA 5B8AA 5GZZB 2H1DA 3CSIA 4DEJA 2VAFA 2C0EA 4OD7A 4WETA 2IMIA 5JCWA 4HI7A 10GSA 2R2JA 1V58A 4D73A 3Q6OA 4TW5A 5L71A 3BBYA 1XCCA 3CSJA 4ZXGA 2XBQA 1LU4A 5HFGA 2GZZA 4JRRA 2WZ9A 5ID2B 3FK8A 4N30A 1DE1A 4Q5QA 2R5GA 1V57A 2FA4A 3H1NA 1BEDA 2DMLA 2NBSA 2N5FA 1EZKA 1TRWA 3KXOA 3ZVJD 3TJGA 1XXUA 1M2BA 3IK7A 3GKNA 2IN3A 3WYWA 5F8BA 4XS6A 3HJOA 5ELAA 2H74A 3HY2A 1OAZA 3JCML 3LYKA 3GL5A 1GSUA 3IE3A 4POKA 3EC3A 2AAWA 1OC8A 2C3QA 2ES7A 1FB0A 2H0IA 2O87A 4KNDA 19GSA 2LS5A 5JWRB 2C3NA 1TDIA 1HD2A 4K2DA 3PGTA 3ZFBA 4ID0A 4N10A 1GL8A 3HDCA 1B4PA 1GTBA 3KTLA 1TI1A 3F3QA 1FHEA 3QAWA 5C04A 2VIMA 1U3AA 2I9HA 5DAKA 2VLVA 4HU7A 2PERA 1GH2A 2OE3A 2VCZA 3VURA 4ZBAA 2I1UA 3KM6A 5GSTA 3M9JA 1B4QA 4K6XA 2BJXA 2B1KA 4POLA 12GSA 3BCIA 4I97A 3C1RA 1FVKA 2H1BA 3EYTA 3F8UA 4K7IA 3VPQA 4MP4A 1IYHA 5IM9A 1GNWA 2ZCTA 2DJJA 1O8WA 2IPAA 5D8IA 5CO3A 2MYGA 4J2FA 4I2UA 3HCZA 4TRXA 1JLWA 2CVBA 5ELGA 2F8AA 1T00A 4KDYA 3GMFA 4JR6A 1I5GA 3KIJA 3FKFA 3TUEA 3J7Yk 2PU9C 3UL3A 2FY6A 3QAGA 1OC9A 3GTUB 5ID2A 3HA9A 3P8WA 4MF6A 6GSYA 2P5QA 3ZZXA 5GSSA 3NZNA 4KB3A 4OFTA 5FWGA 2GT5A 3A2WA 2E2MA 4XIHA 4IHUA 5ENUA 1M9BA 2VO4A 3A2VA 4TR1B 2WJUA 18GSA 3CYNA 3W6GA 2FHEA 4TR0A 2GVPA 5D93A 4CDOA 1K0NA 3DD3A 1Z7RA 2GSTA 4ILFA 3D0ZA 4OCFA 1SKRB 1AQXA 1HYUA 1U6TA 5HQPA 1X5DA 4MCUA 2VCVA 2LNSA 3VWXA 2R37A 4XS4B 5IPHA 1ZYQB 4GQFA 2JZTA 4EDYA 2O85A 5HFKA 3TJJA 5AISA 1NHYA 4DSRA 1ERWA 5EPFA 4MJBA 2YANA 5DCHA 3IR4A 2L4QA 1T3BA 4WBJA 1S3AA 5FT3A 4Q5FA 1ERVA 1QXHA 2P5RA 4F03A 4JBBA 1SK0A 5DALB 3EU3A 3FYGA 3TJBA 1A0FA 2ON5A 3BD2A 5A5KA 3GH6A 1MDIA 4EUYA 1S3CA 1OE8A 1BQ7A 3QMXA 2VL3A 2HSHA 3TRQA 4HZ4A 5KN3A 3UEMA 2HNLA 1XW5A 1M2DA 3L0HA 5CRGA 3ED3A 1EWXA 4TOPA 2DJ0A 2D2ZA 4J57E 4AGSA 1JLVA 1ZZYA 3LXTA 2K9FA 3ZIVA 4FIWA 1EGRA 5IO2A 1FO5A 3IA1A 4QQ7A 3KJYA 3EURA 3CSHA 2HZFA 5CAXA 3GTUA 2G2QA 2H0GA 4G9HA 2YWMA 1R4WA 3UAPA 4RI7A 5DJMA 3LGCA 2YN1A 3APOA 5AIVA 2JU5A 5AN1A 4JZQA 5CRWA 2A4VA 1A8YA 4KUNA 4PURA 2RM6A 1EOHA 2IL3A 1VF2A 1TU7A 3TDGA 2JL4A 1YKAA 2LRTA 3L9VA 1TXXA 4KDXA 2O8VB 1H75A 4KSMA 2H66A 1M99A 4MH2A 3F9UA 4XS4A 1XVQA 4GWRA 4L0UA 4EVMA 3UVTA 4IELA 2KHPA 3D22A 3FR6A 2J9HA 3M3MA 3MAKA 3IHQA 2LTKA 3QCPA 3QPMA 3NOFA 2L59A 1SL1B 4V1Ap 1U88A 1ZOFA 3TKSE 2ALBA 1Y6EA 5HR2A 4NWYA 5ABRA 3TKSA 2KOKA 3TRXA 1DBYA 5DALA 5J9CA 3FZAA 4BVXA 2PVQA 5A4UA 2YWNA 2H0HA 3ME8A 6GSVA 1CQGA 3L78A 4QL9A 2H19A 1W4VA 4GCIA 1EEMA 3VPTA 3CXGA 2H6XA 1XOAA 1J08A 2C0FA 2CX4A 17GSA 5DCGA 2FNOA 1FG4A 5G2ZA 4HDEA 1A2JA 1GRXA 1QFNA 2YJHA 4LMWA 2AUVA 2FCHA 1XPVA 5IPGA 1V2AA 5LNKe 1O7UA 4RI6A 1RK4A 1PGTA 2F9SA 4XCSA 1XIYA 3QDNA 2F3MA 2YWIA 2YNXA 2X99A 4Q5NA 3CMIA 1EP8A 3RPPA 1K0CA 2H30A 5EY6A 3TGZA 5LCZA 3C1SA 2A2SA 4I8BA 2QGVA 4WBRD 1LBKA 1HNCA 1U87A 1V98A 4PUAA 1TW9A 5AGYA 1PKZA 4MA9A 1ML6A 2PBJA 2P0GA 3IC4A 2MBSA 1DUGA 4YQUA 1GP1A 1C72A 2VL2C 2E0QA 2PWJA 3QFAC 4HJ2A 3RDWA 1TK8B 5D9XA 3KMOA 3H8QA 5JCUA 3C7MA 1YZXA 3BJ5A 3VI7A 4NHWA 3EE2A 2X8HA 3TCOA 3FRCA 5F0GA 5D96A 3ERWA 1URMA 3I69A 4EO3A 3KP9A 3VLNA 4ULXA 4ISDA 3O3TA 1MD4A 4IP6A 2BTOT 1T7PB 5CYYA 1G6WA 2WB9A 1NW2A 2H71A 5DQYA 4PNFA 2KLXA 4PQ1A 3HZ8A 4XTSA 5B6NA 4I2TA 1AUCA 2QKEA 3KZQA 4ECCA 4WF4A 1K3LA 3MWHA 4YQVA 3E9JB 4K8MA 3US3A 1SYRA 2CV4A 1E6BA 2MMOA 4TR4A 2C80A 4PQHA 3ISOA 4O5RA 1V40A 1WMJA 3DXBA 4F9ZA 1TKDB 5E59A 3GHAA 1PL1A 5ECSA 1SKSB 2WGRA 1F9MA 2H1GA 3EU4A 2LJRA 2VM1A 2L5LA 1JZOA 2H70A 1X9MB 2H8LA 3D6IA 2B7KA 2CAQA 4PXOA 3HJMA 2B5YA 5JWOB 5GAPD 1DSBA 1U3IA 4MDCA 3HJPA 2L57A 2F51A 2I3YA 3CRTA 3F0IA 1F3BA 1WE0A 3DVWA 5CRHA 5GAND 2LKUA 2H76A 2RIIA 5ECQB 5D9TA 4FH8A 1AW9A 2JACA 3DWVA 3FW2A 2V41A 2OE0A 2CVKA 2RLIA 3UBLA 2G0FA 4MZBA 4X0XA 2GSSA 3FHKA 4K0GA 5B6MA 3MNGA 4NAXA 2RUEA 4V1Ag 3L9UA 3QR6A 2JSZA 2C3TA 2C1YA 2EIOA 2P31A 4LMVA 2MBTA 1LJRA 4KA0A 4MJCA 4MMMA 3GKMA 1XWKA 2BMXA 1AQVA 4OO5A 3H4KA 2IJYA 3M9KA 2FGXA 1VF3A 2K8VA 1Q4JA 1PL2A 2HYXA 5IMAA 5HFIA 1O6JA 3E3EA 1TTZA 2CZ3A 1K0BA 3GURA 2VUPA 6GSSA 2YWOA 4L8EA 5F06A 2M72A 2YZUA 5DVBA 3GKXA 3UOMA 2CA8A 2OKAA 20GSA 1JHBA 1QGVA 2YOIA 1M7TA 1Z5YE 4WR4A 2GQKA 2HRNA 1BJXA 1ST9A 1N2AA 4YH2A 13GSA 3ZL5A 1SJ6A 3GFKA 4XHMA 4BWSA 2DJ2A 1BX9A 3IBHA 3UVHA 3UARA 2FWEA 1F2EA 3GUSA 3DYRA 2XPDA 3KCMA 4E8HA 1R26A 5IMCA 5JWQB 3WGEA 3HD5A 1T1VA 3ME7A 4AJ6A 1DE2A 3HKRA 5H5QA 2AYTA 3VWWA 2PUKC 4GSTA 2YP6A 2KP2A 4HZ2A 4K7NA 2JSYA 3DIEA 1PN9A 1YF1A 4LL1B 3EVIA 3TOUA 3FZ5A 3NIVA 1UA5A 2HXKA 3FEUA 1ERUA 3LG6A 4N0VA 4FO5A 3M0FA 1YJ6A 2QSIA 1EV9A 4ZB9A 3ZMLA 3UJ1A 2X64A 2DMMA 2WULA 2YJ7A 1SD9A 5D73A 4K7OA 1M9AA 2HE3A 3D5JA 1X5EA 4MLYA 4GSNA 1Z9HA 1I9DA 1GSFA 3C73A 4KSOA 1VF1A 2HRFA 1XWGA 1GWCA 5D9VA 4TXOB 2OA7A 3WT1A 2V32A 2K18A 2E2GA 4Z7XA 3ZYWA 1G7EA 3I9V2 1G6YA 1EEJA 5IMDA 3WD6A 2V6OA 2GQLA 1PQNA 1ZCPA 4EE0A 1ON4A 1H4OA 3EMXA 1NM3A 1BAYA 1OKTA 4IJ3A 2L6DA 2GLRA 4LL4B 1VF4A 1UVZA 4PX1A 4HOJA 2CZ2A 2VLUA 2DJ1A 5AIXA 4DSQA 5ECRB 1V9WA 1O85A 3IAS2 5ECHB 1R5AA 1Z6MA 1GUMA 3IOSA 1TK5B 3W8JA 3ZREA 4N11A 1PA3A 1ACVA 2C0DA 9GSSA 5IIZA 1QUWA 5DDLA 3KD0A 5H5RA 3LSZA 3O76A 3EINA 1PSQA 4GXZA 1WRYA 4TR1A 2L4CA 1YEXA 3VWVA 5H5SA 1XVWA 3I43A 1SYXA 3TB2A 2VCQA 4K1FA 3RBTA 4HS1A 3F4SA 1WJKA 2DJ3A 1XBSA 1WP0A 4HQZA 4HUAA 2GZYA 1ZYEA 1THXA 2O7KA 2LRCA 4TR3A 1T4YA 5ECNB 4BWQA 1JFUA 3WGDA 1HNAA 1BYEA 4HU9A 3QOUA 2WFCA 4V2LA 2H6ZA 2DIZA 4NHZA 2XC2A 2OJLA 3F3RA 1SJZA 4ZL7A 2L5OA 4IN0A 2OBKA 4IKHA 2YV9A 7GSSA 1OE7A 1WOUA 3J7Yb 1N8JA 5CRDA 1Z7PA 4OFNA 5IMVA 2I81A 3FR3A 5G31A 4ZILA 4IQAA 1F3AA 4WR5A 4KGIA 1AQWA 3DEXA 4FYBA 3UIWA 5G30A 4ZL9A 4NMUA 3A2XA 4F82A 4GSSA 1WIKA 5HR0A 3DRNA 5J9BA 3TKSC 3P7XA 3MSZA 2GZPA 3RHBA 4KE3A 3M1GA 1TRSA 1B8XA 4TXOA 4OWYA 4DVCA 1GSSA 1GSQA 5F05A 4KCAA 3C8EA 2IMFA 2TRCP 3GIXA 1PRXA 2FLSA 3LORA 2FWGA 2F8FA 4BPYA 4MJAA 4IQ1A 1VGLA 1GTUA 3KMNA 2JZSA 4ECJA 3D4MA 3HVVA 4H86A 1TK0B 4MABA 1K0OA 2QC7A 2TRXA 4LLRA 1GULA 2J23A 2B1LA 3GN3A 5KEJA 2JZRA 2OACA 5D9WA 3WT2A 4ECBA 3OR5A 3TKPA 1ZL9A 4WXTA 3KH7A 4BA7A 4F0CA 2XPEA 6GSXA 3VFIA 1QQ2A 1G7OA 4O32A 1EV4A 1A8LA 2IFQB 3ZLPA 2GQMA 2LQQA 4N0ZA 3AY8A 1MEKA 2HFDA 4GRFA 2M80A 2IMDA 2PVOC 4TXVA 3GV1A 1KBNA 4NV5A 3TJKA 3RPNA 3GSTA 5J41A 3LQ7A 2KP1A 3V1WA 1XW6A 3PR8A 3GL3A 1GTIA 3P90A 1KTEA 4ZBDA 1ERTA 2VOCA 5C00A 3KH9A 3UBKA 5CREA 5ECLB 1SL2B 4AF2A 4JEDA 2XBIA 1XOBA 2VL2A 3O6TA 3A5WA 2H1AA 3ZFLA 3S9FA 1YY7A 4ZIJA 2L6CA 1A2LA 3PINA 2GSRA 4ZB6A 3QAVA 3R2QA 4MJEA 1NHOA 1XWAA 4I6XA 2V2GA 4XRDA 4KAEA 3BCKA 4NXIA 1IYIA 3TRPA 4BVYA 2OADA 5IMFA 3ZIJA 4G19A 2GSQA 11GSA 2TIRA 2HLSA 2ZUPA 2DIYA 2HSYA 4EF0A 1YQ1A 1FW1A 1OC9B 3ZITA 1GSDA 3HVSA 3IDVA 1Q98A 2H72A 1SD8A 1RQMA 2PMTA 3D4TA 5DJLA 4PUFC 4EXJA 3G7IA 1PX7A 5ECIB 2FWHA 4XS1A 5J4UA 3G9BA 2HI7A 2GGTA 1OKDA 3LYPA 2EIRA 1K0MA 1SKWB 6GSUA 4WF5A 1XFLA 1JZWA 3APSA 5DQSA 4F2IA 3W8SA 1S3DA 2JADA 4L0WA 3D21A 4OCEA 1YF0A 1PD21 1GUHA 4MPGA 2FD3A 3IK9A 4RUVA 4TVEA 2MZCA 2WDUA 4I5QA 4E8EA 3RHCA 2IFQA 4FYUA 1Z6NA 3KEBA 4GTUA 1XWBA 2GTUA 1K0AA 1GNEA 4LA1A 4DSSB 3GA4A 2X8GA 2Z9SA 4MF5A 2YCDA 1TRUA 2LQOA 1KNGA 5A4VA 2C8UA 3GH9A 1X9SB 4EL1A 2AHEA 2VM2A 1A23A 2WCIA 4MPFA 4MZWA 16GSA 2YPMA 3KTBA 4FYCA 22GSA 2CX3A 5G5EA 1M0UA 4YAVA 2MMAA 3QFBC 1T8EB 1QK8A 5CNWA 3PH9A 5A4WA 5HR3A 2OE1A 4KX4A 2H01A 3LWAA 5HR1A 3I6AA 2NPBA 2FWFA 1GUKA 4KW6A 3F63A 1SK1A 1SU9A 4IS0A 3EWLA 4XRAA 1TP9A 3BOAA 3GYKA 5KN2A 1GSYA 4RQXA 3Q74A 2HT9A 1OC3A 3FR9A 1M2AA 3GSSA 2O89A 3E0UA 2KUCA 3IRAA 4TN8A 2LJAA 1F37A 4MZCA 4OMVA 4L5OA 1YKCA 3HZ4A 1R7HA 3TKRA 1FB6A 2PPTA 3ZMKA 4L5LA 3H79A 3GNJA 4JE1A 3IV4A 1E2YA 4WKWA 4G10A 1WWJA 1AAZA 2M46A 1G0TA 2R6KA 1WPIA 4K0NA 1BG5A 2CT6A 1K3OA 1W89A 3F6DA 3KP8A 3L4NA 4AJ7A 2YV7A 3VK9A 2PGTA 3TJFA 3GKKA 1EGOA 1EOGA 3GX8A 4ZL8A 8GSSA 2HZEB 3Q19A 3DGQA 5ECKB 1T4ZA 4Q5RA 1FOVA 5IOWA 1GTAA 1Y25A 3Q18A 1AC1A 3EMPA 4J56E 4O7HA 1VRSD 3F4RA 4F0BA 4OO4A 2WRTA 1R5PA 1B9XC 5CP1A 2FUG2 4DSSA 4MK3A 3ZVJA 2GT6A 5FHIA 1CQHA 5ECMB 3GRXA 4CHSA 2DSAA 3APQA 4MH3A 3LJRA 4EKZA 3FY7A 2IMEA 3KGKA 3WGXA 1USBA 1O81A 1EP7A 3K8NA 2DC5A 3HYPA 3FZ4A 1TRVA 4IBPA 4ZBBA 1ABAA 3CBUA 1A24A 1FAAA 3RAZA 1ILOA 6GSWA 5G1LA 5DBQA 2DJKA 2IWTA 3CTGA 3ZRDA 5B8BA 1B48A 1HNBA 1A2MA 2ZNMA 1SL0B 1B9YC 3VWUA 3F4TA 2V6KA 2GDRA 5EL8A 2B5XA 1NSWA 1OYJA 3A3TA 2R3XA 3HHVA 1YDKA 4YQMA 1THOA 4HJMA 1JZRA 2R4VA 4IVFA 3ERFA 3GX0A 3G7YA 4G2EA 2LUSA 2I4AA 4KDUA 1ZMAA 4ML1A 4JU5A 2B7JA 2IMKA 1K0DA 1JZDA 5E4WA 4TKYA 3MDKA 2C0GA 2LSTA 4O92A 3P2AA 2LJKA 3U6VA 3IPZA 1XW9A 2CQ9A 3DKSA 1MDKA 3TOTA 3L9SA 2REMA 1PMTA 1GLPA 2B6MA 4EC0A 2VCXA 1Z3EA 4PNGA 1KEBA 2DBCA 2VCWA 4P3YB 1X0RA 5ECPB 2RUFA 1AXDA 1GLQA 1O8XA 2K6VA 3CTFA 4IGJA 5IMZA 2LNTA 2HZEA 3C71A 2A2RA
chains in the Genus database with same CATH superfamily
