4POMA

Crystal structures of thioredoxin with mesna at 1.85a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
107
structure length
107
Chain Sequence
GTMVKQIESKTAFQKALKAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKKKLEATINKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title BNP7787 Forms Novel Covalent Adducts on Human Thioredoxin and Modulates Thioredoxin Activity
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 37
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4pomA00
3SBCA 1YY7A 2C3NA 3Q18A 2E0QA 3FZAA 1NM3A 4K9ZA 2AHEA 1Y25A 4MA9A 1R5AA 2VO4A 1SD9A 1GUMA 5J5NA 2EIRA 3D5JA 5HR1A 3KP8A 3QAVA 1GSEA 2DLXA 1WRYA 4GQFA 1M9AA 4ZBDA 4RQRA 4XIHA 3TUEA 3VWWA 3ZVJD 4N11A 1A0RP 1PSQA 3GTUA 3TRXA 3L4NA 1VF4A 4TR1A 1A2LA 2WULA 2C80A 3HJMA 5ECLB 1ERUA 5LNKe 1MDKA 2X99A 4N10A 2K18A 3TKQA 5IOXA 1EEJA 4NHZA 4Q5QA 4KUNA 1F3BA 3GYKA 3GSSA 3FR3A 1SYRA 3TRQA 4POLA 1AQWA 4GSTA 1W4VA 2L5OA 4TRXA 4IW9A 1FVKA 4O92A 1YDKA 3L9SA 3F4SA 2LEGA 4H86A 2AJQB 3DGQA 3KP9A 1KTEA 6GSUA 3FW2A 1NHOA 5E4WA 3CRTA 3KGKA 3P2AA 2A4VA 5G5FA 5EY6A 3GFKA 4GTUA 3EWLA 3QDNA 2I81A 2YJ7A 1UVZA 2H70A 4NMUA 3C8EA 1PMTA 3KXOA 1XW5A 3VPTA 4XCSA 1A8LA 4ACSA 1S3AA 4ID0A 3EVIA 4MH3A 3G7IA 2I9HA 2XBQA 3PGTA 4JBBA 1XWBA 3PH9A 4WF5A 5J9CA 2B6MA 4XS6A 3F6DA 5B8BA 5IOWA 4DSQA 4KA0A 1MD4A 3IA1A 4E8EA 3VURA 2BJXA 1NW2A 2X8GA 4ZIJA 5D9VA 2AAWA 4KAEA 4ECBA 1ABAA 2YWNA 2B1LA 5F07A 4ECJA 1HD2A 5G1KA 2MMAA 4MF6A 1LU4A 4POKA 1SK2A 3HJOA 4HU9A 2H30A 5B6MA 3QD9A 2O89A 3RHCA 3Q6OA 1SKSB 4HUAA 3L78A 2CT6A 4KDXA 2LUSA 3TOTA 4MF7A 4KH7A 1PKZA 1B4QA 3TKSE 3F3QA 2RM6A 1HNAA 1T4YA 4IP6A 4TXVA 1EGOA 5HFIA 2B5YA 4IQ1A 4V1Ag 1S3DA 1O8WA 1ERVA 3UBKA 2A2RA 2YN1A 5CRWA 2OBKA 4JR4A 3UEMA 4XRDA 3TCOA 1YZXA 2WZ9A 2VCTA 2DMMA 4MZBA 2H72A 3ZL5A 4HJ2A 2LNSA 5LCZA 1MD3A 2FWFA 3QFAC 4WF4A 2LRTA 3DVWA 3G7JA 4MH2A 3UVTA 4XS4A 3CSJA 5D96A 2PMTA 3G9BA 1R26A 4J57E 1SL2B 4Q5FA 1U87A 12GSA 1TK0B 3DVXA 4NV5A 3ZITA 3D0ZA 5IO0A 1X9SB 2VAFA 2VL2A 1QMVA 1GSFA 2LJRA 5DQYA 4MF5A 4ISDA 3LJRA 4WR5A 1GSYA 3WGDA 2I1UA 1K0OA 2L59A 5COHA 1F6MC 1BEDA 1K0DA 2CA8A 4ML1A 3KTLA 5DAKA 2BMXA 14GSA 3A5WA 5J9BA 4MCUA 4ULXA 1TRWA 1HYUA 2L4QA 2PERA 1EOGA 3LXZA 1K0CA 5J4UA 3LGCA 4RI7A 1EV9A 5DALB 3ZRDA 3R2QA 1N8JA 1ZCPA 2PBJA 1SJIA 2M46A 3F63A 1XFLA 2E2MA 1F2EA 3ZFLA 4IHUA 4GRFA 5IPGA 1SU9A 2MZCA 1V58A 4MP4A 4G9HA 3GH6A 2PPTA 5ECSA 5H5SA 4AJ8A 3H1NA 4HU7A 3U6VA 3N5OA 2GDRA 1GNWA 4AJ6A 5DQSA 3F4TA 1U3AA 2ON7A 3QCPA 1XCCA 2RIIA 4LL4B 1V9WA 1EGRA 3ME8A 1W89A 3GL5A 3RBTA 5HR0A 4I2UA 3WD6A 6GSSA 2HFDA 2HRNA 8GSSA 1ERWA 1VF3A 1Z3EA 2GQKA 2AUVA 2YP6A 1GULA 1FW1A 3VWUA 5DCHA 1Z9HA 4ZILA 2C1YA 5IMAA 2OA7A 1EP8A 1R5PA 5J3RA 2FCHA 2PVOC 5A5KA 5DBQA 2N5BA 1TRVA 4PURA 1WPIA 3QPMA 3EURA 3IHQA 2XBIA 1QQ2A 5EVOA 5IMDA 1K0AA 3LSZA 1Z6MA 2YWMA 3QAWA 2C0DA 1SD8A 1BX9A 4CHSA 1TRSA 2GSTA 2YPMA 3EU4A 3D22A 4G19A 3L0HA 2DJ2A 1XBSA 2FNOA 2CV4A 1ML6A 1X5EA 2PVQA 4JE1A 3UL3A 5B6NA 5H5RA 1GNEA 2G0FA 3D4MA 3KEBA 4D73A 2H6YA 1SK1A 1X9WB 2FA8A 3L9VA 3ZYWA 4MZCA 4IVFA 3MDKA 3TKSA 4ZL7A 1GTUA 2VOCA 2WRTA 1GTIA 4XRAA 4V2LA 5CRGA 5D9TA 1VF2A 1T1VA 2IFQB 5HFGA 2R5GA 3IOSA 1V2AA 1SL0B 2VCQA 3LYPA 2OACA 3TOUA 4ZXGA 3M1GA 4TXOB 4AF2A 3HA9A 1O8XA 3O3TA 1K3YA 2DIZA 2H0GA 2K9FA 1M2DA 3C1SA 1V40A 1Y6EA 3GN3A 4GQCA 5ID2B 4LLRA 2HZEB 4DSRA 5KN1A 5G31A 4J2FA 4K0NA 4AGSA 4K7IA 1M99A 1WOUA 5JCGA 11GSA 5IO2A 4JEDA 4HDEA 2LJKA 3VWVA 1KEBA 4F2IA 2JACA 1T00A 2DJ1A 2XHFA 2GS3A 3GUSA 1MDJA 5ELAA 1YKAA 1U6TA 1PN9A 3GKXA 4FIWA 1GSQA 3I69A 1BQ7A 4PQIA 2YNXA 1TU8A 2IJYA 3O6TA 17GSA 2R6KA 3KH7A 1OKTA 2OADA 5AN1A 1SL1B 3TB2A 3LXTA 5A4UA 9GSSA 4LA1A 1PX6A 2VL9A 2AYTA 5LD0A 20GSA 1OKDA 1XVQA 2L5LA 2GVPA 7GSSA 3FK8A 3C71A 1A2MA 3RDWA 1T8EB 2RUEA 1YF0A 4DVCA 3IK9A 1XW9A 1PGTA 3ERGA 3QAGA 5IM9A 2YJHA 1WP0A 5G1LA 4MPFA 1K0NA 3P8WA 1DE1A 3WT1A 1TU7A 1GH2A 2DJ3A 2V1MA 5GAPD 1G0TA 3CSHA 2H0IA 4HQSA 3PINA 2JZRA 1ZZYA 1XPVA 2H6XA 2DJ0A 4LMWA 3LFLA 4V2MA 5F0GA 3CYNA 4QL9A 1I5GA 3J7Yb 2FA4A 2KLXA 4FH8A 2MBTA 3E9JB 4F9ZA 1X9MB 3LYKA 4KX4A 4MZWA 3C1RA 2LKUA 3KZQA 1XWCA 3D4TA 1USBA 2FLSA 5AISA 2YZUA 4TR3A 3WGXA 5IMVA 1XZOA 3ISOA 1DUGA 1QUWA 5GSSA 4TOPA 2R2JA 2HNLA 2NBSA 4NAXA 4YQVA 4ZB8A 10GSA 4EXJA 4IN0A 2K8SA 4K7NA 3GKMA 1ZYQB 1PL1A 5A4WA 1WWJA 1SYXA 3HKRA 3TGZA 4OO4A 3EC3A 4G2EA 2Z9SA 4K1FA 2V41A 2L6DA 1RQMA 4DSSB 2C0GA 4QQ7A 4EDYA 2M80A 1SJ6A 5DVBA 4O5RA 5CREA 1JLWA 2V6KA 1JZOA 1GLPA 1YJ6A 4IS0A 2LNTA 2CAIA 3GSTA 1XVWA 2BTOT 2C3TA 2OBIA 2B5EA 4EF0A 3GURA 1FHEA 1JZDA 3ZIVA 4P3YB 3IRAA 1SJZA 2LSTA 2ES7A 2FGXA 3GV1A 2RLIA 4POBA 5IMFA 2GT6A 4X43A 1O73A 2KOKA 4WKWA 3LQ7A 4HS1A 3GTUB 3HY2A 4WETA 4MDCA 3DKSA 2VLUA 2VLVA 4TR1B 4GF0A 1ZYEA 3GIXA 2GLRA 3F9UA 1ZL9A 1GSUA 3NIVA 4OWYA 1LJRA 3M8NA 4TKYA 3D6IA 4K8MA 2O87A 2WB9A 1Z7PA 3H4KA 2OJLA 1OE8A 3UIWA 4EKZA 1DSBA 4YQMA 2P0GA 2N5AA 1OE7A 3FEUA 1VGLA 3ZMLA 1LBKA 5GSTA 4BA7A 2LQOA 1EOHA 1F37A 3W6GA 4I97A 2F8FA 1XW6A 4YAVA 2GT5A 1RW1A 2CZ2A 2E7PA 2C0FA 5ECPB 2IMDA 5F8BA 4QL7A 5DJLA 3AY8A 1F3AA 1R7HA 3F8UA 1TW9A 1B48A 3U5RE 4JU5A 2P5QA 2WFCA 6GSXA 2HXKA 4OFMA 3BBYA 2XC2A 1U88A 3EMXA 5FHIA 2KUCA 4ZL9A 3UAPA 4HQZA 3TJKA 4Q5RA 3GH9A 3W8SA 5CAXA 1ZGNA 3VLNA 3LWAA 3E0UA 1OC9B 3GX8A 2LTKA 3TJBA 3RPNA 3OR5A 1SENA 1TOFA 4KE3A 2YV7A 2CVDA 3BJ5A 1XOAA 4F82A 3FZ9A 3LG6A 3MAKA 4ZBBA 4OCFA 3TKRA 5AIXA 1K3LA 5DALA 2R37A 1FVJA 2MMZA 4LL1B 4WBRD 3C7MA 4I8BA 1AXDA 2QC7A 4PX1A 1JLVA 1PA3A 2GQLA 6GSTA 1OVNA 1GUKA 2EC4A 3IC4A 3IDVA 1C72A 2HI7A 3Q74A 2C0EA 6GSWA 4OD7A 4TR0A 1TK5B 2YOIA 2VCZA 4PNFA 1X5DA 16GSA 5D9WA 2VL2C 2KP1A 1JFUA 3HD5A 2NVLA 3TJJA 3N9JA 5D8IA 1GP1A 1Q98A 1PL2A 2H71A 4JRRA 4J56E 5HFKA 4MJBA 2CAQA 3H79A 5GAND 1A8YA 1EV4A 2LRNA 1Q4JA 2HRFA 4KSMA 4HZ4A 4L0WA 4K2DA 5A4VA 5JCWA 3H93A 4L5LA 5ECQB 2YWOA 1AC1A 4FYCA 3KD0A 2DJJA 3LORA 2KHPA 2H75A 1XOBA 1A0FA 5KN2A 2CX4A 1K0MA 1NHYA 4K6XA 1G6YA 3FRCA 1KBNA 1GWCA 2K8VA 1A2JA 3IBHA 2VM1A 2CQ9A 2V6OA 2GGTA 3VK9A 1XWGA 3CXGA 1T4ZA 5JCUA 1U3IA 1QK8A 4L0UA 1B9YC 5IQYA 1T3BA 3KTBA 3GKNA 1O6JA 1G7OA 1FB0A 5IPHA 4FYBA 4NXIA 3RHBA 2O85A 1YEXA 2PN8A 5AGYA 1GUHA 2ZNMA 2VM2A 3HDCA 1TKDB 1ST9A 3VWXA 3D21A 5ECIB 1QFNA 4I6XA 3DRNA 2KP2A 2WGRA 2QKEA 2WS2A 4IQAA 2IIYA 5AIVA 5CP1A 3BD2A 4OCEA 3CMIA 3TRPA 2K6VA 3APSA 4TXOA 2CX3A 2DSAA 3IXRA 4TW5A 5G2ZA 4POMA 4TR4A 2IMIA 1R4WA 2DC5A 2J23A 3ERWA 5CO3A 2HZEA 5ID2A 4JR6A 3ZIJA 3LEFA 3UJ1A 2ON5A 3APQA 2N5FA 2F9SA 5HR3A 5CNWA 3K8NA 2F51A 3MSZA 2C3QA 2YANA 2H1DA 5ECMB 4N0VA 2FWEA 5ECOB 1BG5A 1AIUA 1EEMA 2LJAA 4OFNA 3FKFA 2DMLA 3APOA 2XPDA 3J7Yk 2HSHA 1K0BA 3TKSC 1KNGA 4KDYA 4GWRA 4WXTA 3V1WA 2CZ3A 2IMFA 1TJDA 2IWTA 4BVXA 3CTGA 5HQPA 3GHAA 5F06A 1OYJA 2A2SA 4IKHA 4XS1A 3QMXA 4WEYA 5KEJA 1GRXA 1Z7RA 2ZUPA 1OC3A 1G6WA 5L71A 5INYA 4ECIA 1G7EA 2FWHA 1J9BA 3SWLA 4GSNA 1ON4A 1H4OA 3G7YA 1EP7A 4NHWA 2HYXA 3KIJA 3L9UA 4OO5A 3TDGA 2H1GA 3C73A 2PUKC 2LRCA 1XXUA 2C8UA 3DEXA 3GX0A 3GL3A 2NDOA 2JZSA 1WE0A 3HZ4A 4RI6A 2GZYA 3MWHA 1PD21 4YQUA 3CBUA 1J0FA 1B8XA 3P90A 3DMLA 3ZFBA 1DE2A 3H8QA 1O81A 3HYPA 3VPQA 4KCAA 2IN3A 2YCDA 4KDUA 1JZWA 2GSRA 1GL8A 1A24A 3UARA 1YF1A 4IELA 3GA4A 4G10A 1M2AA 4PUFC 5F05A 4RUVA 4F03A 1FG4A 4XHMA 1OAZA 3P7XA 3I43A 5ENUA 3S9FA 4OFTA 4ZB6A 4F0BA 4DSSA 2IMEA 3FR9A 1FO5A 5G5EA 1S3CA 2DJKA 1YQ1A 1J08A 3DD3A 2H74A 1MEKA 4K0GA 2OE1A 1IYHA 2EIOA 1Z6NA 4ZL8A 1JZRA 1N2AA 3EE2A 2L4CA 4TVEA 5H5QA 4YH2A 4HI7A 4KW6A 4WBJA 2GTUA 1M7TA 2REMA 3DIEA 2B7JA 5ABRA 4TN8A 4NPBA 3UOMA 3A2WA 4JZQA 3ZREA 2L6CA 1E6BA 4LMVA 5EL8A 5GZZB 1UA5A 1HQOA 1URMA 1AQXA 4GLTA 1TP9A 1XIYA 1QXHA 3IPZA 1E2YA 4KB3A 3CTFA 3GMFA 5FWGA 1EWXA 3TJFA 3F6FA 4PQ1A 2DIYA 4KCEA 1GSSA 5CRHA 2WJUA 3F4RA 5IMZA 2ZCTA 2VIMA 3ZMKA 3NOFA 2FD3A 3WYWA 2HT9A 3E3EA 2V32A 1CQGA 4ECCA 2VUPA 3JCML 1YEPA 4X0XA 2FY6A 1GLQA 1SKRB 2M72A 2JZTA 3VI5A 3QOUA 18GSA 2I3YA 3FY7A 2WDUA 1H75A 1AW9A 13GSA 3EU3A 2L57A 4MJEA 4GSSA 1AAZA 1OC9A 2PGTA 4F0CA 4IGJA 1Z5YE 4MPGA 3Q19A 3GRXA 3HZ8A 4KNDA 2FUG2 2IPAA 1MTCA 1UC7A 3HVVA 1O85A 3NZNA 2AV4A 3M9KA 3VFIA 2QSIA 2VCXA 2YZHA 3ZTLA 22GSA 3IV4A 1FAAA 3RAZA 2HLSA 2VCWA 3WGEA 1THOA 4MK3A 2NTOA 3KMOA 3EMPA 3HVSA 2NPBA 3RPPA 2LQQA 5CRDA 3EYTA 1XWAA 3KCMA 2HE3A 1I9DA 2C4JA 3O76A 4EL1A 1GTAA 4ZB9A 2VCVA 3DYRA 4L5OA 1X0RA 2RUFA 4IP1A 1B9XC 4RQXA 5IIZA 3FZ5A 5FT3A 3FYGA 5C00A 4PUAA 3QR6A 2H19A 1ZMAA 2XPEA 1ZOFA 5ECKB 2B3SA 4I2TA 2JADA 4Z7XA 2VD0A 5ECRB 2RM5A 5E59A 5CYYA 4FO5A 5IMCA 1XWKA 4DEJA 5KN3A 2I4AA 4V2NA 3F3RA 1F9MA 4MABA 4HZ2A 3A2VA 3HCZA 4O7HA 4CDOA 5B7CA 1PX7A 4EVMA 1O7UA 2G2QA 4EDZA 3ERFA 4L8EA 1WJKA 5DJMA 5ELGA 3FHKA 1TDIA 4MJCA 2MBSA 2MMOA 1IYIA 1SK0A 1THXA 4N30A 1V57A 3KMNA 2B7KA 1ILOA 3ME7A 1TRUA 3M3MA 1MDIA 2P5RA 1V98A 5JWQB 2H8LA 3DWVA 5D93A 2JU5A 5D9XA 3UBLA 2H73A 2LV3A 3FZ4A 1A23A 3UMAA 5JWRB 3KJYA 2TIRA 4XS4B 2X64A 3IAM2 2AB6A 2GZPA 3MNGA 1YKCA 1PKWA 4BWQA 1M9BA 1BAYA 4OMVA 4HEA2 4FYUA 2TRXA 2CVBA 5KN0A 2F3MA 1TI3A 1VF1A 3HXSA 2H1BA 2IL3A 2F8AA 2H0HA 3UVHA 2VLTA 4CW9A 4EO3A 1FOVA 1M2BA 3BCKA 2OE0A 3IAS2 4MJAA 5DAKB 5G30A 4V1Ap 3WT2A 2PWJA 1ACVA 2YV9A 4KSOA 1UN2A 4EE0A 2VD1A 4EC0A 3A3TA 3IE3A 3TKPA 1HNBA 1TXXA 2OE3A 2O8VB 2MYGA 4PQHA 1TI1A 2IFQA 2ALBA 1OC8A 3ZVJA 4K7OA 3HVXA 2B1KA 2DBCA 3IR4A 3A2XA 3I6AA 2FHEA 3HHVA 3M9JA 6GSVA 1VRSD 2PU9C 4E8HA 3TJGA 3GKKA 2GQMA 1JHBA 1AUCA 5ECNB 5DCGA 2R3XA 5D73A 1X5CA 6GSYA 4BVYA 4XTSA 4MLYA 1TTZA 1M0UA 2H76A 1WMJA 4HJMA 2D2ZA 5C04A 3FR6A 19GSA 3GNJA 3VI7A 4Q5NA 2TRCP 3DXBA 4WR4A 5JWOB 1BYEA 2H01A 1CQHA 2HZFA 4IBPA 3ZZXA 1NSWA 4GXZA 2GSQA 4BPYA 2H66A 5J41A 2MMNA 3F0IA 4ZBAA 3BOAA 1SKWB 4IJIA 4N0ZA 3KM6A 1GTBA 2FWGA 2QGVA 2V2GA 1PRXA 3EINA 3ED3A 3CRUA 2VL3A 2IMKA 4EUYA 3CSIA 4X1UA 4I5QA 1RK4A 2JSYA 4PGTA 4PXOA 1K3OA 5DDLA 3QFBC 4BWSA 2EIQA 4PNGA 1PQNA 2H6ZA 2GZZA 1BJXA 3HJPA 4GCIA 4HOJA 4NWYA 1ERTA 1FB6A 2OKAA 4D73B 5EPFA 1HNCA 2R4VA 5B8AA 2X8HA 4IJ3A 3BCIA 3PR8A 3I9V2 1EZKA 4AJ7A 4NV2A 3IK7A 4O32A 2WCIA 1T7PB 4MMMA 5HR2A 2H1AA 2CVKA 4ILFA 4BL7A 2YWIA 2GSSA 1B4PA 3M0FA 1TK8B 1QGVA 3KH9A 2X8CA 2B5XA 4ML6A 2JL4A 2O7KA 2HSYA 1DBYA 4KGIA 3US3A 1AQVA 5ECHB 2P31A 2E2GA 3W8JA 1WIKA 4YAPA 3ZLPA 1GSDA 2JSZA 2LS5A 2J9HA
