4POUB

Vhh-metal in complex with rnase a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
122
structure length
120
Chain Sequence
QVQLVESGGGLVQAGSLRLSCAASGYPHPYLHMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRFTISRDKGKNTVYLQMDSLKPEDTATYYCAAGGYQLRDRTYGHWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Ribonuclease pancreatic
publication title Structural basis of an engineered dual-specific antibody: conformational diversity leads to a hypervariable loop metal-binding site.
pubmed doi rcsb
source organism Lama glama
total genus 27
structure length 120
sequence length 122
ec nomenclature
pdb deposition date 2014-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pouB00
1UYWL 4RISL 1FFOB 3MLTB 3BRDA 1DE4B 5JMRA 1QD0A 4LARL 4AQOA 5FEBA 3N06B 3QWOB 5CSGA 5C07D 3FQUA 1Z5LB 2M1KA 2CKBL 2RFXA 3I85A 1EO8H 2XA3A 4I2XB 3PGCA 2HLFC 3VMOA 1VENA 2YS4A 3BAEH 3UX9B 1DL7H 1TQCC 1SVZA 1HXMB 5FA4B 5CD3A 1ULVA 4WFED 3RJQB 4OUOA 2R69H 2QSCL 5EOQL 4RAVA 5GHWH 3AREC 1LHZA 2PO6D 5GIRB 1DJSA 1R5IB 4LDLB 4GH7B 1Z9MA 2R0KL 5F1IB 3U7WH 4G9FA 5EZLA 4RZCB 1CLOH 1JWUB 1U3YA 5GRVK 3O41B 3FT4B 5E00A 5DQJB 3GKZA 1SYVB 4FFVD 4X8JB 1A7OL 4FRWA 3RPIA 3IU4H 3HE6A 2YPKB 5C0AD 5C0NC 1HI6A 1LO0H 1OQOA 1B6DA 1DUZA 4JR9L 5FGCB 1DLHA 5CUSH 5JDSA 4JZNA 5L88H 5DA4A 2D7OA 2BERA 2Q7YA 3ULUH 3O8XD 1C12A 1A64A 3QI9A 5CEZL 4H5SA 5DRNA 3O0RH 3QJHA 1V3LA 3CPLB 4DZBA 3NACL 2F9BT 1BFVL 3U7WL 5ILTL 3CH8A 1I7UA 1CLOL 4BQ8A 3QUXA 5F3BA 4ZAKB 2VLKD 4APQA 5JW4N 1FVDB 3VRJB 5C86A 3HPJA 2Y4SA 1NKRA 3DI3B 2MQ3A 1BJ8A 2UWEE 5C08B 4IJ3B 1LO0L 3KGRA 1TETL 1RHHA 1JRHI 1SMOA 3O6FB 2PXYA 3EYVB 3O6MH 2MKLC 3VGHA 1X4ZA 4O2CA 5EN2B 3V0VA 2QHRL 2WIIB 2J8OA 4BZ2H 3ESUF 2C3XA 1AC6A 2EDFA 3V5KA 1YY8A 3AB0B 3MJ7A 3G5XA 1NCDL 3F5WA 1CXEA 3CSPA 3AAZB 4NIKB 3DXAE 3MOAL 5F96L 5F93C 4TSCL 5MENA 3ARZA 43C9B 5EIIA 4DQOL 4NQEA 4C56A 2GTZB 1FC2D 3G9AB 1AD9B 4HIEB 1ORQA 2H32B 3T8XA 4JRYD 3N1QC 3BWUC 32C2B 3MNWB 2IPUK 3MMEB 5CLWA 1T1WB 2HTLC 2VQ1A 4K94H 3O6ML 3RU8L 4HS3A 1F8TH 1FYTB 4L9DA 1IKNA 2GJ6E 1KCVL 5DUPH 3KPNB 2P8LA 4JY4A 3FB7B 3C5JB 2BOBB 5B39G 5GGVL 3L5WA 4Z7QE 4UILH 4P48A 4OQ1A 4RGNB 1FFOA 3MLTA 4M48H 4RGMB 1PBYA 4MNQA 4X80L 2E6JA 3ARTA 4ODTL 3SCMA 4HLZG 3WE6A 3NCBB 4M6OL 3NFSH 4LRNH 4AH2B 3P77B 3MLUL 1Z5LA 5B39B 4OCSL 1E4XI 3R8BB 3OJDB 2XT1B 4OZGB 3UJTL 4I2XA 4JPKL 4YGAB 1CL7L 1R3IH 3NCYS 3WCYA 4UIKL 1D5MB 1NPUA 1WK0A 2WP3T 4MJ6B 1A47A 4LNRB 5BS0E 3WS6C 1C1EL 4OF0A 1C5CH 1K4CA 1HXMA 1SMAA 5FA4A 2EDRA 4Z7VF 5IVXE 1R5IA 3AXLB 4M4RA 5F1IA 1FRGL 3MOQA 4U1MB 1T7ZA 4RZCA 1JWUA 1TQBB 3C2SA 3FT4A 5SX5K 3UBXG 5DQJA 1PW3A 2D7QA 1SYVA 1T4KB 1XGUA 1IM3B 4X8JA 4WI4A 3CVHL 5EIVA 2EEBA 3KPOB 2YPKA 5JA9A 1QFUL 3G6JB 2MPAL 2CIIA 4UV7L 5DJAB 2ESVA 4ERSH 4LLQB 5EBGA 3UBXB 4WWKB 1R3IL 1QFWM 4NCC2 2J8UF 3QUKB 3HB3C 1C5CL 2HFTA 1CXKA 5F9OH 3OWEA 3IGAB 4KQ4H 4WRLA 4PLJC 1TJIL 4PRIB 4QRRE 4M6AA 2R9HC 3P4MB 3QIUC 4AIXA 3EDDA 2FL5B 4DUWA 5KAQG 4ZAKA 5I1EH 2V6HA 1JZ4A 5IK3B 1DQQB 1ZT7B 4HIXL 3NCJL 2R0LH 1FVDA 1QPPA 4J2XA 4XMLL 2NZ9C 1YC7A 1QSEE 3UPAA 1PG7X 4LLVB 3HE6D 2BNUB 3SDDC 3BPLC 3O3DA 3O6FA 3FO9B 1MFEL 4PGEB 5EN2A 3UTTB 4P5TC 5F44A 2GKIA 5IJKA 4JO1H 5AEAA 4QRTA 4NO2A 3ZL4L 4KQ4L 4OLEA 5DMIH 1KEGH 1RV6X 3QI9D 4IDJH 1U2HA 4OZHB 3AAZA 4G5ZH 2DJSA 4I0PC 3L3KA 2NNAB 2R4RH 4JZJB 4PJAB 5ERWB 1JZ2A 2E7LA 3QUXD 2GTZA 4XCEB 4XHJD 4F7TB 4YDKL 1I3UA 2JB6A 4HIEA 1AD9A 1IKFH 1BJMA 4APQD 1VGEH 1D5ZA 2AABL 32C2A 3GMNA 4BSWB 5KVMC 3ARDB 1MCOH 1IGYB 1T1WA 5DT1L 2VQUA 3RVUD 1J7VR 1FYTA 4HSQA 3RGVB 4LLDB 4PGCB 2PXYD 4J4PA 4JO1L 3FB7A 3C5JA 4NQTA 2BOBA 3MLZH 1C16B 3MBEA 3ZTJH 3FT2A 4R7NA 3FZUD 2AV7B 1IC7H 1T89C 5D1XB 4PJEF 1S7TB 1NGWB 3VI4F 3D1MC 2NYYD 3PHSA 4AH2A 5JOPE 5B39A 3OJDA 2DQIH 2IPUG 3QB7C 5CP7B 3VXOB 5I0DA 3D25A 4D2NA 1FJ1B 1F11B 3Q5YA 1HXYB 1IEBB 3QUZC 5MEND 1D5MA 2R1XB 4LNRA 4NQED 4X0KB 3U7YL 1VGEL 3K80A 4C56D 2G5RA 1HZHH 4KI5C 3UTZA 3BIAX 4K7FA 4ORGB 1M6OA 2OJEB 1UJ3B 3AXLA 3G5VA 3W81A 2CJUH 5CKGA 1SY6H 1T4KA 2XFXB 3B2VH 1IM3A 1RUQL 2AKRB 4EI6A 3KPOA 4KTEH 3T2NL 3R8QA 3G6JA 2B7DT 1RUAH 1IEAB 5TQ2H 3F6LA 4N68A 5DJAA 5HI4D 1BF2A 1ZAGA 3UBXA 2OSLA 4FABL 1MNUH 4P2RE 3MV7E 3S96B 1CFNB 4BKLB 3AS2A 3QUKA 4MNGB 1HZHL 2FBJH 3QQ9C 5IB3A 4WTZG 5HHVH 3V7AE 5D6CB 3RVTC 4QYOB 3QCTH 3IGAA 5DF0A 2XQBL 4OZIE 4PRIA 1GSMA 4LL9A 4HS6B 4HGWB 2CJUL 2FL5A 4WW2B 2WZPD 3I02B 5INDB 3ARYA 5EDXA 1DQQA 1ZT7A 4QWWD 4BSVB 3VFVB 1V7MH 4KTEL 5SV4A 5F7FA 3P4LA 3S37H 4KJPD 4YWGL 1QOKA 2P42B 