2H73A 3SBCA 4PGTA 5EVOA 2PN8A 2OBIA 3SWLA 1PFOA 4BL7A 5J5NA 3CRUA 5INYA 4POBA 2N5AA 2AV4A 2V1MA 3HVXA 5LD0A 4EDZA 1SK2A 2B5EA 4KCEA 3HVNA 4ACSA 2LV3A 3LEFA 5ECOB 3TKQA 2ON7A 1RW1A 2E7PA 4ECIA 2VL9A 2RM5A 2DKHA 2QA1A 4D73B 2X8CA 1AIUA 4HEA2 2CAIA 4NPBA 3LFLA 1ZGNA 2MMZA 4QL7A 4GLTA 2VLTA 2NDOA 2H75A 1MD3A 2VCTA 2LRNA 1MTCA 1GSEA 4EIQA 4Z2TA 3QD9A 5B7CA 3IC8A 3H93A 2NVLA 4K5RA 1UC7A 2VD1A 1TU8A 1FVJA 4ML6A 3ERGA 5F07A 3U5RE 4AJ8A 1HQOA 6GSTA 1PX6A 1J9BA 5J3RA 2C4JA 1TOFA 2XHFA 1UN2A 4RQRA 1XZOA 2AJQB 1X5CA 4V2NA 4WEYA 5G5FA 1X9WB 2DLXA 3ZTLA 1SJIA 1QMVA 1XWCA 14GSA 5KN0A 2B3SA 4X1UA 4YAPA 2LEGA 1F6MC 2EIQA 2YZHA 4NV2A 3IAM2 3DMLA 4IW9A 3VI5A 3FZ9A 4HQSA 3HXSA 5IOXA 1YEPA 1TJDA 4ZB8A 2EC4A 4GQCA 4JR4A 4PQIA 2GS3A 2WS2A 3UMAA 1O73A 2IIYA 2FA8A 2NTOA 4MF7A 2AB6A 1MDJA 5JCGA 1OVNA 1PKWA 1A0RP 2N5BA 3G7JA 2H6YA 4K9ZA 4CW9A 4POMA 5DAKB 1SENA 4A5PA 5KN1A 3M8NA 5IO0A 5COHA 4GF0A 3F6FA 4OFMA 2K8SA 1K3YA 4X43A 4IJIA 2MMNA 3LXZA 2HRKA 3N5OA 3IXRA 2VD0A 5IQYA 4IP1A 5G1KA 1TI3A 2CVDA 4KH7A 4V2MA 3DVXA 3N9JA 1J0FA 5B8AA 5GZZB 2H1DA 3CSIA 4DEJA 2VAFA 2C0EA 4OD7A 4WETA 2IMIA 5JCWA 4HI7A 10GSA 2R2JA 2A2PA 1V58A 4D73A 3Q6OA 4TW5A 5L71A 3BBYA 1XCCA 3CSJA 4ZXGA 2XBQA 1LU4A 5HFGA 2GZZA 4JRRA 2WZ9A 5ID2B 3FK8A 4N30A 1DE1A 4Q5QA 2R5GA 1V57A 2FA4A 3H1NA 1BEDA 2DMLA 2NBSA 2N5FA 1EZKA 1TRWA 3KXOA 3ZVJD 3TJGA 1XXUA 1M2BA 3IK7A 3GKNA 2IN3A 3WYWA 5F8BA 4XS6A 3HJOA 5ELAA 1FOHA 2H74A 3HY2A 1OAZA 3JCML 3LYKA 3GL5A 1GSUA 3IE3A 4POKA 3EC3A 2AAWA 1OC8A 2C3QA 2ES7A 1FB0A 2H0IA 2O87A 4KNDA 19GSA 2LS5A 5JWRB 2C3NA 1TDIA 4Z2UA 1HD2A 4K2DA 3PGTA 3ZFBA 4ID0A 4N10A 1GL8A 3HDCA 4PTSA 1B4PA 1GTBA 3KTLA 1TI1A 3F3QA 1FHEA 3QAWA 5C04A 2VIMA 1U3AA 2I9HA 5DAKA 2VLVA 4HU7A 2PERA 1GH2A 2OE3A 2VCZA 3VURA 4ZBAA 2I1UA 3KM6A 5GSTA 3M9JA 1B4QA 4K6XA 2BJXA 2B1KA 4POLA 12GSA 3BCIA 4I97A 3C1RA 1FVKA 5KOXA 2H1BA 3EYTA 3F8UA 4K7IA 3VPQA 4MP4A 1IYHA 5IM9A 1GNWA 2ZCTA 2DJJA 1O8WA 2IPAA 5D8IA 5CO3A 2A4HA 2MYGA 4J2FA 4I2UA 3HCZA 4TRXA 1JLWA 2CVBA 5ELGA 2F8AA 1S3RA 1T00A 4KDYA 3GMFA 4JR6A 1I5GA 3KIJA 3FKFA 3TUEA 3J7Yk 2PU9C 3UL3A 2FY6A 3QAGA 1OC9A 3GTUB 5ID2A 3HA9A 3P8WA 4MF6A 6GSYA 2P5QA 3ZZXA 5GSSA 2R0CA 3NZNA 4KB3A 4OFTA 5FWGA 2GT5A 2X49A 3A2WA 2E2MA 2QA2A 4XIHA 4IHUA 5ENUA 1M9BA 2VO4A 3A2VA 4TR1B 2WJUA 18GSA 3CYNA 3W6GA 2FHEA 4TR0A 2GVPA 5D93A 4CDOA 1K0NA 3DD3A 1Z7RA 2GSTA 4ILFA 3D0ZA 4OCFA 1SKRB 1AQXA 1HYUA 1U6TA 5HQPA 1X5DA 4MCUA 2VCVA 2LNSA 3VWXA 2R37A 4XS4B 5IPHA 1ZYQB 4GQFA 2JZTA 4EDYA 2O85A 5HFKA 3TJJA 5AISA 1NHYA 4DSRA 1ERWA 5EPFA 4MJBA 2YANA 5DCHA 3IR4A 2L4QA 1T3BA 4WBJA 1S3AA 5FT3A 4Q5FA 1ERVA 1QXHA 2P5RA 4F03A 4JBBA 1SK0A 5DALB 4BVXB 2R0GA 3EU3A 3FYGA 3TJBA 1A0FA 2ON5A 3BD2A 5A5KA 3GH6A 1MDIA 4EUYA 1S3CA 1OE8A 1BQ7A 3QMXA 2VL3A 2HSHA 3TRQA 4HZ4A 5KN3A 3UEMA 2HNLA 3EPTA 1XW5A 4K2XA 1M2DA 3L0HA 5CRGA 3ED3A 1EWXA 4TOPA 2DJ0A 2D2ZA 4J57E 4AGSA 1JLVA 1ZZYA 3LXTA 2K9FA 3ZIVA 4FIWA 1EGRA 5IO2A 1FO5A 3IA1A 4QQ7A 3KJYA 3EURA 3CSHA 2HZFA 5CAXA 3GTUA 2G2QA 2H0GA 4G9HA 2YWMA 1R4WA 3UAPA 4RI7A 5DJMA 2HSMA 2YN1A 3LGCA 3APOA 5AIVA 2JU5A 5AN1A 4CY8A 4JZQA 5CRWA 2A4VA 1A8YA 4KUNA 4PURA 2RM6A 1EOHA 2IL3A 1VF2A 1TU7A 3TDGA 2JL4A 1YKAA 2LRTA 3L9VA 1TXXA 4KDXA 2O8VB 1H75A 4KSMA 2H66A 1M99A 4MH2A 3F9UA 4XS4A 1XVQA 4GWRA 4L0UA 4EVMA 3UVTA 4IELA 2KHPA 3D22A 3FR6A 2J9HA 3M3MA 3MAKA 3IHQA 2LTKA 3QCPA 3QPMA 3NOFA 2L59A 1SL1B 4V1Ap 1U88A 4O5UA 1ZOFA 3TKSE 2ALBA 1Y6EA 5HR2A 4NWYA 5ABRA 3TKSA 2KOKA 3TRXA 1DBYA 5DALA 5J9CA 3FZAA 4BVXA 2PVQA 5A4UA 4Z2RA 2YWNA 2H0HA 3ME8A 6GSVA 1CQGA 3L78A 4QL9A 2H19A 1W4VA 4GCIA 1EEMA 3VPTA 3CXGA 2H6XA 1XOAA 5BRTA 1J08A 2C0FA 2CX4A 17GSA 5DCGA 2FNOA 1FG4A 5G2ZA 4HDEA 1A2JA 2DKIA 1GRXA 4G0IA 1QFNA 4YKFA 2YJHA 4LMWA 2AUVA 2FCHA 1XPVA 5IPGA 1V2AA 5LNKe 1O7UA 4RI6A 1RK4A 1PGTA 2F9SA 4XCSA 1XIYA 3QDNA 2F3MA 2YWIA 2YNXA 2X99A 1PN0A 4Q5NA 3CMIA 4ICYA 1EP8A 3RPPA 1K0CA 4USSA 2H30A 5EY6A 3TGZA 5LCZA 3C1SA 2A2SA 4I8BA 2QGVA 4WBRD 1LBKA 1HNCA 1U87A 1V98A 4PUAA 1TW9A 5AGYA 1PKZA 4MA9A 1ML6A 2PBJA 5BMUA 2P0GA 3IC4A 2MBSA 1DUGA 4YQUA 1GP1A 1C72A 2VL2C 2E0QA 2PWJA 3QFAC 4HJ2A 3RDWA 1TK8B 5D9XA 3KMOA 3H8QA 5JCUA 3C7MA 1YZXA 3BJ5A 3VI7A 4NHWA 3EE2A 2X8HA 3TCOA 3FRCA 5F0GA 5D96A 3ERWA 1URMA 3I69A 4EO3A 3KP9A 3VLNA 4ULXA 4ISDA 3O3TA 1MD4A 4IP6A 2BTOT 1T7PB 5CYYA 1G6WA 2WB9A 1NW2A 2H71A 5DQYA 4PNFA 2KLXA 4PQ1A 3HZ8A 4XTSA 5B6NA 4I2TA 1AUCA 2QKEA 3KZQA 4ECCA 4WF4A 1K3LA 3MWHA 4YQVA 3E9JB 4K8MA 3US3A 1SYRA 2CV4A 1E6BA 2MMOA 4O5QA 4TR4A 2C80A 4PQHA 3ISOA 4O5RA 1V40A 1WMJA 3DXBA 4F9ZA 1TKDB 5E59A 3GHAA 1PL1A 5ECSA 1SKSB 2WGRA 1F9MA 2H1GA 3EU4A 2LJRA 2VM1A 2L5LA 1JZOA 2H70A 1X9MB 2H8LA 3D6IA 2B7KA 2CAQA 4PXOA 4BIKA 3HJMA 2B5YA 5JWOB 5GAPD 1DSBA 1U3IA 4MDCA 3HJPA 2L57A 2F51A 2I3YA 3CRTA 3F0IA 1F3BA 1WE0A 3DVWA 5CRHA 5GAND 2LKUA 2H76A 2RIIA 5ECQB 5D9TA 4FH8A 1AW9A 2JACA 3DWVA 3FW2A 2V41A 2OE0A 2CVKA 2RLIA 3UBLA 2G0FA 4MZBA 4X0XA 2GSSA 3FMWA 3FHKA 4K0GA 5B6MA 3MNGA 4NAXA 2RUEA 4V1Ag 3L9UA 3QR6A 2JSZA 2C3TA 2C1YA 2EIOA 2P31A 4LMVA 2MBTA 1LJRA 4KA0A 4MJCA 4MMMA 3GKMA 1XWKA 2BMXA 1AQVA 4OO5A 3H4KA 2IJYA 3M9KA 2FGXA 1VF3A 2K8VA 1Q4JA 1PL2A 2HYXA 5IMAA 5HFIA 1O6JA 3E3EA 4G0KA 1TTZA 2CZ3A 1K0BA 3GURA 2VUPA 6GSSA 2YWOA 4L8EA 5F06A 2M72A 2YZUA 5DVBA 3GKXA 3UOMA 2CA8A 2OKAA 20GSA 1JHBA 1QGVA 2YOIA 1M7TA 1Z5YE 4WR4A 2GQKA 2HRNA 1BJXA 1ST9A 1N2AA 4YH2A 13GSA 3ZL5A 1SJ6A 3GFKA 4XHMA 2R0PA 4BWSA 2DJ2A 1BX9A 3IBHA 3UVHA 3UARA 2FWEA 1F2EA 3GUSA 3DYRA 2XPDA 3KCMA 4E8HA 1R26A 5IMCA 4X4JA 5JWQB 3WGEA 3HD5A 1T1VA 3ME7A 4AJ6A 1DE2A 3HKRA 5H5QA 2AYTA 3VWWA 2PUKC 4GSTA 2YP6A 2KP2A 4HZ2A 4K7NA 3LW9A 2JSYA 3DIEA 1PN9A 1YF1A 4LL1B 3EVIA 3TOUA 3FZ5A 3NIVA 1UA5A 2HXKA 3FEUA 1ERUA 3LG6A 4N0VA 4KF9A 4FO5A 3M0FA 1YJ6A 2QSIA 1EV9A 4ZB9A 3ZMLA 3UJ1A 2X64A 2DMMA 2WULA 2YJ7A 1SD9A 5D73A 4K7OA 1M9AA 2HE3A 3D5JA 1X5EA 4MLYA 4GSNA 1Z9HA 1I9DA 3R3EA 1GSFA 3C73A 4KSOA 1VF1A 2HRFA 1XWGA 1GWCA 5D9VA 4TXOB 2OA7A 3WT1A 2V32A 2K18A 2E2GA 4Z7XA 3ZYWA 1G7EA 3I9V2 1G6YA 1EEJA 5IMDA 3WD6A 2V6OA 2GQLA 1PQNA 1ZCPA 4EE0A 1ON4A 1H4OA 3EMXA 1NM3A 1BAYA 1OKTA 4IJ3A 2L6DA 2GLRA 4LL4B 1VF4A 1UVZA 4PX1A 4HOJA 2CZ2A 4HSCX 2VLUA 2DJ1A 5AIXA 4DSQA 5ECRB 1V9WA 1O85A 3IAS2 5ECHB 1R5AA 1Z6MA 1GUMA 3IOSA 1TK5B 3W8JA 3ZREA 4N11A 1PA3A 1ACVA 2C0DA 9GSSA 5IIZA 1QUWA 5DDLA 3KD0A 5H5RA 3LSZA 3O76A 3EINA 1PSQA 4GXZA 1WRYA 4TR1A 2L4CA 1YEXA 3VWVA 5H5SA 1XVWA 3I43A 1SYXA 3TB2A 4K5SA 2VCQA 4K1FA 3RBTA 4HS1A 3F4SA 1WJKA 2DJ3A 1XBSA 1WP0A 4HQZA 4HUAA 2GZYA 1ZYEA 4CY6A 1THXA 2O7KA 2LRCA 4TR3A 1T4YA 5ECNB 4BWQA 1JFUA 3WGDA 1HNAA 1BYEA 4HU9A 3QOUA 2WFCA 4V2LA 2H6ZA 2DIZA 4NHZA 2XC2A 2OJLA 3F3RA 1SJZA 4ZL7A 2L5OA 4IN0A 2OBKA 4IKHA 2YV9A 7GSSA 1OE7A 1WOUA 3J7Yb 1N8JA 5CRDA 1Z7PA 4OFNA 5IMVA 2I81A 3FR3A 5G31A 4ZILA 4BVYB 4IQAA 2HRAA 1F3AA 4WR5A 4KGIA 1AQWA 3DEXA 4FYBA 3UIWA 5G30A 4ZL9A 4NMUA 3A2XA 4F82A 4GSSA 1WIKA 5HR0A 3DRNA 5J9BA 3TKSC 3P7XA 3MSZA 2GZPA 3RHBA 4KE3A 3M1GA 1TRSA 1B8XA 4TXOA 4OWYA 4DVCA 1GSSA 1GSQA 5F05A 4KCAA 3C8EA 2IMFA 2TRCP 3GIXA 1PRXA 2FLSA 3LORA 2FWGA 2F8FA 4BPYA 4MJAA 4IQ1A 1VGLA 1GTUA 3KMNA 2JZSA 4ECJA 3D4MA 3HVVA 4H86A 1TK0B 4MABA 1K0OA 2QC7A 2TRXA 4LLRA 1GULA 2J23A 2B1LA 3GN3A 5KEJA 2JZRA 2OACA 5D9WA 3WT2A 4ECBA 3OR5A 3TKPA 1ZL9A 4WXTA 3KH7A 4BA7A 4F0CA 2XPEA 6GSXA 3VFIA 1QQ2A 1G7OA 4O32A 1EV4A 1A8LA 2IFQB 3ZLPA 2GQMA 2LQQA 4N0ZA 3AY8A 1MEKA 2HFDA 4GRFA 2M80A 2IMDA 2PVOC 4TXVA 3GV1A 1KBNA 4NV5A 3TJKA 3RPNA 3GSTA 3A5IA 5J41A 3LQ7A 2KP1A 3V1WA 1XW6A 3PR8A 3GL3A 1GTIA 3P90A 1KTEA 4ZBDA 1ERTA 2VOCA 5C00A 3KH9A 3UBKA 5CREA 5ECLB 1SL2B 4AF2A 4JEDA 2XBIA 1XOBA 1M3JA 2VL2A 3O6TA 3A5WA 2H1AA 3ZFLA 3S9FA 1YY7A 4G0LA 4ZIJA 2L6CA 1A2LA 3PINA 2GSRA 4ZB6A 3QAVA 3R2QA 4MJEA 1NHOA 1XWAA 4I6XA 2V2GA 4XRDA 4KAEA 3BCKA 4NXIA 1IYIA 3TRPA 4BVYA 5KOWA 2OADA 5IMFA 3ZIJA 4G19A 2GSQA 11GSA 2TIRA 2HLSA 2ZUPA 2DIYA 2HSYA 4EF0A 1YQ1A 1ZYNA 1FW1A 1OC9B 3ZITA 1GSDA 3HVSA 3IDVA 1Q98A 1XG8A 2H72A 1SD8A 1RQMA 2PMTA 3D4TA 5DJLA 4PUFC 4EXJA 3G7IA 1PX7A 5ECIB 2FWHA 4XS1A 3PPUA 5J4UA 3G9BA 2HI7A 2GGTA 1OKDA 3LYPA 2EIRA 1K0MA 1SKWB 6GSUA 4WF5A 1XFLA 1JZWA 3APSA 5DQSA 4F2IA 3W8SA 1S3DA 2JADA 4L0WA 1ZYPA 3D21A 4OCEA 1YF0A 1PD21 1GUHA 4MNNA 2FD3A 3IK9A 4MPGA 4RUVA 4TVEA 2MZCA 2WDUA 4I5QA 4E8EA 3RHCA 2IFQA 4FYUA 1Z6NA 3KEBA 4GTUA 1XWBA 2GTUA 2X4AA 1K0AA 1GNEA 4LA1A 4DSSB 3GA4A 2X8GA 2Z9SA 4MF5A 2YCDA 1TRUA 2LQOA 1KNGA 5A4VA 2C8UA 3GH9A 1X9SB 4EL1A 2AHEA 4YKGA 2VM2A 1A23A 2WCIA 4MPFA 4MZWA 16GSA 2YPMA 3KTBA 4FYCA 22GSA 2CX3A 5G5EA 1M0UA 4YAVA 2MMAA 3QFBC 1T8EB 1QK8A 5CNWA 3PH9A 5A4WA 5HR3A 2OE1A 4KX4A 2H01A 3LWAA 5HR1A 3IHGA 3I6AA 2NPBA 2FWFA 1GUKA 4KW6A 3F63A 1SK1A 3CQFA 1SU9A 4IS0A 3EWLA 4XRAA 1TP9A 3BOAA 3GYKA 5KN2A 1GSYA 4RQXA 3Q74A 2HT9A 1OC3A 3FR9A 1M2AA 3GSSA 2O89A 3E0UA 2KUCA 3IRAA 4TN8A 2LJAA 1F37A 4MZCA 4FQUA 4OMVA 4L5OA 1YKCA 3HZ4A 1R7HA 3TKRA 1FB6A 2PPTA 3ZMKA 4L5LA 3H79A 3GNJA 4JE1A 3IV4A 1E2YA 4WKWA 4G10A 1WWJA 1AAZA 2M46A 1G0TA 2R6KA 1WPIA 4K0NA 1BG5A 4EIPA 2CT6A 1K3OA 1W89A 3F6DA 3KP8A 3L4NA 4AJ7A 2YV7A 3VK9A 2PGTA 3TJFA 3GKKA 1EGOA 1EOGA 3GX8A 4ZL8A 8GSSA 2HZEB 3Q19A 3DGQA 5ECKB 1T4ZA 4Q5RA 1FOVA 5IOWA 1GTAA 1Y25A 3Q18A 1AC1A 3EMPA 4BL7B 4J56E 4O7HA 1VRSD 3F4RA 4F0BA 4OO4A 2WRTA 1R5PA 1B9XC 5CP1A 2FUG2 4DSSA 4MK3A 3ZVJA 2GT6A 5FHIA 1CQHA 5ECMB 3MYDA 3GRXA 4CHSA 2DSAA 3APQA 4MH3A 3LJRA 4EKZA 3FY7A 2IMEA 3KGKA 3WGXA 1USBA 1O81A 1EP7A 3K8NA 2DC5A 3HYPA 3FZ4A 1TRVA 4IBPA 4ZBBA 1ABAA 3CBUA 1A24A 1FAAA 3RAZA 1ILOA 6GSWA 5G1LA 5DBQA 2DJKA 2IWTA 3CTGA 3ZRDA 5B8BA 1B48A 1HNBA 1A2MA 2ZNMA 1SL0B 1B9YC 3VWUA 3F4TA 2V6KA 2GDRA 5EL8A 2B5XA 1NSWA 1OYJA 3A3TA 2R3XA 3HHVA 1YDKA 4YQMA 1THOA 4HJMA 1JZRA 2R4VA 1M3IA 4IVFA 3ERFA 3GX0A 3G7YA 4G2EA 2LUSA 2I4AA 4KDUA 1ZMAA 4ML1A 4JU5A 2B7JA 2IMKA 1K0DA 1JZDA 5E4WA 4TKYA 2UZ8A 4O92A 2C0GA 2LSTA 3MDKA 3P2AA 2LJKA 3U6VA 3IPZA 1XW9A 2CQ9A 3DKSA 1MDKA 3TOTA 3L9SA 2REMA 1PMTA 1GLPA 2B6MA 4EC0A 2VCXA 1Z3EA 4PNGA 1KEBA 2DBCA 2VCWA 3MIXA 4P3YB 1X0RA 5ECPB 2RUFA 1AXDA 1GLQA 1O8XA 2K6VA 3CTFA 4IGJA 5IMZA 2LNTA 2HZEA 3C71A 2A2RA