chains in the Genus database with same CATH superfamily
3SBCA 1YY7A 2C3NA 3Q18A 3IHGA 2E0QA 3FZAA 1NM3A 4K9ZA 2AHEA 1Y25A 4MA9A 1R5AA 2VO4A 1SD9A 1GUMA 5J5NA 2EIRA 3D5JA 5HR1A 3FMWA 3KP8A 3QAVA 1GSEA 2DLXA 1WRYA 4GQFA 1M9AA 4ZBDA 4RQRA 4XIHA 3TUEA 4KF9A 3VWWA 3ZVJD 4N11A 1A0RP 1PSQA 3GTUA 3TRXA 3L4NA 1VF4A 4TR1A 1A2LA 2WULA 2C80A 3HJMA 5ECLB 1ERUA 5LNKe 1MDKA 2X99A 4N10A 2K18A 3TKQA 5IOXA 1EEJA 4NHZA 4Q5QA 4KUNA 1F3BA 3GYKA 3GSSA 3FR3A 1SYRA 3TRQA 4POLA 1AQWA 4GSTA 1W4VA 2L5OA 4TRXA 4IW9A 1FVKA 4O92A 1YDKA 3L9SA 3F4SA 2LEGA 4H86A 2AJQB 3DGQA 3KP9A 1KTEA 6GSUA 3FW2A 1NHOA 3CRTA 5E4WA 3KGKA 3P2AA 2A4VA 5G5FA 5EY6A 3GFKA 4GTUA 3EWLA 3QDNA 2I81A 2YJ7A 1UVZA 2H70A 4NMUA 3C8EA 1PMTA 3KXOA 1XW5A 3VPTA 5BRTA 4XCSA 1A8LA 4ACSA 4G0KA 1S3AA 4ID0A 3EVIA 4MH3A 3G7IA 2I9HA 2XBQA 3PGTA 4JBBA 1XWBA 3PH9A 4WF5A 5J9CA 1S3RA 2B6MA 4XS6A 3F6DA 5B8BA 5IOWA 4DSQA 4KA0A 1MD4A 3IA1A 4E8EA 3VURA 4Z2TA 2BJXA 1NW2A 1PN0A 2X8GA 4ZIJA 5D9VA 2AAWA 4KAEA 4ECBA 1ABAA 2YWNA 2B1LA 5F07A 4ECJA 1HD2A 5G1KA 2MMAA 4MF6A 1LU4A 4POKA 1SK2A 3HJOA 4HU9A 2H30A 5B6MA 3QD9A 2O89A 3RHCA 3Q6OA 1SKSB 4HUAA 3L78A 2CT6A 4KDXA 2LUSA 3TOTA 4MF7A 4KH7A 1PKZA 3R3EA 1B4QA 3TKSE 3F3QA 3MIXA 2RM6A 1HNAA 1T4YA 4IP6A 4TXVA 1EGOA 5HFIA 2B5YA 4IQ1A 4V1Ag 1S3DA 1O8WA 1ERVA 3UBKA 2A2RA 2YN1A 5CRWA 2OBKA 4JR4A 3UEMA 4XRDA 1XG8A 4G0LA 3TCOA 1YZXA 2WZ9A 2VCTA 2DMMA 4MZBA 2H72A 3ZL5A 4HJ2A 2LNSA 5LCZA 1MD3A 2FWFA 3QFAC 4WF4A 2LRTA 3DVWA 3G7JA 4MH2A 3UVTA 4XS4A 3CSJA 5D96A 2PMTA 3G9BA 1R26A 4J57E 1SL2B 4Q5FA 1U87A 12GSA 1TK0B 3DVXA 4NV5A 3ZITA 3D0ZA 5IO0A 1X9SB 2VAFA 2VL2A 1QMVA 1GSFA 2LJRA 5DQYA 4MF5A 4ISDA 3LJRA 4WR5A 1GSYA 3WGDA 2I1UA 1K0OA 2L59A 5COHA 1F6MC 1BEDA 1K0DA 2CA8A 4ML1A 3KTLA 5DAKA 2BMXA 14GSA 3A5WA 5J9BA 4MCUA 4ULXA 1TRWA 1HYUA 2L4QA 2PERA 1EOGA 3LXZA 1K0CA 5J4UA 3LGCA 4RI7A 1EV9A 5DALB 3ZRDA 3R2QA 1N8JA 1ZCPA 2PBJA 1SJIA 2M46A 3F63A 1XFLA 2E2MA 1F2EA 3ZFLA 4IHUA 4GRFA 5IPGA 1SU9A 2MZCA 1V58A 4MP4A 4G9HA 3GH6A 2PPTA 5ECSA 5H5SA 4AJ8A 3H1NA 4HU7A 3U6VA 3N5OA 2GDRA 1GNWA 4AJ6A 5DQSA 3F4TA 1U3AA 2ON7A 3QCPA 1XCCA 2RIIA 4K5SA 4LL4B 1V9WA 1EGRA 3ME8A 1W89A 3GL5A 3RBTA 5HR0A 4I2UA 3WD6A 6GSSA 2HFDA 2HRNA 8GSSA 1ERWA 1VF3A 1Z3EA 2GQKA 2AUVA 2YP6A 1GULA 1FW1A 3VWUA 5DCHA 1Z9HA 4ZILA 2C1YA 5IMAA 2OA7A 1EP8A 1R5PA 5J3RA 2FCHA 2PVOC 5A5KA 5DBQA 2N5BA 1TRVA 4PURA 1WPIA 3QPMA 3EURA 3IHQA 2XBIA 1QQ2A 5EVOA 5IMDA 1K0AA 3LSZA 1Z6MA 2YWMA 3QAWA 2C0DA 1SD8A 1BX9A 4CHSA 1TRSA 2GSTA 2YPMA 3EU4A 3D22A 4G19A 3L0HA 2DJ2A 1XBSA 2QA2A 2FNOA 2CV4A 1ML6A 1X5EA 2PVQA 4JE1A 3UL3A 5B6NA 5H5RA 1GNEA 4YKFA 2G0FA 3CQFA 3D4MA 3KEBA 4D73A 2H6YA 1SK1A 1X9WB 2FA8A 3L9VA 3ZYWA 4MZCA 4IVFA 1FOHA 3MDKA 3TKSA 4ZL7A 1GTUA 2VOCA 2WRTA 1GTIA 4XRAA 4V2LA 5CRGA 5D9TA 1VF2A 1T1VA 2IFQB 5HFGA 2R5GA 3IOSA 1V2AA 1SL0B 2VCQA 3LYPA 2OACA 3TOUA 2UZ8A 4ZXGA 3M1GA 4TXOB 4AF2A 3HA9A 1O8XA 3O3TA 1K3YA 2DIZA 2H0GA 2K9FA 1M2DA 3C1SA 1V40A 1Y6EA 3GN3A 4GQCA 5ID2B 4LLRA 2HZEB 4DSRA 5KN1A 5G31A 4J2FA 4K0NA 4AGSA 4K7IA 1M99A 1WOUA 5JCGA 11GSA 5IO2A 4JEDA 4HDEA 2LJKA 3VWVA 1KEBA 4F2IA 2JACA 1T00A 2DJ1A 3IC8A 2XHFA 2GS3A 3GUSA 1MDJA 5ELAA 1YKAA 1U6TA 1PN9A 3GKXA 4FIWA 1GSQA 3I69A 1BQ7A 4PQIA 2YNXA 1TU8A 2IJYA 3O6TA 17GSA 2R6KA 3KH7A 1OKTA 2OADA 5AN1A 1SL1B 3TB2A 3LXTA 5A4UA 9GSSA 4LA1A 2R0CA 1PX6A 2VL9A 2AYTA 5LD0A 20GSA 1OKDA 1XVQA 2L5LA 2GVPA 7GSSA 3FK8A 3C71A 1A2MA 3RDWA 1T8EB 2RUEA 1YF0A 4DVCA 3IK9A 1XW9A 1PGTA 3ERGA 3QAGA 5IM9A 2YJHA 1WP0A 5G1LA 4MPFA 1K0NA 3P8WA 1DE1A 3WT1A 1TU7A 1GH2A 1ZYPA 2DJ3A 2V1MA 5GAPD 1G0TA 3CSHA 2H0IA 4HQSA 3PINA 2JZRA 1ZZYA 1XPVA 2H6XA 2DJ0A 4LMWA 3LFLA 2HRKA 4V2MA 5F0GA 3CYNA 4QL9A 1I5GA 3J7Yb 2FA4A 2KLXA 4FH8A 2MBTA 3E9JB 4F9ZA 1X9MB 3LYKA 4KX4A 4MZWA 3C1RA 2LKUA 3KZQA 1XWCA 3D4TA 1USBA 2FLSA 5AISA 2YZUA 4BL7B 4TR3A 3WGXA 5IMVA 1XZOA 3ISOA 1DUGA 1QUWA 5GSSA 4TOPA 2R2JA 2HNLA 2NBSA 4NAXA 4YQVA 4ZB8A 10GSA 4EXJA 4IN0A 2K8SA 4K7NA 3GKMA 1ZYQB 5KOWA 1PL1A 5A4WA 1WWJA 1SYXA 3HKRA 3TGZA 4OO4A 3EC3A 4G2EA 2Z9SA 4K1FA 2V41A 2L6DA 1RQMA 4DSSB 2C0GA 4QQ7A 4EDYA 2M80A 1SJ6A 5DVBA 4O5RA 5CREA 1JLWA 2V6KA 1JZOA 1GLPA 1YJ6A 4IS0A 1ZYNA 2LNTA 2CAIA 3GSTA 1XVWA 2BTOT 2C3TA 2OBIA 2B5EA 4EF0A 3GURA 1FHEA 1JZDA 3ZIVA 4P3YB 3IRAA 1SJZA 2LSTA 2ES7A 2FGXA 3GV1A 2RLIA 4G0IA 4POBA 5IMFA 2GT6A 4X43A 1O73A 2KOKA 4WKWA 3LQ7A 4HS1A 3GTUB 3HY2A 4WETA 4BIKA 4MDCA 3DKSA 2VLUA 2VLVA 4TR1B 4GF0A 1ZYEA 3GIXA 2GLRA 3F9UA 1ZL9A 1GSUA 3NIVA 4OWYA 1LJRA 3M8NA 4TKYA 3D6IA 4K8MA 2O87A 2WB9A 1Z7PA 3H4KA 2OJLA 1OE8A 2HRAA 3UIWA 4EKZA 1DSBA 4YQMA 2P0GA 2N5AA 1OE7A 3FEUA 1VGLA 3ZMLA 1LBKA 5GSTA 4BA7A 2LQOA 1EOHA 1F37A 3W6GA 4I97A 2F8FA 1XW6A 4YAVA 2GT5A 1RW1A 2CZ2A 2E7PA 2C0FA 5ECPB 2IMDA 5F8BA 4QL7A 5DJLA 3AY8A 1F3AA 1R7HA 3F8UA 1TW9A 1B48A 3U5RE 4JU5A 4CY6A 2P5QA 2WFCA 6GSXA 2HXKA 4OFMA 2X4AA 2XC2A 1U88A 3BBYA 3EMXA 5FHIA 2KUCA 4ZL9A 3UAPA 4HQZA 3TJKA 4Q5RA 3GH9A 3W8SA 5CAXA 1ZGNA 3VLNA 3LWAA 3E0UA 1OC9B 3GX8A 2LTKA 3TJBA 3RPNA 3OR5A 1SENA 1TOFA 4KE3A 2YV7A 2CVDA 3BJ5A 1XOAA 4F82A 3FZ9A 3LG6A 3MAKA 4ZBBA 4OCFA 4USSA 4ICYA 3TKRA 5AIXA 1K3LA 5DALA 2R37A 2DKIA 1FVJA 2MMZA 4LL1B 4WBRD 3C7MA 4I8BA 1AXDA 2QC7A 4PX1A 1JLVA 1PA3A 2GQLA 6GSTA 1OVNA 1GUKA 2EC4A 3IC4A 3IDVA 1C72A 2HI7A 3Q74A 2C0EA 6GSWA 4OD7A 4TR0A 1TK5B 2YOIA 4A5PA 2VCZA 4PNFA 1X5DA 16GSA 5D9WA 2VL2C 2KP1A 1JFUA 3HD5A 2NVLA 3TJJA 3N9JA 5D8IA 1GP1A 1Q98A 1PL2A 2H71A 4JRRA 4J56E 5HFKA 4MJBA 2CAQA 3H79A 5GAND 1A8YA 1EV4A 2LRNA 1Q4JA 2HRFA 4KSMA 4HZ4A 4L0WA 4K2DA 5A4VA 5JCWA 3H93A 4L5LA 5ECQB 2YWOA 1AC1A 4FYCA 3KD0A 2DJJA 3LORA 2KHPA 2H75A 1XOBA 1A0FA 5KN2A 2CX4A 1K0MA 1NHYA 4K6XA 1G6YA 3FRCA 1KBNA 1GWCA 2K8VA 1A2JA 3IBHA 2VM1A 2CQ9A 4X4JA 2V6OA 2GGTA 2A2PA 3VK9A 1XWGA 3CXGA 1T4ZA 5JCUA 1U3IA 1QK8A 4L0UA 1B9YC 5IQYA 1T3BA 3KTBA 3GKNA 1O6JA 1G7OA 1FB0A 5IPHA 4FYBA 4NXIA 2HSMA 3RHBA 2O85A 1YEXA 2PN8A 5AGYA 1GUHA 2ZNMA 2VM2A 3HDCA 1TKDB 1ST9A 3VWXA 3D21A 5ECIB 1QFNA 4I6XA 3DRNA 2KP2A 2WGRA 2QKEA 2WS2A 4IQAA 2IIYA 5AIVA 5CP1A 3BD2A 4OCEA 3CMIA 3TRPA 2K6VA 3APSA 5BMUA 4TXOA 2CX3A 2DSAA 3IXRA 4TW5A 5G2ZA 4POMA 4TR4A 2IMIA 1R4WA 2DC5A 2J23A 3ERWA 5CO3A 2HZEA 5ID2A 4EIQA 4JR6A 3ZIJA 3LEFA 3UJ1A 2ON5A 3APQA 4K2XA 2N5FA 2F9SA 5HR3A 2DKHA 5CNWA 3K8NA 2F51A 3MSZA 2C3QA 2YANA 2H1DA 5ECMB 4N0VA 2FWEA 5ECOB 1BG5A 1AIUA 1EEMA 2LJAA 4OFNA 3FKFA 2DMLA 3APOA 2XPDA 3J7Yk 4HSCX 2HSHA 1K0BA 3TKSC 1KNGA 4KDYA 4GWRA 4WXTA 3V1WA 2CZ3A 2IMFA 1TJDA 2IWTA 4BVXA 3CTGA 5HQPA 3GHAA 5F06A 1OYJA 2A2SA 4IKHA 4XS1A 3QMXA 4WEYA 5KEJA 1GRXA 1Z7RA 2ZUPA 1OC3A 1G6WA 5L71A 5INYA 4BVYB 4ECIA 2FWHA 1G7EA 1J9BA 3SWLA 4GSNA 1ON4A 1H4OA 3G7YA 1EP7A 4NHWA 2HYXA 3KIJA 3L9UA 4OO5A 3TDGA 2H1GA 3C73A 2PUKC 2LRCA 1XXUA 2C8UA 3DEXA 3GX0A 3GL3A 2NDOA 2JZSA 1WE0A 3HZ4A 4RI6A 2GZYA 3MWHA 1PD21 4YQUA 3CBUA 1J0FA 1B8XA 3P90A 3DMLA 3ZFBA 1DE2A 3H8QA 1O81A 3HYPA 3VPQA 4KCAA 2IN3A 2YCDA 4KDUA 1JZWA 2GSRA 1GL8A 1A24A 3UARA 1YF1A 4IELA 3GA4A 4G10A 1M2AA 4PUFC 5F05A 4RUVA 4F03A 1FG4A 4XHMA 1OAZA 3P7XA 3I43A 5ENUA 3S9FA 4OFTA 4ZB6A 4F0BA 4DSSA 2IMEA 3FR9A 4Z2RA 1FO5A 5G5EA 1S3CA 2DJKA 1YQ1A 1J08A 3DD3A 2H74A 1MEKA 3HVNA 4K0GA 2OE1A 1IYHA 2EIOA 1Z6NA 4ZL8A 1JZRA 1N2AA 3EE2A 2L4CA 4TVEA 5H5QA 4YH2A 4HI7A 4KW6A 4WBJA 2GTUA 1M7TA 2REMA 3DIEA 2B7JA 5ABRA 4TN8A 4NPBA 3UOMA 3A2WA 4JZQA 3ZREA 2L6CA 1E6BA 4LMVA 2R0PA 5EL8A 5GZZB 1UA5A 3LW9A 1HQOA 1URMA 1AQXA 1M3JA 4GLTA 1TP9A 1XIYA 1QXHA 4MNNA 3IPZA 1E2YA 4KB3A 3CTFA 3GMFA 5FWGA 1EWXA 3TJFA 3F6FA 4PQ1A 2DIYA 4KCEA 1GSSA 5CRHA 2WJUA 3F4RA 5IMZA 2ZCTA 2VIMA 3ZMKA 3NOFA 2FD3A 3WYWA 2HT9A 3E3EA 2V32A 1CQGA 4ECCA 2VUPA 3JCML 1YEPA 4FQUA 4X0XA 2FY6A 3A5IA 1GLQA 1SKRB 2M72A 2JZTA 3VI5A 3QOUA 18GSA 2I3YA 3FY7A 2WDUA 1H75A 1AW9A 13GSA 3EU3A 2L57A 4MJEA 4GSSA 1AAZA 1OC9A 2PGTA 4F0CA 4IGJA 1Z5YE 4MPGA 3Q19A 3GRXA 3HZ8A 4KNDA 2FUG2 2IPAA 1MTCA 3MYDA 1UC7A 3HVVA 1O85A 3NZNA 2AV4A 3M9KA 3VFIA 2QSIA 2VCXA 2YZHA 3ZTLA 22GSA 3IV4A 1FAAA 3PPUA 3RAZA 1M3IA 2HLSA 2VCWA 3WGEA 1THOA 4MK3A 2NTOA 3KMOA 3EMPA 3HVSA 2NPBA 3RPPA 2LQQA 5CRDA 2X49A 3EYTA 1XWAA 3KCMA 2HE3A 1I9DA 2C4JA 3O76A 4EL1A 1GTAA 4ZB9A 2VCVA 3DYRA 4L5OA 1X0RA 2RUFA 4IP1A 1B9XC 4RQXA 5IIZA 3FZ5A 5FT3A 3FYGA 5C00A 4PUAA 3QR6A 2H19A 5KOXA 1ZMAA 2XPEA 1ZOFA 5ECKB 2B3SA 4I2TA 2JADA 4Z7XA 4CY8A 2VD0A 5ECRB 2RM5A 5E59A 5CYYA 3EPTA 4FO5A 5IMCA 1XWKA 4DEJA 5KN3A 2I4AA 4V2NA 3F3RA 1F9MA 4MABA 4HZ2A 3A2VA 3HCZA 4O7HA 4O5QA 4CDOA 5B7CA 1PX7A 4EVMA 1O7UA 2G2QA 4EDZA 3ERFA 4L8EA 1WJKA 5DJMA 5ELGA 3FHKA 1TDIA 4EIPA 4MJCA 2MBSA 2MMOA 1IYIA 1SK0A 2R0GA 1THXA 4N30A 4K5RA 1V57A 3KMNA 2B7KA 1ILOA 3ME7A 1TRUA 3M3MA 1MDIA 