2BNUA 2R1WB 3U2SB 1CF8H 4K7PY 4PGEA 1AGFA 5T3XE 2ZOKB 1UWXK 3WFHB 4M7KL 5EA0H 3MNZB 2F74A 1X5KA 5DFTA 4Y8AA 3C6LA 4OGAD 3H8NA 2DM7A 3LMJH 4OZHA 2A74B 4YC2B 5MHSD 4QXGH 4YHPB 1EK3A 2B1HL 3ME0A 3MRFA 4JZJA 4PJAA 5ERWA 5DURB 4C83A 4NYLB 3VFTB 4XX1E 4NDMB 4F7TA 1U8MB 4ZAKD 3TBVB 4WUKH 4M93B 3S37L 1INDL 3IDYC 4TVPH 5E8DL 4BSWA 5E6IA 3ARDA 3C8KA 5B3JE 1IGYA 1LVEA 1CF8L 1FZJB 4G8GE 2VABB 5L9DH 4WV1C 2IGFL 3RGVA 4LLDA 4PGCA 3O6FD 5TF1H 1HH6B 3QWQB 4MJIB 4JN1H 4ODBD 5BVPL 1IGIL 1K8DA 1F42A 1FCGA 2AV7A 2CO7B 4M43L 1S7SB 1S7TA 3ZTNL 2X10A 3AS1A 1NFDA 3VFGL 1A6TB 3FFDB 5F72S 1T7VA 5CP7A 3MFGB 4HUVB 3VXOA 2VKWA 1FJ1A 1F11A 1KTKE 2A0LC 3INUH 1HXYA 3QIWB 1IEBA 4WUKL 5DC4B 3RKDC 4NRZB 1BLNB 3DMMB 4X0KA 4JO2H 3BDBA 5IHUH 1MRDH 3BHBB 2MKWA 4LIQH 2ARJA 4ORGA 4OSUL 5D5MA 3H3BC 5DR5L 4PGBB 2ENSA 5IB1B 1GPOH 1UJ3A 3MFFB 3RAJH 5TF1L 3A6BL 3W39A 1FYTD 4HKXB 5C6PB 4XAWH 5D70H 1E4KA 3ULUD 4J4PD 3LD8C 1E27B 1MUJB 2XFXA 3MBED 1HIML 2AKRA 2C3VB 3W0WA 4RGND 1YYMH 3UPRB 1EEYB 4ZOAA 4JG0H 1IEAA 2C3GA 3HC0A 4OGXH 3EZJB 4JPVL 4NWTL 5IVZB 4D0BB 4OCRH 5I76B 3INUL 4BKLA 3S96A 1CFNA 4R26H 4MNGA 4D9LL 1IZKA 3KHOA 2ZPKL 3RDTA 1E6OH 1V3MA 1MWAL 4LIQL 5D6CA 4F2MB 4QYOA 1QSFB 4HIIA 2A2QT 5FKAB 4AEIH 1UWXH 2WBJC 1GPOL 3WKMH 3KXFB 2GIYA 4YXHH 4HS6A 4XAWL 3BJLA 4LQ1A 4HGWA 3FKUS 3I02A 4BFBD 4KXZI 3TYFB 1N5AB 4OFIA 4MQSB 1NCTA 3VFVA 5J1TC 1RPQA 1YYML 2NX5E 4WEBH 2AW2A 5GZOC 4HK0B 3CNKA 2R1WA 3HMXA 3U2SA 2APWA 3ULVC 1FNFA 1BOGA 2X70A 1WZ1H 4W70A 2ZKHL 4M1GL 4OLUH 2WQ8A 3WFHA 1IC1A 5K9QI 3B8YA 3P4NB 3MNZA 1OAKH 4AEIL 5EU6A 4WTXA 3GSUB 4OI8A 1DEEB 1NMAL 1WBZB 2GQHA 3WN5C 4PRID 1AJ7H 4YE4L 4Y4FC 2HVKB 4YHPA 2V5YA 1N7ML 4IOFC 4P3WA 1QACA 4NYLA 4J3TA 5DRZB 3VFTA 3TBVA 3WIIH 4N8PA 2HMID 2EIZA 2HT3C 4F9LA 1VB9A 4LCWB 3FO0L 1I85C 1YEIH 3L5IA 1FZJA 2P5WE 2VZSA 2L7JA 1HH6A 1SJHA 1NGQH 5M94B 2Y7QB 1LO4H 1DUYA 1Z3GL 4LSRH 4LP5A 4HMDA 3SGEI 2R8SH 1S7SA 4X4YB 3K1KC 2BDNH 1A6TA 3FFDA 1FL6B 4PRBB 4KMLB 5DQDL 1NLDL 1MVFA 4AQ1B 3K8MA 4KZDH 3QIWA 1GIGL 1KCUL 1BLNA 2WWMC 2ZUXA 2EDDA 1EO5A 2PCPA 2PO6C 1CS6A 2BHUA 1KTRL 2IBZY 4L9LB 4NM8H 3T65B 1LNUA 2MSPA 1YEIL 4HC1H 1FL3B 4ONGL 1JF1B 4DJMA 5IB4B 3LS4L 2QQQA 5E6ID 3ARDD 4IEFB 4PGBA 2C3HA 5IB1A 3MFFA 3NGBC 3VWKA 1JE6A 3VXME 4D8PA 4HKXA 1N4XH 3RGVD 5J57B 4NO3B 5T5FL 1KPVB 1MUJA 2YXMA 2C5DC 3ULVL 2OXGA 3RY6C 4JM4H 4K3GA 3MXVL 3UPRA 3U82B 3MZTA 5D1XD 4CKVX 4CU6A 5HHXH 1XCQB 4NZDA 2PKDA 5T5NG 3O8XC 4D0BA 4L8CB 2P46B 4KZDL 1PKQB 3NBNA 3WIFB 1KTLB 3T0AA 2DWEB 1MJUL 4ZFFB 4Y19E 4YHZL 4P3CH 3PWUB 2VH5L 4F2MA 1QSFA 4PJXB 3LSOA 5FKAA 4NFCA 5A2FA 1B4JH 3KXFA 1F02I 1N4XL 2DICA 3TPKA 4XI5D 4G6MH 2IMNA 4U1KB 5JNYB 3S9DB 1FH5L 2HVJB 4R0LB 3U79A 3TYFA 3HA0A 1N5AA 4MX7B 2FHBA 3DV4A 3WMSA 2VWEC 3SKJH 3BKJL 3DVFA 3GKWH 4H0GA 5AUMA 5HDLA 3E3QE 3MPCA 5C2BH 1WZKA 3CSBA 2DLTA 2O5YH 2ZUUA 4EBQL 4NHUB 3BISA 3TCXA 3NPSB 3LQAC 1S78D 5F70A 2H9GB 3OX8A 5H94B 3GSUA 1TNMA 1DEEA 1FAKT 1WBZA 1FHGA 2ZSVB 4FQCH 1EJOH 3ZYZA 4G6ML 1SJXA 5CKAA 4XVJH 2ICWI 3QWRA 5DRZA 4HJJL 1U6AL 5EUOF 3LRSA 5KTEL 1QTYT 2B5IC 5LBSH 4OIIH 3GO1L 3MO1B 4JVWA 4LSVL 4ZFOL 3P0GB 3P73B 3QXUA 4KMTL 5C2BL 3CSYA 1ZVYA 2VLMD 3RNKA 1MCFA 3S37X 4HD9A 3WD5H 4LOUD 3O2DH 2Y7QA 5DLMH 2L4OA 2DIAA 1XZ0B 4X4YA 1PDKA 3MJ9H 2AK4B 4FQCL 1FL6A 2XPGA 5A2KH 2B1AH 4FZ8L 2FX8H 3S6CA 3WXWH 5JW3H 1EZVX 4HWEL 1RFDH 2QKIB 4UTBH 1CCZA 5DURD 4Z18A 4L9LA 2R0WH 3T65A 1FL3A 1I8IB 5B8CC 3CU7A 3ULSB 3SE4C 3BO8B 1JGLH 1RQ5A 2QTEA 2DAVA 1HCFX 4EI5B 1IQWH 3EAKA 4N8CL 1I3RB 1LP9F 1A9EB 1DN0B 1UB5B 1EGJH 2QQKH 1U3ZA 1KPVA 5TE7L 1YJDC 1S9YB 3FQNB 4MJID 4ZG1A 1X5ZA 1HYSD 3MJ9L 1Q1JH 1MLBB 1FDLL 3EUUA 2WNGA 1G7QA 4C57C 3VXQB 6FABL 4HZLA 4BUGA 1XCQA 5AAMA 3OQ3B 3WXWL 5HYSA 4L8CA 1RFDL 1R3HB 3LQAL 5FO7A 1PKQA 5ITBH 3WIFA 5AAWA 3PGFL 1JBJA 1Y6MR 5BMFH 4ZFFA 5D7SL 2WLZA 2OP4H 3QIWD 2HT4C 4J1UA 3PWUA 2CPCA 3CX2A 2DQGL 4PJXA 2IANB 5KSBE 2V2WB 5SWSA 5D72H 3DPBA 2MHAB 3RIFK 2BVTA 1Q94B 3NAAL 1RZKH 2D4DA 4F7PB 2Q76B 1EGJL 3EDKA 5JNYA 3VWKD 3HI5H 1KJVB 1IAKB 2NY4C 4TNWK 2HVJA 4R0LA 5JIKA 2LTQC 3HE6C 4MX7A 4XTRC 4KKLD 3U9PH 1DQLH 3BP4A 1TVBA 1XH3A 2B20A 3PWVB 4N1EA 3TNNB 5T1DL 3TJHC 3JV4A 3M1BB 4PGZA 1C5BL 5IFHH 5DJZA 2AV1A 4HC1A 1WWWX 4Z7UB 3QI9C 5DUMH 1F90L 1VEOA 4NHUA 4YO0B 4MLSA 3RP1A 5D72L 2H9GA 3KPLA 1JGUH 1QSFD 1RZKL 3QUXC 4XHJC 2BZDA 3FHAA 3IJYB 2BNRB 3KXFD 4APQC 2PYFB 1MHHA 2OTWA 2YZ1A 2QSTA 2PF6A 4OCXL 3RVUC 4YDJB 3ZDXE 5BO1H 5E2TH 2E5EA 4YXLL 4OJFL 1T6VN 2EDNA 1IGTB 1DQLL 4QRUB 3MO1A 2VDRL 2AJVH 