chains in the Genus database with same CATH topology
2H73A 3SBCA 4PGTA 5EVOA 2PN8A 2OBIA 3SWLA 4BL7A 5J5NA 3CRUA 5INYA 4POBA 2N5AA 2AV4A 2V1MA 3HVXA 5LD0A 4EDZA 1SK2A 2B5EA 4KCEA 4ACSA 2LV3A 3LEFA 5ECOB 3TKQA 2ON7A 1RW1A 2E7PA 4ECIA 2VL9A 2RM5A 2DKHA 2QA1A 4D73B 2X8CA 1AIUA 4HEA2 2CAIA 4NPBA 3LFLA 1ZGNA 2MMZA 4QL7A 4GLTA 2VLTA 2NDOA 2H75A 1MD3A 2VCTA 2LRNA 1MTCA 1GSEA 4EIQA 4Z2TA 3QD9A 5B7CA 3IC8A 3H93A 2NVLA 4K5RA 1UC7A 2VD1A 1TU8A 1FVJA 4ML6A 3ERGA 5F07A 3U5RE 4AJ8A 1HQOA 6GSTA 1PX6A 1J9BA 5J3RA 2C4JA 1TOFA 2XHFA 1UN2A 4RQRA 1XZOA 2AJQB 1X5CA 4V2NA 4WEYA 5G5FA 1X9WB 2DLXA 3ZTLA 1SJIA 1QMVA 1XWCA 14GSA 5KN0A 2B3SA 4X1UA 4YAPA 2LEGA 1F6MC 2EIQA 2YZHA 4NV2A 3IAM2 3DMLA 4IW9A 3VI5A 3FZ9A 4HQSA 3HXSA 5IOXA 1YEPA 1TJDA 4ZB8A 2EC4A 4GQCA 4JR4A 4PQIA 2GS3A 2WS2A 3UMAA 1O73A 2IIYA 2FA8A 2NTOA 4MF7A 2AB6A 1MDJA 5JCGA 1OVNA 1PKWA 1A0RP 2N5BA 3G7JA 2H6YA 4K9ZA 4CW9A 4POMA 5DAKB 1SENA 4A5PA 5KN1A 3M8NA 5IO0A 5COHA 4GF0A 3F6FA 4OFMA 2K8SA 1K3YA 4X43A 4IJIA 2MMNA 3LXZA 2HRKA 3N5OA 3IXRA 2VD0A 5IQYA 4IP1A 5G1KA 1TI3A 2CVDA 4KH7A 4V2MA 3DVXA 3N9JA 1J0FA 5B8AA 5GZZB 2H1DA 3CSIA 4DEJA 2VAFA 2C0EA 4OD7A 4WETA 2IMIA 5JCWA 4HI7A 10GSA 2R2JA 2A2PA 1V58A 4D73A 3Q6OA 4TW5A 5L71A 3BBYA 1XCCA 3CSJA 4ZXGA 2XBQA 1LU4A 5HFGA 2GZZA 4JRRA 2WZ9A 5ID2B 3FK8A 4N30A 1DE1A 4Q5QA 2R5GA 1V57A 2FA4A 3H1NA 1BEDA 2DMLA 2NBSA 2N5FA 1EZKA 1TRWA 3KXOA 3ZVJD 3TJGA 1XXUA 1M2BA 3IK7A 3GKNA 2IN3A 3WYWA 5F8BA 4XS6A 3HJOA 5ELAA 1FOHA 2H74A 3HY2A 1OAZA 3JCML 3LYKA 3GL5A 1GSUA 3IE3A 4POKA 3EC3A 2AAWA 1OC8A 2C3QA 2ES7A 1FB0A 2H0IA 2O87A 4KNDA 19GSA 2LS5A 5JWRB 2C3NA 1TDIA 4Z2UA 1HD2A 4K2DA 3PGTA 3ZFBA 4ID0A 4N10A 1GL8A 3HDCA 4PTSA 1B4PA 1GTBA 3KTLA 1TI1A 3F3QA 1FHEA 3QAWA 5C04A 2VIMA 1U3AA 2I9HA 5DAKA 2VLVA 4HU7A 2PERA 1GH2A 2OE3A 2VCZA 3VURA 4ZBAA 2I1UA 3KM6A 5GSTA 3M9JA 1B4QA 4K6XA 2BJXA 2B1KA 4POLA 12GSA 3BCIA 4I97A 3C1RA 1FVKA 5KOXA 2H1BA 3EYTA 3F8UA 4K7IA 3VPQA 4MP4A 1IYHA 5IM9A 1GNWA 2ZCTA 2DJJA 1O8WA 2IPAA 5D8IA 5CO3A 2A4HA 2MYGA 4J2FA 4I2UA 3HCZA 4TRXA 1JLWA 2CVBA 5ELGA 2F8AA 1T00A 4KDYA 3GMFA 4JR6A 1I5GA 3KIJA 3FKFA 3TUEA 3J7Yk 2PU9C 3UL3A 2FY6A 3QAGA 1OC9A 3GTUB 5ID2A 3HA9A 3P8WA 4MF6A 6GSYA 2P5QA 3ZZXA 5GSSA 2R0CA 3NZNA 4KB3A 4OFTA 5FWGA 2GT5A 2X49A 3A2WA 2E2MA 2QA2A 4XIHA 4IHUA 5ENUA 1M9BA 2VO4A 3A2VA 4TR1B 2WJUA 18GSA 3CYNA 3W6GA 2FHEA 4TR0A 2GVPA 5D93A 4CDOA 1K0NA 3DD3A 1Z7RA 2GSTA 4ILFA 3D0ZA 4OCFA 1SKRB 1AQXA 1HYUA 1U6TA 5HQPA 1X5DA 4MCUA 2VCVA 2LNSA 3VWXA 2R37A 4XS4B 5IPHA 1ZYQB 4GQFA 2JZTA 4EDYA 2O85A 5HFKA 3TJJA 5AISA 1NHYA 4DSRA 1ERWA 5EPFA 4MJBA 2YANA 5DCHA 3IR4A 2L4QA 1T3BA 4WBJA 1S3AA 5FT3A 4Q5FA 1ERVA 1QXHA 2P5RA 4F03A 4JBBA 1SK0A 5DALB 4BVXB 2R0GA 3EU3A 3FYGA 3TJBA 1A0FA 2ON5A 3BD2A 5A5KA 3GH6A 1MDIA 4EUYA 1S3CA 1OE8A 1BQ7A 3QMXA 2VL3A 2HSHA 3TRQA 4HZ4A 5KN3A 3UEMA 2HNLA 3EPTA 1XW5A 4K2XA 1M2DA 3L0HA 5CRGA 3ED3A 1EWXA 4TOPA 2DJ0A 2D2ZA 4J57E 4AGSA 1JLVA 1ZZYA 3LXTA 2K9FA 3ZIVA 4FIWA 1EGRA 5IO2A 1FO5A 3IA1A 4QQ7A 3KJYA 3EURA 3CSHA 2HZFA 5CAXA 3GTUA 2G2QA 2H0GA 4G9HA 2YWMA 1R4WA 3UAPA 4RI7A 5DJMA 2HSMA 2YN1A 3LGCA 3APOA 5AIVA 2JU5A 5AN1A 4CY8A 4JZQA 5CRWA 2A4VA 1A8YA 4KUNA 4PURA 2RM6A 1EOHA 2IL3A 1VF2A 1TU7A 3TDGA 2JL4A 1YKAA 2LRTA 3L9VA 1TXXA 4KDXA 2O8VB 1H75A 4KSMA 2H66A 1M99A 4MH2A 3F9UA 4XS4A 1XVQA 4GWRA 4L0UA 4EVMA 3UVTA 4IELA 2KHPA 3D22A 3FR6A 2J9HA 3M3MA 3MAKA 3IHQA 2LTKA 3QCPA 3QPMA 3NOFA 2L59A 1SL1B 4V1Ap 1U88A 4O5UA 1ZOFA 3TKSE 2ALBA 1Y6EA 5HR2A 4NWYA 5ABRA 3TKSA 2KOKA 3TRXA 1DBYA 5DALA 5J9CA 3FZAA 4BVXA 2PVQA 5A4UA 4Z2RA 2YWNA 2H0HA 3ME8A 6GSVA 1CQGA 3L78A 4QL9A 2H19A 1W4VA 4GCIA 1EEMA 3VPTA 3CXGA 2H6XA 1XOAA 5BRTA 1J08A 2C0FA 2CX4A 17GSA 5DCGA 2FNOA 1FG4A 5G2ZA 4HDEA 1A2JA 2DKIA 1GRXA 4G0IA 1QFNA 4YKFA 2YJHA 4LMWA 2AUVA 2FCHA 1XPVA 5IPGA 1V2AA 5LNKe 1O7UA 4RI6A 1RK4A 1PGTA 2F9SA 4XCSA 1XIYA 3QDNA 2F3MA 2YWIA 2YNXA 2X99A 1PN0A 4Q5NA 3CMIA 4ICYA 1EP8A 3RPPA 1K0CA 4USSA 2H30A 5EY6A 3TGZA 5LCZA 3C1SA 2A2SA 4I8BA 2QGVA 4WBRD 1LBKA 1HNCA 1U87A 1V98A 4PUAA 1TW9A 5AGYA 1PKZA 4MA9A 1ML6A 2PBJA 5BMUA 2P0GA 3IC4A 2MBSA 1DUGA 4YQUA 1GP1A 1C72A 2VL2C 2E0QA 2PWJA 3QFAC 4HJ2A 3RDWA 1TK8B 5D9XA 3KMOA 3H8QA 5JCUA 3C7MA 1YZXA 3BJ5A 3VI7A 4NHWA 3EE2A 2X8HA 3TCOA 3FRCA 5F0GA 5D96A 3ERWA 1URMA 3I69A 4EO3A 3KP9A 3VLNA 4ULXA 4ISDA 3O3TA 1MD4A 4IP6A 2BTOT 1T7PB 5CYYA 1G6WA 2WB9A 1NW2A 2H71A 5DQYA 4PNFA 2KLXA 4PQ1A 3HZ8A 4XTSA 5B6NA 4I2TA 1AUCA 2QKEA 3KZQA 4ECCA 4WF4A 1K3LA 3MWHA 4YQVA 3E9JB 4K8MA 3US3A 1SYRA 2CV4A 1E6BA 2MMOA 4O5QA 4TR4A 2C80A 4PQHA 3ISOA 4O5RA 1V40A 1WMJA 3DXBA 4F9ZA 1TKDB 5E59A 3GHAA 1PL1A 5ECSA 1SKSB 2WGRA 1F9MA 2H1GA 3EU4A 2LJRA 2VM1A 2L5LA 1JZOA 2H70A 1X9MB 2H8LA 3D6IA 2B7KA 2CAQA 4PXOA 3HJMA 2B5YA 5JWOB 5GAPD 1DSBA 1U3IA 4MDCA 3HJPA 2L57A 2F51A 2I3YA 3CRTA 3F0IA 1F3BA 1WE0A 3DVWA 5CRHA 5GAND 2LKUA 2H76A 2RIIA 5ECQB 5D9TA 4FH8A 1AW9A 2JACA 3DWVA 3FW2A 2V41A 2OE0A 2CVKA 2RLIA 3UBLA 2G0FA 4MZBA 4X0XA 2GSSA 3FMWA 3FHKA 4K0GA 5B6MA 3MNGA 4NAXA 2RUEA 4V1Ag 3L9UA 3QR6A 2JSZA 2C3TA 2C1YA 2EIOA 2P31A 4LMVA 2MBTA 1LJRA 4KA0A 4MJCA 4MMMA 3GKMA 1XWKA 2BMXA 1AQVA 4OO5A 3H4KA 2IJYA 3M9KA 2FGXA 1VF3A 2K8VA 1Q4JA 1PL2A 2HYXA 5IMAA 5HFIA 1O6JA 3E3EA 4G0KA 1TTZA 2CZ3A 1K0BA 3GURA 2VUPA 6GSSA 2YWOA 4L8EA 5F06A 2M72A 2YZUA 5DVBA 3GKXA 3UOMA 2CA8A 2OKAA 20GSA 1JHBA 1QGVA 2YOIA 1M7TA 1Z5YE 4WR4A 2GQKA 2HRNA 1BJXA 1ST9A 1N2AA 4YH2A 13GSA 3ZL5A 1SJ6A 3GFKA 4XHMA 2R0PA 4BWSA 2DJ2A 1BX9A 3IBHA 3UVHA 3UARA 2FWEA 1F2EA 3GUSA 3DYRA 2XPDA 3KCMA 4E8HA 1R26A 5IMCA 4X4JA 5JWQB 3WGEA 3HD5A 1T1VA 3ME7A 4AJ6A 1DE2A 3HKRA 5H5QA 2AYTA 3VWWA 2PUKC 4GSTA 2YP6A 2KP2A 4HZ2A 4K7NA 3LW9A 2JSYA 3DIEA 1PN9A 1YF1A 4LL1B 3EVIA 3TOUA 3FZ5A 3NIVA 1UA5A 2HXKA 3FEUA 1ERUA 3LG6A 4N0VA 4KF9A 4FO5A 3M0FA 1YJ6A 2QSIA 1EV9A 4ZB9A 3ZMLA 3UJ1A 2X64A 2DMMA 2WULA 2YJ7A 1SD9A 5D73A 4K7OA 1M9AA 2HE3A 3D5JA 1X5EA 4MLYA 4GSNA 1Z9HA 1I9DA 3R3EA 1GSFA 3C73A 4KSOA 1VF1A 2HRFA 1XWGA 1GWCA 5D9VA 4TXOB 2OA7A 3WT1A 2V32A 2K18A 2E2GA 4Z7XA 3ZYWA 1G7EA 3I9V2 1G6YA 1EEJA 5IMDA 3WD6A 2V6OA 2GQLA 1PQNA 1ZCPA 4EE0A 1ON4A 1H4OA 3EMXA 1NM3A 1BAYA 1OKTA 4IJ3A 2L6DA 2GLRA 4LL4B 1VF4A 1UVZA 4PX1A 4HOJA 2CZ2A 2VLUA 2DJ1A 5AIXA 4DSQA 5ECRB 1V9WA 1O85A 3IAS2 5ECHB 1R5AA 1Z6MA 1GUMA 3IOSA 1TK5B 3W8JA 3ZREA 4N11A 1PA3A 1ACVA 2C0DA 9GSSA 5IIZA 1QUWA 5DDLA 3KD0A 5H5RA 3LSZA 3O76A 3EINA 1PSQA 4GXZA 1WRYA 4TR1A 2L4CA 1YEXA 3VWVA 5H5SA 1XVWA 3I43A 1SYXA 3TB2A 4K5SA 2VCQA 4K1FA 3RBTA 4HS1A 3F4SA 1WJKA 2DJ3A 1XBSA 1WP0A 4HQZA 4HUAA 2GZYA 1ZYEA 4CY6A 1THXA 2O7KA 2LRCA 4TR3A 1T4YA 5ECNB 4BWQA 1JFUA 3WGDA 1HNAA 1BYEA 4HU9A 3QOUA 2WFCA 4V2LA 2H6ZA 2DIZA 4NHZA 2XC2A 2OJLA 3F3RA 1SJZA 4ZL7A 2L5OA 4IN0A 2OBKA 4IKHA 2YV9A 7GSSA 1OE7A 1WOUA 3J7Yb 1N8JA 5CRDA 1Z7PA 4OFNA 5IMVA 2I81A 3FR3A 5G31A 4ZILA 4BVYB 4IQAA 2HRAA 1F3AA 4WR5A 4KGIA 1AQWA 3DEXA 4FYBA 3UIWA 5G30A 4ZL9A 4NMUA 3A2XA 4F82A 4GSSA 1WIKA 5HR0A 3DRNA 5J9BA 3TKSC 3P7XA 3MSZA 2GZPA 3RHBA 4KE3A 3M1GA 1TRSA 1B8XA 4TXOA 4OWYA 4DVCA 1GSSA 1GSQA 5F05A 4KCAA 3C8EA 2IMFA 2TRCP 3GIXA 1PRXA 2FLSA 3LORA 2FWGA 2F8FA 4BPYA 4MJAA 4IQ1A 1VGLA 1GTUA 3KMNA 2JZSA 4ECJA 3D4MA 3HVVA 4H86A 1TK0B 4MABA 1K0OA 2QC7A 2TRXA 4LLRA 1GULA 2J23A 2B1LA 3GN3A 5KEJA 2JZRA 2OACA 5D9WA 3WT2A 4ECBA 3OR5A 3TKPA 1ZL9A 4WXTA 3KH7A 4BA7A 4F0CA 2XPEA 6GSXA 3VFIA 1QQ2A 1G7OA 4O32A 1EV4A 1A8LA 2IFQB 3ZLPA 2GQMA 2LQQA 4N0ZA 3AY8A 1MEKA 2HFDA 4GRFA 2M80A 2IMDA 2PVOC 4TXVA 3GV1A 1KBNA 4NV5A 3TJKA 3RPNA 3GSTA 3A5IA 5J41A 3LQ7A 2KP1A 3V1WA 1XW6A 3PR8A 3GL3A 1GTIA 3P90A 1KTEA 4ZBDA 1ERTA 2VOCA 5C00A 3KH9A 3UBKA 5CREA 5ECLB 1SL2B 4AF2A 4JEDA 2XBIA 1XOBA 2VL2A 3O6TA 3A5WA 2H1AA 3ZFLA 3S9FA 1YY7A 4G0LA 4ZIJA 2L6CA 1A2LA 3PINA 2GSRA 4ZB6A 3QAVA 3R2QA 4MJEA 1NHOA 1XWAA 4I6XA 2V2GA 4XRDA 4KAEA 3BCKA 4NXIA 1IYIA 3TRPA 4BVYA 5KOWA 2OADA 5IMFA 3ZIJA 4G19A 2GSQA 11GSA 2TIRA 2HLSA 2ZUPA 2DIYA 2HSYA 4EF0A 1YQ1A 1ZYNA 1FW1A 1OC9B 3ZITA 1GSDA 3HVSA 3IDVA 1Q98A 2H72A 1SD8A 1RQMA 2PMTA 3D4TA 5DJLA 4PUFC 4EXJA 3G7IA 1PX7A 5ECIB 2FWHA 4XS1A 3PPUA 5J4UA 3G9BA 2HI7A 2GGTA 1OKDA 3LYPA 2EIRA 1K0MA 1SKWB 6GSUA 4WF5A 1XFLA 1JZWA 3APSA 5DQSA 4F2IA 3W8SA 1S3DA 2JADA 4L0WA 1ZYPA 3D21A 4OCEA 1YF0A 1PD21 1GUHA 4MNNA 2FD3A 3IK9A 4MPGA 4RUVA 4TVEA 2MZCA 2WDUA 4I5QA 4E8EA 3RHCA 2IFQA 4FYUA 1Z6NA 3KEBA 4GTUA 1XWBA 2GTUA 2X4AA 1K0AA 1GNEA 4LA1A 4DSSB 3GA4A 2X8GA 2Z9SA 4MF5A 2YCDA 1TRUA 2LQOA 1KNGA 5A4VA 2C8UA 3GH9A 1X9SB 4EL1A 2AHEA 4YKGA 2VM2A 1A23A 2WCIA 4MPFA 4MZWA 16GSA 2YPMA 3KTBA 4FYCA 22GSA 2CX3A 5G5EA 1M0UA 4YAVA 2MMAA 3QFBC 1T8EB 1QK8A 5CNWA 3PH9A 5A4WA 5HR3A 2OE1A 4KX4A 2H01A 3LWAA 5HR1A 3IHGA 3I6AA 2NPBA 2FWFA 1GUKA 4KW6A 3F63A 1SK1A 1SU9A 4IS0A 3EWLA 4XRAA 1TP9A 3BOAA 3GYKA 5KN2A 1GSYA 4RQXA 3Q74A 2HT9A 1OC3A 3FR9A 1M2AA 3GSSA 2O89A 3E0UA 2KUCA 3IRAA 4TN8A 2LJAA 1F37A 4MZCA 4FQUA 4OMVA 4L5OA 1YKCA 