2P5RA 1V98A 5JWQB 2H8LA 3DWVA 5D93A 2JU5A 5D9XA 3UBLA 2H73A 2LV3A 3FZ4A 1A23A 3UMAA 5JWRB 3KJYA 2TIRA 4XS4B 2X64A 3IAM2 2AB6A 2GZPA 3MNGA 1YKCA 1PKWA 4BWQA 1M9BA 1BAYA 4OMVA 4HEA2 4FYUA 2TRXA 2CVBA 5KN0A 2F3MA 1TI3A 1VF1A 4YKGA 4Z2UA 3HXSA 2H1BA 2IL3A 2F8AA 2H0HA 3UVHA 2VLTA 4CW9A 4EO3A 1FOVA 1M2BA 3BCKA 2OE0A 3IAS2 4MJAA 5DAKB 5G30A 4V1Ap 3WT2A 2PWJA 1ACVA 2YV9A 4KSOA 1UN2A 4EE0A 2VD1A 4EC0A 3A3TA 3IE3A 3TKPA 1HNBA 1TXXA 2OE3A 2O8VB 2MYGA 4PQHA 1TI1A 2IFQA 2ALBA 1OC8A 3ZVJA 4K7OA 3HVXA 2B1KA 2DBCA 3IR4A 3A2XA 3I6AA 2FHEA 3HHVA 3M9JA 6GSVA 1VRSD 2PU9C 4E8HA 3TJGA 3GKKA 2GQMA 1JHBA 1AUCA 5ECNB 5DCGA 2R3XA 5D73A 1PFOA 1X5CA 6GSYA 4BVYA 4XTSA 4MLYA 1TTZA 1M0UA 2H76A 1WMJA 4HJMA 2D2ZA 5C04A 3FR6A 19GSA 3GNJA 3VI7A 4Q5NA 4PTSA 2TRCP 3DXBA 4WR4A 5JWOB 1BYEA 2H01A 1CQHA 2HZFA 4IBPA 3ZZXA 2QA1A 1NSWA 4GXZA 2GSQA 4BPYA 2H66A 5J41A 2MMNA 3F0IA 4ZBAA 3BOAA 1SKWB 4IJIA 4N0ZA 3KM6A 1GTBA 2FWGA 2QGVA 2V2GA 1PRXA 3EINA 3ED3A 2A4HA 3CRUA 2VL3A 2IMKA 4EUYA 3CSIA 4X1UA 4I5QA 1RK4A 2JSYA 4PGTA 4PXOA 1K3OA 5DDLA 3QFBC 4BWSA 2EIQA 4PNGA 1PQNA 2H6ZA 2GZZA 4O5UA 1BJXA 3HJPA 4GCIA 4HOJA 4NWYA 1ERTA 1FB6A 2OKAA 4D73B 5EPFA 1HNCA 2R4VA 5B8AA 2X8HA 4IJ3A 3BCIA 3PR8A 3I9V2 1EZKA 4AJ7A 4NV2A 3IK7A 4O32A 2WCIA 1T7PB 4MMMA 5HR2A 2H1AA 2CVKA 4ILFA 4BL7A 2YWIA 2GSSA 1B4PA 3M0FA 1TK8B 4BVXB 1QGVA 3KH9A 2X8CA 2B5XA 4ML6A 2JL4A 2O7KA 2HSYA 1DBYA 4KGIA 3US3A 1AQVA 5ECHB 2P31A 2E2GA 3W8JA 1WIKA 4YAPA 3ZLPA 1GSDA 2JSZA 2LS5A 2J9HA
chains in the Genus database with same CATH topology
3SBCA 1YY7A 2C3NA 3Q18A 3IHGA 2E0QA 3FZAA 1NM3A 4K9ZA 2AHEA 1Y25A 4MA9A 1R5AA 2VO4A 1SD9A 1GUMA 5J5NA 2EIRA 3D5JA 5HR1A 3FMWA 3KP8A 3QAVA 1GSEA 2DLXA 1WRYA 4GQFA 1M9AA 4ZBDA 4RQRA 4XIHA 3TUEA 4KF9A 3VWWA 3ZVJD 4N11A 1A0RP 1PSQA 3GTUA 3TRXA 3L4NA 1VF4A 4TR1A 1A2LA 2WULA 2C80A 3HJMA 5ECLB 1ERUA 5LNKe 1MDKA 2X99A 4N10A 2K18A 3TKQA 5IOXA 1EEJA 4NHZA 4Q5QA 4KUNA 1F3BA 3GYKA 3GSSA 3FR3A 1SYRA 3TRQA 4POLA 1AQWA 4GSTA 1W4VA 2L5OA 4TRXA 4IW9A 1FVKA 4O92A 1YDKA 3L9SA 3F4SA 2LEGA 4H86A 2AJQB 3DGQA 3KP9A 1KTEA 6GSUA 3FW2A 1NHOA 3CRTA 5E4WA 3KGKA 3P2AA 2A4VA 5G5FA 5EY6A 3GFKA 4GTUA 3EWLA 3QDNA 2I81A 2YJ7A 1UVZA 2H70A 4NMUA 3C8EA 1PMTA 3KXOA 1XW5A 3VPTA 5BRTA 4XCSA 1A8LA 4ACSA 4G0KA 1S3AA 4ID0A 3EVIA 4MH3A 3G7IA 2I9HA 2XBQA 3PGTA 4JBBA 1XWBA 3PH9A 4WF5A 5J9CA 2B6MA 4XS6A 3F6DA 5B8BA 5IOWA 4DSQA 4KA0A 1MD4A 3IA1A 4E8EA 3VURA 4Z2TA 2BJXA 1NW2A 1PN0A 2X8GA 4ZIJA 5D9VA 2AAWA 4KAEA 4ECBA 1ABAA 2YWNA 2B1LA 5F07A 4ECJA 1HD2A 5G1KA 2MMAA 4MF6A 1LU4A 4POKA 1SK2A 3HJOA 4HU9A 2H30A 5B6MA 3QD9A 2O89A 3RHCA 3Q6OA 1SKSB 4HUAA 3L78A 2CT6A 4KDXA 2LUSA 3TOTA 4MF7A 4KH7A 1PKZA 3R3EA 1B4QA 3TKSE 3F3QA 3MIXA 2RM6A 1HNAA 1T4YA 4IP6A 4TXVA 1EGOA 5HFIA 2B5YA 4IQ1A 4V1Ag 1S3DA 1O8WA 1ERVA 3UBKA 2A2RA 2YN1A 5CRWA 2OBKA 4JR4A 3UEMA 4XRDA 4G0LA 3TCOA 1YZXA 2WZ9A 2VCTA 2DMMA 4MZBA 2H72A 3ZL5A 4HJ2A 2LNSA 5LCZA 1MD3A 2FWFA 3QFAC 4WF4A 2LRTA 3DVWA 3G7JA 4MH2A 3UVTA 4XS4A 3CSJA 5D96A 2PMTA 3G9BA 1R26A 4J57E 1SL2B 4Q5FA 1U87A 12GSA 1TK0B 3DVXA 4NV5A 3ZITA 3D0ZA 5IO0A 1X9SB 2VAFA 2VL2A 1QMVA 1GSFA 2LJRA 5DQYA 4MF5A 4ISDA 3LJRA 4WR5A 1GSYA 3WGDA 2I1UA 1K0OA 2L59A 5COHA 1F6MC 1BEDA 1K0DA 2CA8A 4ML1A 3KTLA 5DAKA 2BMXA 14GSA 3A5WA 5J9BA 4MCUA 4ULXA 1TRWA 1HYUA 2L4QA 2PERA 1EOGA 3LXZA 1K0CA 5J4UA 3LGCA 4RI7A 1EV9A 5DALB 3ZRDA 3R2QA 1N8JA 1ZCPA 2PBJA 1SJIA 2M46A 3F63A 1XFLA 2E2MA 1F2EA 3ZFLA 4IHUA 4GRFA 5IPGA 1SU9A 2MZCA 1V58A 4MP4A 4G9HA 3GH6A 2PPTA 5ECSA 5H5SA 4AJ8A 3H1NA 4HU7A 3U6VA 3N5OA 2GDRA 1GNWA 4AJ6A 5DQSA 3F4TA 1U3AA 2ON7A 3QCPA 1XCCA 2RIIA 4K5SA 4LL4B 1V9WA 1EGRA 3ME8A 1W89A 3GL5A 3RBTA 5HR0A 4I2UA 3WD6A 6GSSA 2HFDA 2HRNA 8GSSA 1ERWA 1VF3A 1Z3EA 2GQKA 2AUVA 2YP6A 1GULA 1FW1A 3VWUA 5DCHA 1Z9HA 4ZILA 2C1YA 5IMAA 2OA7A 1EP8A 1R5PA 5J3RA 2FCHA 2PVOC 5A5KA 5DBQA 2N5BA 1TRVA 4PURA 1WPIA 3QPMA 3EURA 3IHQA 2XBIA 1QQ2A 5EVOA 5IMDA 1K0AA 3LSZA 1Z6MA 2YWMA 3QAWA 2C0DA 1SD8A 1BX9A 4CHSA 1TRSA 2GSTA 2YPMA 3EU4A 3D22A 4G19A 3L0HA 2DJ2A 1XBSA 2QA2A 2FNOA 2CV4A 1ML6A 1X5EA 2PVQA 4JE1A 3UL3A 5B6NA 5H5RA 1GNEA 4YKFA 2G0FA 3D4MA 3KEBA 4D73A 2H6YA 1SK1A 1X9WB 2FA8A 3L9VA 3ZYWA 4MZCA 4IVFA 1FOHA 3MDKA 3TKSA 4ZL7A 1GTUA 2VOCA 2WRTA 1GTIA 4XRAA 4V2LA 5CRGA 5D9TA 1VF2A 1T1VA 2IFQB 5HFGA 2R5GA 3IOSA 1V2AA 1SL0B 2VCQA 3LYPA 2OACA 3TOUA 2UZ8A 4ZXGA 3M1GA 4TXOB 4AF2A 3HA9A 1O8XA 3O3TA 1K3YA 2DIZA 2H0GA 2K9FA 1M2DA 3C1SA 1V40A 1Y6EA 3GN3A 4GQCA 5ID2B 4LLRA 2HZEB 4DSRA 5KN1A 5G31A 4J2FA 4K0NA 4AGSA 4K7IA 1M99A 1WOUA 5JCGA 11GSA 5IO2A 4JEDA 4HDEA 2LJKA 3VWVA 1KEBA 4F2IA 2JACA 1T00A 2DJ1A 3IC8A 2XHFA 2GS3A 3GUSA 1MDJA 5ELAA 1YKAA 1U6TA 1PN9A 3GKXA 4FIWA 1GSQA 3I69A 1BQ7A 4PQIA 2YNXA 1TU8A 2IJYA 3O6TA 17GSA 2R6KA 3KH7A 1OKTA 2OADA 5AN1A 1SL1B 3TB2A 3LXTA 5A4UA 9GSSA 4LA1A 2R0CA 1PX6A 2VL9A 2AYTA 5LD0A 20GSA 1OKDA 1XVQA 2L5LA 2GVPA 7GSSA 3FK8A 3C71A 1A2MA 3RDWA 1T8EB 2RUEA 1YF0A 4DVCA 3IK9A 1XW9A 1PGTA 3ERGA 3QAGA 5IM9A 2YJHA 1WP0A 5G1LA 4MPFA 1K0NA 3P8WA 1DE1A 3WT1A 1TU7A 1GH2A 1ZYPA 2DJ3A 2V1MA 5GAPD 1G0TA 3CSHA 2H0IA 4HQSA 3PINA 2JZRA 1ZZYA 1XPVA 2H6XA 2DJ0A 4LMWA 3LFLA 2HRKA 4V2MA 5F0GA 3CYNA 4QL9A 1I5GA 3J7Yb 2FA4A 2KLXA 4FH8A 2MBTA 3E9JB 4F9ZA 1X9MB 3LYKA 4KX4A 4MZWA 3C1RA 2LKUA 3KZQA 1XWCA 3D4TA 1USBA 2FLSA 5AISA 2YZUA 4BL7B 4TR3A 3WGXA 5IMVA 1XZOA 3ISOA 1DUGA 1QUWA 5GSSA 4TOPA 2R2JA 2HNLA 2NBSA 4NAXA 4YQVA 4ZB8A 10GSA 4EXJA 4IN0A 2K8SA 4K7NA 3GKMA 1ZYQB 5KOWA 1PL1A 5A4WA 1WWJA 1SYXA 3HKRA 3TGZA 4OO4A 3EC3A 4G2EA 2Z9SA 4K1FA 2V41A 2L6DA 1RQMA 4DSSB 2C0GA 4QQ7A 4EDYA 2M80A 1SJ6A 5DVBA 4O5RA 5CREA 1JLWA 2V6KA 1JZOA 1GLPA 1YJ6A 4IS0A 1ZYNA 2LNTA 2CAIA 3GSTA 1XVWA 2BTOT 2C3TA 2OBIA 2B5EA 4EF0A 3GURA 1FHEA 1JZDA 3ZIVA 4P3YB 3IRAA 1SJZA 2LSTA 2ES7A 2FGXA 3GV1A 2RLIA 4G0IA 4POBA 5IMFA 2GT6A 4X43A 1O73A 2KOKA 4WKWA 3LQ7A 4HS1A 3GTUB 3HY2A 4WETA 4MDCA 3DKSA 2VLUA 2VLVA 4TR1B 4GF0A 1ZYEA 3GIXA 2GLRA 3F9UA 1ZL9A 1GSUA 3NIVA 4OWYA 1LJRA 3M8NA 4TKYA 3D6IA 4K8MA 2O87A 2WB9A 1Z7PA 3H4KA 2OJLA 1OE8A 2HRAA 3UIWA 4EKZA 1DSBA 4YQMA 2P0GA 2N5AA 1OE7A 3FEUA 1VGLA 3ZMLA 1LBKA 5GSTA 4BA7A 2LQOA 1EOHA 1F37A 3W6GA 4I97A 2F8FA 1XW6A 4YAVA 2GT5A 1RW1A 2CZ2A 2E7PA 2C0FA 5ECPB 2IMDA 5F8BA 4QL7A 5DJLA 3AY8A 1F3AA 1R7HA 3F8UA 1TW9A 1B48A 3U5RE 4JU5A 4CY6A 2P5QA 2WFCA 6GSXA 2HXKA 4OFMA 2X4AA 2XC2A 1U88A 3BBYA 3EMXA 5FHIA 2KUCA 4ZL9A 3UAPA 4HQZA 3TJKA 4Q5RA 3GH9A 3W8SA 5CAXA 1ZGNA 3VLNA 3LWAA 3E0UA 1OC9B 3GX8A 2LTKA 3TJBA 3RPNA 3OR5A 1SENA 1TOFA 4KE3A 2YV7A 2CVDA 3BJ5A 1XOAA 4F82A 3FZ9A 3LG6A 3MAKA 4ZBBA 4OCFA 4USSA 4ICYA 3TKRA 5AIXA 1K3LA 5DALA 2R37A 2DKIA 1FVJA 2MMZA 4LL1B 4WBRD 3C7MA 4I8BA 1AXDA 2QC7A 4PX1A 1JLVA 1PA3A 2GQLA 6GSTA 1OVNA 1GUKA 2EC4A 3IC4A 3IDVA 1C72A 2HI7A 3Q74A 2C0EA 6GSWA 4OD7A 4TR0A 1TK5B 2YOIA 4A5PA 2VCZA 4PNFA 1X5DA 16GSA 5D9WA 2VL2C 2KP1A 1JFUA 3HD5A 2NVLA 3TJJA 3N9JA 5D8IA 1GP1A 1Q98A 1PL2A 2H71A 4JRRA 4J56E 5HFKA 4MJBA 2CAQA 3H79A 5GAND 1A8YA 1EV4A 2LRNA 1Q4JA 2HRFA 4KSMA 4HZ4A 4L0WA 4K2DA 5A4VA 5JCWA 3H93A 4L5LA 5ECQB 2YWOA 1AC1A 4FYCA 3KD0A 2DJJA 3LORA 2KHPA 2H75A 1XOBA 1A0FA 5KN2A 2CX4A 1K0MA 1NHYA 4K6XA 1G6YA 3FRCA 1KBNA 1GWCA 2K8VA 1A2JA 3IBHA 2VM1A 2CQ9A 4X4JA 2V6OA 2GGTA 2A2PA 3VK9A 1XWGA 3CXGA 1T4ZA 5JCUA 1U3IA 1QK8A 4L0UA 1B9YC 5IQYA 1T3BA 3KTBA 3GKNA 1O6JA 1G7OA 1FB0A 5IPHA 4FYBA 4NXIA 2HSMA 3RHBA 2O85A 1YEXA 2PN8A 5AGYA 1GUHA 2ZNMA 2VM2A 3HDCA 1TKDB 1ST9A 3VWXA 3D21A 5ECIB 1QFNA 4I6XA 3DRNA 2KP2A 2WGRA 2QKEA 2WS2A 4IQAA 2IIYA 5AIVA 5CP1A 3BD2A 4OCEA 3CMIA 3TRPA 2K6VA 3APSA 5BMUA 4TXOA 2CX3A 2DSAA 3IXRA 4TW5A 5G2ZA 4POMA 4TR4A 2IMIA 1R4WA 2DC5A 2J23A 3ERWA 5CO3A 2HZEA 5ID2A 4EIQA 4JR6A 3ZIJA 3LEFA 3UJ1A 2ON5A 3APQA 4K2XA 2N5FA 2F9SA 5HR3A 2DKHA 5CNWA 3K8NA 2F51A 3MSZA 2C3QA 2YANA 2H1DA 5ECMB 4N0VA 2FWEA 5ECOB 1BG5A 1AIUA 1EEMA 2LJAA 4OFNA 3FKFA 2DMLA 3APOA 2XPDA 3J7Yk 2HSHA 1K0BA 3TKSC 1KNGA 4KDYA 4GWRA 4WXTA 3V1WA 2CZ3A 2IMFA 1TJDA 2IWTA 4BVXA 3CTGA 5HQPA 3GHAA 5F06A 1OYJA 2A2SA 4IKHA 4XS1A 3QMXA 4WEYA 5KEJA 1GRXA 1Z7RA 2ZUPA 1OC3A 1G6WA 5L71A 5INYA 4BVYB 4ECIA 2FWHA 1G7EA 1J9BA 3SWLA 4GSNA 1ON4A 1H4OA 3G7YA 1EP7A 4NHWA 2HYXA 3KIJA 3L9UA 4OO5A 3TDGA 2H1GA 3C73A 2PUKC 2LRCA 1XXUA 2C8UA 3DEXA 3GX0A 3GL3A 2NDOA 2JZSA 1WE0A 3HZ4A 4RI6A 2GZYA 3MWHA 1PD21 4YQUA 3CBUA 1J0FA 1B8XA 3P90A 3DMLA 3ZFBA 1DE2A 3H8QA 1O81A 3HYPA 3VPQA 4KCAA 2IN3A 2YCDA 4KDUA 1JZWA 2GSRA 1GL8A 1A24A 3UARA 1YF1A 4IELA 3GA4A 4G10A 1M2AA 4PUFC 5F05A 4RUVA 4F03A 1FG4A 4XHMA 1OAZA 3P7XA 3I43A 5ENUA 3S9FA 4OFTA 4ZB6A 4F0BA 4DSSA 2IMEA 3FR9A 4Z2RA 1FO5A 5G5EA 1S3CA 2DJKA 1YQ1A 1J08A 3DD3A 2H74A 1MEKA 4K0GA 2OE1A 1IYHA 2EIOA 1Z6NA 4ZL8A 1JZRA 1N2AA 3EE2A 2L4CA 4TVEA 5H5QA 4YH2A 4HI7A 4KW6A 4WBJA 2GTUA 1M7TA 2REMA 3DIEA 2B7JA 5ABRA 4TN8A 4NPBA 3UOMA 3A2WA 4JZQA 3ZREA 2L6CA 1E6BA 4LMVA 2R0PA 5EL8A 5GZZB 1UA5A 3LW9A 1HQOA 1URMA 1AQXA 4GLTA 1TP9A 1XIYA 1QXHA 4MNNA 3IPZA 1E2YA 4KB3A 3CTFA 3GMFA 5FWGA 1EWXA 3TJFA 3F6FA 4PQ1A 2DIYA 4KCEA 1GSSA 5CRHA 2WJUA 3F4RA 5IMZA 2ZCTA 2VIMA 3ZMKA 3NOFA 2FD3A 3WYWA 2HT9A 3E3EA 2V32A 1CQGA 4ECCA 2VUPA 3JCML 1YEPA 4FQUA 4X0XA 2FY6A 3A5IA 1GLQA 1SKRB 2M72A 2JZTA 3VI5A 3QOUA 18GSA 2I3YA 3FY7A 2WDUA 1H75A 1AW9A 13GSA 3EU3A 2L57A 4MJEA 4GSSA 1AAZA 1OC9A 2PGTA 4F0CA 4IGJA 1Z5YE 4MPGA 3Q19A 3GRXA 3HZ8A 4KNDA 2FUG2 2IPAA 1MTCA 3MYDA 1UC7A 3HVVA 1O85A 3NZNA 2AV4A 3M9KA 3VFIA 2QSIA 2VCXA 2YZHA 3ZTLA 22GSA 