1I1FB 1BFOB 5FYLE 3P73A 1NDMB 2C1PB 4GMSL 1CGVA 4E41B 2NYYC 1X5XA 5D7LE 2H2SD 1Q9KB 1JN6B 5LGJB 1XZ0A 1T3FB 5FECB 3QSKB 1EMTH 4YJZL 5K9KA 5HVHB 3F8UB 5E0QA 4PJFB 4AG4L 3O45B 3UXFA 5KSUA 4AYFA 1BOYA 5DVMA 2I5YL 2QKIA 5BO1L 3TC9A 5E2TL 3QWRD 1CLCA 1FVEB 1XMWA 3QPXH 4HWBH 1NJ9A 2HKHL 1ZLUH 1I8IA 4ELMA 3ULSA 1IKNC 3BO8A 3JWDH 2HYMA 2N7BA 4LCWD 4XPGH 1A6PA 2WBWB 4HF5H 5IROA 4Q2ZB 1REIA 4DEPB 4EI5A 1CDJA 3N1PC 1DN0A 1MRCH 3LEVH 1UB5A 4JHWL 2W0KA 3VXSE 1NFIB 4HIHA 4HDIB 2ZNWA 5JXEA 3FQNA 5HI4C 2CK0H 2YRLA 1CK0H 1YPZB 1MLBA 5EO0A 1QG3A 4P2QB 3VXQA 5GQBA 2PTVA 5JHDE 4X5WB 5IB5A 2YPLE 1E4WL 1R3HA 3CZJA 5ISZE 3WFEL 4HWBL 1DFBL 2A6JA 2EDYA 5KN5B 5HYFA 3ZYOA 4CW1B 3LN4B 1VDGA 4EQ3A 1L0XA 4DVRL 2IANA 1VHPA 4HF5L 4XPAL 4MWFB 4R9HA 1Q94A 2DOCA 3RWHA 4QWWC 1NMCB 1F45A 3O2DA 2HKFL 1MRCL 4L3AA 4F7PA 2R2BA 2Q76A 5HGDB 2X4UA 1JIBA 3N85H 1KJVA 1IAKA 4KJPC 2XY1A 3DX8A 4FXKB 2V9RA 3LV3B 2CK0L 3FCTA 5HHOA 3TYGH 4TN9A 4Z76B 4PV8B 4UQ3A 2VR9A 1NEUA 4MS8D 3CXHK 3PWVA 3WV0A 1CR9H 1G9NC 3TNNA 2IPKB 2OJZH 4R2GB 5HYJE 4BH8B 1KACB 4Z7UA 4OCLC 2HJFB 4KUZL 4OGAC 2CGRH 5ACZB 5IT2L 4GG6B 5GGRY 2OL3H 4YO0A 5FYKD 4R90L 1RUMH 1SYSB 4WGWB 4LBEB 1ACZA 2EDWA 4HWNA 4RMSA 4ZAKC 1AQDB 4K9EH 3IJYA 2BNRA 1YMMB 2YKLL 3QNYB 2W65B 5JPNB 4QNPF 4DKEL 1KIPB 1EERB 1II4E 2AJYL 5AG9A 4YDJA 3QQ4A 4IJ3C 4YHML 2QQLH 3BMWA 1QO3B 3MV11 3MROB 3O6FC 3VD3A 1IGTA 4QRUA 1NDGA 2YMXH 2VXQH 4KI5F 2MCPH 2XWJB 1I1FA 1BFOA 1IGFH 1NDMA 1YEKL 4K23L 5HVWA 4NC1C 5D2NC 5D93C 3AB0C 4NZUL 2CGRL 3IRPX 2DQUH 4E41A 5ADOH 5H35A 4O2FB 4KK9C 1WVZA 2ENYA 2J4WH 4TUKH 1Q9KA 1JN6A 5EO1B 5LGJA 5D1ZA 4OFPA 5IGXH 1NLBH 4G6KL 2FYYB 2YEZB 5DC9B 5DHVB 2UWEB 1J1PL 4Q74A 2E7LC 2JJSC 1H3VA 3C2AH 3O45A 5CAYB 3HG1A 3NFPA 3LY6A 4GAJL 5F7DB 1DVFB 3C60B 3O9WB 4JQXA 3PL6B 1FVEA 1I7RB 5DTFA 4JFQA 2YPVL 5ICZB 5DMKB 4LAJH 4J4PC 1HN1A 4MAYB 4Q2ZA 4YUEL 1QEWA 1T0MA 3IDXH 1B0WA 1TTFA 2OL3B 2DQUL 4RGNC 3SKNB 3ZLQC 3P9MB 2BY1A 3NA9L 4RGMC 2J4WL 4HDIA 3KYMB 3MJGX 1G9NL 3KYOB 2CLRB 1YPZA 5GJSL 3MV9E 1BD2E 1U93A 4JFYB 5H8DA 1RZGB 3O3UN 4HV8B 5F7HA 3KYAA 4OT1L 4HJ0D 5IP4A 3LVEA 1ADQA 3LDBB 2HFEB 2DQCL 3IKCB 1DN2A 2BCKA 3CJJA 3BQUB 5E1AB 5DEGB 2O5ZL 1JZ3A 5EBMB 3SGKA 3IDXL 1TQBC 2YBRA 4PLKD 5HGDA 4EI5D 4AJ0A 1DBAH 3UPCA 4W4OA 1CGUA 3G5ZA 2XQYK 4FXKA 2P5EE 4ZPVB 1AGDB 4D9RE 3LV3A 4ZS7L 4TOYH 4HFUH 1X3DA 5BS0B 4K7PH 5JXED 4Z76A 1F4WH 5EWIH 4PV8A 4OV5B 3IDGB 5FOBA 4WWKC 1WWAX 2IPKA 5CJ5A 1JK8B 4TUJA 1RMFH 3GMLA 3EKCA 4BH8A 1J1XH 2NTFB 5ITFB 4GG6A 5ACZA 1LK2B 4OLZH 4LKXB 3MUZ1 1IM9B 2HFGL 4JFHD 4NKIL 4WEMB 1U8KB 1SYSA 4EQ2A 4CN6A 1CT8B 2DLFH 1GOFA 3TESA 4LBEA 2IAND 3H7BB 2ICEB 5T3ZE 2PR4L 1AQDA 2ED9A 2HMIC 5GJTL 1UWEH 5F6IB 2O93L 3QNYA 1MJ7H 5GGSB 1PLGL 4U0RB 5I18H 1T7YA 5JO5B 2KZWA 1A0QL 1RUKL 1F4WL 1QO3A 5HHOD 1O0VA 3MROA 4N0YL 5KW9H 2M2DA 3OXRB 3X11B 1RMFL 4U0QB 4LAQH 4QRRB 2ZUSA 1J1XL 2BSED 4J3OC 2XG4A 1ZSDB 3QUYA 3WS3B 4P0DA 43CAA 4O2FA 4OQTH 1Z9LA 2UZIH 1T5WB 5FGRA 1N64H 4Z8FL 1MCJA 1VFUA 1CLZH 1CFVH 3MTRA 1ZHBB 2FYYA 5I66B 2YEZA 1QSEB 1OAUH 2UWEA 3H9HB 5DHVA 4XB8A 4JZJC 3DNKA 1OP3H 3GMQA 1KGCD 4F80A 1KFAL 5F7DA 2VDPL 4PP2B 2WINA 5A2JH 2BNRD 3C60A 4U1GB 3QUMH 5C0IB 2GCYA 2QJDA 3K2UH 3ARDC 4WI6A 1KYOK 4OLXL 1CD8A 5KW9L 3PL6A 4K2UL 5J8OA 5KS9E 1X5AA 3RGVC 5ICZA 5DMKA 3IF1B 4LAQL 5E7FA 1T80A 5HXMA 4MAYA 5JUEL 4Z95H 5MEQA 3L95B 2OL3A 3RA7H 3SKNA 1BP3B 3UTQA 1YDPB 4P5KB 3TBTA 4I3RH 5D1XC 2B8OT 4MSWA 1N64L 4BK5A 4E41D 3KYOA 2XKSA 4WHYH 4ZPTB 3FTGB 1CLZL 2CLRA 2H6PB 2HG5B 1J8HB 1OAUL 3LKPA 1RZGA 4HV8A 1ZTXH 1TZGH 3HG1D 2HFEA 5ALBH 2Q86B 4PGDB 4JFXB 4ZO8A 4MD4B 1JGEB 1NBVH 5E1AA 1UJ3C 1QVOB 4XI5C 5EBMA 2ZG3A 1NL0L 3GHBH 4XC1H 1B9ZA 1E4KC 4NC0B 4S0TD 4Y1AB 3BN3B 3SPVA 4TRPH 4HPYH 1MREL 1XGRB 3MSPA 4KHTH 4I3RL 4P46A 4ZPVA 1AGDA 3QULB 5C2UB 5K59F 3KLDA 5BS0A 5E2UL 3IT8D 4OV5A 4CGTA 1WWCA 5IJVB 3P9WB 1MCCA 2OTUB 3QUMB 4PB9H 5IVXA 4JKPL 4OGYH 4UDTB 1TZGL 4YHKL 3CX5J 1CBVH 3BUTA 4ALAL 5E2WL 2NTFA 5ITFA 3GSVB 1LK2A 5EOCH 1N59B 4KY1L 5GS3A 4RMUA 1NBVL 4LKXA 2IQAB 4ONFL 1IM9A 1U8KA 4RIRB 4ZD3L 1CT8A 1NC2A 2XQYG 3EOAB 4AMKH 3H7BA 1PY9A 4WW2C 2ICEA 3RTQB 4TRPL 3W2DH 3RFZC 3DUSB 4KHTL 1KB5H 4OBRA 2VZTA 4K07A 5GGSA 4PJIF 3VW3L 4P2RB 3MV7B 2CIKA 2XN9E 2EDKA 2L7UA 2OR9L 1NBZB 3OXRA 4FFYH 4PB9L 4NZRH 3X11A 2GEEA 2P8PB 4G6AD 1S8DB 4LOUC 5I75C 4KAQL 3KYNB 3FQTB 4QRRA 1TITA 1MEXH 4L4TE 2K9UA 1ZSDA 3OAYK 3WS3A 1F00I 1KG0B 3BH8B 5A1AA 1T5WA 3VRIB 4CMMB 5IW3A 4H26B 3BESR 5FO8B 4YC2C 5DJDB 2VOTA 3TVMB 5FOJA 1QSEA 