3HZ4A 1R7HA 3TKRA 1FB6A 2PPTA 3ZMKA 4L5LA 3H79A 3GNJA 4JE1A 3IV4A 1E2YA 4WKWA 4G10A 1WWJA 1AAZA 2M46A 1G0TA 2R6KA 1WPIA 4K0NA 1BG5A 4EIPA 2CT6A 1K3OA 1W89A 3F6DA 3KP8A 3L4NA 4AJ7A 2YV7A 3VK9A 2PGTA 3TJFA 3GKKA 1EGOA 1EOGA 3GX8A 4ZL8A 8GSSA 2HZEB 3Q19A 3DGQA 5ECKB 1T4ZA 4Q5RA 1FOVA 5IOWA 1GTAA 1Y25A 3Q18A 1AC1A 3EMPA 4BL7B 4J56E 4O7HA 1VRSD 3F4RA 4F0BA 4OO4A 2WRTA 1R5PA 1B9XC 5CP1A 2FUG2 4DSSA 4MK3A 3ZVJA 2GT6A 5FHIA 1CQHA 5ECMB 3MYDA 3GRXA 4CHSA 2DSAA 3APQA 4MH3A 3LJRA 4EKZA 3FY7A 2IMEA 3KGKA 3WGXA 1USBA 1O81A 1EP7A 3K8NA 2DC5A 3HYPA 3FZ4A 1TRVA 4IBPA 4ZBBA 1ABAA 3CBUA 1A24A 1FAAA 3RAZA 1ILOA 6GSWA 5G1LA 5DBQA 2DJKA 2IWTA 3CTGA 3ZRDA 5B8BA 1B48A 1HNBA 1A2MA 2ZNMA 1SL0B 1B9YC 3VWUA 3F4TA 2V6KA 2GDRA 5EL8A 2B5XA 1NSWA 1OYJA 3A3TA 2R3XA 3HHVA 1YDKA 4YQMA 1THOA 4HJMA 1JZRA 2R4VA 4IVFA 3ERFA 3GX0A 3G7YA 4G2EA 2LUSA 2I4AA 4KDUA 1ZMAA 4ML1A 4JU5A 2B7JA 2IMKA 1K0DA 1JZDA 5E4WA 4TKYA 2UZ8A 4O92A 2C0GA 2LSTA 3MDKA 3P2AA 2LJKA 3U6VA 3IPZA 1XW9A 2CQ9A 3DKSA 1MDKA 3TOTA 3L9SA 2REMA 1PMTA 1GLPA 2B6MA 4EC0A 2VCXA 1Z3EA 4PNGA 1KEBA 2DBCA 2VCWA 3MIXA 4P3YB 1X0RA 5ECPB 2RUFA 1AXDA 1GLQA 1O8XA 2K6VA 3CTFA 4IGJA 5IMZA 2LNTA 2HZEA 3C71A 2A2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H73 A;  3SBC A;  4PGT A;  5EVO A;  2PN8 A;  2OBI A;  3SWL A;  4BL7 A;  5J5N A;  3CRU A;  5INY A;  4POB A;  2N5A A;  2AV4 A;  2V1M A;  3HVX A;  5LD0 A;  4EDZ A;  1SK2 A;  2B5E A;  4KCE A;  4ACS A;  2LV3 A;  3LEF A;  5ECO B;  3TKQ A;  2ON7 A;  1RW1 A;  2E7P A;  4ECI A;  2VL9 A;  2RM5 A;  4D73 B;  2X8C A;  1AIU A;  4HEA 2;  2CAI A;  4NPB A;  3LFL A;  1ZGN A;  2MMZ A;  4QL7 A;  4GLT A;  2VLT A;  2NDO A;  2H75 A;  1MD3 A;  2VCT A;  2LRN A;  1MTC A;  1GSE A;  3QD9 A;  5B7C A;  3H93 A;  2NVL A;  1UC7 A;  2VD1 A;  1TU8 A;  1FVJ A;  4ML6 A;  3ERG A;  5F07 A;  3U5R E;  4AJ8 A;  1HQO A;  6GST A;  1PX6 A;  1J9B A;  5J3R A;  2C4J A;  1TOF A;  2XHF A;  1UN2 A;  4RQR A;  1XZO A;  2AJQ B;  1X5C A;  4V2N A;  4WEY A;  5G5F A;  1X9W B;  2DLX A;  3ZTL A;  1SJI A;  1QMV A;  1XWC A;  14GS A;  5KN0 A;  2B3S A;  4X1U A;  4YAP A;  2LEG A;  1F6M C;  2EIQ A;  2YZH A;  4NV2 A;  3IAM 2;  3DML A;  4IW9 A;  3VI5 A;  3FZ9 A;  4HQS A;  3HXS A;  5IOX A;  1YEP A;  1TJD A;  4ZB8 A;  2EC4 A;  4GQC A;  4JR4 A;  4PQI A;  2GS3 A;  2WS2 A;  3UMA A;  1O73 A;  2IIY A;  2FA8 A;  2NTO A;  4MF7 A;  2AB6 A;  1MDJ A;  5JCG A;  1OVN A;  1PKW A;  1A0R P;  2N5B A;  3G7J A;  2H6Y A;  4K9Z A;  4CW9 A;  4POM A;  5DAK B;  1SEN A;  5KN1 A;  3M8N A;  5IO0 A;  5COH A;  4GF0 A;  3F6F A;  4OFM A;  2K8S A;  1K3Y A;  4X43 A;  4IJI A;  2MMN A;  3LXZ A;  3N5O A;  3IXR A;  2VD0 A;  5IQY A;  4IP1 A;  5G1K A;  1TI3 A;  2CVD A;  4KH7 A;  4V2M A;  3DVX A;  3N9J A;  1J0F A;  5B8A A;  5GZZ B;  2H1D A;  3CSI A;  4DEJ A;  2VAF A;  2C0E A;  4OD7 A;  4WET A;  2IMI A;  5JCW A;  4HI7 A;  10GS A;  2R2J A;  1V58 A;  4D73 A;  3Q6O A;  4TW5 A;  5L71 A;  3BBY A;  1XCC A;  3CSJ A;  4ZXG A;  2XBQ A;  1LU4 A;  5HFG A;  2GZZ A;  4JRR A;  2WZ9 A;  5ID2 B;  3FK8 A;  4N30 A;  1DE1 A;  4Q5Q A;  2R5G A;  1V57 A;  2FA4 A;  3H1N A;  1BED A;  2DML A;  2NBS A;  2N5F A;  1EZK A;  1TRW A;  3KXO A;  3ZVJ D;  3TJG A;  1XXU A;  1M2B A;  3IK7 A;  3GKN A;  2IN3 A;  3WYW A;  5F8B A;  4XS6 A;  3HJO A;  5ELA A;  2H74 A;  3HY2 A;  1OAZ A;  3JCM L;  3LYK A;  3GL5 A;  1GSU A;  3IE3 A;  4POK A;  3EC3 A;  2AAW A;  1OC8 A;  2C3Q A;  2ES7 A;  1FB0 A;  2H0I A;  2O87 A;  4KND A;  19GS A;  2LS5 A;  5JWR B;  2C3N A;  1TDI A;  1HD2 A;  4K2D A;  3PGT A;  3ZFB A;  4ID0 A;  4N10 A;  1GL8 A;  3HDC A;  1B4P A;  1GTB A;  3KTL A;  1TI1 A;  3F3Q A;  1FHE A;  3QAW A;  5C04 A;  2VIM A;  1U3A A;  2I9H A;  5DAK A;  2VLV A;  4HU7 A;  2PER A;  1GH2 A;  2OE3 A;  2VCZ A;  3VUR A;  4ZBA A;  2I1U A;  3KM6 A;  5GST A;  3M9J A;  1B4Q A;  4K6X A;  2BJX A;  2B1K A;  4POL A;  12GS A;  3BCI A;  4I97 A;  3C1R A;  1FVK A;  2H1B A;  3EYT A;  3F8U A;  4K7I A;  3VPQ A;  4MP4 A;  1IYH A;  5IM9 A;  1GNW A;  2ZCT A;  2DJJ A;  1O8W A;  2IPA A;  5D8I A;  5CO3 A;  2MYG A;  4J2F A;  4I2U A;  3HCZ A;  4TRX A;  1JLW A;  2CVB A;  5ELG A;  2F8A A;  1T00 A;  4KDY A;  3GMF A;  4JR6 A;  1I5G A;  3KIJ A;  3FKF A;  3TUE A;  3J7Y k;  2PU9 C;  3UL3 A;  2FY6 A;  3QAG A;  1OC9 A;  3GTU B;  5ID2 A;  3HA9 A;  3P8W A;  4MF6 A;  6GSY A;  2P5Q A;  3ZZX A;  5GSS A;  3NZN A;  4KB3 A;  4OFT A;  5FWG A;  2GT5 A;  3A2W A;  2E2M A;  4XIH A;  4IHU A;  5ENU A;  1M9B A;  2VO4 A;  3A2V A;  4TR1 B;  2WJU A;  18GS A;  3CYN A;  3W6G A;  2FHE A;  4TR0 A;  2GVP A;  5D93 A;  4CDO A;  1K0N A;  3DD3 A;  1Z7R A;  2GST A;  4ILF A;  3D0Z A;  4OCF A;  1SKR B;  1AQX A;  1HYU A;  1U6T A;  5HQP A;  1X5D A;  4MCU A;  2VCV A;  2LNS A;  3VWX A;  2R37 A;  4XS4 B;  5IPH A;  1ZYQ B;  4GQF A;  2JZT A;  4EDY A;  2O85 A;  5HFK A;  3TJJ A;  5AIS A;  1NHY A;  4DSR A;  1ERW A;  5EPF A;  4MJB A;  2YAN A;  5DCH A;  3IR4 A;  2L4Q A;  1T3B A;  4WBJ A;  1S3A A;  5FT3 A;  4Q5F A;  1ERV A;  1QXH A;  2P5R A;  4F03 A;  4JBB A;  1SK0 A;  5DAL B;  3EU3 A;  3FYG A;  3TJB A;  1A0F A;  2ON5 A;  3BD2 A;  5A5K A;  3GH6 A;  1MDI A;  4EUY A;  1S3C A;  1OE8 A;  1BQ7 A;  3QMX A;  2VL3 A;  2HSH A;  3TRQ A;  4HZ4 A;  5KN3 A;  3UEM A;  2HNL A;  1XW5 A;  1M2D A;  3L0H A;  5CRG A;  3ED3 A;  1EWX A;  4TOP A;  2DJ0 A;  2D2Z A;  4J57 E;  4AGS A;  1JLV A;  1ZZY A;  3LXT A;  2K9F A;  3ZIV A;  4FIW A;  1EGR A;  5IO2 A;  1FO5 A;  3IA1 A;  4QQ7 A;  3KJY A;  3EUR A;  3CSH A;  2HZF A;  5CAX A;  3GTU A;  2G2Q A;  2H0G A;  4G9H A;  2YWM A;  1R4W A;  3UAP A;  4RI7 A;  5DJM A;  3LGC A;  2YN1 A;  3APO A;  5AIV A;  2JU5 A;  5AN1 A;  4JZQ A;  5CRW A;  2A4V A;  1A8Y A;  4KUN A;  4PUR A;  2RM6 A;  1EOH A;  2IL3 A;  1VF2 A;  1TU7 A;  3TDG A;  2JL4 A;  1YKA A;  2LRT A;  3L9V A;  1TXX A;  4KDX A;  2O8V B;  1H75 A;  4KSM A;  2H66 A;  1M99 A;  4MH2 A;  3F9U A;  4XS4 A;  1XVQ A;  4GWR A;  4L0U A;  4EVM A;  3UVT A;  4IEL A;  2KHP A;  3D22 A;  3FR6 A;  2J9H A;  3M3M A;  3MAK A;  3IHQ A;  2LTK A;  3QCP A;  3QPM A;  3NOF A;  2L59 A;  1SL1 B;  4V1A p;  1U88 A;  1ZOF A;  3TKS E;  2ALB A;  1Y6E A;  5HR2 A;  4NWY A;  5ABR A;  3TKS A;  2KOK A;  3TRX A;  1DBY A;  5DAL A;  5J9C A;  3FZA A;  4BVX A;  2PVQ A;  5A4U A;  2YWN A;  2H0H A;  3ME8 A;  6GSV A;  1CQG A;  3L78 A;  4QL9 A;  2H19 A;  1W4V A;  4GCI A;  1EEM A;  3VPT A;  3CXG A;  2H6X A;  1XOA A;  1J08 A;  2C0F A;  2CX4 A;  17GS A;  5DCG A;  2FNO A;  1FG4 A;  5G2Z A;  4HDE A;  1A2J A;  1GRX A;  1QFN A;  2YJH A;  4LMW A;  2AUV A;  2FCH A;  1XPV A;  5IPG A;  1V2A A;  5LNK e;  1O7U A;  4RI6 A;  1RK4 A;  1PGT A;  2F9S A;  4XCS A;  1XIY A;  3QDN A;  2F3M A;  2YWI A;  2YNX A;  2X99 A;  4Q5N A;  3CMI A;  1EP8 A;  3RPP A;  1K0C A;  2H30 A;  5EY6 A;  3TGZ A;  5LCZ A;  3C1S A;  2A2S A;  4I8B A;  2QGV A;  4WBR D;  1LBK A;  1HNC A;  1U87 A;  1V98 A;  4PUA A;  1TW9 A;  5AGY A;  1PKZ A;  4MA9 A;  1ML6 A;  2PBJ A;  2P0G A;  3IC4 A;  2MBS A;  1DUG A;  4YQU A;  1GP1 A;  1C72 A;  2VL2 C;  2E0Q A;  2PWJ A;  3QFA C;  4HJ2 A;  3RDW A;  1TK8 B;  5D9X A;  3KMO A;  3H8Q A;  5JCU A;  3C7M A;  1YZX A;  3BJ5 A;  3VI7 A;  4NHW A;  3EE2 A;  2X8H A;  3TCO A;  3FRC A;  5F0G A;  5D96 A;  3ERW A;  1URM A;  3I69 A;  4EO3 A;  3KP9 A;  3VLN A;  4ULX A;  4ISD A;  3O3T A;  1MD4 A;  4IP6 A;  2BTO T;  1T7P B;  5CYY A;  1G6W A;  2WB9 A;  1NW2 A;  2H71 A;  5DQY A;  4PNF A;  2KLX A;  4PQ1 A;  3HZ8 A;  4XTS A;  5B6N A;  4I2T A;  1AUC A;  2QKE A;  3KZQ A;  4ECC A;  4WF4 A;  1K3L A;  3MWH A;  4YQV A;  3E9J B;  4K8M A;  3US3 A;  1SYR A;  2CV4 A;  1E6B A;  2MMO A;  4TR4 A;  2C80 A;  4PQH A;  3ISO A;  4O5R A;  1V40 A;  1WMJ A;  3DXB A;  4F9Z A;  1TKD B;  5E59 A;  3GHA A;  1PL1 A;  5ECS A;  1SKS B;  2WGR A;  1F9M A;  2H1G A;  3EU4 A;  2LJR A;  2VM1 A;  2L5L A;  1JZO A;  2H70 A;  1X9M B;  2H8L A;  3D6I A;  2B7K A;  2CAQ A;  4PXO A;  3HJM A;  2B5Y A;  5JWO B;  5GAP D;  1DSB A;  1U3I A;  4MDC A;  3HJP A;  2L57 A;  2F51 A;  2I3Y A;  3CRT A;  3F0I A;  1F3B A;  1WE0 A;  3DVW A;  5CRH A;  5GAN D;  2LKU A;  2H76 A;  2RII A;  5ECQ B;  5D9T A;  4FH8 A;  1AW9 A;  2JAC A;  3DWV A;  3FW2 A;  2V41 A;  2OE0 A;  2CVK A;  2RLI A;  3UBL A;  2G0F A;  4MZB A;  4X0X A;  2GSS A;  3FHK A;  4K0G A;  5B6M A;  3MNG A;  4NAX A;  2RUE A;  4V1A g;  3L9U A;  3QR6 A;  2JSZ A;  2C3T A;  2C1Y A;  2EIO A;  2P31 A;  4LMV A;  2MBT A;  1LJR A;  4KA0 A;  4MJC A;  4MMM A;  3GKM A;  1XWK A;  2BMX A;  1AQV A;  4OO5 A;  3H4K A;  2IJY A;  3M9K A;  2FGX A;  1VF3 A;  2K8V A;  1Q4J A;  1PL2 A;  2HYX A;  5IMA A;  5HFI A;  1O6J A;  3E3E A;  1TTZ A;  2CZ3 A;  1K0B A;  3GUR A;  2VUP A;  6GSS A;  2YWO A;  4L8E A;  5F06 A;  2M72 A;  2YZU A;  5DVB A;  3GKX A;  3UOM A;  2CA8 A;  2OKA A;  20GS A;  1JHB A;  1QGV A;  2YOI A;  1M7T A;  1Z5Y E;  4WR4 A;  2GQK A;  2HRN A;  1BJX A;  1ST9 A;  1N2A A;  4YH2 A;  13GS A;  3ZL5 A;  1SJ6 A;  3GFK A;  4XHM A;  4BWS A;  2DJ2 A;  1BX9 A;  3IBH A;  3UVH A;  3UAR A;  2FWE A;  1F2E A;  3GUS A;  3DYR A;  2XPD A;  3KCM A;  4E8H A;  1R26 A;  5IMC A;  5JWQ B;  3WGE A;  3HD5 A;  1T1V A;  3ME7 A;  4AJ6 A;  