3IV4A 1FAAA 3PPUA 3RAZA 2HLSA 2VCWA 3WGEA 1THOA 4MK3A 2NTOA 3KMOA 3EMPA 3HVSA 2NPBA 3RPPA 2LQQA 5CRDA 2X49A 3EYTA 1XWAA 3KCMA 2HE3A 1I9DA 2C4JA 3O76A 4EL1A 1GTAA 4ZB9A 2VCVA 3DYRA 4L5OA 1X0RA 2RUFA 4IP1A 1B9XC 4RQXA 5IIZA 3FZ5A 5FT3A 3FYGA 5C00A 4PUAA 3QR6A 2H19A 5KOXA 1ZMAA 2XPEA 1ZOFA 5ECKB 2B3SA 4I2TA 2JADA 4Z7XA 4CY8A 2VD0A 5ECRB 2RM5A 5E59A 5CYYA 3EPTA 4FO5A 5IMCA 1XWKA 4DEJA 5KN3A 2I4AA 4V2NA 3F3RA 1F9MA 4MABA 4HZ2A 3A2VA 3HCZA 4O7HA 4O5QA 4CDOA 5B7CA 1PX7A 4EVMA 1O7UA 2G2QA 4EDZA 3ERFA 4L8EA 1WJKA 5DJMA 5ELGA 3FHKA 1TDIA 4EIPA 4MJCA 2MBSA 2MMOA 1IYIA 1SK0A 2R0GA 1THXA 4N30A 4K5RA 1V57A 3KMNA 2B7KA 1ILOA 3ME7A 1TRUA 3M3MA 1MDIA 2P5RA 1V98A 5JWQB 2H8LA 3DWVA 5D93A 2JU5A 5D9XA 3UBLA 2H73A 2LV3A 3FZ4A 1A23A 3UMAA 5JWRB 3KJYA 2TIRA 4XS4B 2X64A 3IAM2 2AB6A 2GZPA 3MNGA 1YKCA 1PKWA 4BWQA 1M9BA 1BAYA 4OMVA 4HEA2 4FYUA 2TRXA 2CVBA 5KN0A 2F3MA 1TI3A 1VF1A 4YKGA 4Z2UA 3HXSA 2H1BA 2IL3A 2F8AA 2H0HA 3UVHA 2VLTA 4CW9A 4EO3A 1FOVA 1M2BA 3BCKA 2OE0A 3IAS2 4MJAA 5DAKB 5G30A 4V1Ap 3WT2A 2PWJA 1ACVA 2YV9A 4KSOA 1UN2A 4EE0A 2VD1A 4EC0A 3A3TA 3IE3A 3TKPA 1HNBA 1TXXA 2OE3A 2O8VB 2MYGA 4PQHA 1TI1A 2IFQA 2ALBA 1OC8A 3ZVJA 4K7OA 3HVXA 2B1KA 2DBCA 3IR4A 3A2XA 3I6AA 2FHEA 3HHVA 3M9JA 6GSVA 1VRSD 2PU9C 4E8HA 3TJGA 3GKKA 2GQMA 1JHBA 1AUCA 5ECNB 5DCGA 2R3XA 5D73A 1X5CA 6GSYA 4BVYA 4XTSA 4MLYA 1TTZA 1M0UA 2H76A 1WMJA 4HJMA 2D2ZA 5C04A 3FR6A 19GSA 3GNJA 3VI7A 4Q5NA 4PTSA 2TRCP 3DXBA 4WR4A 5JWOB 1BYEA 2H01A 1CQHA 2HZFA 4IBPA 3ZZXA 2QA1A 1NSWA 4GXZA 2GSQA 4BPYA 2H66A 5J41A 2MMNA 3F0IA 4ZBAA 3BOAA 1SKWB 4IJIA 4N0ZA 3KM6A 1GTBA 2FWGA 2QGVA 2V2GA 1PRXA 3EINA 3ED3A 2A4HA 3CRUA 2VL3A 2IMKA 4EUYA 3CSIA 4X1UA 4I5QA 1RK4A 2JSYA 4PGTA 4PXOA 1K3OA 5DDLA 3QFBC 4BWSA 2EIQA 4PNGA 1PQNA 2H6ZA 2GZZA 4O5UA 1BJXA 3HJPA 4GCIA 4HOJA 4NWYA 1ERTA 1FB6A 2OKAA 4D73B 5EPFA 1HNCA 2R4VA 5B8AA 2X8HA 4IJ3A 3BCIA 3PR8A 3I9V2 1EZKA 4AJ7A 4NV2A 3IK7A 4O32A 2WCIA 1T7PB 4MMMA 5HR2A 2H1AA 2CVKA 4ILFA 4BL7A 2YWIA 2GSSA 1B4PA 3M0FA 1TK8B 4BVXB 1QGVA 3KH9A 2X8CA 2B5XA 4ML6A 2JL4A 2O7KA 2HSYA 1DBYA 4KGIA 3US3A 1AQVA 5ECHB 2P31A 2E2GA 3W8JA 1WIKA 4YAPA 3ZLPA 1GSDA 2JSZA 2LS5A 2J9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SBC A;  1YY7 A;  2C3N A;  3Q18 A;  2E0Q A;  3FZA A;  1NM3 A;  4K9Z A;  2AHE A;  1Y25 A;  4MA9 A;  1R5A A;  2VO4 A;  1SD9 A;  1GUM A;  5J5N A;  2EIR A;  3D5J A;  5HR1 A;  3KP8 A;  3QAV A;  1GSE A;  2DLX A;  1WRY A;  4GQF A;  1M9A A;  4ZBD A;  4RQR A;  4XIH A;  3TUE A;  3VWW A;  3ZVJ D;  4N11 A;  1A0R P;  1PSQ A;  3GTU A;  3TRX A;  3L4N A;  1VF4 A;  4TR1 A;  1A2L A;  2WUL A;  2C80 A;  3HJM A;  5ECL B;  1ERU A;  5LNK e;  1MDK A;  2X99 A;  4N10 A;  2K18 A;  3TKQ A;  5IOX A;  1EEJ A;  4NHZ A;  4Q5Q A;  4KUN A;  1F3B A;  3GYK A;  3GSS A;  3FR3 A;  1SYR A;  3TRQ A;  4POL A;  1AQW A;  4GST A;  1W4V A;  2L5O A;  4TRX A;  4IW9 A;  1FVK A;  4O92 A;  1YDK A;  3L9S A;  3F4S A;  2LEG A;  4H86 A;  2AJQ B;  3DGQ A;  3KP9 A;  1KTE A;  6GSU A;  3FW2 A;  1NHO A;  5E4W A;  3CRT A;  3KGK A;  3P2A A;  2A4V A;  5G5F A;  5EY6 A;  3GFK A;  4GTU A;  3EWL A;  3QDN A;  2I81 A;  2YJ7 A;  1UVZ A;  2H70 A;  4NMU A;  3C8E A;  1PMT A;  3KXO A;  1XW5 A;  3VPT A;  4XCS A;  1A8L A;  4ACS A;  1S3A A;  4ID0 A;  3EVI A;  4MH3 A;  3G7I A;  2I9H A;  2XBQ A;  3PGT A;  4JBB A;  1XWB A;  3PH9 A;  4WF5 A;  5J9C A;  2B6M A;  4XS6 A;  3F6D A;  5B8B A;  5IOW A;  4DSQ A;  4KA0 A;  1MD4 A;  3IA1 A;  4E8E A;  3VUR A;  2BJX A;  1NW2 A;  2X8G A;  4ZIJ A;  5D9V A;  2AAW A;  4KAE A;  4ECB A;  1ABA A;  2YWN A;  2B1L A;  5F07 A;  4ECJ A;  1HD2 A;  5G1K A;  2MMA A;  4MF6 A;  1LU4 A;  4POK A;  1SK2 A;  3HJO A;  4HU9 A;  2H30 A;  5B6M A;  3QD9 A;  2O89 A;  3RHC A;  3Q6O A;  1SKS B;  4HUA A;  3L78 A;  2CT6 A;  4KDX A;  2LUS A;  3TOT A;  4MF7 A;  4KH7 A;  1PKZ A;  1B4Q A;  3TKS E;  3F3Q A;  2RM6 A;  1HNA A;  1T4Y A;  4IP6 A;  4TXV A;  1EGO A;  5HFI A;  2B5Y A;  4IQ1 A;  4V1A g;  1S3D A;  1O8W A;  1ERV A;  3UBK A;  2A2R A;  2YN1 A;  5CRW A;  2OBK A;  4JR4 A;  3UEM A;  4XRD A;  3TCO A;  1YZX A;  2WZ9 A;  2VCT A;  2DMM A;  4MZB A;  2H72 A;  3ZL5 A;  4HJ2 A;  2LNS A;  5LCZ A;  1MD3 A;  2FWF A;  3QFA C;  4WF4 A;  2LRT A;  3DVW A;  3G7J A;  4MH2 A;  3UVT A;  4XS4 A;  3CSJ A;  5D96 A;  2PMT A;  3G9B A;  1R26 A;  4J57 E;  1SL2 B;  4Q5F A;  1U87 A;  12GS A;  1TK0 B;  3DVX A;  4NV5 A;  3ZIT A;  3D0Z A;  5IO0 A;  1X9S B;  2VAF A;  2VL2 A;  1QMV A;  1GSF A;  2LJR A;  5DQY A;  4MF5 A;  4ISD A;  3LJR A;  4WR5 A;  1GSY A;  3WGD A;  2I1U A;  1K0O A;  2L59 A;  5COH A;  1F6M C;  1BED A;  1K0D A;  2CA8 A;  4ML1 A;  3KTL A;  5DAK A;  2BMX A;  14GS A;  3A5W A;  5J9B A;  4MCU A;  4ULX A;  1TRW A;  1HYU A;  2L4Q A;  2PER A;  1EOG A;  3LXZ A;  1K0C A;  5J4U A;  3LGC A;  4RI7 A;  1EV9 A;  5DAL B;  3ZRD A;  3R2Q A;  1N8J A;  1ZCP A;  2PBJ A;  1SJI A;  2M46 A;  3F63 A;  1XFL A;  2E2M A;  1F2E A;  3ZFL A;  4IHU A;  4GRF A;  5IPG A;  1SU9 A;  2MZC A;  1V58 A;  4MP4 A;  4G9H A;  3GH6 A;  2PPT A;  5ECS A;  5H5S A;  4AJ8 A;  3H1N A;  4HU7 A;  3U6V A;  3N5O A;  2GDR A;  1GNW A;  4AJ6 A;  5DQS A;  3F4T A;  1U3A A;  2ON7 A;  3QCP A;  1XCC A;  2RII A;  4LL4 B;  1V9W A;  1EGR A;  3ME8 A;  1W89 A;  3GL5 A;  3RBT A;  5HR0 A;  4I2U A;  3WD6 A;  6GSS A;  2HFD A;  2HRN A;  8GSS A;  1ERW A;  1VF3 A;  1Z3E A;  2GQK A;  2AUV A;  2YP6 A;  1GUL A;  1FW1 A;  3VWU A;  5DCH A;  1Z9H A;  4ZIL A;  2C1Y A;  5IMA A;  2OA7 A;  1EP8 A;  1R5P A;  5J3R A;  2FCH A;  2PVO C;  5A5K A;  5DBQ A;  2N5B A;  1TRV A;  4PUR A;  1WPI A;  3QPM A;  3EUR A;  3IHQ A;  2XBI A;  1QQ2 A;  5EVO A;  5IMD A;  1K0A A;  3LSZ A;  1Z6M A;  2YWM A;  3QAW A;  2C0D A;  1SD8 A;  1BX9 A;  4CHS A;  1TRS A;  2GST A;  2YPM A;  3EU4 A;  3D22 A;  4G19 A;  3L0H A;  2DJ2 A;  1XBS A;  2FNO A;  2CV4 A;  1ML6 A;  1X5E A;  2PVQ A;  4JE1 A;  3UL3 A;  5B6N A;  5H5R A;  1GNE A;  2G0F A;  3D4M A;  3KEB A;  4D73 A;  2H6Y A;  1SK1 A;  1X9W B;  2FA8 A;  3L9V A;  3ZYW A;  4MZC A;  4IVF A;  3MDK A;  3TKS A;  4ZL7 A;  1GTU A;  2VOC A;  2WRT A;  1GTI A;  4XRA A;  4V2L A;  5CRG A;  5D9T A;  1VF2 A;  1T1V A;  2IFQ B;  5HFG A;  2R5G A;  3IOS A;  1V2A A;  1SL0 B;  2VCQ A;  3LYP A;  2OAC A;  3TOU A;  4ZXG A;  3M1G A;  4TXO B;  4AF2 A;  3HA9 A;  1O8X A;  3O3T A;  1K3Y A;  2DIZ A;  2H0G A;  2K9F A;  1M2D A;  3C1S A;  1V40 A;  1Y6E A;  3GN3 A;  4GQC A;  5ID2 B;  4LLR A;  2HZE B;  4DSR A;  5KN1 A;  5G31 A;  4J2F A;  4K0N A;  4AGS A;  4K7I A;  1M99 A;  1WOU A;  5JCG A;  11GS A;  5IO2 A;  4JED A;  4HDE A;  2LJK A;  3VWV A;  1KEB A;  4F2I A;  2JAC A;  1T00 A;  2DJ1 A;  2XHF A;  2GS3 A;  3GUS A;  1MDJ A;  5ELA A;  1YKA A;  1U6T A;  1PN9 A;  3GKX A;  4FIW A;  1GSQ A;  3I69 A;  1BQ7 A;  4PQI A;  2YNX A;  1TU8 A;  2IJY A;  3O6T A;  17GS A;  2R6K A;  3KH7 A;  1OKT A;  2OAD A;  5AN1 A;  1SL1 B;  3TB2 A;  3LXT A;  5A4U A;  9GSS A;  4LA1 A;  1PX6 A;  2VL9 A;  2AYT A;  5LD0 A;  20GS A;  1OKD A;  1XVQ A;  2L5L A;  2GVP A;  7GSS A;  3FK8 A;  3C71 A;  1A2M A;  3RDW A;  1T8E B;  2RUE A;  1YF0 A;  4DVC A;  3IK9 A;  1XW9 A;  1PGT A;  3ERG A;  3QAG A;  5IM9 A;  2YJH A;  1WP0 A;  5G1L A;  4MPF A;  1K0N A;  3P8W A;  1DE1 A;  3WT1 A;  1TU7 A;  1GH2 A;  2DJ3 A;  2V1M A;  5GAP D;  1G0T A;  3CSH A;  2H0I A;  4HQS A;  3PIN A;  2JZR A;  1ZZY A;  1XPV A;  2H6X A;  2DJ0 A;  4LMW A;  3LFL A;  4V2M A;  5F0G A;  3CYN A;  4QL9 A;  1I5G A;  3J7Y b;  2FA4 A;  2KLX A;  4FH8 A;  2MBT A;  3E9J B;  4F9Z A;  1X9M B;  3LYK A;  4KX4 A;  4MZW A;  3C1R A;  2LKU A;  3KZQ A;  1XWC A;  3D4T A;  1USB A;  2FLS A;  5AIS A;  2YZU A;  4TR3 A;  3WGX A;  5IMV A;  1XZO A;  3ISO A;  1DUG A;  1QUW A;  5GSS A;  4TOP A;  2R2J A;  2HNL A;  2NBS A;  4NAX A;  4YQV A;  4ZB8 A;  10GS A;  4EXJ A;  4IN0 A;  2K8S A;  4K7N A;  3GKM A;  1ZYQ B;  1PL1 A;  5A4W A;  1WWJ A;  1SYX A;  3HKR A;  3TGZ A;  4OO4 A;  3EC3 A;  4G2E A;  2Z9S A;  4K1F A;  2V41 A;  2L6D A;  1RQM A;  4DSS B;  2C0G A;  4QQ7 A;  4EDY A;  2M80 A;  1SJ6 A;  5DVB A;  4O5R A;  5CRE A;  1JLW A;  2V6K A;  1JZO A;  1GLP A;  1YJ6 A;  4IS0 A;  2LNT A;  2CAI A;  3GST A;  1XVW A;  2BTO T;  2C3T A;  2OBI A;  2B5E A;  4EF0 A;  3GUR A;  1FHE A;  1JZD A;  3ZIV A;  4P3Y B;  3IRA A;  1SJZ A;  2LST A;  2ES7 A;  2FGX A;  3GV1 A;  2RLI A;  4POB A;  5IMF A;  2GT6 A;  4X43 A;  1O73 A;  2KOK A;  4WKW A;  3LQ7 A;  4HS1 A;  3GTU B;  3HY2 A;  4WET A;  4MDC A;  3DKS A;  2VLU A;  2VLV A;  4TR1 B;  4GF0 A;  1ZYE A;  3GIX A;  2GLR A;  3F9U A;  1ZL9 A;  1GSU A;  3NIV A;  4OWY A;  1LJR A;  3M8N A;  4TKY A;  3D6I A;  4K8M A;  2O87 A;  2WB9 A;  1Z7P A;  3H4K A;  2OJL A;  1OE8 A;  3UIW A;  4EKZ A;  1DSB A;  4YQM A;  2P0G A;  2N5A A;  1OE7 A;  3FEU A;  1VGL A;  3ZML A;  1LBK A;  5GST A;  4BA7 A;  2LQO A;  1EOH A;  1F37 A;  3W6G A;  4I97 A;  2F8F A;  1XW6 A;  4YAV A;  2GT5 A;  1RW1 A;  2CZ2 A;  2E7P A;  2C0F A;  5ECP B;  2IMD A;  5F8B A;  4QL7 A;  5DJL A;  3AY8 A;  1F3A A;  1R7H A;  3F8U A;  1TW9 A;  1B48 A;  3U5R E;  4JU5 A;  2P5Q A;  2WFC A;  6GSX A;  2HXK A;  4OFM A;  3BBY A;  2XC2 A;  1U88 A;  3EMX A;  5FHI A;  2KUC A;  4ZL9 A;  3UAP A;  4HQZ A;  3TJK A;  4Q5R A;  3GH9 A;  3W8S A;  5CAX A;  1ZGN A;  3VLN A;  3LWA A;  3E0U A;  1OC9 B;  3GX8 A;  2LTK A;  3TJB A;  3RPN A;  3OR5 A;  1SEN A;  1TOF A;  4KE3 A;  2YV7 A;  