5ABDE 1L7TL 4M1CD 3PV7A 1A6VH 1KB5L 4Z7VE 3FQWA 5DK0B 2HH0H 4JPWL 4M93C 1MHEB 4PP2A 3HAEG 2P24B 3WBDA 5GS0D 3VFOB 5LXGH 1I1RA 1A7RH 4QF1B 4F9LC 3T0DA 4LQFH 4XNXL 4M5ZH 2H8PB 1XGYH 4WFFE 5MERB 3R06B 7FABH 3TV3L 3IF1A 4XX1G 2YUWA 5FCSH 3SQOL 3VGEA 3HAEB 3N0PB 1SJVA 3L95A 1U0QA 1UXSB 4KK5C 1DBKH 4Z5RA 4LCIH 4HK3N 1YDPA 2VZ1A 4P5KA 4G7VL 1MCPL 3KPPB 1XCTB 1KB9K 2J8UE 3NOIA 2G75B 2VDNH 4ZPTA 3FTGA 1HHIB 4U1LB 2HG5A 1J8HA 3S3PA 4QGYA 3BKML 2DYPB 3ZZ1A 4NM4L 3VFPB 1K4DB 4ODSH 3QIWC 4UB0L 4G8GB 5J13B 2FEEL 3DMMC 3FAWA 2APFA 3V8CA 2Q86A 1CGSL 1PYWB 2VB5A 1D6VH 1DVFD 3C60D 3O9WD 4PGDA 3DWTA 4MD4A 1YN6B 1IVLA 3DYMA 1QVOA 3PL6D 5FK9B 1UACH 1VACB 3JV5A 2HA1A 2X44D 3LS5H 2HTKC 5T1MB 3BOVA 4WTWA 1DBKL 3FO2B 1I8MB 4OQTA 4MAYD 2I25N 3MNVB 4H88H 4KK6D 1MFNA 1M05B 3QULA 1B6UA 2ADIA 1KXTB 3TN0B 2Y72A 3HNVL 2FEDD 3LZFH 4YFLI 3IS1X 2OS7A 4O5LH 5F8QC 4HUKB 1A6UH 3GB7B 3L6FB 2V7NA 1Q0YH 2OTUA 1WBXB 3QUMA 3CLEL 4UDTA 4YR6B 1R0AH 2ZCKL 3ARFB 2JJVA 3B5GA 3GSVA 1EXUB 1OAXH 1T03H 2IQAA 5F6HJ 4DCQA 1UACL 4Z7WF 4RIRA 3LS5L 3BSZL 1T2XA 3RTQA 3VFWA 1WZMA 2HP4A 1H3TA 1ZEAL 4G6JH 2IQ9L 3DUSA 1OWRM 1J1OL 1I3VA 1V5JA 1OAQL 4P2RA 4RDQF 3MV7A 3REWB 3LZFL 2X4PB 3H42H 3LPFA 5MP6L 4QT5B 3UC0H 3ILQC 5DJYA 5DDHB 5BS0D 5DWUL 1EEUA 3VI4E 1S8DA 4U1SB 4OZIA 3FQTA 4V1DE 1AXSB 3GBNL 1R0AL 3O2VL 3QDJE 3CFCH 1Q9WA 1KG0A 3BH8A 1H5BB 4P2CG 4G80B 4H26A 5FO8A 5DJDA 5B22A 1IM9D 3TVMA 1DQTA 3MV01 1U3HB 2NX5B 1CU4H 4XVSH 3BE1H 3SOBH 1NC2D 3R4DA 3RHWF 1FG2B 5BOZG 1VPOL 2OR7A 5DK0A 1PEZA 1MHEA 3TNMB 2P24A 1AO7B 3VFOA 1G6RH 1PVHA 4XP5L 4QF1A 2APTA 3H42L 4HBCL 2H8PA 3CVIH 3DVNB 3EDEA 5MERA 3R06A 5J0BA 1A7NH 4FHBD 4F57H 1TVHB 1ACYL 4CU8A 3HAEA 4D3CL 1DQJB 3SN6N 4FQ2H 3FFCE 5GISH 4QRRD 4GAGL 3CFCL 4MHHI 1W0WA 4MYWB 3KPPA 1A3RH 2D7TL 1XCTA 3HE7B 1GGTA 1RZFH 3EJZD 4F37K 4HMEA 2G75A 3TH2T 4U1LA 4XVSL 1CU4L 3UYRL 2RAMA 1QUNA 3BE1L 1KN2L 3GUTB 2DYPA 4P59H 3VFPA 5EULV 1RZJH 5JHLH 1K4DA 5DXWA 4OGZA 1QSED 5I1HL 4G8GA 2ADFL 4ZUUB 3G9VA 1IGJA 4WENB 4X6CE 2P5WB 4L9LC 5HY9B 5C0RH 2BVEA 4OM0L 1A7NL 2VXVH 5FK9A 1IC4H 1W0VB 2ZWLT 3DTXB 1OTTD 4NNYB 5T1MA 1PFCA 3FO2A 1I8MA 1L6ZA 5SX4H 3OKKB 2Q8AH 3O3EA 3SGDH 3MNVA 1S5HB 3T2PA 5ACMA 1OCWH 1M05A 1P7KB 4MS8C 4XGZB 3CFKB 3TN0A 3D9AL 3V95A 1GZPB 4RBPH 3L6FA 2HJLB 4P59L 1RZJL 1JGVH 1J8HD 4EVNB 1JI1A 1H3PL 3ARFA 5C0RL 1A7QH 4P2OB 3I50L 1EXUA 5AWNH 2RCSH 2NXYB 3PHOB 4ZO7A 4XNQB 2BY2A 1U8QA 3S35L 1NMBL 4Z7NE 4WEUD 4R0LC 1DBJH 1D5IL 4Y1AD 3U1SL 5M7QA 2EXWD 3RIAF 3TBYA 5JOPD 4MQTB 3UTSB 3SGJC 4JDZB 1OLZA 4QT5A 1JGVL 2A77H 4OZ4B 1G0DA 3EYUH 3U36B 3X14A 4UAOB 3AU1B 3UJJH 2R2HB 1AXSA 5LWYL 5I19L 3JV0A 1A7QL 2EH7H 2F19L 3O3BB 2FECL 3NPSC 3MREB 2EXYD 1H5BA 4KTDL 1JNNL 1QLEH 3GHEH 4G80A 5AG8A 3D18B 4WI2A 2NX5A 4NT6B 3SBWC 5I2IA 1IGCH 3DLQR 3T77B 1DBJL 1FG2A 3ARXA 3O11B 3WJJC 3WNKA 3RTQD 5DVKA 3TH3T 3Q6GL 1X7QA 1E4JA 2IBBA 5A16B 5CP3H 1AO7A 3O2WL 3EIFA 3D2UB 2X9WA 2RR3A 4P2RD 3MV7D 3TIDB 4KKCD 3EYUL 3PDDA 5IVNA 4AIZA 1EHXA 3NZ8B 1KBGL 3X3GL 2EH7L 7CGTA 4KQ3H 4NKMB 4IRJA 4LSSL 1QLEL 3BP5B 4YIQB 1YEGH 3GHEL 3HE7A 4Y16B 1OSPH 2X1QA 4FP8H 3VFMB 4YDLB 1NGPH 4P9HC 3NCFB 2IJ0C 3O6KL 1ZGLP 1H8SA 3TVMD 2CD0A 4M62H 3UEZA 5C0GB 4ZUUA 3ECBB 2P5WA 1T66C 1ZA6A 3LAFA 5HY9A 3ESVF 5T3XD 5DD0H 1T6WA 3U6RA 3EYFB 4NKDB 4PLKC 1NCBH 4RMVA 2IBZX 5DUBB 3U0TB 1W0VA 4EI5C 4MNHB 3DTXA 1JYWA 4NNYA 3EFFA 4RMTA 5I1JL 2DL9A 3OKKA 5JXEC 4I9WE 4FQIH 5EG6C 4R4FH 4NNPH 3HR5B 5J6GA 1P7KA 3ET9F 3CFKA 3U0WL 3TT1L 4E5XB 1LDPH 1GZPA 2P8MB 4OLYH 1YEDB 2HJLA 3QXWA 2Z31B 4EVNA 5C3LD 1DLFH 1RIVH 1UWGL 2DYPD 1G6RA 4X9BA 5JIHA 1RULL 1UEMA 4G8GD 3V6OE 2VUYA 2DBLH 3VXMA 3P3YA 2X41A 1RJYB 4ODVH 2YD9A 3TO4B 3V4UH 5I1LB 4LSUL 3L3GB 1EFQA 1NCBL 1IBGH 5JR1H 5EU7E 4A6YH 4XNQA 5E9DE 3ARGA 3S98A 3R0MA 1ZANH 3OL2A 1CDCA 5IMOA 2VC2H 5MEPA 5TE6H 4NNPL 4G8IB 1U91B 1EA9C 5DJ6B 1CICB 3QHZL 4N0UB 2L0DA 3FQXB 4TPRH 4HULB 1T1ZA 4DN3L 3UTSA 2VIRB 3QPQD 5FYLH 3NTCH 5GS2D 4JFFE 3TN0D 4Y19A 3LEYH 1LWRA 4FQXB 5I30H 4OZ4A 1S7WB 5BZWA 2XWTB 4M6NH 1OLLA 3U36A 3LKQB 1RUPL 4V2CB 4FQHB 2XICA 3LHPL 2JE8A 1DSFH 2XWBA 4P9HL 4JKLA 5E24E 4Q9QH 4PREB 4EDXB 4C4KT 3F58H 3MREA 3ROLB 3ARFD 2PYEE 3B9VA 3FO1B 5C9JB 4CAGA 4A6YL 1MF2H 4OF8A 4NT6A 5FUZH 3VDAA 3QHFH 1XGQA 3O11A 4X7SH 4OZGF 5D7JB 2EH8H 3N9GH 1FZOB 1RHFA 4JFEE 5A16A 4YHLH 2D4FA 3TIDA 2CRMA 1N2RB 5I30L 3D39B 4M6NL 2AAVA 3DETD 5IF0B 4M1DH 4OV6F 4MA7L 4XVTH 1NCWH 1HHHB 4JO3H 1G1CA 5JW4Q 4MMZC 2QL1A 1DQML 4NKMA 3ARRA 3BP5A 3TEUA 4Y16A 3VFMA 5HVHC 5FUZL 