1DE2 A;  3HKR A;  5H5Q A;  2AYT A;  3VWW A;  2PUK C;  4GST A;  2YP6 A;  2KP2 A;  4HZ2 A;  4K7N A;  2JSY A;  3DIE A;  1PN9 A;  1YF1 A;  4LL1 B;  3EVI A;  3TOU A;  3FZ5 A;  3NIV A;  1UA5 A;  2HXK A;  3FEU A;  1ERU A;  3LG6 A;  4N0V A;  4FO5 A;  3M0F A;  1YJ6 A;  2QSI A;  1EV9 A;  4ZB9 A;  3ZML A;  3UJ1 A;  2X64 A;  2DMM A;  2WUL A;  2YJ7 A;  1SD9 A;  5D73 A;  4K7O A;  1M9A A;  2HE3 A;  3D5J A;  1X5E A;  4MLY A;  4GSN A;  1Z9H A;  1I9D A;  1GSF A;  3C73 A;  4KSO A;  1VF1 A;  2HRF A;  1XWG A;  1GWC A;  5D9V A;  4TXO B;  2OA7 A;  3WT1 A;  2V32 A;  2K18 A;  2E2G A;  4Z7X A;  3ZYW A;  1G7E A;  3I9V 2;  1G6Y A;  1EEJ A;  5IMD A;  3WD6 A;  2V6O A;  2GQL A;  1PQN A;  1ZCP A;  4EE0 A;  1ON4 A;  1H4O A;  3EMX A;  1NM3 A;  1BAY A;  1OKT A;  4IJ3 A;  2L6D A;  2GLR A;  4LL4 B;  1VF4 A;  1UVZ A;  4PX1 A;  4HOJ A;  2CZ2 A;  2VLU A;  2DJ1 A;  5AIX A;  4DSQ A;  5ECR B;  1V9W A;  1O85 A;  3IAS 2;  5ECH B;  1R5A A;  1Z6M A;  1GUM A;  3IOS A;  1TK5 B;  3W8J A;  3ZRE A;  4N11 A;  1PA3 A;  1ACV A;  2C0D A;  9GSS A;  5IIZ A;  1QUW A;  5DDL A;  3KD0 A;  5H5R A;  3LSZ A;  3O76 A;  3EIN A;  1PSQ A;  4GXZ A;  1WRY A;  4TR1 A;  2L4C A;  1YEX A;  3VWV A;  5H5S A;  1XVW A;  3I43 A;  1SYX A;  3TB2 A;  2VCQ A;  4K1F A;  3RBT A;  4HS1 A;  3F4S A;  1WJK A;  2DJ3 A;  1XBS A;  1WP0 A;  4HQZ A;  4HUA A;  2GZY A;  1ZYE A;  1THX A;  2O7K A;  2LRC A;  4TR3 A;  1T4Y A;  5ECN B;  4BWQ A;  1JFU A;  3WGD A;  1HNA A;  1BYE A;  4HU9 A;  3QOU A;  2WFC A;  4V2L A;  2H6Z A;  2DIZ A;  4NHZ A;  2XC2 A;  2OJL A;  3F3R A;  1SJZ A;  4ZL7 A;  2L5O A;  4IN0 A;  2OBK A;  4IKH A;  2YV9 A;  7GSS A;  1OE7 A;  1WOU A;  3J7Y b;  1N8J A;  5CRD A;  1Z7P A;  4OFN A;  5IMV A;  2I81 A;  3FR3 A;  5G31 A;  4ZIL A;  4IQA A;  1F3A A;  4WR5 A;  4KGI A;  1AQW A;  3DEX A;  4FYB A;  3UIW A;  5G30 A;  4ZL9 A;  4NMU A;  3A2X A;  4F82 A;  4GSS A;  1WIK A;  5HR0 A;  3DRN A;  5J9B A;  3TKS C;  3P7X A;  3MSZ A;  2GZP A;  3RHB A;  4KE3 A;  3M1G A;  1TRS A;  1B8X A;  4TXO A;  4OWY A;  4DVC A;  1GSS A;  1GSQ A;  5F05 A;  4KCA A;  3C8E A;  2IMF A;  2TRC P;  3GIX A;  1PRX A;  2FLS A;  3LOR A;  2FWG A;  2F8F A;  4BPY A;  4MJA A;  4IQ1 A;  1VGL A;  1GTU A;  3KMN A;  2JZS A;  4ECJ A;  3D4M A;  3HVV A;  4H86 A;  1TK0 B;  4MAB A;  1K0O A;  2QC7 A;  2TRX A;  4LLR A;  1GUL A;  2J23 A;  2B1L A;  3GN3 A;  5KEJ A;  2JZR A;  2OAC A;  5D9W A;  3WT2 A;  4ECB A;  3OR5 A;  3TKP A;  1ZL9 A;  4WXT A;  3KH7 A;  4BA7 A;  4F0C A;  2XPE A;  6GSX A;  3VFI A;  1QQ2 A;  1G7O A;  4O32 A;  1EV4 A;  1A8L A;  2IFQ B;  3ZLP A;  2GQM A;  2LQQ A;  4N0Z A;  3AY8 A;  1MEK A;  2HFD A;  4GRF A;  2M80 A;  2IMD A;  2PVO C;  4TXV A;  3GV1 A;  1KBN A;  4NV5 A;  3TJK A;  3RPN A;  3GST A;  5J41 A;  3LQ7 A;  2KP1 A;  3V1W A;  1XW6 A;  3PR8 A;  3GL3 A;  1GTI A;  3P90 A;  1KTE A;  4ZBD A;  1ERT A;  2VOC A;  5C00 A;  3KH9 A;  3UBK A;  5CRE A;  5ECL B;  1SL2 B;  4AF2 A;  4JED A;  2XBI A;  1XOB A;  2VL2 A;  3O6T A;  3A5W A;  2H1A A;  3ZFL A;  3S9F A;  1YY7 A;  4ZIJ A;  2L6C A;  1A2L A;  3PIN A;  2GSR A;  4ZB6 A;  3QAV A;  3R2Q A;  4MJE A;  1NHO A;  1XWA A;  4I6X A;  2V2G A;  4XRD A;  4KAE A;  3BCK A;  4NXI A;  1IYI A;  3TRP A;  4BVY A;  2OAD A;  5IMF A;  3ZIJ A;  4G19 A;  2GSQ A;  11GS A;  2TIR A;  2HLS A;  2ZUP A;  2DIY A;  2HSY A;  4EF0 A;  1YQ1 A;  1FW1 A;  1OC9 B;  3ZIT A;  1GSD A;  3HVS A;  3IDV A;  1Q98 A;  2H72 A;  1SD8 A;  1RQM A;  2PMT A;  3D4T A;  5DJL A;  4PUF C;  4EXJ A;  3G7I A;  1PX7 A;  5ECI B;  2FWH A;  4XS1 A;  5J4U A;  3G9B A;  2HI7 A;  2GGT A;  1OKD A;  3LYP A;  2EIR A;  1K0M A;  1SKW B;  6GSU A;  4WF5 A;  1XFL A;  1JZW A;  3APS A;  5DQS A;  4F2I A;  3W8S A;  1S3D A;  2JAD A;  4L0W A;  3D21 A;  4OCE A;  1YF0 A;  1PD2 1;  1GUH A;  4MPG A;  2FD3 A;  3IK9 A;  4RUV A;  4TVE A;  2MZC A;  2WDU A;  4I5Q A;  4E8E A;  3RHC A;  2IFQ A;  4FYU A;  1Z6N A;  3KEB A;  4GTU A;  1XWB A;  2GTU A;  1K0A A;  1GNE A;  4LA1 A;  4DSS B;  3GA4 A;  2X8G A;  2Z9S A;  4MF5 A;  2YCD A;  1TRU A;  2LQO A;  1KNG A;  5A4V A;  2C8U A;  3GH9 A;  1X9S B;  4EL1 A;  2AHE A;  2VM2 A;  1A23 A;  2WCI A;  4MPF A;  4MZW A;  16GS A;  2YPM A;  3KTB A;  4FYC A;  22GS A;  2CX3 A;  5G5E A;  1M0U A;  4YAV A;  2MMA A;  3QFB C;  1T8E B;  1QK8 A;  5CNW A;  3PH9 A;  5A4W A;  5HR3 A;  2OE1 A;  4KX4 A;  2H01 A;  3LWA A;  5HR1 A;  3I6A A;  2NPB A;  2FWF A;  1GUK A;  4KW6 A;  3F63 A;  1SK1 A;  1SU9 A;  4IS0 A;  3EWL A;  4XRA A;  1TP9 A;  3BOA A;  3GYK A;  5KN2 A;  1GSY A;  4RQX A;  3Q74 A;  2HT9 A;  1OC3 A;  3FR9 A;  1M2A A;  3GSS A;  2O89 A;  3E0U A;  2KUC A;  3IRA A;  4TN8 A;  2LJA A;  1F37 A;  4MZC A;  4OMV A;  4L5O A;  1YKC A;  3HZ4 A;  1R7H A;  3TKR A;  1FB6 A;  2PPT A;  3ZMK A;  4L5L A;  3H79 A;  3GNJ A;  4JE1 A;  3IV4 A;  1E2Y A;  4WKW A;  4G10 A;  1WWJ A;  1AAZ A;  2M46 A;  1G0T A;  2R6K A;  1WPI A;  4K0N A;  1BG5 A;  2CT6 A;  1K3O A;  1W89 A;  3F6D A;  3KP8 A;  3L4N A;  4AJ7 A;  2YV7 A;  3VK9 A;  2PGT A;  3TJF A;  3GKK A;  1EGO A;  1EOG A;  3GX8 A;  4ZL8 A;  8GSS A;  2HZE B;  3Q19 A;  3DGQ A;  5ECK B;  1T4Z A;  4Q5R A;  1FOV A;  5IOW A;  1GTA A;  1Y25 A;  3Q18 A;  1AC1 A;  3EMP A;  4J56 E;  4O7H A;  1VRS D;  3F4R A;  4F0B A;  4OO4 A;  2WRT A;  1R5P A;  1B9X C;  5CP1 A;  2FUG 2;  4DSS A;  4MK3 A;  3ZVJ A;  2GT6 A;  5FHI A;  1CQH A;  5ECM B;  3GRX A;  4CHS A;  2DSA A;  3APQ A;  4MH3 A;  3LJR A;  4EKZ A;  3FY7 A;  2IME A;  3KGK A;  3WGX A;  1USB A;  1O81 A;  1EP7 A;  3K8N A;  2DC5 A;  3HYP A;  3FZ4 A;  1TRV A;  4IBP A;  4ZBB A;  1ABA A;  3CBU A;  1A24 A;  1FAA A;  3RAZ A;  1ILO A;  6GSW A;  5G1L A;  5DBQ A;  2DJK A;  2IWT A;  3CTG A;  3ZRD A;  5B8B A;  1B48 A;  1HNB A;  1A2M A;  2ZNM A;  1SL0 B;  1B9Y C;  3VWU A;  3F4T A;  2V6K A;  2GDR A;  5EL8 A;  2B5X A;  1NSW A;  1OYJ A;  3A3T A;  2R3X A;  3HHV A;  1YDK A;  4YQM A;  1THO A;  4HJM A;  1JZR A;  2R4V A;  4IVF A;  3ERF A;  3GX0 A;  3G7Y A;  4G2E A;  2LUS A;  2I4A A;  4KDU A;  1ZMA A;  4ML1 A;  4JU5 A;  2B7J A;  2IMK A;  1K0D A;  1JZD A;  5E4W A;  4TKY A;  3MDK A;  2C0G A;  2LST A;  4O92 A;  3P2A A;  2LJK A;  3U6V A;  3IPZ A;  1XW9 A;  2CQ9 A;  3DKS A;  1MDK A;  3TOT A;  3L9S A;  2REM A;  1PMT A;  1GLP A;  2B6M A;  4EC0 A;  2VCX A;  1Z3E A;  4PNG A;  1KEB A;  2DBC A;  2VCW A;  4P3Y B;  1X0R A;  5ECP B;  2RUF A;  1AXD A;  1GLQ A;  1O8X A;  2K6V A;  3CTF A;  4IGJ A;  5IMZ A;  2LNT A;  2HZE A;  3C71 A;  2A2R A; 
#chains in the Genus database with same CATH topology
 2H73 A;  3SBC A;  4PGT A;  5EVO A;  2PN8 A;  2OBI A;  3SWL A;  1PFO A;  4BL7 A;  5J5N A;  3CRU A;  5INY A;  4POB A;  2N5A A;  2AV4 A;  2V1M A;  3HVX A;  5LD0 A;  4EDZ A;  1SK2 A;  2B5E A;  4KCE A;  3HVN A;  4ACS A;  2LV3 A;  3LEF A;  5ECO B;  3TKQ A;  2ON7 A;  1RW1 A;  2E7P A;  4ECI A;  2VL9 A;  2RM5 A;  2DKH A;  2QA1 A;  4D73 B;  2X8C A;  1AIU A;  4HEA 2;  2CAI A;  4NPB A;  3LFL A;  1ZGN A;  2MMZ A;  4QL7 A;  4GLT A;  2VLT A;  2NDO A;  2H75 A;  1MD3 A;  2VCT A;  2LRN A;  1MTC A;  1GSE A;  4EIQ A;  4Z2T A;  3QD9 A;  5B7C A;  3IC8 A;  3H93 A;  2NVL A;  4K5R A;  1UC7 A;  2VD1 A;  1TU8 A;  1FVJ A;  4ML6 A;  3ERG A;  5F07 A;  3U5R E;  4AJ8 A;  1HQO A;  6GST A;  1PX6 A;  1J9B A;  5J3R A;  2C4J A;  1TOF A;  2XHF A;  1UN2 A;  4RQR A;  1XZO A;  2AJQ B;  1X5C A;  4V2N A;  4WEY A;  5G5F A;  1X9W B;  2DLX A;  3ZTL A;  1SJI A;  1QMV A;  1XWC A;  14GS A;  5KN0 A;  2B3S A;  4X1U A;  4YAP A;  2LEG A;  1F6M C;  2EIQ A;  2YZH A;  4NV2 A;  3IAM 2;  3DML A;  4IW9 A;  3VI5 A;  3FZ9 A;  4HQS A;  3HXS A;  5IOX A;  1YEP A;  1TJD A;  4ZB8 A;  2EC4 A;  4GQC A;  4JR4 A;  4PQI A;  2GS3 A;  2WS2 A;  3UMA A;  1O73 A;  2IIY A;  2FA8 A;  2NTO A;  4MF7 A;  2AB6 A;  1MDJ A;  5JCG A;  1OVN A;  1PKW A;  1A0R P;  2N5B A;  3G7J A;  2H6Y A;  4K9Z A;  4CW9 A;  4POM A;  5DAK B;  1SEN A;  4A5P A;  5KN1 A;  3M8N A;  5IO0 A;  5COH A;  4GF0 A;  3F6F A;  4OFM A;  2K8S A;  1K3Y A;  4X43 A;  4IJI A;  2MMN A;  3LXZ A;  2HRK A;  3N5O A;  3IXR A;  2VD0 A;  5IQY A;  4IP1 A;  5G1K A;  1TI3 A;  2CVD A;  4KH7 A;  4V2M A;  3DVX A;  3N9J A;  1J0F A;  5B8A A;  5GZZ B;  2H1D A;  3CSI A;  4DEJ A;  2VAF A;  2C0E A;  4OD7 A;  4WET A;  2IMI A;  5JCW A;  4HI7 A;  10GS A;  2R2J A;  2A2P A;  1V58 A;  4D73 A;  3Q6O A;  4TW5 A;  5L71 A;  3BBY A;  1XCC A;  3CSJ A;  4ZXG A;  2XBQ A;  1LU4 A;  5HFG A;  2GZZ A;  4JRR A;  2WZ9 A;  5ID2 B;  3FK8 A;  4N30 A;  1DE1 A;  4Q5Q A;  2R5G A;  1V57 A;  2FA4 A;  3H1N A;  1BED A;  2DML A;  2NBS A;  2N5F A;  1EZK A;  1TRW A;  3KXO A;  3ZVJ D;  3TJG A;  1XXU A;  1M2B A;  3IK7 A;  3GKN A;  2IN3 A;  3WYW A;  5F8B A;  4XS6 A;  3HJO A;  5ELA A;  1FOH A;  2H74 A;  3HY2 A;  1OAZ A;  3JCM L;  3LYK A;  3GL5 A;  1GSU A;  3IE3 A;  4POK A;  3EC3 A;  2AAW A;  1OC8 A;  2C3Q A;  2ES7 A;  1FB0 A;  2H0I A;  2O87 A;  4KND A;  19GS A;  2LS5 A;  5JWR B;  2C3N A;  1TDI A;  4Z2U A;  1HD2 A;  4K2D A;  3PGT A;  3ZFB A;  4ID0 A;  4N10 A;  1GL8 A;  3HDC A;  4PTS A;  1B4P A;  1GTB A;  3KTL A;  1TI1 A;  3F3Q A;  1FHE A;  3QAW A;  5C04 A;  2VIM A;  1U3A A;  2I9H A;  5DAK A;  2VLV A;  4HU7 A;  2PER