2CVD A;  3BJ5 A;  1XOA A;  4F82 A;  3FZ9 A;  3LG6 A;  3MAK A;  4ZBB A;  4OCF A;  3TKR A;  5AIX A;  1K3L A;  5DAL A;  2R37 A;  1FVJ A;  2MMZ A;  4LL1 B;  4WBR D;  3C7M A;  4I8B A;  1AXD A;  2QC7 A;  4PX1 A;  1JLV A;  1PA3 A;  2GQL A;  6GST A;  1OVN A;  1GUK A;  2EC4 A;  3IC4 A;  3IDV A;  1C72 A;  2HI7 A;  3Q74 A;  2C0E A;  6GSW A;  4OD7 A;  4TR0 A;  1TK5 B;  2YOI A;  2VCZ A;  4PNF A;  1X5D A;  16GS A;  5D9W A;  2VL2 C;  2KP1 A;  1JFU A;  3HD5 A;  2NVL A;  3TJJ A;  3N9J A;  5D8I A;  1GP1 A;  1Q98 A;  1PL2 A;  2H71 A;  4JRR A;  4J56 E;  5HFK A;  4MJB A;  2CAQ A;  3H79 A;  5GAN D;  1A8Y A;  1EV4 A;  2LRN A;  1Q4J A;  2HRF A;  4KSM A;  4HZ4 A;  4L0W A;  4K2D A;  5A4V A;  5JCW A;  3H93 A;  4L5L A;  5ECQ B;  2YWO A;  1AC1 A;  4FYC A;  3KD0 A;  2DJJ A;  3LOR A;  2KHP A;  2H75 A;  1XOB A;  1A0F A;  5KN2 A;  2CX4 A;  1K0M A;  1NHY A;  4K6X A;  1G6Y A;  3FRC A;  1KBN A;  1GWC A;  2K8V A;  1A2J A;  3IBH A;  2VM1 A;  2CQ9 A;  2V6O A;  2GGT A;  3VK9 A;  1XWG A;  3CXG A;  1T4Z A;  5JCU A;  1U3I A;  1QK8 A;  4L0U A;  1B9Y C;  5IQY A;  1T3B A;  3KTB A;  3GKN A;  1O6J A;  1G7O A;  1FB0 A;  5IPH A;  4FYB A;  4NXI A;  3RHB A;  2O85 A;  1YEX A;  2PN8 A;  5AGY A;  1GUH A;  2ZNM A;  2VM2 A;  3HDC A;  1TKD B;  1ST9 A;  3VWX A;  3D21 A;  5ECI B;  1QFN A;  4I6X A;  3DRN A;  2KP2 A;  2WGR A;  2QKE A;  2WS2 A;  4IQA A;  2IIY A;  5AIV A;  5CP1 A;  3BD2 A;  4OCE A;  3CMI A;  3TRP A;  2K6V A;  3APS A;  4TXO A;  2CX3 A;  2DSA A;  3IXR A;  4TW5 A;  5G2Z A;  4POM A;  4TR4 A;  2IMI A;  1R4W A;  2DC5 A;  2J23 A;  3ERW A;  5CO3 A;  2HZE A;  5ID2 A;  4JR6 A;  3ZIJ A;  3LEF A;  3UJ1 A;  2ON5 A;  3APQ A;  2N5F A;  2F9S A;  5HR3 A;  5CNW A;  3K8N A;  2F51 A;  3MSZ A;  2C3Q A;  2YAN A;  2H1D A;  5ECM B;  4N0V A;  2FWE A;  5ECO B;  1BG5 A;  1AIU A;  1EEM A;  2LJA A;  4OFN A;  3FKF A;  2DML A;  3APO A;  2XPD A;  3J7Y k;  2HSH A;  1K0B A;  3TKS C;  1KNG A;  4KDY A;  4GWR A;  4WXT A;  3V1W A;  2CZ3 A;  2IMF A;  1TJD A;  2IWT A;  4BVX A;  3CTG A;  5HQP A;  3GHA A;  5F06 A;  1OYJ A;  2A2S A;  4IKH A;  4XS1 A;  3QMX A;  4WEY A;  5KEJ A;  1GRX A;  1Z7R A;  2ZUP A;  1OC3 A;  1G6W A;  5L71 A;  5INY A;  4ECI A;  1G7E A;  2FWH A;  1J9B A;  3SWL A;  4GSN A;  1ON4 A;  1H4O A;  3G7Y A;  1EP7 A;  4NHW A;  2HYX A;  3KIJ A;  3L9U A;  4OO5 A;  3TDG A;  2H1G A;  3C73 A;  2PUK C;  2LRC A;  1XXU A;  2C8U A;  3DEX A;  3GX0 A;  3GL3 A;  2NDO A;  2JZS A;  1WE0 A;  3HZ4 A;  4RI6 A;  2GZY A;  3MWH A;  1PD2 1;  4YQU A;  3CBU A;  1J0F A;  1B8X A;  3P90 A;  3DML A;  3ZFB A;  1DE2 A;  3H8Q A;  1O81 A;  3HYP A;  3VPQ A;  4KCA A;  2IN3 A;  2YCD A;  4KDU A;  1JZW A;  2GSR A;  1GL8 A;  1A24 A;  3UAR A;  1YF1 A;  4IEL A;  3GA4 A;  4G10 A;  1M2A A;  4PUF C;  5F05 A;  4RUV A;  4F03 A;  1FG4 A;  4XHM A;  1OAZ A;  3P7X A;  3I43 A;  5ENU A;  3S9F A;  4OFT A;  4ZB6 A;  4F0B A;  4DSS A;  2IME A;  3FR9 A;  1FO5 A;  5G5E A;  1S3C A;  2DJK A;  1YQ1 A;  1J08 A;  3DD3 A;  2H74 A;  1MEK A;  4K0G A;  2OE1 A;  1IYH A;  2EIO A;  1Z6N A;  4ZL8 A;  1JZR A;  1N2A A;  3EE2 A;  2L4C A;  4TVE A;  5H5Q A;  4YH2 A;  4HI7 A;  4KW6 A;  4WBJ A;  2GTU A;  1M7T A;  2REM A;  3DIE A;  2B7J A;  5ABR A;  4TN8 A;  4NPB A;  3UOM A;  3A2W A;  4JZQ A;  3ZRE A;  2L6C A;  1E6B A;  4LMV A;  5EL8 A;  5GZZ B;  1UA5 A;  1HQO A;  1URM A;  1AQX A;  4GLT A;  1TP9 A;  1XIY A;  1QXH A;  3IPZ A;  1E2Y A;  4KB3 A;  3CTF A;  3GMF A;  5FWG A;  1EWX A;  3TJF A;  3F6F A;  4PQ1 A;  2DIY A;  4KCE A;  1GSS A;  5CRH A;  2WJU A;  3F4R A;  5IMZ A;  2ZCT A;  2VIM A;  3ZMK A;  3NOF A;  2FD3 A;  3WYW A;  2HT9 A;  3E3E A;  2V32 A;  1CQG A;  4ECC A;  2VUP A;  3JCM L;  1YEP A;  4X0X A;  2FY6 A;  1GLQ A;  1SKR B;  2M72 A;  2JZT A;  3VI5 A;  3QOU A;  18GS A;  2I3Y A;  3FY7 A;  2WDU A;  1H75 A;  1AW9 A;  13GS A;  3EU3 A;  2L57 A;  4MJE A;  4GSS A;  1AAZ A;  1OC9 A;  2PGT A;  4F0C A;  4IGJ A;  1Z5Y E;  4MPG A;  3Q19 A;  3GRX A;  3HZ8 A;  4KND A;  2FUG 2;  2IPA A;  1MTC A;  1UC7 A;  3HVV A;  1O85 A;  3NZN A;  2AV4 A;  3M9K A;  3VFI A;  2QSI A;  2VCX A;  2YZH A;  3ZTL A;  22GS A;  3IV4 A;  1FAA A;  3RAZ A;  2HLS A;  2VCW A;  3WGE A;  1THO A;  4MK3 A;  2NTO A;  3KMO A;  3EMP A;  3HVS A;  2NPB A;  3RPP A;  2LQQ A;  5CRD A;  3EYT A;  1XWA A;  3KCM A;  2HE3 A;  1I9D A;  2C4J A;  3O76 A;  4EL1 A;  1GTA A;  4ZB9 A;  2VCV A;  3DYR A;  4L5O A;  1X0R A;  2RUF A;  4IP1 A;  1B9X C;  4RQX A;  5IIZ A;  3FZ5 A;  5FT3 A;  3FYG A;  5C00 A;  4PUA A;  3QR6 A;  2H19 A;  1ZMA A;  2XPE A;  1ZOF A;  5ECK B;  2B3S A;  4I2T A;  2JAD A;  4Z7X A;  2VD0 A;  5ECR B;  2RM5 A;  5E59 A;  5CYY A;  4FO5 A;  5IMC A;  1XWK A;  4DEJ A;  5KN3 A;  2I4A A;  4V2N A;  3F3R A;  1F9M A;  4MAB A;  4HZ2 A;  3A2V A;  3HCZ A;  4O7H A;  4CDO A;  5B7C A;  1PX7 A;  4EVM A;  1O7U A;  2G2Q A;  4EDZ A;  3ERF A;  4L8E A;  1WJK A;  5DJM A;  5ELG A;  3FHK A;  1TDI A;  4MJC A;  2MBS A;  2MMO A;  1IYI A;  1SK0 A;  1THX A;  4N30 A;  1V57 A;  3KMN A;  2B7K A;  1ILO A;  3ME7 A;  1TRU A;  3M3M A;  1MDI A;  2P5R A;  1V98 A;  5JWQ B;  2H8L A;  3DWV A;  5D93 A;  2JU5 A;  5D9X A;  3UBL A;  2H73 A;  2LV3 A;  3FZ4 A;  1A23 A;  3UMA A;  5JWR B;  3KJY A;  2TIR A;  4XS4 B;  2X64 A;  3IAM 2;  2AB6 A;  2GZP A;  3MNG A;  1YKC A;  1PKW A;  4BWQ A;  1M9B A;  1BAY A;  4OMV A;  4HEA 2;  4FYU A;  2TRX A;  2CVB A;  5KN0 A;  2F3M A;  1TI3 A;  1VF1 A;  3HXS A;  2H1B A;  2IL3 A;  2F8A A;  2H0H A;  3UVH A;  2VLT A;  4CW9 A;  4EO3 A;  1FOV A;  1M2B A;  3BCK A;  2OE0 A;  3IAS 2;  4MJA A;  5DAK B;  5G30 A;  4V1A p;  3WT2 A;  2PWJ A;  1ACV A;  2YV9 A;  4KSO A;  1UN2 A;  4EE0 A;  2VD1 A;  4EC0 A;  3A3T A;  3IE3 A;  3TKP A;  1HNB A;  1TXX A;  2OE3 A;  2O8V B;  2MYG A;  4PQH A;  1TI1 A;  2IFQ A;  2ALB A;  1OC8 A;  3ZVJ A;  4K7O A;  3HVX A;  2B1K A;  2DBC A;  3IR4 A;  3A2X A;  3I6A A;  2FHE A;  3HHV A;  3M9J A;  6GSV A;  1VRS D;  2PU9 C;  4E8H A;  3TJG A;  3GKK A;  2GQM A;  1JHB A;  1AUC A;  5ECN B;  5DCG A;  2R3X A;  5D73 A;  1X5C A;  6GSY A;  4BVY A;  4XTS A;  4MLY A;  1TTZ A;  1M0U A;  2H76 A;  1WMJ A;  4HJM A;  2D2Z A;  5C04 A;  3FR6 A;  19GS A;  3GNJ A;  3VI7 A;  4Q5N A;  2TRC P;  3DXB A;  4WR4 A;  5JWO B;  1BYE A;  2H01 A;  1CQH A;  2HZF A;  4IBP A;  3ZZX A;  1NSW A;  4GXZ A;  2GSQ A;  4BPY A;  2H66 A;  5J41 A;  2MMN A;  3F0I A;  4ZBA A;  3BOA A;  1SKW B;  4IJI A;  4N0Z A;  3KM6 A;  1GTB A;  2FWG A;  2QGV A;  2V2G A;  1PRX A;  3EIN A;  3ED3 A;  3CRU A;  2VL3 A;  2IMK A;  4EUY A;  3CSI A;  4X1U A;  4I5Q A;  1RK4 A;  2JSY A;  4PGT A;  4PXO A;  1K3O A;  5DDL A;  3QFB C;  4BWS A;  2EIQ A;  4PNG A;  1PQN A;  2H6Z A;  2GZZ A;  1BJX A;  3HJP A;  4GCI A;  4HOJ A;  4NWY A;  1ERT A;  1FB6 A;  2OKA A;  4D73 B;  5EPF A;  1HNC A;  2R4V A;  5B8A A;  2X8H A;  4IJ3 A;  3BCI A;  3PR8 A;  3I9V 2;  1EZK A;  4AJ7 A;  4NV2 A;  3IK7 A;  4O32 A;  2WCI A;  1T7P B;  4MMM A;  5HR2 A;  2H1A A;  2CVK A;  4ILF A;  4BL7 A;  2YWI A;  2GSS A;  1B4P A;  3M0F A;  1TK8 B;  1QGV A;  3KH9 A;  2X8C A;  2B5X A;  4ML6 A;  2JL4 A;  2O7K A;  2HSY A;  1DBY A;  4KGI A;  3US3 A;  1AQV A;  5ECH B;  2P31 A;  2E2G A;  3W8J A;  1WIK A;  4YAP A;  3ZLP A;  1GSD A;  2JSZ A;  2LS5 A;  2J9H A; 
#chains in the Genus database with same CATH topology
 3SBC A;  1YY7 A;  2C3N A;  3Q18 A;  3IHG A;  2E0Q A;  3FZA A;  1NM3 A;  4K9Z A;  2AHE A;  1Y25 A;  4MA9 A;  1R5A A;  2VO4 A;  1SD9 A;  1GUM A;  5J5N A;  2EIR A;  3D5J A;  5HR1 A;  3FMW A;  3KP8 A;  3QAV A;  1GSE A;  2DLX A;  1WRY A;  4GQF A;  1M9A A;  4ZBD A;  4RQR A;  4XIH A;  3TUE A;  4KF9 A;  3VWW A;  3ZVJ D;  4N11 A;  1A0R P;  1PSQ A;  3GTU A;  3TRX A;  3L4N A;  1VF4 A;  4TR1 A;  1A2L A;  2WUL A;  2C80 A;  3HJM A;  5ECL B;  1ERU A;  5LNK e;  1MDK A;  2X99 A;  4N10 A;  2K18 A;  3TKQ A;  5IOX A;  1EEJ A;  4NHZ A;  4Q5Q A;  4KUN A;  1F3B A;  3GYK A;  3GSS A;  3FR3 A;  1SYR A;  3TRQ A;  4POL A;  1AQW A;  4GST A;  1W4V A;  2L5O A;  4TRX A;  4IW9 A;  1FVK A;  4O92 A;  1YDK A;  3L9S A;  3F4S A;  2LEG A;  4H86 A;  2AJQ B;  3DGQ A;  3KP9 A;  1KTE A;  6GSU A;  3FW2 A;  1NHO A;  3CRT A;  5E4W A;  3KGK A;  3P2A A;  2A4V A;  5G5F A;  5EY6 A;  3GFK A;  4GTU A;  3EWL A;  3QDN A;  2I81 A;  2YJ7 A;  1UVZ A;  2H70 A;  4NMU A;  3C8E A;  1PMT A;  3KXO A;  1XW5 A;  3VPT A;  5BRT A;  4XCS A;  1A8L A;  4ACS A;  4G0K A;  1S3A A;  4ID0 A;  3EVI A;  4MH3 A;  3G7I A;  2I9H A;  2XBQ A;  3PGT A;  4JBB A;  1XWB A;  3PH9 A;  4WF5 A;  5J9C A;  1S3R A;  2B6M A;  4XS6 A;  3F6D A;  5B8B A;  5IOW A;  4DSQ A;  4KA0 A;  1MD4 A;  3IA1 A;  4E8E A;  3VUR A;  4Z2T A;  2BJX A;  1NW2 A;  1PN0 A;  2X8G A;  4ZIJ A;  5D9V A;  2AAW A;  4KAE A;  4ECB A;  1ABA A;  2YWN A;  2B1L A;  5F07 A;  4ECJ A;  1HD2 A;  5G1K A;  2MMA A;  4MF6 A;  1LU4 A;  4POK A;  1SK2 A;  3HJO A;  4HU9 A;  2H30 A;  5B6M A;  3QD9 A;  2O89 A;  3RHC A;  3Q6O A;  1SKS B;  4HUA A;  3L78 A;  2CT6 A;  4KDX A;  2LUS A;  3TOT A;  4MF7 A;  4KH7 A;  1PKZ A;  3R3E A;  1B4Q A;  3TKS E;  3F3Q A;  3MIX A;  2RM6 A;  1HNA A;  1T4Y A;  4IP6 A;  4TXV A;  1EGO A;  5HFI A;  2B5Y A;  4IQ1 A;  4V1A g;  1S3D A;  1O8W A;  1ERV A;  3UBK A;  2A2R A;  2YN1 A;  5CRW A;  2OBK A;  4JR4 A;  3UEM A;  4XRD A;  1XG8 A;  4G0L A;  3TCO A;  1YZX A;  2WZ9 A;  2VCT A;  2DMM A;  4MZB A;  2H72 A;  3ZL5 A;  4HJ2 A;  