4I13B 2VDKH 3UP1A 4PUBH 2NX5D 2XIDA 1ZVHA 2EKSA 3CCHA 5D1QB 5C0GA 3RWEB 4NJAH 1QQDB 5F7EL 4YHLL 3UROR 4JQXC 5T1LB 5LG1A 4S1DD 4Y5VA 5CEZE 4XPTL 1AO7D 1NAMH 2WWKO 1EEZB 4WFHE 5F7MC 1G9MC 2YUZA 3EYFA 4YLQT 4NKDA 5KSAC 4DEPC 5DUBA 4M1DL 2E9IA 3T0WA 1DQDL 4XVTL 2FO4B 2AERT 4FQPA 3OJMB 4ZSOE 1KPUA 4FQQB 5L8LB 1GHFL 1X5IA 4JQIH 3HR5A 5CEXB 2AQ2A 2ZUYA 3VXPA 4WU7B 5C0FB 3HE7D 4MQXC 5ESVB 2VDKL 2FGWL 3LKOB 2Q87A 4E5XA 4YFDB 4WO4B 1YEDA 1HNGA 3DUHA 2Z31A 5DEFA 2P4AB 5E5MB 5CP3A 4BZYA 2R1YB 1VFMA 1IEHA 2IAMB 3GBLA 2VZOA 3HCVB 1CTOA 1LQSR 1B0GB 1BX2A 1RJYA 2P5WD 3RNQB 3TO4A 3DBXB 3SGKC 5I1LA 4U49A 1UA6H 1MI5B 3L3GA 3VXSB 3OKLB 2UV3A 5EUOE 1YEHH 1WC7B 5CILL 3WLBB 3U4BH 1NMCC 3MACL 4PJCF 1OTUD 3QCVL 4W4OC 1WQVT 2WW8A 2XV6B 2IH1B 1QFWI 4R4ND 4G8IA 1U91A 2YPLB 3FT3A 4JQIL 4PJBB 5DJ6A 2F54E 4MMXC 3FQXA 4I5BB 4G6AC 4ODHL 1RIUH 2GSGA 3OPZH 4MZ2A 4ZO6A 2E8YA 1G7JB 4FQXA 5I16B 2NY3B 1MHCB 1YQVH 1HQRB 2XWTA 3DGCR 3D0LB 4R2GC 3LKQA 4FQHA 5IHLB 1Y0LA 1S3KH 2G5BB 4PREA 4EDXA 4M9PA 3SQBA 4ZNEE 3ROLA 1BPVA 3IXAB 3NH7H 3VXMD 2X1OA 4O2EA 4RMWA 3CFBA 3SJVE 4M1CC 3UBXI 4HX1B 1N3NB 1CLYH 1YNTB 4U1IB 5GS0C 4MAUH 3PP3H 4OI9A 2NXYD 2QQNL 3G5YB 5D7JA 5C1MB 3ARGD 3MJ8B 1LP9E 4LVNB 3WFBH 3DJ9A 5HYJB 3MCLH 4ZFGL 2FB4L 2JB5L 3UTSD 3D39A 1U8HB 2IFFH 5GGRA 5B3JF 1J18A 4M9OA 5IF0A 4Y19D 2R4SL 4GAYB 4YNYB 1VGKB 5IMKB 3S34H 2AJSH 1Y18B 1HHHA 2DQFB 3I6GB 2LVCA 1UJTA 3QIBB 5F9WB 2FATH 5DD6B 1ADQL 4QY8B 1CLYL 3WJLA 1AGEA 2LE9A 5FCUH 4NBXB 1KCRH 4X6EA 5C71A 3MCG1 1DVFC 1N6VA 3C60C 3O9WC 1JHLH 3TA3C 3K1DA 3RWEA 4NSKB 1IFHH 1JPFB 3PL6C 1T83A 4ZUTA 3B43A 3KDMB 1D5BB 1K8IB 1UM6H 1EEZA 4LMQE 3KS0H 3P4OB 4KI1A 5D7LA 1K9TA 2FX7H 4Y4KB 4NUGL 1BVKB 4M6MH 3RQ3A 1F4HA 4GRLB 1QPXA 1NGYB 2FO4A 5TDPB 3KPQB 3ZKNC 4WW2F 2FEDC 4FQQA 2WUCL 1HKLH 1PKOA 4MA3B 4YZFF 5CEXA 1UGNA 5C0FA 4WU7A 3GGWB 2GUOB 3MLRL 4Y16D 5ESVA 4EDWL 5FCUL 3LKOA 3EOTL 3P0YH 1KYOJ 2Y6SD 4WO4A 5I1CH 4I48A 1L9MA 4S1QH 5E5MA 4OB5H 5JORA 3GI9L 4TSAH 2ZZUT 2R1YA 3LDBC 5FKPB 3QXVA 4DUXA 2IAMA 3HCVA 4WCYH 1AC0A 1QR1B 4JY5H 4LF3B 1B0GA 3JVGC 3BQUC 1UM6L 3RNQA 5T3ZH 1AI1H 3DBXA 4FG6D 1JHTB 2FX7L 3VXSA 3WNPA 4H0IA 1WC7A 4NZJA 3L5HA 3WLBA 1TVDA 2VLRB 4XMPL 2Y06H 1CDIA 3MV9B 4X9IA 4GBXB 1EX0A 2IH1A 3KLSA 2LU7A 5DK3A 5IQ9B 2VDOH 2YPLA 2JF1A 4PJBA 1A1MB 5LCVL 3SEPA 3MRGA 5ISZA 4I5BA 1QHOA 1AXTH 3HN3A 4B7LA 5FM8A 3ZT5A 4N9GB 5I1CL 1G7JA 1I3GH 4S1QL 1WT5A 4OB5L 1MHCA 1ZMYA 4POYA 3UO1H 3D0LA 2CDEB 1M7DB 2Z31D 3OG4B 4WCYL 2A1WH 2WLYA 5H37H 1FSKB 2G5BA 2AGJL 1U8LA 1N0XL 5I8OL 4N5UA 3IXAA 2EECA 4X5XB 2MCG1 3MRCA 3TO4D 2ZSWA 3NIDF 1K6QH 3ZE2F 2ZUTA 4HX1A 1N3NA 1XFPA 3BKCH 2AK1L 1JRHL 4U1IA 4FQ1L 1H15A 5F6IC 4LRIA 1MJ8H 3G5YA 1FIEA 4K3HA 2GSIB 5IHZB 3L3OB 3MQIA 2G2RB 1TTUA 4KDWA 5INCB 1CICD 3QFJE 5HYJA 4R6UA 1OT2A 3C08L 2LU3A 3QEUB 5B21A 1I3GL 4MCZB 1U8HA 3QH3B 3QRFM 4XXDB 4J8RB 4GAYA 2NR6D 3U48A 5L0QC 4YNYA 4FQXD 5E8EB 2A1WL 1VGKA 5IMKA 1E4XH 3MJ6A 5BZDB 3SKOB 1Y18A 4FXLA 1J8KA 1CE6B 1UH3A 2DQFA 1G7LB 3OKEB 4CL7A 3I6GA 1IAIM 2W9DL 3H6JA 2OQJB 3V6ZB 2VDLH 5D7IB 4LNVA 4QY8A 4U1HA 3BFOA 1HCVA 2C3WA 2D7NA 4U1GC 1SJEA 3LOWA 3GJFH 5H37G 2BVPB 5D7JD 5CLTA 5HGAB 4NSKA 2Z8RA 1JPFA 3QG7L 4OZFG 3KDMA 1D5BA 1K8IA 4JQVA 3MGTB 4CDGC 3GMOB 1QYGL 3P4OA 1N5YL 1NUGA 3I2CH 3QEHB 4FTVE 4Y4KA 4ZTPL 1A1NB 4U05A 5BXFB 4GRLA 3D39D 1Q72H 2GFBB 4HXAL 5DO2D 1NGYA 1E4XL 3KWWB 1WGOA 3KPQA 1EPFA 3RWJB 4NQVB 4OZFB 5FIEA 2IG2H 3UZQA 1F3JB 3MRDB 3REVA 3HC3H 3MA9H 1TZHB 4HBQA 3MRNB 5C70A 3GGWA 2GUOA 2GK2A 4OFDA 4QHUB 2B0SH 4FZEH 5IV2B 1MELA 4LSPH 5FKPA 5HJ3B 1B4RA 4U1JB 4JAMB 1YY9D 1QR1A 1NCNA 4JHBA 3IDIB 3HZKA 4YHOH 1CZ8L 3L7FB 1OPGL 3IAQA 1KB9J 1Q72L 1UZ8B 5B4MD 2EXWC 3OJVC 6CGTA 2X2YA 5I17A 3THMH 4GKNB 3MV9A 1F6AB 2KL6A 2HWZH 4GBXA 4KI5E 2CMRH 4Q97A 5IWLA 5LGHL 2Z4QB 4YPGB 3MA9L 4N0FB 1FIGH 1KCLA 4LFHG 4XWGH 3OB0K 5J1SC 1P4LA 5I73B 2DQEH 4PY7B 1ZA3B 2J5LB 4N9GA 4XCFH 2XXCB 5BCAA 4BK4A 4I77H 3U4AA 1LE5B 4PLOB 3BEWB 4WO4D 4Z9KB 2CDEA 1M7DA 3I6KB 3C5SB 1YECH 2OMNA 5SV3A 2A83A 3PWPE 4LSTH 2IAMD 3KR3L 1TJGH 2W9EH 4OAWB 5LKNA 3WDHA 4X5XA 1I7TB 2F5AL 2P5EA 3H9YA 4PJGB 4JGUA 4PBXA 5C0CE 1G7HA 3OKOB 3VXSD 4UNTA 3RTQC 4D0CB 1MCIA 5F7NC 4JM2B 3WFDH 5DQ9B 1P7QA 4XNMB 3V5HB 3MLXH 4EUPG 3RBGA 3CH1A 2A73B 2APXA 2GSIA 1KC5H 3R1GH 3L3OA 3EDFA 4XWGL 2G2RA 4J3UA 2YPLD 1GRWA 3K81A 1S5IL 4K3JH 4Q6IB 5ISZD 3QEUA 4MCZA 1HHJB 4PJ5E 4XCFL 3M17B 4I77L 3ZE0F 4XXDA 5EZOL 4EUPB 4J8RA 3BRFA 1F58H 2NY3D 2N56A 2Y07H 5BZDA 3DHJA 3IFNH 3SKOA 1TJGL 