A;  1GH2 A;  2OE3 A;  2VCZ A;  3VUR A;  4ZBA A;  2I1U A;  3KM6 A;  5GST A;  3M9J A;  1B4Q A;  4K6X A;  2BJX A;  2B1K A;  4POL A;  12GS A;  3BCI A;  4I97 A;  3C1R A;  1FVK A;  5KOX A;  2H1B A;  3EYT A;  3F8U A;  4K7I A;  3VPQ A;  4MP4 A;  1IYH A;  5IM9 A;  1GNW A;  2ZCT A;  2DJJ A;  1O8W A;  2IPA A;  5D8I A;  5CO3 A;  2A4H A;  2MYG A;  4J2F A;  4I2U A;  3HCZ A;  4TRX A;  1JLW A;  2CVB A;  5ELG A;  2F8A A;  1S3R A;  1T00 A;  4KDY A;  3GMF A;  4JR6 A;  1I5G A;  3KIJ A;  3FKF A;  3TUE A;  3J7Y k;  2PU9 C;  3UL3 A;  2FY6 A;  3QAG A;  1OC9 A;  3GTU B;  5ID2 A;  3HA9 A;  3P8W A;  4MF6 A;  6GSY A;  2P5Q A;  3ZZX A;  5GSS A;  2R0C A;  3NZN A;  4KB3 A;  4OFT A;  5FWG A;  2GT5 A;  2X49 A;  3A2W A;  2E2M A;  2QA2 A;  4XIH A;  4IHU A;  5ENU A;  1M9B A;  2VO4 A;  3A2V A;  4TR1 B;  2WJU A;  18GS A;  3CYN A;  3W6G A;  2FHE A;  4TR0 A;  2GVP A;  5D93 A;  4CDO A;  1K0N A;  3DD3 A;  1Z7R A;  2GST A;  4ILF A;  3D0Z A;  4OCF A;  1SKR B;  1AQX A;  1HYU A;  1U6T A;  5HQP A;  1X5D A;  4MCU A;  2VCV A;  2LNS A;  3VWX A;  2R37 A;  4XS4 B;  5IPH A;  1ZYQ B;  4GQF A;  2JZT A;  4EDY A;  2O85 A;  5HFK A;  3TJJ A;  5AIS A;  1NHY A;  4DSR A;  1ERW A;  5EPF A;  4MJB A;  2YAN A;  5DCH A;  3IR4 A;  2L4Q A;  1T3B A;  4WBJ A;  1S3A A;  5FT3 A;  4Q5F A;  1ERV A;  1QXH A;  2P5R A;  4F03 A;  4JBB A;  1SK0 A;  5DAL B;  4BVX B;  2R0G A;  3EU3 A;  3FYG A;  3TJB A;  1A0F A;  2ON5 A;  3BD2 A;  5A5K A;  3GH6 A;  1MDI A;  4EUY A;  1S3C A;  1OE8 A;  1BQ7 A;  3QMX A;  2VL3 A;  2HSH A;  3TRQ A;  4HZ4 A;  5KN3 A;  3UEM A;  2HNL A;  3EPT A;  1XW5 A;  4K2X A;  1M2D A;  3L0H A;  5CRG A;  3ED3 A;  1EWX A;  4TOP A;  2DJ0 A;  2D2Z A;  4J57 E;  4AGS A;  1JLV A;  1ZZY A;  3LXT A;  2K9F A;  3ZIV A;  4FIW A;  1EGR A;  5IO2 A;  1FO5 A;  3IA1 A;  4QQ7 A;  3KJY A;  3EUR A;  3CSH A;  2HZF A;  5CAX A;  3GTU A;  2G2Q A;  2H0G A;  4G9H A;  2YWM A;  1R4W A;  3UAP A;  4RI7 A;  5DJM A;  2HSM A;  2YN1 A;  3LGC A;  3APO A;  5AIV A;  2JU5 A;  5AN1 A;  4CY8 A;  4JZQ A;  5CRW A;  2A4V A;  1A8Y A;  4KUN A;  4PUR A;  2RM6 A;  1EOH A;  2IL3 A;  1VF2 A;  1TU7 A;  3TDG A;  2JL4 A;  1YKA A;  2LRT A;  3L9V A;  1TXX A;  4KDX A;  2O8V B;  1H75 A;  4KSM A;  2H66 A;  1M99 A;  4MH2 A;  3F9U A;  4XS4 A;  1XVQ A;  4GWR A;  4L0U A;  4EVM A;  3UVT A;  4IEL A;  2KHP A;  3D22 A;  3FR6 A;  2J9H A;  3M3M A;  3MAK A;  3IHQ A;  2LTK A;  3QCP A;  3QPM A;  3NOF A;  2L59 A;  1SL1 B;  4V1A p;  1U88 A;  4O5U A;  1ZOF A;  3TKS E;  2ALB A;  1Y6E A;  5HR2 A;  4NWY A;  5ABR A;  3TKS A;  2KOK A;  3TRX A;  1DBY A;  5DAL A;  5J9C A;  3FZA A;  4BVX A;  2PVQ A;  5A4U A;  4Z2R A;  2YWN A;  2H0H A;  3ME8 A;  6GSV A;  1CQG A;  3L78 A;  4QL9 A;  2H19 A;  1W4V A;  4GCI A;  1EEM A;  3VPT A;  3CXG A;  2H6X A;  1XOA A;  5BRT A;  1J08 A;  2C0F A;  2CX4 A;  17GS A;  5DCG A;  2FNO A;  1FG4 A;  5G2Z A;  4HDE A;  1A2J A;  2DKI A;  1GRX A;  4G0I A;  1QFN A;  4YKF A;  2YJH A;  4LMW A;  2AUV A;  2FCH A;  1XPV A;  5IPG A;  1V2A A;  5LNK e;  1O7U A;  4RI6 A;  1RK4 A;  1PGT A;  2F9S A;  4XCS A;  1XIY A;  3QDN A;  2F3M A;  2YWI A;  2YNX A;  2X99 A;  1PN0 A;  4Q5N A;  3CMI A;  4ICY A;  1EP8 A;  3RPP A;  1K0C A;  4USS A;  2H30 A;  5EY6 A;  3TGZ A;  5LCZ A;  3C1S A;  2A2S A;  4I8B A;  2QGV A;  4WBR D;  1LBK A;  1HNC A;  1U87 A;  1V98 A;  4PUA A;  1TW9 A;  5AGY A;  1PKZ A;  4MA9 A;  1ML6 A;  2PBJ A;  5BMU A;  2P0G A;  3IC4 A;  2MBS A;  1DUG A;  4YQU A;  1GP1 A;  1C72 A;  2VL2 C;  2E0Q A;  2PWJ A;  3QFA C;  4HJ2 A;  3RDW A;  1TK8 B;  5D9X A;  3KMO A;  3H8Q A;  5JCU A;  3C7M A;  1YZX A;  3BJ5 A;  3VI7 A;  4NHW A;  3EE2 A;  2X8H A;  3TCO A;  3FRC A;  5F0G A;  5D96 A;  3ERW A;  1URM A;  3I69 A;  4EO3 A;  3KP9 A;  3VLN A;  4ULX A;  4ISD A;  3O3T A;  1MD4 A;  4IP6 A;  2BTO T;  1T7P B;  5CYY A;  1G6W A;  2WB9 A;  1NW2 A;  2H71 A;  5DQY A;  4PNF A;  2KLX A;  4PQ1 A;  3HZ8 A;  4XTS A;  5B6N A;  4I2T A;  1AUC A;  2QKE A;  3KZQ A;  4ECC A;  4WF4 A;  1K3L A;  3MWH A;  4YQV A;  3E9J B;  4K8M A;  3US3 A;  1SYR A;  2CV4 A;  1E6B A;  2MMO A;  4O5Q A;  4TR4 A;  2C80 A;  4PQH A;  3ISO A;  4O5R A;  1V40 A;  1WMJ A;  3DXB A;  4F9Z A;  1TKD B;  5E59 A;  3GHA A;  1PL1 A;  5ECS A;  1SKS B;  2WGR A;  1F9M A;  2H1G A;  3EU4 A;  2LJR A;  2VM1 A;  2L5L A;  1JZO A;  2H70 A;  1X9M B;  2H8L A;  3D6I A;  2B7K A;  2CAQ A;  4PXO A;  4BIK A;  3HJM A;  2B5Y A;  5JWO B;  5GAP D;  1DSB A;  1U3I A;  4MDC A;  3HJP A;  2L57 A;  2F51 A;  2I3Y A;  3CRT A;  3F0I A;  1F3B A;  1WE0 A;  3DVW A;  5CRH A;  5GAN D;  2LKU A;  2H76 A;  2RII A;  5ECQ B;  5D9T A;  4FH8 A;  1AW9 A;  2JAC A;  3DWV A;  3FW2 A;  2V41 A;  2OE0 A;  2CVK A;  2RLI A;  3UBL A;  2G0F A;  4MZB A;  4X0X A;  2GSS A;  3FMW A;  3FHK A;  4K0G A;  5B6M A;  3MNG A;  4NAX A;  2RUE A;  4V1A g;  3L9U A;  3QR6 A;  2JSZ A;  2C3T A;  2C1Y A;  2EIO A;  2P31 A;  4LMV A;  2MBT A;  1LJR A;  4KA0 A;  4MJC A;  4MMM A;  3GKM A;  1XWK A;  2BMX A;  1AQV A;  4OO5 A;  3H4K A;  2IJY A;  3M9K A;  2FGX A;  1VF3 A;  2K8V A;  1Q4J A;  1PL2 A;  2HYX A;  5IMA A;  5HFI A;  1O6J A;  3E3E A;  4G0K A;  1TTZ A;  2CZ3 A;  1K0B A;  3GUR A;  2VUP A;  6GSS A;  2YWO A;  4L8E A;  5F06 A;  2M72 A;  2YZU A;  5DVB A;  3GKX A;  3UOM A;  2CA8 A;  2OKA A;  20GS A;  1JHB A;  1QGV A;  2YOI A;  1M7T A;  1Z5Y E;  4WR4 A;  2GQK A;  2HRN A;  1BJX A;  1ST9 A;  1N2A A;  4YH2 A;  13GS A;  3ZL5 A;  1SJ6 A;  3GFK A;  4XHM A;  2R0P A;  4BWS A;  2DJ2 A;  1BX9 A;  3IBH A;  3UVH A;  3UAR A;  2FWE A;  1F2E A;  3GUS A;  3DYR A;  2XPD A;  3KCM A;  4E8H A;  1R26 A;  5IMC A;  4X4J A;  5JWQ B;  3WGE A;  3HD5 A;  1T1V A;  3ME7 A;  4AJ6 A;  1DE2 A;  3HKR A;  5H5Q A;  2AYT A;  3VWW A;  2PUK C;  4GST A;  2YP6 A;  2KP2 A;  4HZ2 A;  4K7N A;  3LW9 A;  2JSY A;  3DIE A;  1PN9 A;  1YF1 A;  4LL1 B;  3EVI A;  3TOU A;  3FZ5 A;  3NIV A;  1UA5 A;  2HXK A;  3FEU A;  1ERU A;  3LG6 A;  4N0V A;  4KF9 A;  4FO5 A;  3M0F A;  1YJ6 A;  2QSI A;  1EV9 A;  4ZB9 A;  3ZML A;  3UJ1 A;  2X64 A;  2DMM A;  2WUL A;  2YJ7 A;  1SD9 A;  5D73 A;  4K7O A;  1M9A A;  2HE3 A;  3D5J A;  1X5E A;  4MLY A;  4GSN A;  1Z9H A;  1I9D A;  3R3E A;  1GSF A;  3C73 A;  4KSO A;  1VF1 A;  2HRF A;  1XWG A;  1GWC A;  5D9V A;  4TXO B;  2OA7 A;  3WT1 A;  2V32 A;  2K18 A;  2E2G A;  4Z7X A;  3ZYW A;  1G7E A;  3I9V 2;  1G6Y A;  1EEJ A;  5IMD A;  3WD6 A;  2V6O A;  2GQL A;  1PQN A;  1ZCP A;  4EE0 A;  1ON4 A;  1H4O A;  3EMX A;  1NM3 A;  1BAY A;  1OKT A;  4IJ3 A;  2L6D A;  2GLR A;  4LL4 B;  1VF4 A;  1UVZ A;  4PX1 A;  4HOJ A;  2CZ2 A;  4HSC X;  2VLU A;  2DJ1 A;  5AIX A;  4DSQ A;  5ECR B;  1V9W A;  1O85 A;  3IAS 2;  5ECH B;  1R5A A;  1Z6M A;  1GUM A;  3IOS A;  1TK5 B;  3W8J A;  3ZRE A;  4N11 A;  1PA3 A;  1ACV A;  2C0D A;  9GSS A;  5IIZ A;  1QUW A;  5DDL A;  3KD0 A;  5H5R A;  3LSZ A;  3O76 A;  3EIN A;  1PSQ A;  4GXZ A;  1WRY A;  4TR1 A;  2L4C A;  1YEX A;  3VWV A;  5H5S A;  1XVW A;  3I43 A;  1SYX A;  3TB2 A;  4K5S A;  2VCQ A;  4K1F A;  3RBT A;  4HS1 A;  3F4S A;  1WJK A;  2DJ3 A;  1XBS A;  1WP0 A;  4HQZ A;  4HUA A;  2GZY A;  1ZYE A;  4CY6 A;  1THX A;  2O7K A;  2LRC A;  4TR3 A;  1T4Y A;  5ECN B;  4BWQ A;  1JFU A;  3WGD A;  1HNA A;  1BYE A;  4HU9 A;  3QOU A;  2WFC A;  4V2L A;  2H6Z A;  2DIZ A;  4NHZ A;  2XC2 A;  2OJL A;  3F3R A;  1SJZ A;  4ZL7 A;  2L5O A;  4IN0 A;  2OBK A;  4IKH A;  2YV9 A;  7GSS A;  1OE7 A;  1WOU A;  3J7Y b;  1N8J A;  5CRD A;  1Z7P A;  4OFN A;  5IMV A;  2I81 A;  3FR3 A;  5G31 A;  4ZIL A;  4BVY B;  4IQA A;  2HRA A;  1F3A A;  4WR5 A;  4KGI A;  1AQW A;  3DEX A;  4FYB A;  3UIW A;  5G30 A;  4ZL9 A;  4NMU A;  3A2X A;  4F82 A;  4GSS A;  1WIK A;  5HR0 A;  3DRN A;  5J9B A;  3TKS C;  3P7X A;  3MSZ A;  2GZP A;  3RHB A;  4KE3 A;  3M1G A;  1TRS A;  1B8X A;  4TXO A;  4OWY A;  4DVC A;  1GSS A;  1GSQ A;  5F05 A;  4KCA A;  3C8E A;  2IMF A;  2TRC P;  3GIX A;  1PRX A;  2FLS A;  3LOR A;  2FWG A;  2F8F A;  4BPY A;  4MJA A;  4IQ1 A;  1VGL A;  1GTU A;  3KMN A;  2JZS A;  4ECJ A;  3D4M A;  3HVV A;  4H86 A;  1TK0 B;  4MAB A;  1K0O A;  2QC7 A;  2TRX A;  4LLR A;  1GUL A;  2J23 A;  2B1L A;  3GN3 A;  5KEJ A;  2JZR A;  2OAC A;  5D9W A;  3WT2 A;  4ECB A;  3OR5 A;  3TKP A;  1ZL9 A;  4WXT A;  3KH7 A;  4BA7 A;  4F0C A;  2XPE A;  6GSX A;  3VFI A;  1QQ2 A;  1G7O A;  4O32 A;  1EV4 A;  1A8L A;  2IFQ B;  3ZLP A;  2GQM A;  2LQQ A;  4N0Z A;  3AY8 A;  1MEK A;  2HFD A;  4GRF A;  2M80 A;  2IMD A;  2PVO C;  4TXV A;  3GV1 A;  1KBN A;  4NV5 A;  3TJK A;  3RPN A;  3GST A;  3A5I A;  5J41 A;  3LQ7 A;  2KP1 A;  3V1W A;  1XW6 A;  3PR8 A;  3GL3 A;  1GTI A;  3P90 A;  1KTE A;  4ZBD A;  1ERT A;  2VOC A;  5C00 A;  3KH9 A;  3UBK A;  5CRE A;  5ECL B;  1SL2 B;  4AF2 A;  4JED A;  2XBI A;  1XOB A;  1M3J A;  2VL2 A;  3O6T A;  3A5W A;  2H1A A;  3ZFL A;  3S9F A;  1YY7 A;  4G0L A;  4ZIJ A;  2L6C A;  1A2L A;  3PIN A;  2GSR A;  4ZB6 A;  3QAV A;  3R2Q A;  4MJE A;  1NHO A;  1XWA A;  4I6X A;  2V2G A;  4XRD A;  4KAE A;  3BCK A;  4NXI A;  1IYI A;  3TRP A;  4BVY A;  5KOW A;  2OAD A;  5IMF A;  3ZIJ A;  4G19 A;  2GSQ A;  11GS A;  2TIR A;  2HLS A;  2ZUP A;  2DIY A;  2HSY A;  4EF0 A;  1YQ1 A;  1ZYN