2LNS A;  5LCZ A;  1MD3 A;  2FWF A;  3QFA C;  4WF4 A;  2LRT A;  3DVW A;  3G7J A;  4MH2 A;  3UVT A;  4XS4 A;  3CSJ A;  5D96 A;  2PMT A;  3G9B A;  1R26 A;  4J57 E;  1SL2 B;  4Q5F A;  1U87 A;  12GS A;  1TK0 B;  3DVX A;  4NV5 A;  3ZIT A;  3D0Z A;  5IO0 A;  1X9S B;  2VAF A;  2VL2 A;  1QMV A;  1GSF A;  2LJR A;  5DQY A;  4MF5 A;  4ISD A;  3LJR A;  4WR5 A;  1GSY A;  3WGD A;  2I1U A;  1K0O A;  2L59 A;  5COH A;  1F6M C;  1BED A;  1K0D A;  2CA8 A;  4ML1 A;  3KTL A;  5DAK A;  2BMX A;  14GS A;  3A5W A;  5J9B A;  4MCU A;  4ULX A;  1TRW A;  1HYU A;  2L4Q A;  2PER A;  1EOG A;  3LXZ A;  1K0C A;  5J4U A;  3LGC A;  4RI7 A;  1EV9 A;  5DAL B;  3ZRD A;  3R2Q A;  1N8J A;  1ZCP A;  2PBJ A;  1SJI A;  2M46 A;  3F63 A;  1XFL A;  2E2M A;  1F2E A;  3ZFL A;  4IHU A;  4GRF A;  5IPG A;  1SU9 A;  2MZC A;  1V58 A;  4MP4 A;  4G9H A;  3GH6 A;  2PPT A;  5ECS A;  5H5S A;  4AJ8 A;  3H1N A;  4HU7 A;  3U6V A;  3N5O A;  2GDR A;  1GNW A;  4AJ6 A;  5DQS A;  3F4T A;  1U3A A;  2ON7 A;  3QCP A;  1XCC A;  2RII A;  4K5S A;  4LL4 B;  1V9W A;  1EGR A;  3ME8 A;  1W89 A;  3GL5 A;  3RBT A;  5HR0 A;  4I2U A;  3WD6 A;  6GSS A;  2HFD A;  2HRN A;  8GSS A;  1ERW A;  1VF3 A;  1Z3E A;  2GQK A;  2AUV A;  2YP6 A;  1GUL A;  1FW1 A;  3VWU A;  5DCH A;  1Z9H A;  4ZIL A;  2C1Y A;  5IMA A;  2OA7 A;  1EP8 A;  1R5P A;  5J3R A;  2FCH A;  2PVO C;  5A5K A;  5DBQ A;  2N5B A;  1TRV A;  4PUR A;  1WPI A;  3QPM A;  3EUR A;  3IHQ A;  2XBI A;  1QQ2 A;  5EVO A;  5IMD A;  1K0A A;  3LSZ A;  1Z6M A;  2YWM A;  3QAW A;  2C0D A;  1SD8 A;  1BX9 A;  4CHS A;  1TRS A;  2GST A;  2YPM A;  3EU4 A;  3D22 A;  4G19 A;  3L0H A;  2DJ2 A;  1XBS A;  2QA2 A;  2FNO A;  2CV4 A;  1ML6 A;  1X5E A;  2PVQ A;  4JE1 A;  3UL3 A;  5B6N A;  5H5R A;  1GNE A;  4YKF A;  2G0F A;  3CQF A;  3D4M A;  3KEB A;  4D73 A;  2H6Y A;  1SK1 A;  1X9W B;  2FA8 A;  3L9V A;  3ZYW A;  4MZC A;  4IVF A;  1FOH A;  3MDK A;  3TKS A;  4ZL7 A;  1GTU A;  2VOC A;  2WRT A;  1GTI A;  4XRA A;  4V2L A;  5CRG A;  5D9T A;  1VF2 A;  1T1V A;  2IFQ B;  5HFG A;  2R5G A;  3IOS A;  1V2A A;  1SL0 B;  2VCQ A;  3LYP A;  2OAC A;  3TOU A;  2UZ8 A;  4ZXG A;  3M1G A;  4TXO B;  4AF2 A;  3HA9 A;  1O8X A;  3O3T A;  1K3Y A;  2DIZ A;  2H0G A;  2K9F A;  1M2D A;  3C1S A;  1V40 A;  1Y6E A;  3GN3 A;  4GQC A;  5ID2 B;  4LLR A;  2HZE B;  4DSR A;  5KN1 A;  5G31 A;  4J2F A;  4K0N A;  4AGS A;  4K7I A;  1M99 A;  1WOU A;  5JCG A;  11GS A;  5IO2 A;  4JED A;  4HDE A;  2LJK A;  3VWV A;  1KEB A;  4F2I A;  2JAC A;  1T00 A;  2DJ1 A;  3IC8 A;  2XHF A;  2GS3 A;  3GUS A;  1MDJ A;  5ELA A;  1YKA A;  1U6T A;  1PN9 A;  3GKX A;  4FIW A;  1GSQ A;  3I69 A;  1BQ7 A;  4PQI A;  2YNX A;  1TU8 A;  2IJY A;  3O6T A;  17GS A;  2R6K A;  3KH7 A;  1OKT A;  2OAD A;  5AN1 A;  1SL1 B;  3TB2 A;  3LXT A;  5A4U A;  9GSS A;  4LA1 A;  2R0C A;  1PX6 A;  2VL9 A;  2AYT A;  5LD0 A;  20GS A;  1OKD A;  1XVQ A;  2L5L A;  2GVP A;  7GSS A;  3FK8 A;  3C71 A;  1A2M A;  3RDW A;  1T8E B;  2RUE A;  1YF0 A;  4DVC A;  3IK9 A;  1XW9 A;  1PGT A;  3ERG A;  3QAG A;  5IM9 A;  2YJH A;  1WP0 A;  5G1L A;  4MPF A;  1K0N A;  3P8W A;  1DE1 A;  3WT1 A;  1TU7 A;  1GH2 A;  1ZYP A;  2DJ3 A;  2V1M A;  5GAP D;  1G0T A;  3CSH A;  2H0I A;  4HQS A;  3PIN A;  2JZR A;  1ZZY A;  1XPV A;  2H6X A;  2DJ0 A;  4LMW A;  3LFL A;  2HRK A;  4V2M A;  5F0G A;  3CYN A;  4QL9 A;  1I5G A;  3J7Y b;  2FA4 A;  2KLX A;  4FH8 A;  2MBT A;  3E9J B;  4F9Z A;  1X9M B;  3LYK A;  4KX4 A;  4MZW A;  3C1R A;  2LKU A;  3KZQ A;  1XWC A;  3D4T A;  1USB A;  2FLS A;  5AIS A;  2YZU A;  4BL7 B;  4TR3 A;  3WGX A;  5IMV A;  1XZO A;  3ISO A;  1DUG A;  1QUW A;  5GSS A;  4TOP A;  2R2J A;  2HNL A;  2NBS A;  4NAX A;  4YQV A;  4ZB8 A;  10GS A;  4EXJ A;  4IN0 A;  2K8S A;  4K7N A;  3GKM A;  1ZYQ B;  5KOW A;  1PL1 A;  5A4W A;  1WWJ A;  1SYX A;  3HKR A;  3TGZ A;  4OO4 A;  3EC3 A;  4G2E A;  2Z9S A;  4K1F A;  2V41 A;  2L6D A;  1RQM A;  4DSS B;  2C0G A;  4QQ7 A;  4EDY A;  2M80 A;  1SJ6 A;  5DVB A;  4O5R A;  5CRE A;  1JLW A;  2V6K A;  1JZO A;  1GLP A;  1YJ6 A;  4IS0 A;  1ZYN A;  2LNT A;  2CAI A;  3GST A;  1XVW A;  2BTO T;  2C3T A;  2OBI A;  2B5E A;  4EF0 A;  3GUR A;  1FHE A;  1JZD A;  3ZIV A;  4P3Y B;  3IRA A;  1SJZ A;  2LST A;  2ES7 A;  2FGX A;  3GV1 A;  2RLI A;  4G0I A;  4POB A;  5IMF A;  2GT6 A;  4X43 A;  1O73 A;  2KOK A;  4WKW A;  3LQ7 A;  4HS1 A;  3GTU B;  3HY2 A;  4WET A;  4BIK A;  4MDC A;  3DKS A;  2VLU A;  2VLV A;  4TR1 B;  4GF0 A;  1ZYE A;  3GIX A;  2GLR A;  3F9U A;  1ZL9 A;  1GSU A;  3NIV A;  4OWY A;  1LJR A;  3M8N A;  4TKY A;  3D6I A;  4K8M A;  2O87 A;  2WB9 A;  1Z7P A;  3H4K A;  2OJL A;  1OE8 A;  2HRA A;  3UIW A;  4EKZ A;  1DSB A;  4YQM A;  2P0G A;  2N5A A;  1OE7 A;  3FEU A;  1VGL A;  3ZML A;  1LBK A;  5GST A;  4BA7 A;  2LQO A;  1EOH A;  1F37 A;  3W6G A;  4I97 A;  2F8F A;  1XW6 A;  4YAV A;  2GT5 A;  1RW1 A;  2CZ2 A;  2E7P A;  2C0F A;  5ECP B;  2IMD A;  5F8B A;  4QL7 A;  5DJL A;  3AY8 A;  1F3A A;  1R7H A;  3F8U A;  1TW9 A;  1B48 A;  3U5R E;  4JU5 A;  4CY6 A;  2P5Q A;  2WFC A;  6GSX A;  2HXK A;  4OFM A;  2X4A A;  2XC2 A;  1U88 A;  3BBY A;  3EMX A;  5FHI A;  2KUC A;  4ZL9 A;  3UAP A;  4HQZ A;  3TJK A;  4Q5R A;  3GH9 A;  3W8S A;  5CAX A;  1ZGN A;  3VLN A;  3LWA A;  3E0U A;  1OC9 B;  3GX8 A;  2LTK A;  3TJB A;  3RPN A;  3OR5 A;  1SEN A;  1TOF A;  4KE3 A;  2YV7 A;  2CVD A;  3BJ5 A;  1XOA A;  4F82 A;  3FZ9 A;  3LG6 A;  3MAK A;  4ZBB A;  4OCF A;  4USS A;  4ICY A;  3TKR A;  5AIX A;  1K3L A;  5DAL A;  2R37 A;  2DKI A;  1FVJ A;  2MMZ A;  4LL1 B;  4WBR D;  3C7M A;  4I8B A;  1AXD A;  2QC7 A;  4PX1 A;  1JLV A;  1PA3 A;  2GQL A;  6GST A;  1OVN A;  1GUK A;  2EC4 A;  3IC4 A;  3IDV A;  1C72 A;  2HI7 A;  3Q74 A;  2C0E A;  6GSW A;  4OD7 A;  4TR0 A;  1TK5 B;  2YOI A;  4A5P A;  2VCZ A;  4PNF A;  1X5D A;  16GS A;  5D9W A;  2VL2 C;  2KP1 A;  1JFU A;  3HD5 A;  2NVL A;  3TJJ A;  3N9J A;  5D8I A;  1GP1 A;  1Q98 A;  1PL2 A;  2H71 A;  4JRR A;  4J56 E;  5HFK A;  4MJB A;  2CAQ A;  3H79 A;  5GAN D;  1A8Y A;  1EV4 A;  2LRN A;  1Q4J A;  2HRF A;  4KSM A;  4HZ4 A;  4L0W A;  4K2D A;  5A4V A;  5JCW A;  3H93 A;  4L5L A;  5ECQ B;  2YWO A;  1AC1 A;  4FYC A;  3KD0 A;  2DJJ A;  3LOR A;  2KHP A;  2H75 A;  1XOB A;  1A0F A;  5KN2 A;  2CX4 A;  1K0M A;  1NHY A;  4K6X A;  1G6Y A;  3FRC A;  1KBN A;  1GWC A;  2K8V A;  1A2J A;  3IBH A;  2VM1 A;  2CQ9 A;  4X4J A;  2V6O A;  2GGT A;  2A2P A;  3VK9 A;  1XWG A;  3CXG A;  1T4Z A;  5JCU A;  1U3I A;  1QK8 A;  4L0U A;  1B9Y C;  5IQY A;  1T3B A;  3KTB A;  3GKN A;  1O6J A;  1G7O A;  1FB0 A;  5IPH A;  4FYB A;  4NXI A;  2HSM A;  3RHB A;  2O85 A;  1YEX A;  2PN8 A;  5AGY A;  1GUH A;  2ZNM A;  2VM2 A;  3HDC A;  1TKD B;  1ST9 A;  3VWX A;  3D21 A;  5ECI B;  1QFN A;  4I6X A;  3DRN A;  2KP2 A;  2WGR A;  2QKE A;  2WS2 A;  4IQA A;  2IIY A;  5AIV A;  5CP1 A;  3BD2 A;  4OCE A;  3CMI A;  3TRP A;  2K6V A;  3APS A;  5BMU A;  4TXO A;  2CX3 A;  2DSA A;  3IXR A;  4TW5 A;  5G2Z A;  4POM A;  4TR4 A;  2IMI A;  1R4W A;  2DC5 A;  2J23 A;  3ERW A;  5CO3 A;  2HZE A;  5ID2 A;  4EIQ A;  4JR6 A;  3ZIJ A;  3LEF A;  3UJ1 A;  2ON5 A;  3APQ A;  4K2X A;  2N5F A;  2F9S A;  5HR3 A;  2DKH A;  5CNW A;  3K8N A;  2F51 A;  3MSZ A;  2C3Q A;  2YAN A;  2H1D A;  5ECM B;  4N0V A;  2FWE A;  5ECO B;  1BG5 A;  1AIU A;  1EEM A;  2LJA A;  4OFN A;  3FKF A;  2DML A;  3APO A;  2XPD A;  3J7Y k;  4HSC X;  2HSH A;  1K0B A;  3TKS C;  1KNG A;  4KDY A;  4GWR A;  4WXT A;  3V1W A;  2CZ3 A;  2IMF A;  1TJD A;  2IWT A;  4BVX A;  3CTG A;  5HQP A;  3GHA A;  5F06 A;  1OYJ A;  2A2S A;  4IKH A;  4XS1 A;  3QMX A;  4WEY A;  5KEJ A;  1GRX A;  1Z7R A;  2ZUP A;  1OC3 A;  1G6W A;  5L71 A;  5INY A;  4BVY B;  4ECI A;  2FWH A;  1G7E A;  1J9B A;  3SWL A;  4GSN A;  1ON4 A;  1H4O A;  3G7Y A;  1EP7 A;  4NHW A;  2HYX A;  3KIJ A;  3L9U A;  4OO5 A;  3TDG A;  2H1G A;  3C73 A;  2PUK C;  2LRC A;  1XXU A;  2C8U A;  3DEX A;  3GX0 A;  3GL3 A;  2NDO A;  2JZS A;  1WE0 A;  3HZ4 A;  4RI6 A;  2GZY A;  3MWH A;  1PD2 1;  4YQU A;  3CBU A;  1J0F A;  1B8X A;  3P90 A;  3DML A;  3ZFB A;  1DE2 A;  3H8Q A;  1O81 A;  3HYP A;  3VPQ A;  4KCA A;  2IN3 A;  2YCD A;  4KDU A;  1JZW A;  2GSR A;  1GL8 A;  1A24 A;  3UAR A;  1YF1 A;  4IEL A;  3GA4 A;  4G10 A;  1M2A A;  4PUF C;  5F05 A;  4RUV A;  4F03 A;  1FG4 A;  4XHM A;  1OAZ A;  3P7X A;  3I43 A;  5ENU A;  3S9F A;  4OFT A;  4ZB6 A;  4F0B A;  4DSS A;  2IME A;  3FR9 A;  4Z2R A;  1FO5 A;  5G5E A;  1S3C A;  2DJK A;  1YQ1 A;  1J08 A;  3DD3 A;  2H74 A;  1MEK A;  3HVN A;  4K0G A;  2OE1 A;  1IYH A;  2EIO A;  1Z6N A;  4ZL8 A;  1JZR A;  1N2A A;  3EE2 A;  2L4C A;  4TVE A;  5H5Q A;  4YH2 A;  4HI7 A;  4KW6 A;  4WBJ A;  2GTU A;  1M7T A;  2REM A;  3DIE A;  2B7J A;  5ABR A;  4TN8 A;  4NPB A;  3UOM A;  3A2W A;  4JZQ A;  3ZRE A;  2L6C A;  1E6B A;  4LMV A;  2R0P A;  5EL8 A;  5GZZ B;  1UA5 A;  3LW9 A;  1HQO A;  1URM A;  1AQX A;  1M3J A;  4GLT A;  1TP9 A;  1XIY A;  1QXH A;  4MNN A;  3IPZ A;  1E2Y A;  4KB3 A;  3CTF A;  3GMF A;  5FWG A;  1EWX A;  3TJF A;  3F6F A;  4PQ1 A;  2DIY A;  4KCE A;  1GSS A;  5CRH A;  2WJU A;  3F4R A;  5IMZ A;  2ZCT A;  2VIM A;  3ZMK A;  3NOF A;  2FD3 A;  3WYW A;  2HT9 A;  3E3E A;  2V32 A;  1CQG A;  4ECC A;  2VUP A;  3JCM L;  1YEP A;  4FQU A;  4X0X A;  2FY6 A;  3A5I A;  1GLQ A;  1SKR B;  2M72 A;  2JZT A;  3VI5 A;  3QOU A;  18GS A;  2I3Y A;  3FY7 A;  2WDU A;  1H75 A;  1AW9 A;  13GS A;  3EU3 A;  2L57 A;  4MJE A;  4GSS A;  1AAZ A;  1OC9 A;  2PGT A;  4F0C A;  4IGJ A;  1Z5Y E;  4MPG A;  3Q19 A;  3GRX A;  3HZ8 A;  4KND A;  2FUG 2;  2IPA A;  1MTC A;  3MYD A;  1UC7 A;  3HVV A;  1O85 A;  3NZN A;  2AV4 A;  3M9K A;  3VFI A;  2QSI A;  2VCX A;  2YZH A;  3ZTL A;  22GS A;  3IV4 A;  1FAA A;  3PPU A;  3RAZ A;  1M3I A;  2HLS A;  2VCW A;  3WGE A;  1THO A;  4MK3 A;  2NTO A;  3KMO A;  3EMP A;  3HVS A;  2NPB A;  3RPP A;  2LQQ A;  5CRD A;  2X49 A;  3EYT A;  1XWA A;  3KCM A;  2HE3 A;  1I9D A;  2C4J A;  3O76 A;  4EL1 A;  1GTA A;  4ZB9 A;  2VCV A;  3DYR A;  4L5O A;  1X0R A;  2RUF A;  4IP1 A;  1B9X C;  4RQX A;  5IIZ A;  3FZ5 A;  5FT3 A;  3FYG A;  5C00 A;  4PUA A;  3QR6 A;  2H19 A;  5KOX A;  1ZMA A;  2XPE A;  1ZOF A;  5ECK B;  2B3S A;  4I2T A;  2JAD A;  4Z7X A;  4CY8 A;  2VD0 A;  5ECR B;  2RM5 A;  5E59 A;  5CYY A;  3EPT A;  4FO5 A;  5IMC A;  1XWK A;  4DEJ A;  5KN3 A;  2I4A A;  4V2N A;  3F3R A;  1F9M A;  4MAB A;  4HZ2 A;  3A2V A;  3HCZ A;  4O7H A;  4O5Q A;  4CDO A;  5B7C A;  1PX7 A;  4EVM A;  1O7U A;  2G2Q A;  4EDZ A;  3ERF A;  4L8E A;  1WJK A;  5DJM A;  5ELG A;  3FHK A;  1TDI A;  4EIP A;  4MJC A;  2MBS A;  2MMO A;  1IYI A;  1SK0 A;  2R0G A;  1THX A;  4N30 A;  4K5R A;  1V57 A;  3KMN A;  2B7K A;  1ILO A;  3ME7 A;  1TRU A;  3M3M A;  1MDI A;  2P5R A;  1V98 A;  5JWQ B;  2H8L A;  3DWV A;  5D93 A;  2JU5 A;  5D9X A;  3UBL A;  2H73 A;  2LV3 A;  3FZ4 A;  1A23 A;  3UMA A;  5JWR B;  3KJY A;  2TIR A;  4XS4 B;  2X64 A;  3IAM 2;  2AB6 A;  2GZP A;  3MNG A;  1YKC A;  1PKW A;  4BWQ A;  1M9B A;  1BAY A;  4OMV A;  4HEA 2;  4FYU A;  2TRX A;  2CVB A;  5KN0 A;  2F3M A;  1TI3 A;  1VF1 A;  4YKG A;  4Z2U A;  3HXS A;  2H1B A;  2IL3 A;  2F8A A;  2H0H A;  3UVH A;  2VLT A;  4CW9 A;  4EO3 A;  1FOV A;  1M2B A;  3BCK A;  2OE0 A;  3IAS 2;  4MJA A;  5DAK B;  5G30 A;  4V1A p;  3WT2 A;  2PWJ A;  1ACV A;  2YV9 A;  4KSO A;  1UN2 A;  4EE0 A;  2VD1 A;  4EC0 A;  3A3T A;  3IE3 A;  3TKP A;  1HNB A;  1TXX A;  2OE3 A;  2O8V B;  2MYG A;  4PQH A;  1TI1 A;  2IFQ A;  2ALB A;  1OC8 A;  3ZVJ A;  4K7O A;  3HVX A;  2B1K A;  2DBC A;  3IR4 A;  3A2X A;  3I6A A;  2FHE A;  3HHV A;  3M9J A;  6GSV A;  1VRS D;  2PU9 C;  4E8H A;  3TJG A;  3GKK A;  2GQM A;  1JHB A;  1AUC A;  5ECN B;  5DCG A;  2R3X A;  5D73 A;  1PFO A;  1X5C A;  6GSY A;  4BVY A;  4XTS A;  4MLY A;  1TTZ A;  1M0U A;  2H76 A;  1WMJ A;  4HJM A;  2D2Z A;  5C04 A;  3FR6 A;  19GS A;  3GNJ A;  3VI7 A;  4Q5N A;  4PTS A;  2TRC P;  3DXB A;  4WR4 A;  5JWO B;  1BYE A;  2H01 A;  1CQH A;  2HZF A;  4IBP A;  3ZZX A;  2QA1 A;  1NSW A;  4GXZ A;  2GSQ A;  4BPY A;  2H66 A;  5J41 A;  2MMN A;  3F0I A;  4ZBA A;  3BOA A;  1SKW B;  4IJI A;  4N0Z A;  3KM6 A;  1GTB A;  2FWG A;  2QGV A;  2V2G A;  1PRX A;  3EIN A;  3ED3 A;  2A4H A;  3CRU A;  2VL3 A;  2IMK A;  4EUY A;  3CSI A;  4X1U A;  4I5Q A;  1RK4 A;  2JSY A;  4PGT A;  4PXO A;  1K3O A;  5DDL A;  3QFB C;  4BWS A;  2EIQ A;  4PNG A;  1PQN A;  2H6Z A;  2GZZ A;  4O5U A;  1BJX A;  3HJP A;  4GCI A;  4HOJ A;  4NWY A;  1ERT A;  1FB6 A;  2OKA A;  4D73 B;  5EPF A;  1HNC A;  2R4V A;  5B8A A;  2X8H A;  4IJ3 A;  3BCI A;  3PR8 A;  3I9V 2;  1EZK A;  4AJ7 A;  4NV2 A;  3IK7 A;  4O32 A;  2WCI A;  1T7P B;  4MMM A;  5HR2 A;  2H1A A;  2CVK A;  4ILF A;  4BL7 A;  2YWI A;  2GSS A;  1B4P A;  3M0F A;  1TK8 B;  4BVX B;  1QGV A;  3KH9 A;  2X8C A;  2B5X A;  4ML6 A;  2JL4 A;  2O7K A;  2HSY A;  1DBY A;  4KGI A;  3US3 A;  1AQV A;  5ECH B;  2P31 A;  2E2G A;  3W8J A;  1WIK A;  4YAP A;  3ZLP A;  1GSD A;  2JSZ A;  2LS5 A;  2J9H A; 
#chains in the Genus database with same CATH homology
 3SBC A;  1YY7 A;  2C3N A;  3Q18 A;  3IHG A;  2E0Q A;  3FZA A;  1NM3 A;  4K9Z A;  2AHE A;  1Y25 A;  4MA9 A;  1R5A A;  2VO4 A;  1SD9 A;  1GUM A;  5J5N A;  2EIR A;  3D5J A;  5HR1 A;  3FMW A;  3KP8 A;  3QAV A;  1GSE A;  2DLX A;  1WRY A;  4GQF A;  1M9A A;  4ZBD A;  4RQR A;  4XIH A;  3TUE A;  4KF9 A;  3VWW A;  3ZVJ D;  4N11 A;  1A0R P;  1PSQ A;  3GTU A;  3TRX A;  3L4N A;  1VF4 A;  4TR1 A;  1A2L A;  2WUL A;  2C80 A;  3HJM A;  5ECL B;  1ERU A;  5LNK e;  1MDK A;  2X99 A;  4N10 A;  2K18 A;  3TKQ A;  5IOX A;  1EEJ A;  4NHZ A;  4Q5Q A;  4KUN A;  1F3B A;  3GYK A;  3GSS A;  3FR3 A;  1SYR A;  3TRQ A;  4POL A;  1AQW A;  4GST A;  1W4V A;  2L5O A;  4TRX A;  4IW9 A;  1FVK A;  4O92 A;  1YDK A;  3L9S A;  3F4S A;  2LEG A;  4H86 A;  2AJQ B;  3DGQ A;  3KP9 A;  1KTE A;  6GSU A;  3FW2 A;  1NHO A;  3CRT A;  5E4W A;  3KGK A;  3P2A A;  2A4V A;  5G5F A;  5EY6 A;  3GFK A;  4GTU A;  3EWL A;  3QDN A;  2I81 A;  2YJ7 A;  1UVZ A;  2H70 A;  4NMU A;  3C8E A;  1PMT A;  3KXO A;  1XW5 A;  3VPT A;  5BRT A;  4XCS A;  1A8L A;  4ACS A;  4G0K A;  1S3A A;  4ID0 A;  3EVI A;  4MH3 A;  3G7I A;  2I9H A;  2XBQ A;  3PGT A;  4JBB A;  1XWB A;  3PH9 A;  4WF5 A;  5J9C A;  2B6M A;  4XS6 A;  3F6D A;  5B8B A;  5IOW A;  4DSQ A;  4KA0 A;  1MD4 A;  3IA1 A;  4E8E A;  3VUR A;  4Z2T A;  2BJX A;  1NW2 A;  1PN0 A;  2X8G A;  4ZIJ A;  5D9V A;  2AAW A;  4KAE A;  4ECB A;  1ABA A;  2YWN A;  2B1L A;  5F07 A;  4ECJ A;  1HD2 A;  5G1K A;  2MMA A;  4MF6 A;  1LU4 A;  4POK A;  1SK2 A;  3HJO A;  4HU9 A;  2H30 A;  5B6M A;  3QD9 A;  2O89 A;  3RHC A;  3Q6O A;  1SKS B;  4HUA A;  3L78 A;  2CT6 A;  4KDX A;  2LUS A;  3TOT A;  4MF7 A;  4KH7 A;  1PKZ A;  3R3E A;  1B4Q A;  3TKS E;  3F3Q A;  3MIX A;  2RM6 A;  1HNA A;  1T4Y A;  4IP6 A;  4TXV A;  1EGO A;  5HFI A;  2B5Y A;  4IQ1 A;  4V1A g;  1S3D A;  1O8W A;  1ERV A;  3UBK A;  2A2R A;  2YN1 A;  5CRW A;  2OBK A;  4JR4 A;  3UEM A;  4XRD A;  4G0L A;  3TCO A;  1YZX A;  2WZ9 A;  2VCT A;  2DMM A;  4MZB A;  2H72 A;  3ZL5 A;  4HJ2 A;  2LNS A;  5LCZ A;  1MD3 A;  2FWF A;  3QFA C;  4WF4 A;  2LRT A;  3DVW A;  3G7J A;  4MH2 A;  3UVT A;  4XS4 A;  3CSJ A;  5D96 A;  2PMT A;  3G9B A;  1R26 A;  4J57 E;  1SL2 B;  4Q5F A;  1U87 A;  12GS A;  1TK0 B;  3DVX A;  4NV5 A;  3ZIT A;  3D0Z A;  5IO0 A;  1X9S B;  2VAF A;  2VL2 A;  1QMV A;  1GSF A;  2LJR A;  5DQY A;  4MF5 A;  4ISD A;  3LJR A;  4WR5 A;  1GSY A;  3WGD A;  2I1U A;  1K0O A;  2L59 A;  5COH A;  1F6M C;  1BED A;  1K0D A;  2CA8 A;  4ML1 A;  3KTL A;  5DAK A;  2BMX A;  14GS A;  3A5W A;  5J9B A;  4MCU A;  4ULX A;  1TRW A;  1HYU A;  2L4Q A;  2PER A;  1EOG A;  3LXZ A;  1K0C A;  5J4U A;  3LGC A;  4RI7 A;  1EV9 A;  5DAL B;  3ZRD A;  3R2Q A;  1N8J A;  1ZCP A;  2PBJ A;  1SJI A;  2M46 A;  3F63 A;  1XFL A;  2E2M A;  1F2E A;  3ZFL A;  4IHU A;  4GRF A;  5IPG A;  1SU9 A;  2MZC A;  1V58 A;  4MP4 A;  4G9H A;  3GH6 A;  2PPT A;  5ECS A;  5H5S A;  4AJ8 A;  3H1N A;  4HU7 A;  3U6V A;  3N5O A;  2GDR A;  1GNW A;  4AJ6 A;  5DQS A;  3F4T A;  1U3A A;  2ON7 A;  3QCP A;  1XCC A;  2RII A;  4K5S A;  4LL4 B;  1V9W A;  1EGR A;  3ME8 A;  1W89 A;  3GL5 A;  3RBT A;  5HR0 A;  4I2U A;  3WD6 A;  6GSS A;  2HFD A;  2HRN A;  8GSS A;  1ERW A;  1VF3 A;  1Z3E A;  2GQK A;  2AUV A;  2YP6 A;  1GUL A;  1FW1 A;  3VWU A;  5DCH A;  1Z9H A;  4ZIL A;  2C1Y A;  5IMA A;  2OA7 A;  1EP8 A;  1R5P A;  5J3R A;  2FCH A;  2PVO C;  5A5K A;  5DBQ A;  2N5B A;  1TRV A;  4PUR A;  1WPI A;  3QPM A;  3EUR A;  3IHQ A;  2XBI A;  1QQ2 A;  5EVO A;  5IMD A;  1K0A A;  3LSZ A;  1Z6M A;  2YWM A;  3QAW A;  2C0D A;  1SD8 A;  1BX9 A;  4CHS A;  1TRS A;  2GST A;  2YPM A;  3EU4 A;  3D22 A;  4G19 A;  3L0H A;  2DJ2 A;  1XBS A;  2QA2 A;  2FNO A;  2CV4 A;  1ML6 A;  1X5E A;  2PVQ A;  4JE1 A;  3UL3 A;  5B6N A;  5H5R A;  1GNE A;  4YKF A;  2G0F A;  3D4M A;  3KEB A;  4D73 A;  2H6Y A;  1SK1 A;  1X9W B;  2FA8 A;  3L9V A;  3ZYW A;  4MZC A;  4IVF A;  1FOH A;  3MDK A;  3TKS A;  4ZL7 A;  1GTU A;  2VOC A;  2WRT A;  1GTI A;  4XRA A;  4V2L A;  5CRG A;  5D9T A;  1VF2 A;  1T1V A;  2IFQ B;  5HFG A;  2R5G A;  3IOS A;  1V2A A;  1SL0 B;  2VCQ A;  3LYP A;  2OAC A;  3TOU A;  2UZ8 A;  4ZXG A;  3M1G A;  4TXO B;  4AF2 A;  3HA9 A;  1O8X A;  3O3T A;  1K3Y A;  2DIZ A;  2H0G A;  2K9F A;  1M2D A;  3C1S A;  1V40 A;  1Y6E A;  3GN3 A;  4GQC A;  5ID2 B;  4LLR A;  2HZE B;  4DSR A;  5KN1 A;  5G31 A;  4J2F A;  4K0N A;  4AGS A;  4K7I A;  1M99 A;  1WOU A;  5JCG A;  11GS A;  5IO2 A;  4JED A;  4HDE A;  2LJK A;  3VWV A;  1KEB A;  4F2I A;  2JAC A;  1T00 A;  2DJ1 A;  3IC8 A;  2XHF A;  2GS3 A;  3GUS A;  1MDJ A;  5ELA A;  1YKA A;  1U6T A;  1PN9 A;  3GKX A;  4FIW A;  1GSQ A;  3I69 A;  1BQ7 A;  4PQI A;  2YNX A;  1TU8 A;  2IJY A;  3O6T A;  17GS A;  2R6K A;  3KH7 A;  1OKT A;  2OAD A;  5AN1 A;  1SL1 B;  3TB2 A;  3LXT A;  5A4U A;  9GSS A;  4LA1 A;  2R0C A;  1PX6 A;  2VL9 A;  2AYT A;  5LD0 A;  20GS A;  1OKD A;  1XVQ A;  2L5L A;  2GVP A;  7GSS A;  3FK8 A;  3C71 A;  1A2M A;  3RDW A;  1T8E B;  2RUE A;  1YF0 A;  4DVC A;  3IK9 A;  1XW9 A;  1PGT A;  3ERG A;  3QAG A;  5IM9 A;  2YJH A;  1WP0 A;  5G1L A;  4MPF A;  1K0N A;  3P8W A;  1DE1 A;  3WT1 A;  1TU7 A;  1GH2 A;  1ZYP A;  2DJ3 A;  2V1M A;  5GAP D;  1G0T A;  3CSH A;  2H0I A;  4HQS A;  3PIN A;  2JZR A;  1ZZY A;  1XPV A;  2H6X A;  2DJ0 A;  4LMW A;  3LFL A;  2HRK A;  4V2M A;  5F0G A;  3CYN A;  4QL9 A;  1I5G A;  3J7Y b;  2FA4 A;  2KLX A;  4FH8 A;  2MBT A;  3E9J B;  4F9Z A;  1X9M B;  3LYK A;  4KX4 A;  4MZW A;  3C1R A;  2LKU A;  3KZQ A;  1XWC A;  3D4T A;  1USB A;  2FLS A;  5AIS A;  2YZU A;  4BL7 B;  4TR3 A;  3WGX A;  5IMV A;  1XZO A;  3ISO A;  1DUG A;  1QUW