5MEOB 1CE6A 1KCSL 4UT7L 1G7LA 3WL9B 4JGMA 4U1NB 2CLVB 2FIKB 1U8IB 5HDOA 3TVMC 4KHXH 4L8SB 4DN4H 2V7HB 3FOMA 5CZXD 3MGOA 2XN9B 3WFDL 1XF2B 4N5ED 2UUDH 3MLXL 3AUVA 3RX7A 4HEME 3WIHH 3BZEB 5JXAH 3BX7C 2BVPA 2HN7B 1JYNA 5CGYC 5HGAA 4R8WH 4LIQE 4L1HA 3S97C 5GRXG 4TULL 3GNMH 3E8UH 3GMOA 3OR7A 5FB8A 5HYJD 4XPHH 1A1NA 3NZHH 4KVCH 5CINL 3CFDB 2ZNXA 5IM7B 5ADPH 2Y07L 5HTSA 4N9OB 3RWJA 5ID0B 4NQVA 4OZFA 2HJKB 2G60L 4Z7VB 3DVGB 3MRDA 3TT3L 3OG6B 2FLRT 2EZ0D 4DTGL 1R24B 1TZHA 5I8CB 4KHXL 2X4SA 3QEGL 4ODWA 1J05B 3MRNA 4DN4L 1ERNA 1P9MA 3PWNB 3QDGE 1I4FB 4QHUA 4TQEH 5TPWL 5IV2A 5J13C 1TNNA 3MXWL 3DRTB 5JXAL 1FAIH 1YZZA 4XP6H 4QRPE 5HJ3A 3GRWH 2ZJSL 4R8WL 4JAMA 5C0JB 3V52H 3DV6A 3GNML 3E8UL 2ICCA 3A67H 3IDIA 3RWFB 3L7FA 4BA8A 2LAAA 2J8UB 1BQHG 1UZ8A 1C5DA 2KQNA 5KSBF 4Y4KD 1SQ2N 4HG4J 4GKNA 4GRLD 3MRHB 1F6AA 4OIBA 1VFAB 3QPQC 2Z4QA 4KGJA 4N0FA 1YMHA 4LPTA 3TN0C 2NY1D 5D8JH 1JMXA 2JLLA 1S7UB 1BQHB 2OI9B 4TQEL 1ZA3A 3ZHDA 2OZ4L 4Y5YB 5FM5M 1WAAE 2VR5A 1CDHA 5TQ0H 4XCYA 2YA0A 1FP5A 4OD3H 4XP6L 1LE5A 3I6KA 4LLMA 3C5SA 3ARFC 4HXBH 1W8OA 3LPGA 1EZVY 1U41A 5DK2B 1MFAH 3ZO0A 3PIQB 5GS1B 1I7TA 2WAHA 2WV3A 3HZVB 5DJ2B 2X1XR 4D0CA 4CADB 2DKUA 4Y4HC 5DQ9A 4PB0H 5BV7H 3OGCB 4UV4L 3V5HA 5FHAL 4YDIL 4IS6B 2AJ3B 3MV9D 4GBXD 4WI3A 3OTTA 1PG7W 4XVUD 4Q6IA 1NANH 35C8L 1HHJA 3NMEA 4YH6A 1GGBH 3PNWB 4K8RC 4EUPA 4MCYB 4HXBL 3QNZB 3JWOC 3V9FA 2CLZB 5DFVD 3T3ME 3OV6A 1H5BC 1MFAL 4XMKL 1X4YA 2UZYB 3ULVE 4U1NA 2FIKA 1U8IA 1U3HC 4L8SA 1MFBH 4OFYA 2V7HA 1OAYH 3ES6A 2P5ED 2XN9A 4D9RD 3EFDL 1XF2A 4PB0L 1CIDA 4S1DC 1QBML 1RJLB 1ZS8A 3BZEA 1KJ2B 1AFVH 4PJEB 1PX3A 2K3TA 3GMRA 3NCMA 5FM5O 1P7QD 3KHQA 2HN7A 2BVYA 4V1DB 1FFNB 1R3JB 4YHNB 2NXZB 4L4TA 4XWOC 3IDUA 4LEOA 2FDBP 1XR9A 3QDJB 1U8OB 5AYUH 2J88H 3BD3A 2IEPA 1FL5B 3U46B 5IM7A 1BVZA 3DRQB 1I9IL 3DHMA 5ID0A 2X4QB 3HE7C 4Y88A 4Z7VA 5KVFL 3DVGA 1MCHA 1A02N 5I8CA 4PIRF 1J05A 3P9LB 1A3LL 1MFBL 5LJYH 5BV7B 2JJWA 5C3TA 4YXKL 1I4FA 1ND0A 3C09B 4LSQH 5A3ID 5FV1L 3DRTA 4JVUA 4QHLB 1A22B 2APBA 1JPTH 2GJZB 2X1WL 4NN6B 3DUUB 3MR9B 1QKZL 5C0JA 2HRLA 3TBWB 4EJ1C 3IVKB 4KXZH 3RWFA 5AYUL 3FHQA 1OTUC 4PJIE 4RRPG 2J8UA 1HSAB 4WFEE 2XG5A 2CKNA 3S3SA 4R4NC 3IFOA 4NRYA 3VFRB 1GC1H 3TJEH 3MRHA 4RFNB 2DQHH 3FOLB 3IU3B 5JMOC 2ZCLL 5IFAL 5DZOA 4X6FB 4K8RL 1A5FH 4QRQB 4KJQD 1F2QA 2QHLA 1S7UA 3UAJD 3L7EB 4Y5YA 3WIHA 4TTDD 3L3JB 5C0AE 4OD2A 3VD9A 2BSTB 1HOCB 4NKOB 4P2OC 5T33L 5DK2A 2P1YA 5KG9B 4XPFL 1ZHKA 4LKCB 2OXHA 1OTSD 3PIQA 5GS1A 4YQXH 2NXYC 3HZVA 4XP9H 5DJCA 4I1NB 3QRGL 4CADA 1LO3H 1GC1L 5I6XB 2KDGA 3DX9B 4PJFF 3OGCA 2YD2A 4XNUL 4F7EB 1TCMA 4IS6A 2AJ3A 4JRWA 3L3IB 5CWSB 1VSCA 1Q9OA 2XA8L 5JW5B 1YC8A 3AS0A 4DW2L 4HKBB 2BVOB 5DHXB 4UAOC 5DGQA 3PNWA 2V2TB 4GLRI 1JWSA 4GS7B 3KPRE 2CLZA 3JBG7 3AVEA 3FQUB 5TE4H 3T0EC 1GGUA 3CXDH 1NAKL 1VADA 1UM4H 3CMOH 4GKSB 4YQXL 4TTGA 3BN9D 2A9MH 3GI8H 1Q0XL 2QSVA 3SE9H 5C0EB 3DROB 1UH4A 3ALPA 4PRAB 1KJ2A 4RAVB 5HYIA 3E3QC 4F7CA 4G7YH 4V1DA 2FX9L 4ZYKA 3A0OA 4YHNA 2MQ0A 3TGXA 1I9RH 1KLUA 4G9FB 3VJ6A 3QDJA 1U8OA 1OGAB 1V3JA 5E56A 5A40E 1F3DJ 4X4ME 1FL5A 2X42A 1ITBB 2DKMA 3DRQA 4TSBH 3HNSL 5F1SA 2IWGA 4OTXH 5TE4L 2X4QA 1UQSB 4Y16C 3CXDL 4QHMA 1S7RB 4GRMA 3CMOL 4YDLC 2Y6SC 4QHNB 4OCMC 1ZT1B 4NQUA 5JDSB 4JZNB 2RHEA 4UI2A 2WQRA 1QLFB 3PG2A 3SE9L 3X13B 4HQQH 4OFYD 4Z7WE 4KRLB 2XN9D 1CFSB 1HE7A 4QHLA 3KG5A 5HPMB 1RU9H 1FO0H 1U3JA 2R0ZL 4FG6C 3RI5F 3DUUA 3GSNB 1HSBB 3MR9A 5EO9B 4GG8B 4ETYA 1IGMH 5F3BB 1BZ9B 3IVKA 4CUCA 3RVVD 1B2WH 4L4TD 1BJ1H 1HSAA 2GY5A 1J0YA 4FS0A 3HPJB 3GK8H 3RIFF 4ELKB 4LK4A 1EHAA 3FOLA 2VSDA 3CSGA 3IU3A 5GSVA 2PXYB 1KOAA 4O2CB 4S10A 4X6FA 4YGVB 2PW1B 4LSDA 4RRPA 1P6AB 1F5WA 1S9XB 3L7EA 2J12B 4W4NA 2Z31C 5I8KH 1WLHA 3DYOA 2FH8A 5DJ8B 1UYWH 2R2CA 1FO0L 2BSTA 1K2DB 1HOCA 3OAUL 4NKOA 3U30B 4M7JL 4WFFD 3F5WB 5E6YA 3S88H 4ZOBA 3TO4C 2ORBL 1WCBB 1CGXA 1TJHL 4XPBL 2CKBH 2GY7B 4NQEB 3MRJB 4HS8L 1B90A 3GK8L 1X5YA 2EC9T 4PJ9B 4G6FB 4TYUA 2YRPA 4F7EA 1CICC 1U8JB 2QSCH 2AEPL 3L3IA 5EOQH 3WEXB 4HS3B 3IDMB 1A6WL 2JCCF 4ZDHB 5E94A 3GEWB 2P8LB 3F7PC 4UIMB 2R0KH 4U33A 4FQXC 2XTLA 4U31A 2V2TA 4MNQB 3ZDZF 5I1KL 1A7OH 3B8SA 3SCMB 3S88L 3RVXC 3WE6B 5E9DB 2FIRT 3MGAA 5A43C 1V05A 5HI3D 3TO2B 3KAAA 4ZOCA 4GKSA 4JR9H 2VKXA 4QEGA 3QR2A 3D5OF 1EEQA 4RWHA 3EHBC 1ROWA 2XZQH 4ZS6D 2I24N 4PTUB 5C0EA 3DROA 1K4CB 5D7JC 4PRAA 2BJML 5CEZH 1KJ3L 1BGXL 3NACH 3VWJB 4WDIA 4H8WC 1KENH 1BFVH 4G8EB 5ILTH 3G08B 3WFZA 1A6AA 1URLA 4WI7A 4HPOL 1IL1B 1CFBA 4NQCE 3FMGH 3VFNA 3VXRE 1OGAA 1XGUB 5KS9F 