A;  1FW1 A;  1OC9 B;  3ZIT A;  1GSD A;  3HVS A;  3IDV A;  1Q98 A;  1XG8 A;  2H72 A;  1SD8 A;  1RQM A;  2PMT A;  3D4T A;  5DJL A;  4PUF C;  4EXJ A;  3G7I A;  1PX7 A;  5ECI B;  2FWH A;  4XS1 A;  3PPU A;  5J4U A;  3G9B A;  2HI7 A;  2GGT A;  1OKD A;  3LYP A;  2EIR A;  1K0M A;  1SKW B;  6GSU A;  4WF5 A;  1XFL A;  1JZW A;  3APS A;  5DQS A;  4F2I A;  3W8S A;  1S3D A;  2JAD A;  4L0W A;  1ZYP A;  3D21 A;  4OCE A;  1YF0 A;  1PD2 1;  1GUH A;  4MNN A;  2FD3 A;  3IK9 A;  4MPG A;  4RUV A;  4TVE A;  2MZC A;  2WDU A;  4I5Q A;  4E8E A;  3RHC A;  2IFQ A;  4FYU A;  1Z6N A;  3KEB A;  4GTU A;  1XWB A;  2GTU A;  2X4A A;  1K0A A;  1GNE A;  4LA1 A;  4DSS B;  3GA4 A;  2X8G A;  2Z9S A;  4MF5 A;  2YCD A;  1TRU A;  2LQO A;  1KNG A;  5A4V A;  2C8U A;  3GH9 A;  1X9S B;  4EL1 A;  2AHE A;  4YKG A;  2VM2 A;  1A23 A;  2WCI A;  4MPF A;  4MZW A;  16GS A;  2YPM A;  3KTB A;  4FYC A;  22GS A;  2CX3 A;  5G5E A;  1M0U A;  4YAV A;  2MMA A;  3QFB C;  1T8E B;  1QK8 A;  5CNW A;  3PH9 A;  5A4W A;  5HR3 A;  2OE1 A;  4KX4 A;  2H01 A;  3LWA A;  5HR1 A;  3IHG A;  3I6A A;  2NPB A;  2FWF A;  1GUK A;  4KW6 A;  3F63 A;  1SK1 A;  3CQF A;  1SU9 A;  4IS0 A;  3EWL A;  4XRA A;  1TP9 A;  3BOA A;  3GYK A;  5KN2 A;  1GSY A;  4RQX A;  3Q74 A;  2HT9 A;  1OC3 A;  3FR9 A;  1M2A A;  3GSS A;  2O89 A;  3E0U A;  2KUC A;  3IRA A;  4TN8 A;  2LJA A;  1F37 A;  4MZC A;  4FQU A;  4OMV A;  4L5O A;  1YKC A;  3HZ4 A;  1R7H A;  3TKR A;  1FB6 A;  2PPT A;  3ZMK A;  4L5L A;  3H79 A;  3GNJ A;  4JE1 A;  3IV4 A;  1E2Y A;  4WKW A;  4G10 A;  1WWJ A;  1AAZ A;  2M46 A;  1G0T A;  2R6K A;  1WPI A;  4K0N A;  1BG5 A;  4EIP A;  2CT6 A;  1K3O A;  1W89 A;  3F6D A;  3KP8 A;  3L4N A;  4AJ7 A;  2YV7 A;  3VK9 A;  2PGT A;  3TJF A;  3GKK A;  1EGO A;  1EOG A;  3GX8 A;  4ZL8 A;  8GSS A;  2HZE B;  3Q19 A;  3DGQ A;  5ECK B;  1T4Z A;  4Q5R A;  1FOV A;  5IOW A;  1GTA A;  1Y25 A;  3Q18 A;  1AC1 A;  3EMP A;  4BL7 B;  4J56 E;  4O7H A;  1VRS D;  3F4R A;  4F0B A;  4OO4 A;  2WRT A;  1R5P A;  1B9X C;  5CP1 A;  2FUG 2;  4DSS A;  4MK3 A;  3ZVJ A;  2GT6 A;  5FHI A;  1CQH A;  5ECM B;  3MYD A;  3GRX A;  4CHS A;  2DSA A;  3APQ A;  4MH3 A;  3LJR A;  4EKZ A;  3FY7 A;  2IME A;  3KGK A;  3WGX A;  1USB A;  1O81 A;  1EP7 A;  3K8N A;  2DC5 A;  3HYP A;  3FZ4 A;  1TRV A;  4IBP A;  4ZBB A;  1ABA A;  3CBU A;  1A24 A;  1FAA A;  3RAZ A;  1ILO A;  6GSW A;  5G1L A;  5DBQ A;  2DJK A;  2IWT A;  3CTG A;  3ZRD A;  5B8B A;  1B48 A;  1HNB A;  1A2M A;  2ZNM A;  1SL0 B;  1B9Y C;  3VWU A;  3F4T A;  2V6K A;  2GDR A;  5EL8 A;  2B5X A;  1NSW A;  1OYJ A;  3A3T A;  2R3X A;  3HHV A;  1YDK A;  4YQM A;  1THO A;  4HJM A;  1JZR A;  2R4V A;  1M3I A;  4IVF A;  3ERF A;  3GX0 A;  3G7Y A;  4G2E A;  2LUS A;  2I4A A;  4KDU A;  1ZMA A;  4ML1 A;  4JU5 A;  2B7J A;  2IMK A;  1K0D A;  1JZD A;  5E4W A;  4TKY A;  2UZ8 A;  4O92 A;  2C0G A;  2LST A;  3MDK A;  3P2A A;  2LJK A;  3U6V A;  3IPZ A;  1XW9 A;  2CQ9 A;  3DKS A;  1MDK A;  3TOT A;  3L9S A;  2REM A;  1PMT A;  1GLP A;  2B6M A;  4EC0 A;  2VCX A;  1Z3E A;  4PNG A;  1KEB A;  2DBC A;  2VCW A;  3MIX A;  4P3Y B;  1X0R A;  5ECP B;  2RUF A;  1AXD A;  1GLQ A;  1O8X A;  2K6V A;  3CTF A;  4IGJ A;  5IMZ A;  2LNT A;  2HZE A;  3C71 A;  2A2R A; 
#chains in the Genus database with same CATH homology
 2H73 A;  3SBC A;  4PGT A;  5EVO A;  2PN8 A;  2OBI A;  3SWL A;  4BL7 A;  5J5N A;  3CRU A;  5INY A;  4POB A;  2N5A A;  2AV4 A;  2V1M A;  3HVX A;  5LD0 A;  4EDZ A;  1SK2 A;  2B5E A;  4KCE A;  4ACS A;  2LV3 A;  3LEF A;  5ECO B;  3TKQ A;  2ON7 A;  1RW1 A;  2E7P A;  4ECI A;  2VL9 A;  2RM5 A;  2DKH A;  2QA1 A;  4D73 B;  2X8C A;  1AIU A;  4HEA 2;  2CAI A;  4NPB A;  3LFL A;  1ZGN A;  2MMZ A;  4QL7 A;  4GLT A;  2VLT A;  2NDO A;  2H75 A;  1MD3 A;  2VCT A;  2LRN A;  1MTC A;  1GSE A;  4EIQ A;  4Z2T A;  3QD9 A;  5B7C A;  3IC8 A;  3H93 A;  2NVL A;  4K5R A;  1UC7 A;  2VD1 A;  1TU8 A;  1FVJ A;  4ML6 A;  3ERG A;  5F07 A;  3U5R E;  4AJ8 A;  1HQO A;  6GST A;  1PX6 A;  1J9B A;  5J3R A;  2C4J A;  1TOF A;  2XHF A;  1UN2 A;  4RQR A;  1XZO A;  2AJQ B;  1X5C A;  4V2N A;  4WEY A;  5G5F A;  1X9W B;  2DLX A;  3ZTL A;  1SJI A;  1QMV A;  1XWC A;  14GS A;  5KN0 A;  2B3S A;  4X1U A;  4YAP A;  2LEG A;  1F6M C;  2EIQ A;  2YZH A;  4NV2 A;  3IAM 2;  3DML A;  4IW9 A;  3VI5 A;  3FZ9 A;  4HQS A;  3HXS A;  5IOX A;  1YEP A;  1TJD A;  4ZB8 A;  2EC4 A;  4GQC A;  4JR4 A;  4PQI A;  2GS3 A;  2WS2 A;  3UMA A;  1O73 A;  2IIY A;  2FA8 A;  2NTO A;  4MF7 A;  2AB6 A;  1MDJ A;  5JCG A;  1OVN A;  1PKW A;  1A0R P;  2N5B A;  3G7J A;  2H6Y A;  4K9Z A;  4CW9 A;  4POM A;  5DAK B;  1SEN A;  4A5P A;  5KN1 A;  3M8N A;  5IO0 A;  5COH A;  4GF0 A;  3F6F A;  4OFM A;  2K8S A;  1K3Y A;  4X43 A;  4IJI A;  2MMN A;  3LXZ A;  2HRK A;  3N5O A;  3IXR A;  2VD0 A;  5IQY A;  4IP1 A;  5G1K A;  1TI3 A;  2CVD A;  4KH7 A;  4V2M A;  3DVX A;  3N9J A;  1J0F A;  5B8A A;  5GZZ B;  2H1D A;  3CSI A;  4DEJ A;  2VAF A;  2C0E A;  4OD7 A;  4WET A;  2IMI A;  5JCW A;  4HI7 A;  10GS A;  2R2J A;  2A2P A;  1V58 A;  4D73 A;  3Q6O A;  4TW5 A;  5L71 A;  3BBY A;  1XCC A;  3CSJ A;  4ZXG A;  2XBQ A;  1LU4 A;  5HFG A;  2GZZ A;  4JRR A;  2WZ9 A;  5ID2 B;  3FK8 A;  4N30 A;  1DE1 A;  4Q5Q A;  2R5G A;  1V57 A;  2FA4 A;  3H1N A;  1BED A;  2DML A;  2NBS A;  2N5F A;  1EZK A;  1TRW A;  3KXO A;  3ZVJ D;  3TJG A;  1XXU A;  1M2B A;  3IK7 A;  3GKN A;  2IN3 A;  3WYW A;  5F8B A;  4XS6 A;  3HJO A;  5ELA A;  1FOH A;  2H74 A;  3HY2 A;  1OAZ A;  3JCM L;  3LYK A;  3GL5 A;  1GSU A;  3IE3 A;  4POK A;  3EC3 A;  2AAW A;  1OC8 A;  2C3Q A;  2ES7 A;  1FB0 A;  2H0I A;  2O87 A;  4KND A;  19GS A;  2LS5 A;  5JWR B;  2C3N A;  1TDI A;  4Z2U A;  1HD2 A;  4K2D A;  3PGT A;  3ZFB A;  4ID0 A;  4N10 A;  1GL8 A;  3HDC A;  4PTS A;  1B4P A;  1GTB A;  3KTL A;  1TI1 A;  3F3Q A;  1FHE A;  3QAW A;  5C04 A;  2VIM A;  1U3A A;  2I9H A;  5DAK A;  2VLV A;  4HU7 A;  2PER A;  1GH2 A;  2OE3 A;  2VCZ A;  3VUR A;  4ZBA A;  2I1U A;  3KM6 A;  5GST A;  3M9J A;  1B4Q A;  4K6X A;  2BJX A;  2B1K A;  4POL A;  12GS A;  3BCI A;  4I97 A;  3C1R A;  1FVK A;  5KOX A;  2H1B A;  3EYT A;  3F8U A;  4K7I A;  3VPQ A;  4MP4 A;  1IYH A;  5IM9 A;  1GNW A;  2ZCT A;  2DJJ A;  1O8W A;  2IPA A;  5D8I A;  5CO3 A;  2A4H A;  2MYG A;  4J2F A;  4I2U A;  3HCZ A;  4TRX A;  1JLW A;  2CVB A;  5ELG A;  2F8A A;  1T00 A;  4KDY A;  3GMF A;  4JR6 A;  1I5G A;  3KIJ A;  3FKF A;  3TUE A;  3J7Y k;  2PU9 C;  3UL3 A;  2FY6 A;  3QAG A;  1OC9 A;  3GTU B;  5ID2 A;  3HA9 A;  3P8W A;  4MF6 A;  6GSY A;  2P5Q A;  3ZZX A;  5GSS A;  2R0C A;  3NZN A;  4KB3 A;  4OFT A;  5FWG A;  2GT5 A;  2X49 A;  3A2W A;  2E2M A;  2QA2 A;  4XIH A;  4IHU A;  5ENU A;  1M9B A;  2VO4 A;  3A2V A;  4TR1 B;  2WJU A;  18GS A;  3CYN A;  3W6G A;  2FHE A;  4TR0 A;  2GVP A;  5D93 A;  4CDO A;  1K0N A;  3DD3 A;  1Z7R A;  2GST A;  4ILF A;  3D0Z A;  4OCF A;  1SKR B;  1AQX A;  1HYU A;  1U6T A;  5HQP A;  1X5D A;  4MCU A;  2VCV A;  2LNS A;  3VWX A;  2R37 A;  4XS4 B;  5IPH A;  1ZYQ B;  4GQF A;  2JZT A;  4EDY A;  2O85 A;  5HFK A;  3TJJ A;  5AIS A;  1NHY A;  4DSR A;  1ERW A;  5EPF A;  4MJB A;  2YAN A;  5DCH A;  3IR4 A;  2L4Q A;  1T3B A;  4WBJ A;  1S3A A;  5FT3 A;  4Q5F A;  1ERV A;  1QXH A;  2P5R A;  4F03 A;  4JBB A;  1SK0 A;  5DAL B;  4BVX B;  2R0G A;  3EU3 A;  3FYG A;  3TJB A;  1A0F A;  2ON5 A;  3BD2 A;  5A5K A;  3GH6 A;  1MDI A;  4EUY A;  1S3C A;  1OE8 A;  1BQ7 A;  3QMX A;  2VL3 A;  2HSH A;  3TRQ A;  4HZ4 A;  5KN3 A;  3UEM A;  2HNL A;  3EPT A;  1XW5 A;  4K2X A;  1M2D A;  3L0H A;  5CRG A;  3ED3 A;  1EWX A;  4TOP A;  2DJ0 A;  2D2Z A;  4J57 E;  4AGS A;  1JLV A;  1ZZY A;  3LXT A;  2K9F A;  3ZIV A;  4FIW A;  1EGR A;  5IO2 A;  1FO5 A;  3IA1 A;  4QQ7 A;  3KJY A;  3EUR A;  3CSH A;  2HZF A;  5CAX A;  3GTU A;  2G2Q A;  2H0G A;  4G9H A;  2YWM A;  1R4W A;  3UAP A;  4RI7 A;  5DJM A;  2HSM A;  2YN1 A;  3LGC A;  3APO A;  5AIV A;  2JU5 A;  5AN1 A;  4CY8 A;  4JZQ A;  5CRW A;  2A4V A;  1A8Y A;  4KUN A;  4PUR A;  2RM6 A;  1EOH A;  2IL3 A;  1VF2 A;  1TU7 A;  3TDG A;  2JL4 A;  1YKA A;  2LRT A;  3L9V A;  1TXX A;  4KDX A;  2O8V B;  1H75 A;  4KSM A;  2H66 A;  1M99 A;  4MH2 A;  3F9U A;  4XS4 A;  1XVQ A;  4GWR A;  4L0U A;  4EVM A;  3UVT A;  4IEL A;  2KHP A;  3D22 A;  3FR6 A;  2J9H A;  3M3M A;  3MAK A;  3IHQ A;  2LTK A;  3QCP A;  3QPM A;  3NOF A;  2L59 A;  1SL1 B;  4V1A p;  1U88 A;  4O5U A;  1ZOF A;  3TKS E;  2ALB A;  1Y6E A;  5HR2 A;  4NWY A;  5ABR A;  3TKS A;  2KOK A;  3TRX A;  1DBY A;  5DAL A;  5J9C A;  3FZA A;  4BVX A;  2PVQ A;  5A4U A;  4Z2R A;  2YWN A;  2H0H A;  3ME8 A;  6GSV A;  1CQG A;  3L78 A;  4QL9 A;  2H19 A;  1W4V A;  4GCI A;  1EEM A;  3VPT A;  3CXG A;  2H6X A;  1XOA A;  5BRT A;  1J08 A;  2C0F A;  2CX4 A;  17GS A;  5DCG A;  2FNO A;  1FG4 A;  5G2Z A;  4HDE A;  1A2J A;  2DKI A;  1GRX A;  4G0I A;  1QFN A;  4YKF A;  2YJH A;  4LMW A;  2AUV A;  2FCH A;  1XPV A;  5IPG A;  1V2A A;  5LNK e;  1O7U A;  4RI6 A;  1RK4 A;  1PGT A;  2F9S A;  4XCS A;  1XIY A;  3QDN A;  2F3M A;  2YWI A;  2YNX A;  2X99 A;  1PN0 A;  4Q5N A;  3CMI A;  4ICY A;  1EP8 A;  3RPP A;  1K0C A;  4USS A;  2H30 A;  5EY6 A;  3TGZ A;  5LCZ A;  3C1S A;  2A2S A;  4I8B A;  2QGV A;  4WBR D;  1LBK A;  1HNC A;  1U87 A;  1V98 A;  4PUA A;  1TW9 A;  5AGY A;  1PKZ A;  4MA9 A;  1ML6 A;  2PBJ A;  5BMU A;  2P0G A;  3IC4 A;  2MBS A;  1DUG A;  4YQU A;  1GP1 A;  1C72 A;  2VL2 C;  2E0Q A;  2PWJ A;  3QFA C;  4HJ2 A;  3RDW A;  1TK8 B;  5D9X A;  3KMO A;  3H8Q A;  5JCU A;  3C7M A;  1YZX A;  3BJ5 A;  3VI7 A;  4NHW A;  3EE2 A;  2X8H A;  3TCO A;  3FRC A;  5F0G A;  5D96 A;  3ERW A;  1URM A;  3I69 A;  4EO3 A;  3KP9 A;  3VLN A;  4ULX A;  4ISD A;  3O3T A;  1MD4 A;  4IP6 A;  2BTO T;  1T7P B;  5CYY A;  1G6W A;  2WB9 A;  1NW2 A;  2H71 A;  5DQY A;  4PNF A;  2KLX A;  4PQ1 A;  3HZ8 A;  4XTS A;  5B6N A;  4I2T A;  1AUC A;  2QKE A;  3KZQ A;  4ECC A;  4WF4 A;  1K3L A;  3MWH A;  4YQV A;  3E9J B;  4K8M A;  3US3 A;  1SYR A;  2CV4 A;  1E6B A;  2MMO A;  4O5Q A;  4TR4 A;  2C80 A;  4PQH A;  3ISO A;  4O5R A;  1V40 A;  1WMJ A;  3DXB A;  4F9Z A;  1TKD B;  5E59 A;  3GHA A;  1PL1 A;  5ECS A;  1SKS B;  2WGR A;  1F9M A;  2H1G A;  3EU4 A;  2LJR A;  2VM1 A;  2L5L A;  1JZO A;  2H70 A;  1X9M B;  2H8L A;  3D6I A;  2B7K A;  2CAQ A;  4PXO A;  3HJM A;  2B5Y A;  5JWO B;  5GAP D;  1DSB A;  1U3I A;  4MDC A;  3HJP A;  2L57 A;  2F51 A;  2I3Y A;  3CRT A;  3F0I A;  1F3B A;  1WE0 A;  3DVW A;  5CRH A;  5GAN D;  2LKU A;  2H76 A;  2RII A;  5ECQ B;  5D9T A;  4FH8 A;  1AW9 A;  2JAC A;  3DWV A;  3FW2 A;  2V41 A;  2OE0 A;  2CVK A;  2RLI A;  3UBL A;  2G0F A;  4MZB A;  4X0X A;  2GSS A;  3FMW A;  3FHK A;  4K0G A;  5B6M A;  3MNG A;  4NAX A;  2RUE A;  4V1A g;  3L9U A;  3QR6 A;  2JSZ A;  2C3T A;  2C1Y A;  2EIO A;  2P31 A;  4LMV A;  2MBT A;  1LJR A;  4KA0 A;  4MJC A;  4MMM A;  3GKM A;  1XWK A;  2BMX A;  1AQV A;  4OO5 A;  3H4K A;  2IJY A;  3M9K A;  2FGX A;  1VF3 A;  2K8V A;  1Q4J A;  1PL2 A;  2HYX A;  5IMA A;  5HFI A;  1O6J A;  3E3E A;  4G0K A;  1TTZ A;  2CZ3 A;  1K0B A;  3GUR A;  2VUP A;  6GSS A;  2YWO A;  4L8E A;  5F06 A;  2M72 A;  2YZU A;  5DVB A;  3GKX A;  3UOM A;  2CA8 A;  2OKA A;  20GS A;  1JHB A;  1QGV A;  2YOI A;  1M7T A;  1Z5Y E;  4WR4 A;  2GQK A;  2HRN A;  1BJX A;  1ST9 A;  1N2A A;  4YH2 A;  13GS A;  3ZL5 A;  1SJ6 A;  3GFK A;  4XHM A;  2R0P A;  4BWS A;  2DJ2 A;  1BX9 A;  3IBH A;  3UVH A;  3UAR A;  2FWE A;  1F2E A;  3GUS A;  3DYR A;  2XPD A;  3KCM A;  4E8H A;  1R26 A;  5IMC A;  4X4J A;  5JWQ B;  3WGE A;  3HD5 A;  1T1V A;  3ME7 A;  4AJ6 A;  1DE2 A;  3HKR A;  5H5Q A;  2AYT A;  3VWW A;  2PUK C;  4GST A;  2YP6 A;  2KP2 A;  4HZ2 A;  4K7N A;  3LW9 A;  2JSY A;  3DIE A;  1PN9 A;  1YF1 A;  4LL1 B;  3EVI A;  3TOU A;  3FZ5 A;  3NIV A;  1UA5 A;  2HXK A;  3FEU A;  1ERU A;  3LG6 A;  4N0V A;  4KF9 A;  4FO5 A;  3M0F A;  1YJ6 A;  2QSI A;  1EV9 A;  4ZB9 A;  3ZML A;  3UJ1 A;  2X64 A;  2DMM A;  2WUL A;  2YJ7 A;  1SD9 A;  5D73 A;  4K7O A;  1M9A A;  2HE3 A;  3D5J A;  1X5E A;  4MLY A;  4GSN A;  1Z9H A;  1I9D A;  3R3E A;  1GSF A;  3C73 A;  4KSO A;  1VF1 A;  2HRF A;  1XWG A;  1GWC A;  5D9V A;  4TXO B;  2OA7 A;  3WT1 A;  2V32 A;  2K18 A;  2E2G A;  4Z7X A;  3ZYW A;  1G7E A;  3I9V 2;  1G6Y A;  1EEJ A;  5IMD A;  3WD6 A;  2V6O A;  2GQL A;  1PQN A;  1ZCP A;  4EE0 A;  1ON4 A;  1H4O A;  3EMX A;  1NM3 A;  1BAY A;  1OKT A;  4IJ3 A;  2L6D A;  2GLR A;  4LL4 B;  1VF4 A;  1UVZ A;  4PX1 A;  4HOJ A;  2CZ2 A;  2VLU A;  2DJ1 A;  5AIX A;  4DSQ A;  5ECR B;  1V9W A;  1O85 A;  3IAS 2;  5ECH B;  1R5A A;  1Z6M A;  1GUM A;  3IOS A;  1TK5 B;  3W8J A;  3ZRE A;  4N11 A;  1PA3 A;  1ACV A;  2C0D A;  9GSS A;  5IIZ A;  1QUW A;  5DDL A;  3KD0 A;  5H5R A;  3LSZ A;  3O76 A;  3EIN A;  1PSQ A;  4GXZ A;  1WRY A;  4TR1 A;  2L4C A;  1YEX A;  3VWV A;  5H5S A;  1XVW A;  3I43 A;  1SYX A;  3TB2 A;  4K5S A;  2VCQ A;  4K1F A;  3RBT A;  4HS1 A;  3F4S A;  1WJK A;  2DJ3 A;  1XBS A;  1WP0 A;  4HQZ A;  4HUA A;  2GZY A;  1ZYE A;  4CY6 A;  1THX A;  2O7K A;  2LRC A;  4TR3 A;  1T4Y A;  5ECN B;  4BWQ A;  1JFU A;  3WGD A;  1HNA A;  1BYE A;  4HU9 A;  3QOU A;  2WFC A;  4V2L A;  2H6Z A;  2DIZ A;  4NHZ A;  2XC2 A;  2OJL A;  3F3R A;  1SJZ A;  4ZL7 A;  2L5O A;  4IN0 A;  2OBK A;  4IKH A;  2YV9 A;  7GSS A;  1OE7 A;  1WOU A;  3J7Y b;  1N8J A;  5CRD A;  1Z7P A;  4OFN A;  5IMV A;  2I81 A;  3FR3 A;  5G31 A;  4ZIL A;  4BVY B;  4IQA A;  2HRA A;  1F3A A;  4WR5 A;  4KGI A;  1AQW A;  3DEX A;  4FYB A;  3UIW A;  5G30 A;  4ZL9 A;  4NMU A;  3A2X A;  4F82 A;  4GSS A;  1WIK A;  5HR0 A;  3DRN A;  5J9B A;  3TKS C;  3P7X A;  3MSZ A;  2GZP A;  3RHB A;  4KE3 A;  3M1G A;  1TRS A;  1B8X A;  4TXO A;  4OWY A;  4DVC A;  1GSS A;  1GSQ A;  5F05 A;  4KCA A;  3C8E A;  2IMF A;  2TRC P;  3GIX A;  1PRX A;  2FLS A;  3LOR A;  2FWG A;  2F8F A;  4BPY A;  4MJA A;  4IQ1 A;  1VGL A;  1GTU A;  3KMN A;  2JZS A;  4ECJ A;  3D4M A;  3HVV A;  4H86 A;  1TK0 B;  4MAB A;  1K0O A;  2QC7 A;  2TRX A;  4LLR A;  1GUL A;  2J23 A;  2B1L A;  3GN3 A;  5KEJ A;  2JZR A;  2OAC A;  5D9W A;  3WT2 A;  4ECB A;  3OR5 A;  3TKP A;  1ZL9 A;  4WXT A;  3KH7 A;  4BA7 A;  4F0C A;  2XPE A;  6GSX A;  3VFI A;  1QQ2 A;  1G7O A;  4O32 A;  1EV4 A;  1A8L A;  2IFQ B;  3ZLP A;  2GQM A;  2LQQ A;  4N0Z A;  3AY8 A;  1MEK A;  2HFD A;  4GRF A;  2M80 A;  2IMD A;  2PVO C;  4TXV A;  3GV1 A;  1KBN A;  4NV5 A;  3TJK A;  3RPN A;  3GST A;  3A5I A;  5J41 A;  3LQ7 A;  2KP1 A;  3V1W A;  1XW6 A;  3PR8 A;  3GL3 A;  1GTI A;  3P90 A;  1KTE A;  4ZBD A;  1ERT A;  2VOC A;  5C00 A;  3KH9 A;  3UBK A;  5CRE A;  5ECL B;  1SL2 B;  4AF2 A;  4JED A;  2XBI A;  1XOB A;  2VL2 A;  3O6T A;  3A5W A;  2H1A A;  3ZFL A;  3S9F A;  1YY7 A;  4G0L A;  4ZIJ A;  2L6C A;  1A2L A;  3PIN A;  2GSR A;  4ZB6 A;  3QAV A;  3R2Q A;  4MJE A;  1NHO A;  1XWA A;  4I6X A;  2V2G A;  4XRD A;  4KAE A;  3BCK A;  4NXI A;  1IYI A;  3TRP A;  4BVY A;  5KOW A;  2OAD A;  5IMF A;  3ZIJ A;  4G19 A;  2GSQ A;  11GS A;  2TIR A;  2HLS A;  2ZUP A;  2DIY A;  2HSY A;  4EF0 A;  1YQ1 A;  1ZYN A;  1FW1 A;  1OC9 B;  3ZIT A;  1GSD A;  3HVS A;  3IDV A;  1Q98 A;  2H72 A;  1SD8 A;  1RQM A;  2PMT A;  3D4T A;  5DJL A;  4PUF C;  4EXJ A;  3G7I A;  1PX7 A;  5ECI B;  2FWH A;  4XS1 A;  3PPU A;  5J4U A;  3G9B A;  2HI7 A;  2GGT A;  1OKD A;  3LYP A;  2EIR A;  1K0M A;  1SKW B;  6GSU A;  4WF5 A;  1XFL A;  1JZW A;  3APS A;  5DQS A;  4F2I A;  3W8S A;  1S3D A;  2JAD A;  4L0W A;  1ZYP A;  3D21 A;  4OCE A;  1YF0 A;  1PD2 1;  1GUH A;  4MNN A;  2FD3 A;  3IK9 A;  4MPG A;  4RUV A;  4TVE A;  2MZC A;  2WDU A;  4I5Q A;  4E8E A;  3RHC A;  2IFQ A;  4FYU A;  1Z6N A;  3KEB A;  4GTU A;  1XWB A;  2GTU A;  2X4A A;  1K0A A;  1GNE A;  4LA1 A;  4DSS B;  3GA4 A;  2X8G A;  2Z9S A;  4MF5 A;  2YCD A;  1TRU A;  2LQO A;  1KNG A;  5A4V A;  2C8U A;  3GH9 A;  1X9S B;  4EL1 A;  2AHE A;  4YKG A;  2VM2 A;  1A23 A;  2WCI A;  4MPF A;  4MZW A;  16GS A;  2YPM A;  3KTB A;  4FYC A;  22GS A;  2CX3 A;  5G5E A;  1M0U A;  4YAV A;  2MMA A;  3QFB C;  1T8E B;  1QK8 A;  5CNW A;  3PH9 A;  5A4W A;  5HR3 A;  2OE1 A;  4KX4 A;  2H01 A;  3LWA A;  5HR1 A;  3IHG A;  3I6A A;  2NPB A;  2FWF A;  1GUK A;  4KW6 A;  3F63 A;  1SK1 A;  1SU9 A;  4IS0 A;  3EWL A;  4XRA A;  1TP9 A;  3BOA A;  3GYK A;  5KN2 A;  1GSY A;  4RQX A;  3Q74 A;  2HT9 A;  1OC3 A;  3FR9 A;  1M2A A;  3GSS A;  2O89 A;  3E0U A;  2KUC A;  3IRA A;  4TN8 A;  2LJA A;  1F37 A;  4MZC A;  4FQU A;  4OMV A;  4L5O A;  1YKC A;  3HZ4 A;  1R7H A;  3TKR A;  1FB6 A;  2PPT A;  3ZMK A;  4L5L A;  3H79 A;  3GNJ A;  4JE1 A;  3IV4 A;  1E2Y A;  4WKW A;  4G10 A;  1WWJ A;  1AAZ A;  2M46 A;  1G0T A;  2R6K A;  1WPI A;  4K0N A;  1BG5 A;  4EIP A;  2CT6 A;  1K3O A;  1W89 A;  3F6D A;  3KP8 A;  3L4N A;  4AJ7 A;  2YV7 A;  3VK9 A;  2PGT A;  3TJF A;  3GKK A;  1EGO A;  1EOG A;  3GX8 A;  4ZL8 A;  8GSS A;  2HZE B;  3Q19 A;  3DGQ A;  5ECK B;  1T4Z A;  4Q5R A;  1FOV A;  5IOW A;  1GTA A;  1Y25 A;  3Q18 A;  1AC1 A;  3EMP A;  4BL7 B;  4J56 E;  4O7H A;  1VRS D;  3F4R A;  4F0B A;  4OO4 A;  2WRT A;  1R5P A;  1B9X C;  5CP1 A;  2FUG 2;  4DSS A;  4MK3 A;  3ZVJ A;  2GT6 A;  5FHI A;  1CQH A;  5ECM B;  3MYD A;  3GRX A;  4CHS A;  2DSA A;  3APQ A;  4MH3 A;  3LJR A;  4EKZ A;  3FY7 A;  2IME A;  3KGK A;  3WGX A;  1USB A;  1O81 A;  1EP7 A;  3K8N A;  2DC5 A;  3HYP A;  3FZ4 A;  1TRV A;  4IBP A;  4ZBB A;  1ABA A;  3CBU A;  1A24 A;  1FAA A;  3RAZ A;  1ILO A;  6GSW A;  5G1L A;  5DBQ A;  2DJK A;  2IWT A;  3CTG A;  3ZRD A;  5B8B A;  1B48 A;  1HNB A;  1A2M A;  2ZNM A;  1SL0 B;  1B9Y C;  3VWU A;  3F4T A;  2V6K A;  2GDR A;  5EL8 A;  2B5X A;  1NSW A;  1OYJ A;  3A3T A;  2R3X A;  3HHV A;  1YDK A;  4YQM A;  1THO A;  4HJM A;  1JZR A;  2R4V A;  4IVF A;  3ERF A;  3GX0 A;  3G7Y A;  4G2E A;  2LUS A;  2I4A A;  4KDU A;  1ZMA A;  4ML1 A;  4JU5 A;  2B7J A;  2IMK A;  1K0D A;  1JZD A;  5E4W A;  4TKY A;  2UZ8 A;  4O92 A;  2C0G A;  2LST A;  3MDK A;  3P2A A;  2LJK A;  3U6V A;  3IPZ A;  1XW9 A;  2CQ9 A;  3DKS A;  1MDK A;  3TOT A;  3L9S A;  2REM A;  1PMT A;  1GLP A;  2B6M A;  4EC0 A;  2VCX A;  1Z3E A;  4PNG A;  1KEB A;  2DBC A;  2VCW A;  3MIX A;  4P3Y B;  1X0R A;  5ECP B;  2RUF A;  1AXD A;  1GLQ A;  1O8X A;  2K6V A;  3CTF A;  4IGJ A;  5IMZ A;  2LNT A;  2HZE A;  3C71 A;  2A2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...