A;  5GSS A;  4TOP A;  2R2J A;  2HNL A;  2NBS A;  4NAX A;  4YQV A;  4ZB8 A;  10GS A;  4EXJ A;  4IN0 A;  2K8S A;  4K7N A;  3GKM A;  1ZYQ B;  5KOW A;  1PL1 A;  5A4W A;  1WWJ A;  1SYX A;  3HKR A;  3TGZ A;  4OO4 A;  3EC3 A;  4G2E A;  2Z9S A;  4K1F A;  2V41 A;  2L6D A;  1RQM A;  4DSS B;  2C0G A;  4QQ7 A;  4EDY A;  2M80 A;  1SJ6 A;  5DVB A;  4O5R A;  5CRE A;  1JLW A;  2V6K A;  1JZO A;  1GLP A;  1YJ6 A;  4IS0 A;  1ZYN A;  2LNT A;  2CAI A;  3GST A;  1XVW A;  2BTO T;  2C3T A;  2OBI A;  2B5E A;  4EF0 A;  3GUR A;  1FHE A;  1JZD A;  3ZIV A;  4P3Y B;  3IRA A;  1SJZ A;  2LST A;  2ES7 A;  2FGX A;  3GV1 A;  2RLI A;  4G0I A;  4POB A;  5IMF A;  2GT6 A;  4X43 A;  1O73 A;  2KOK A;  4WKW A;  3LQ7 A;  4HS1 A;  3GTU B;  3HY2 A;  4WET A;  4MDC A;  3DKS A;  2VLU A;  2VLV A;  4TR1 B;  4GF0 A;  1ZYE A;  3GIX A;  2GLR A;  3F9U A;  1ZL9 A;  1GSU A;  3NIV A;  4OWY A;  1LJR A;  3M8N A;  4TKY A;  3D6I A;  4K8M A;  2O87 A;  2WB9 A;  1Z7P A;  3H4K A;  2OJL A;  1OE8 A;  2HRA A;  3UIW A;  4EKZ A;  1DSB A;  4YQM A;  2P0G A;  2N5A A;  1OE7 A;  3FEU A;  1VGL A;  3ZML A;  1LBK A;  5GST A;  4BA7 A;  2LQO A;  1EOH A;  1F37 A;  3W6G A;  4I97 A;  2F8F A;  1XW6 A;  4YAV A;  2GT5 A;  1RW1 A;  2CZ2 A;  2E7P A;  2C0F A;  5ECP B;  2IMD A;  5F8B A;  4QL7 A;  5DJL A;  3AY8 A;  1F3A A;  1R7H A;  3F8U A;  1TW9 A;  1B48 A;  3U5R E;  4JU5 A;  4CY6 A;  2P5Q A;  2WFC A;  6GSX A;  2HXK A;  4OFM A;  2X4A A;  2XC2 A;  1U88 A;  3BBY A;  3EMX A;  5FHI A;  2KUC A;  4ZL9 A;  3UAP A;  4HQZ A;  3TJK A;  4Q5R A;  3GH9 A;  3W8S A;  5CAX A;  1ZGN A;  3VLN A;  3LWA A;  3E0U A;  1OC9 B;  3GX8 A;  2LTK A;  3TJB A;  3RPN A;  3OR5 A;  1SEN A;  1TOF A;  4KE3 A;  2YV7 A;  2CVD A;  3BJ5 A;  1XOA A;  4F82 A;  3FZ9 A;  3LG6 A;  3MAK A;  4ZBB A;  4OCF A;  4USS A;  4ICY A;  3TKR A;  5AIX A;  1K3L A;  5DAL A;  2R37 A;  2DKI A;  1FVJ A;  2MMZ A;  4LL1 B;  4WBR D;  3C7M A;  4I8B A;  1AXD A;  2QC7 A;  4PX1 A;  1JLV A;  1PA3 A;  2GQL A;  6GST A;  1OVN A;  1GUK A;  2EC4 A;  3IC4 A;  3IDV A;  1C72 A;  2HI7 A;  3Q74 A;  2C0E A;  6GSW A;  4OD7 A;  4TR0 A;  1TK5 B;  2YOI A;  4A5P A;  2VCZ A;  4PNF A;  1X5D A;  16GS A;  5D9W A;  2VL2 C;  2KP1 A;  1JFU A;  3HD5 A;  2NVL A;  3TJJ A;  3N9J A;  5D8I A;  1GP1 A;  1Q98 A;  1PL2 A;  2H71 A;  4JRR A;  4J56 E;  5HFK A;  4MJB A;  2CAQ A;  3H79 A;  5GAN D;  1A8Y A;  1EV4 A;  2LRN A;  1Q4J A;  2HRF A;  4KSM A;  4HZ4 A;  4L0W A;  4K2D A;  5A4V A;  5JCW A;  3H93 A;  4L5L A;  5ECQ B;  2YWO A;  1AC1 A;  4FYC A;  3KD0 A;  2DJJ A;  3LOR A;  2KHP A;  2H75 A;  1XOB A;  1A0F A;  5KN2 A;  2CX4 A;  1K0M A;  1NHY A;  4K6X A;  1G6Y A;  3FRC A;  1KBN A;  1GWC A;  2K8V A;  1A2J A;  3IBH A;  2VM1 A;  2CQ9 A;  4X4J A;  2V6O A;  2GGT A;  2A2P A;  3VK9 A;  1XWG A;  3CXG A;  1T4Z A;  5JCU A;  1U3I A;  1QK8 A;  4L0U A;  1B9Y C;  5IQY A;  1T3B A;  3KTB A;  3GKN A;  1O6J A;  1G7O A;  1FB0 A;  5IPH A;  4FYB A;  4NXI A;  2HSM A;  3RHB A;  2O85 A;  1YEX A;  2PN8 A;  5AGY A;  1GUH A;  2ZNM A;  2VM2 A;  3HDC A;  1TKD B;  1ST9 A;  3VWX A;  3D21 A;  5ECI B;  1QFN A;  4I6X A;  3DRN A;  2KP2 A;  2WGR A;  2QKE A;  2WS2 A;  4IQA A;  2IIY A;  5AIV A;  5CP1 A;  3BD2 A;  4OCE A;  3CMI A;  3TRP A;  2K6V A;  3APS A;  5BMU A;  4TXO A;  2CX3 A;  2DSA A;  3IXR A;  4TW5 A;  5G2Z A;  4POM A;  4TR4 A;  2IMI A;  1R4W A;  2DC5 A;  2J23 A;  3ERW A;  5CO3 A;  2HZE A;  5ID2 A;  4EIQ A;  4JR6 A;  3ZIJ A;  3LEF A;  3UJ1 A;  2ON5 A;  3APQ A;  4K2X A;  2N5F A;  2F9S A;  5HR3 A;  2DKH A;  5CNW A;  3K8N A;  2F51 A;  3MSZ A;  2C3Q A;  2YAN A;  2H1D A;  5ECM B;  4N0V A;  2FWE A;  5ECO B;  1BG5 A;  1AIU A;  1EEM A;  2LJA A;  4OFN A;  3FKF A;  2DML A;  3APO A;  2XPD A;  3J7Y k;  2HSH A;  1K0B A;  3TKS C;  1KNG A;  4KDY A;  4GWR A;  4WXT A;  3V1W A;  2CZ3 A;  2IMF A;  1TJD A;  2IWT A;  4BVX A;  3CTG A;  5HQP A;  3GHA A;  5F06 A;  1OYJ A;  2A2S A;  4IKH A;  4XS1 A;  3QMX A;  4WEY A;  5KEJ A;  1GRX A;  1Z7R A;  2ZUP A;  1OC3 A;  1G6W A;  5L71 A;  5INY A;  4BVY B;  4ECI A;  2FWH A;  1G7E A;  1J9B A;  3SWL A;  4GSN A;  1ON4 A;  1H4O A;  3G7Y A;  1EP7 A;  4NHW A;  2HYX A;  3KIJ A;  3L9U A;  4OO5 A;  3TDG A;  2H1G A;  3C73 A;  2PUK C;  2LRC A;  1XXU A;  2C8U A;  3DEX A;  3GX0 A;  3GL3 A;  2NDO A;  2JZS A;  1WE0 A;  3HZ4 A;  4RI6 A;  2GZY A;  3MWH A;  1PD2 1;  4YQU A;  3CBU A;  1J0F A;  1B8X A;  3P90 A;  3DML A;  3ZFB A;  1DE2 A;  3H8Q A;  1O81 A;  3HYP A;  3VPQ A;  4KCA A;  2IN3 A;  2YCD A;  4KDU A;  1JZW A;  2GSR A;  1GL8 A;  1A24 A;  3UAR A;  1YF1 A;  4IEL A;  3GA4 A;  4G10 A;  1M2A A;  4PUF C;  5F05 A;  4RUV A;  4F03 A;  1FG4 A;  4XHM A;  1OAZ A;  3P7X A;  3I43 A;  5ENU A;  3S9F A;  4OFT A;  4ZB6 A;  4F0B A;  4DSS A;  2IME A;  3FR9 A;  4Z2R A;  1FO5 A;  5G5E A;  1S3C A;  2DJK A;  1YQ1 A;  1J08 A;  3DD3 A;  2H74 A;  1MEK A;  4K0G A;  2OE1 A;  1IYH A;  2EIO A;  1Z6N A;  4ZL8 A;  1JZR A;  1N2A A;  3EE2 A;  2L4C A;  4TVE A;  5H5Q A;  4YH2 A;  4HI7 A;  4KW6 A;  4WBJ A;  2GTU A;  1M7T A;  2REM A;  3DIE A;  2B7J A;  5ABR A;  4TN8 A;  4NPB A;  3UOM A;  3A2W A;  4JZQ A;  3ZRE A;  2L6C A;  1E6B A;  4LMV A;  2R0P A;  5EL8 A;  5GZZ B;  1UA5 A;  3LW9 A;  1HQO A;  1URM A;  1AQX A;  4GLT A;  1TP9 A;  1XIY A;  1QXH A;  4MNN A;  3IPZ A;  1E2Y A;  4KB3 A;  3CTF A;  3GMF A;  5FWG A;  1EWX A;  3TJF A;  3F6F A;  4PQ1 A;  2DIY A;  4KCE A;  1GSS A;  5CRH A;  2WJU A;  3F4R A;  5IMZ A;  2ZCT A;  2VIM A;  3ZMK A;  3NOF A;  2FD3 A;  3WYW A;  2HT9 A;  3E3E A;  2V32 A;  1CQG A;  4ECC A;  2VUP A;  3JCM L;  1YEP A;  4FQU A;  4X0X A;  2FY6 A;  3A5I A;  1GLQ A;  1SKR B;  2M72 A;  2JZT A;  3VI5 A;  3QOU A;  18GS A;  2I3Y A;  3FY7 A;  2WDU A;  1H75 A;  1AW9 A;  13GS A;  3EU3 A;  2L57 A;  4MJE A;  4GSS A;  1AAZ A;  1OC9 A;  2PGT A;  4F0C A;  4IGJ A;  1Z5Y E;  4MPG A;  3Q19 A;  3GRX A;  3HZ8 A;  4KND A;  2FUG 2;  2IPA A;  1MTC A;  3MYD A;  1UC7 A;  3HVV A;  1O85 A;  3NZN A;  2AV4 A;  3M9K A;  3VFI A;  2QSI A;  2VCX A;  2YZH A;  3ZTL A;  22GS A;  3IV4 A;  1FAA A;  3PPU A;  3RAZ A;  2HLS A;  2VCW A;  3WGE A;  1THO A;  4MK3 A;  2NTO A;  3KMO A;  3EMP A;  3HVS A;  2NPB A;  3RPP A;  2LQQ A;  5CRD A;  2X49 A;  3EYT A;  1XWA A;  3KCM A;  2HE3 A;  1I9D A;  2C4J A;  3O76 A;  4EL1 A;  1GTA A;  4ZB9 A;  2VCV A;  3DYR A;  4L5O A;  1X0R A;  2RUF A;  4IP1 A;  1B9X C;  4RQX A;  5IIZ A;  3FZ5 A;  5FT3 A;  3FYG A;  5C00 A;  4PUA A;  3QR6 A;  2H19 A;  5KOX A;  1ZMA A;  2XPE A;  1ZOF A;  5ECK B;  2B3S A;  4I2T A;  2JAD A;  4Z7X A;  4CY8 A;  2VD0 A;  5ECR B;  2RM5 A;  5E59 A;  5CYY A;  3EPT A;  4FO5 A;  5IMC A;  1XWK A;  4DEJ A;  5KN3 A;  2I4A A;  4V2N A;  3F3R A;  1F9M A;  4MAB A;  4HZ2 A;  3A2V A;  3HCZ A;  4O7H A;  4O5Q A;  4CDO A;  5B7C A;  1PX7 A;  4EVM A;  1O7U A;  2G2Q A;  4EDZ A;  3ERF A;  4L8E A;  1WJK A;  5DJM A;  5ELG A;  3FHK A;  1TDI A;  4EIP A;  4MJC A;  2MBS A;  2MMO A;  1IYI A;  1SK0 A;  2R0G A;  1THX A;  4N30 A;  4K5R A;  1V57 A;  3KMN A;  2B7K A;  1ILO A;  3ME7 A;  1TRU A;  3M3M A;  1MDI A;  2P5R A;  1V98 A;  5JWQ B;  2H8L A;  3DWV A;  5D93 A;  2JU5 A;  5D9X A;  3UBL A;  2H73 A;  2LV3 A;  3FZ4 A;  1A23 A;  3UMA A;  5JWR B;  3KJY A;  2TIR A;  4XS4 B;  2X64 A;  3IAM 2;  2AB6 A;  2GZP A;  3MNG A;  1YKC A;  1PKW A;  4BWQ A;  1M9B A;  1BAY A;  4OMV A;  4HEA 2;  4FYU A;  2TRX A;  2CVB A;  5KN0 A;  2F3M A;  1TI3 A;  1VF1 A;  4YKG A;  4Z2U A;  3HXS A;  2H1B A;  2IL3 A;  2F8A A;  2H0H A;  3UVH A;  2VLT A;  4CW9 A;  4EO3 A;  1FOV A;  1M2B A;  3BCK A;  2OE0 A;  3IAS 2;  4MJA A;  5DAK B;  5G30 A;  4V1A p;  3WT2 A;  2PWJ A;  1ACV A;  2YV9 A;  4KSO A;  1UN2 A;  4EE0 A;  2VD1 A;  4EC0 A;  3A3T A;  3IE3 A;  3TKP A;  1HNB A;  1TXX A;  2OE3 A;  2O8V B;  2MYG A;  4PQH A;  1TI1 A;  2IFQ A;  2ALB A;  1OC8 A;  3ZVJ A;  4K7O A;  3HVX A;  2B1K A;  2DBC A;  3IR4 A;  3A2X A;  3I6A A;  2FHE A;  3HHV A;  3M9J A;  6GSV A;  1VRS D;  2PU9 C;  4E8H A;  3TJG A;  3GKK A;  2GQM A;  1JHB A;  1AUC A;  5ECN B;  5DCG A;  2R3X A;  5D73 A;  1X5C A;  6GSY A;  4BVY A;  4XTS A;  4MLY A;  1TTZ A;  1M0U A;  2H76 A;  1WMJ A;  4HJM A;  2D2Z A;  5C04 A;  3FR6 A;  19GS A;  3GNJ A;  3VI7 A;  4Q5N A;  4PTS A;  2TRC P;  3DXB A;  4WR4 A;  5JWO B;  1BYE A;  2H01 A;  1CQH A;  2HZF A;  4IBP A;  3ZZX A;  2QA1 A;  1NSW A;  4GXZ A;  2GSQ A;  4BPY A;  2H66 A;  5J41 A;  2MMN A;  3F0I A;  4ZBA A;  3BOA A;  1SKW B;  4IJI A;  4N0Z A;  3KM6 A;  1GTB A;  2FWG A;  2QGV A;  2V2G A;  1PRX A;  3EIN A;  3ED3 A;  2A4H A;  3CRU A;  2VL3 A;  2IMK A;  4EUY A;  3CSI A;  4X1U A;  4I5Q A;  1RK4 A;  2JSY A;  4PGT A;  4PXO A;  1K3O A;  5DDL A;  3QFB C;  4BWS A;  2EIQ A;  4PNG A;  1PQN A;  2H6Z A;  2GZZ A;  4O5U A;  1BJX A;  3HJP A;  4GCI A;  4HOJ A;  4NWY A;  1ERT A;  1FB6 A;  2OKA A;  4D73 B;  5EPF A;  1HNC A;  2R4V A;  5B8A A;  2X8H A;  4IJ3 A;  3BCI A;  3PR8 A;  3I9V 2;  1EZK A;  4AJ7 A;  4NV2 A;  3IK7 A;  4O32 A;  2WCI A;  1T7P B;  4MMM A;  5HR2 A;  2H1A A;  2CVK A;  4ILF A;  4BL7 A;  2YWI A;  2GSS A;  1B4P A;  3M0F A;  1TK8 B;  4BVX B;  1QGV A;  3KH9 A;  2X8C A;  2B5X A;  4ML6 A;  2JL4 A;  2O7K A;  2HSY A;  1DBY A;  4KGI A;  3US3 A;  1AQV A;  5ECH B;  2P31 A;  2E2G A;  3W8J A;  1WIK A;  4YAP A;  3ZLP A;  1GSD A;  2JSZ A;  2LS5 A;  2J9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...