5D7KE 2MQCA 4MA8L 1C8PA 2CIIB 1UQSA 2ESVB 3CAFA 1TETH 3NCCB 4M61B 1S7RA 1ETZB 5EORL 4QHNA 2NW3B 4R97B 1ZT1A 1JZ8A 3PWJB 2QHRH 4OFVA 2XZQL 1QLFA 1OB1B 3X13A 4YEFA 5D1QC 3VD4A 5BQ7B 4H20L 1CFSA 1XT5A 5HPMA 1NCDH 1O7SA 1T83C 2FBOJ 3GSNA 1QSVA 1KF9B 4JN2B 4CDHA 3QEQE 1KENL 1HSBA 5EO9A 4GG8A 4KV5F 1A3QA 3MOAH 5B4MC 1BZ9A 4V1DD 5F96H 1JHKL 4XNYL 4TSCH 3FMGL 2NXZD 4HT1H 4DQOH 3QDJD 2IPTH 3H3PH 4U6YA 4MQ7A 1YYLL 1W8NA 1I1AC 4ELKA 1IE5A 3O3DB 3RU8H 2R39A 4YGVA 2PW1A 1KCVH 1OW0A 2BVQB 3CFIC 4WO4C 1S9XA 5GGVH 4QRTB 1S7XA 4JG1L 4NO2B 2JJUA 5DJ8A 2VUOA 4OKVA 4J6RL 2IAMC 5DSCA 1K2DA 3G6AB 1AH1A 1FQ9C 1L0QA 5DRXB 2VDQL 4X80H 4ODTH 5L7XL 4M6OH 1WCBA 5IVOA 4L8DB 2X09A 3L3KB 3MLUH 4ZSOB 4OCSH 5IUSA 3UJTH 2PETA 4JPKH 5CCKL 5D4QA 4HT1L 1CL7H 1NGXB 2IPTL 3H3PL 2JB6B 3MRJA 4UIKH 2Q1EA 3BDXA 1JTOA 3BWAA 4H8WL 1C1EH 1D5ZB 2VE6B 3GMNB 3IFLL 4PJ9A 1U8JA 3MV8E 3QJFA 1R3KB 4ODUB 3WEXA 2DBJA 3IDMA 5JQHC 4ZDHA 2CR6A 4UIMA 3V6OA 4CVZB 1FRGH 2NY3C 1IARB 3MBEB 3NVQA 3FT2B 1UZ6F 4R7NB 4O4YL 5CIPH 2D9QB 5FUOH 3CVHH 5HI5D 1QFUH 2MPAH 5E9DA 3U4EB 3TLRA 3TO2A 4UV7H 4N5EC 3D25B 4YK4B 5L2JB 1WFOA 3H7LA 2F54B 3BPCB 3L3DB 4PTUA 1MIMH 3UTZB 4K7FB 4Y5XB 1JL8A 2DB8A 4NOFA 1M6OB 3QBTB 3VWJA 1TJIH 2VISB 1X5HA 3G5VB 4G8EA 2IMMA 3DO3A 3G08A 4WNQB 2WBKA 1IL1A 2NY5C 2DJ4A 2PYEA 4JPIB 4MXQD 5FUOL 3SJVB 4EI6B 4HIXH 3NCJH 3GSOB 1V8HA 5C08E 2EC8A 4XMLH 2EZ0C 4PD4K 3H0TB 4HCRL 4K55A 3QIBC 4JGJA 5DEZA 2CKBA 3SY0B 2QEJA 2YZ8A 5LQBL 4M61A 1ETZA 1MPAL 3KLHC 2OSLB 1MFEH 1JPSL 2NW3A 3PWJA 2K7PA 1LP9B 3HS0B 4JFEA 4N1CA 4CU7A 5D2NE 2DMKA 1OB1A 3VCLA 1MIML 5IB3B 5BQ7A 3ZL4H 4ISVA 2X4RB 3H3KA 4UU9B 1OP5H 4JN2A 1HHKB 2DTMH 4EN3B 3MLWL 1JYXA 4Y4KC 2YOCA 4G9FD 4GRLC 4LPUA 2DQDL 4H1LH 4YDKH 1G84A 3W82A 1OGAD 1CI5A 1JMZA 1D7FA 4IMKA 3AGVA 1CE1H 2AABH 1A7PL 4I4WB 8CGTA 4GSDL 2OR8A 5DT1H 3TZVC 2X9YA 1OAZH 2YUXA 1AGFB 4RAHA 3OKDB 2VN7A 2BVQA 4AT6B 3OKMB 4RGNE 5KJRL 4GT7A 1ZK9A 4LLWB 4OCYH 2F74B 3L5XH 1JNJA 4DGYL 1I9JH 3G6AA 1XAUA 5DRXA 3NCYP 4I3GA 2D03L 3C6LB 2DTML 4PJ7F 2Q3ZA 3D48R 3RWCB 2V17H 4OZGE 4L8DA 1MCDA 4ZSOA 5L8JB 2E27H 3MRFB 5DRWB 2FH6A 4C83B 5T1KB 5IBTL 1YEEL 4K71C 1NGXA 4H25B 5KZCB 5DJ0B 3LIZH 4GBXC 2PN5A 3U7YH 1CE1L 2DS4A 5E6IB 2VE6A 3C8KB 4R3SA 2Q3AA 4XVUC 2NY5L 1OAZL 2OMBA 1R3KA 2I07B 4ODUA 3ROOA 4MA1B 1TDQA 4UINL 4KKAC 1PX4A 4CVZA 5JA8B 5D71L 5AZEL 5D2LF 1EJ6A 4OCYL 3RY5A 2I9TB 3L5XL 4HLJA 2YUVA 1K8DB 5DFVC 5I1GL 5EUOA 1I9JL 1R5WB 3Q1SL 1RUQH 1RZ8B 2A9NL 1QNZH 1FSKC 1OGTA 5E8NA 3UJIL 3T2NH 2V17L 1NFDB 5DD5L 3U4EA 1GOHA 4UZGA 2E27L 5DI8B 1KXQE 4LPWA 4H0HB 4RFOL 2BMKB 2F15A 3AREA 5FGSA 4RAUA 5L2JA 2F54A 1P6FA 4TVSa 1RIHL 4FABH 5C7XH 2YD3A 3BPCA 4I9WD 3LIZL 4L29A 4RWYL 3EO1B 3L3DA 2AI0H 4WY7L 1EIBA 2V5SA 2AJUL 4KTYA 5ALCH 4P9ML 5IHBA 2ARJB 5D5MB 4Z78B 4Y5XA 4PJ9D 2XQBH 4G6FD 2GJJA 3NFNB 2VISA 2I9LA 4YX2L 3W39B 4QXWA 1NKOA 1PAMA 4WNQA 4MDIB 4ZNEA 3BKYL 1T22B 3KYKL 4JPIA 3SJVA 3FJTA 3LRGA 4GW5B 3TWCL 3GSOA 1QNZL 3W0WB 1CD9B 1BEYH 1W72H 4L3CB 5SWZE 4ENED 1HQ4B 3H0TA 4MNQD 3V4VH 2BC4A 4ODXB 4YWGH 2YWYA 3LKNB 3SY0A 3SCMD 3HC0B 3UTTE 2W91A 5E9DD 5A3IC 3D6GA 4WUUE 5C7XL 3EYSH 3I3EA 1LP9A 3HS0A 2ZG2A 4WI8A 3ZTJG 1LK3L 2AI0L 3QFJB 3QIUB 2CUIA 3RDTB 4M7KH 2BRRL 5ALCL 3UZVB 4HIIB 1VFOA 4AL8L 4DZ8A 2X4RA 3VG9B 4UU9A 4PJCE 1GL4B 1HHKA 4EN3A 4X6CF 5J11B 5GXBB 3VWJD 1FORL 4R4BA 1JTTA 2B1HH 1PQZB 3CVHA 1I1YA 1P4BL 4M8QA 1BEYL 1W72L 2GT9B 1V7NH 3V4VL 1INDH 5E8DH 2VMFA 4KJQC 4I4WA 3C9NB 3UAJC 1A2YB 4KGLA 3F7YB 3EYSL 4LEXL 3OKDA 2ESVD 2IGFH 1BOGB 4KRMB 2X70B 4ZXBB 1GXEA 4AT6A 4JFED 3OKMA 4K3EL 2LV4A 4KJWC 4LLWA 3VDBA 5BVPH 1IGIH 2M8XA 1M71B 4ZFZA 3W9DB 4DFHA 5EU6B 4M43H 1TTGA 4PJDF 3ZTNH 4KRNA 1KUMA 3P40A 1MCSA 3RWCA 3VFGH 3ZYIA 2GW5A 1CDUA 3Q2CA 5DRWA 2XTJE 5TGBB 3HTLX 5T1KA 4H25A 4F8QA 5DJ0A 1RY7B 1V7NL 2EIZB 5FF6B 3D0VB 4OSUH 4X9GA 4Z7NF 4JY6B 2I07A 5DR5H 4LASL 2RBLA 4NPYA 4XT1C 5I73C 4LU5L 3I84A 3A6BH 2RIKA 2J5LC 2PTTA 1SJHB 3D3VE 1G9EA 3WFCL 2I9TA 3SDXF 1DUYB 5CEZD 1R5WA 1HIMH 1RZ8A 4WFHD 3IAGC 2XACC 2CXKA 12E8H 1Z2KA 1UKTA 3EGSB 4UOJA 2BY0A 1CD0A 3SO5A 2FZ3A 5F8RC 3BN9C 5KVGL 1WJ3A 5DI8A 4JPVH 2BMKA 2VLLB 2E6QA 4NWTH 5C09E 4MNGE 1BREA 3B2UC 4JM2C 3EO1A 3MLSH 1MAML 2Y1VA 4P49A 2FLBT 4MGXA 4XBGA 3BRGC 2PCPB 4D9LH 2OK0L 2ZPKH 1LNUB 1Q8MA 1NCAH 1MWAH 3QHTC 4O02L 4Z78A 2NY6B 4L5FL 3NFNA 3P30L 4BM7A 1UKSA 1BZQK 4Q6IC 3VWKB 1OF2B 3VDCA 4D8PB 5IEHB 4M7LT 3X3FH 5DD1L 4Z77B 4MDIA 3HI6H 1RVFL 3HHRB 4YZFE 5DGRA 1T22A 4XP4L 4GW5A 4XCNB 4NQDE 3AC0A 2C1OB 5C0CB 12E8L 4L3CA 1HQ4A 3G04B 3ZHLA 2HLFD 4ODXA 3G6DL 3LKNA 2VLME 4N90E 4L8SC 3AROA 2XY2A 5I9QB 3MLSL 4PYHA 4ZODA 1ZV5A 2ZKHH 3QFJA 2F54D 3ORJA 4FN0A 4M1GH 3QIUA 1NCAL 2FD6H 4PJ5B 3JWNC 4PRHE 3LSOB 2OBGA 5IFJA 2AQ3A 4O51B 4PRNB 4I3SL 4LGPB 2QR0B 1NMAH 3MLVL 4GW4B 3X3FL 3RPKA 4DGIH 4YE4H 4MVBD 3HI6L 4NFBA 4BFIA 1PQZA 5C0ND 1N7MH 4KMQA 4HK3J 3DV4B 2GT9A 5FYJL 1A6ZB 3SJVD 5ENWB 4EOWL 4ONHA 3FO0H 3C9NA 5F1KC 1A2YA 3HPLB 1M7IB 1WFTA 5AUMB 3F7YA 4ZXBA 4U2YA 4MJIE 4F15B 5DMYA 1MWAB 1NUFA 1RI8A 4NC2B 2FD6L 2Q6WB 4UTAL 1X5JA 3K2MC 1M71A 3NIDE 3WHE1 1Z3GH 3W9DA 2YD7A 3ZE2E 3OKNA 3OX8B 3SE8L 5GZNC 4FFWD 3IDYB 3VGFA 4DGIL 1SY6A 4EN3D 5DQDH 3BGMB 1NLDH 5TGBA 4KZEL 5B3NA 2CUHA 4X98B 3LRSB 5EC1A 1GIGH 1KCUH 3PDOB 2CH8A 3QDME 5FYJU 5FF6A 2W07A 4YHYC 3D0VA 1QBLL 2ATKB 5GPRA 5EZIL 4X83A 4ONGH 4XC3H 3LS4H 1T89A 4JY6A 4OF3A 2CO6B 1LD9B 2VLJE 2XOTA 1F4XL 2IBGA 4RGOH 4CVWA 5KSVB 3CSYB 4BSJA 5CJQH 3BT2L 3RNKB 1GCFA 1J87A 5T5FH 4B50A 4QOKE 5KVDH 4IMLB 5HI3C 3ULVH 1QZ1A 3HFML 4GXVL 3EGSA 3MXVH 2XPGB 3IETB 5GS1C 3C6LD 1ZLVH 1GH7A 4ZS6C 3GIZL 2VLLA 4LVOB 4XBEL 2JJTC 4E42A 3S7GA 3TF7C 1FYHB 4UUJB 4G9DB 5T1KD 1MJUH 3VXUB 5KZCD 4Y2DB 4YHZH 5HHME 4XC3L 1KN4L 5DD3L 2VH5H 5L2KB 3OAZH 3KXFE 1AR1D 1WISA 2VRAA 4RGOL 2WUBL 4FFVC 5CJQL 1OF2A 3N1FC 3MRBB 5IEHA 3PWPA 3ZHKA 3C8HA 4Z77A 5HYSG 2A6KB 5KVDL 1FH5H 3GZKA 2UVFA 1KEML 4JB9L 1FC1A 4XCNA 2C1OA 5C0CA 4ONOA 3G04A 3BKJH 1G7QB 3UTOA 1XF4B 4HZLB 1JFQH 5HYSB 2O61A 3V79C 5FO7B 4KFZC 2X7LB 4BUHA 3CC5B 4F37F 4PLNC 4QHKJ 4J1UB 4EBQH 5TDOB 3C6SB 3RX5A 4PJ5A 1Z0MA 1DEDA 5SWSB 1WITA 4O51A 1R3LB 1TFHA 2NXZC 2QR0A 4PRNA 4GW4A 5IMMB 5HYQB 2YC1B 5SX4I 3GSQB 3KJ6L 1MFDH 5JQ6L 3DURB 3SGDI 2GI7A 2J6EL 2X89A 5GGQL 4HJJH 1U6AH 5F7LB 4JCMA 4LCWE 1A6ZA 4WVRA 5KTEH 5ENWA 3W0WD 1JFQL 3D85B 1NGZB 1LMKA 3KJ4C 2AS5M 3BP4B 1TVBB 1XH3B 3HPLA 3GO1H 1M7IA 2FR4A 4LSVH 5E4IA 3JV4B 1Z6JT 4KMTH 5DJZB 2AV1B 3C09C 3KNBB 1J0JA 3VA6A 2Z35A 3PJSB 4AEEA 4IDLA 1MWAA 1QHPA 1B3JA 2Q6WA 3QFJD 1UVQB 3QIUD 4NN6C 5J3HD 3RDTD 2WMPA 3KPLB 4WJ5B 5ECJE 4PS4L 4X6BB 5KANG 4M02A 2EE6A 3UYPA 2YA1A 2AQ1A 5CJBA 1FFQA 1MFDL 1BBJB 1MOEA 4FZ8H 3BGMA 1MHHB 2OTWB 4HWEH 1U95B 4YFEA 4X98A 1CDBA 1MQKL 3PDOA 4GKZA 3QDGA 2ATKA 3ZE0E 1WBYB 5KOVC 1LD9A 3RHWK 1MH5B 5KSVA 4MJ2A 2P45B 4N8CH 2ED8A 1EBPA 4ZXBD 5HI5C 1QA9B 3EDJA 1E6JL 3NN8B 3K4DA 5TE7H 4PJIB 4IMLA 3OBAA 4RA0C 1GVIA 3BGFB 5EU6D 2DD8H 4DUVA 5K9KB 4NCC1 1FDLH 3QNXB 2JELH 3IETA 4FMKA 6FABH 1IAMA 1KJ2L 1H0DB 5KSUB 4MDJA 3LQAH 2H26A 5BRZE 3ZKMD 3PGFH 4UUJA 4G9DA 4UQ2B 3VXUA 5D7SH 4Y2DA 1T0NB 1F2XK 3BYTA 4GUPB 4KDTC 1NJ9B 1IQDB 4ELMB 2DQGH 4ZFOB 5L2KA 1WZLA 2DQJH 4HH9B 3HNTH 3NAAH 4L4VB 2B4CC 3MRBA 2UY7A 2A6KA 4HIHB 5HHPA 1JYVA 4GS7C 3OKYA 1GOGA 1UH2A 1JP5A 1NSNL 5EO0B 1RK0B 2DD8L 3N1GC 2JELL 2H41A 1XF4A 4XRCB 2R56H 1UC6A 4NO5A 2Y36L 5IB5B 3CIQA 2Y5EA 4O9HL 4KI5D 2YA2A 3BZFA 5T1DH 1JPGA 3QO0A 1ZLUK 4NP4L 1C5BH 2X7LA 1P84K 3BD4A 3W5MA 3CC5A 5D6DA 4CN1A 4CNIB 2A6JB 4KPHH 1F90H 5TDOA 3C6SA 5F89B 4L1DA 1GAFL 4JO4L 2DQJL 1R3LA 3RWHB 3HNTL 4M4PA 4HUNB 3KPRB 3SDAB 15C8H 2NY6D 2VERN 4AM0A 5IMMA 5HYQA 3RJDA 2R2BB 2ARJQ 2YC1A 2ZOLB 3GSQA 2X4UB 3DX7A 1CXLA 2NPLX 3DURA 3DX8B 3GM0A 4HZAA 2LU4A 1C08A 3V6BR 3FCTB 5HHOB 2QSQA 5GGTH 4OCXH 1PEWA 4YXLH 4UQ3B 4OJFH 1FG9C 2F53E 5C0CD 2R56L 3D85A 1NGZA 3DECA 2VDRH 5E95B 1YJDH 1T1YB 3OMZA 3RIAK 3KNBA 3PJSA 4GMSH 4TVPD 4KPHL 4Y4FA 3NPZB 4KUCF 1UVQA 1X6NA 2AEQH 1U58B 2AK4E 2E3VA 1HILB 4KVNH 4L3EE 4WJ5A 4UDUA 4PJ5D 4X6BA 15C8L 2EDLA 1OWWA 1BBJA 4AG4H 1WUNT 3U83A 3MC0A 1U95A 5GGTL 2I5YH 5ESAB 5C6TL 3QQ4B 3FN0L 2DI9A 2X89D 4C55A 5I15L 1J0KA 2B4CL 2PXYC 2HKHH 4Z7WB 2BOCB 1NDGB 4RDQG 5IBUG 4PJHF 3SDCB 1WBYA 4B7IA 3MCKA 5FO9A 1YJDL 4MZ3A 4MB3A 5FAAA 1MH5A 3FZUC 3LQZB 4CMHB 1KLFA 1QA9A 4QXUL 5H35B 1ZHLB 3NN8A 4JHWH 2AEQL 3U30C 4PJIA 5IBUB 4KVNL 5D1ZB 1EFXB 1EUTA 1A9BB 3OHXB 1VA9A 2PO6A 2Z0BA 3QNXA 3MBXL 3QG6A 4G8FB 3HG1B 3NFPB 1H0DA 1E4WH 5TFSH 5F9DC 2XYCA 1CXFA 3L1OL 4PJ9C 3WFEH 2R29H 3E6FB 4UQ2A 1T0NA 4GUPA 1DFBH 5DTFB 1IQDA 4JFQB 5C0AA 4ZFOA 1KV3A 4DVRH 3H9SB 1UG9A 1FN4B 4XPAH 4HH9A 1QEWB 3T08A 1T0MB 4L4VA 3L5JA 2HKFH 3EOYG 4ENEC 1BIIB 2AJZB 2CSPA 2DQTH 3O8XA 5I74B 2VXSL 5EU7C 3SCMC 2I60H 1BQLL 3LQMA 3D69A 1XIWB 1RK0A 4CN4A 4S1RL 2NY7L 1MCQA 3RKDD 1AIFB 1U93B 4XRCA 1JJUA 2FGZA 1CDGA 2C4XA 4S11A 5E99H 2ILLA 5IQ7H 4KDVA 5TFSL 3EZ8A 4MXVF 4K3DH 4X6DF 2R29L 1EVTC 3K4ZA 5F1OB 2BCKB 4CNIA 5IT2H 4KUZH 1AY1H 3UYOD 5F89A 4MJ4A 3VXUD 2ARWA 3VWJC 4Y2DD 1N0LA 3RKPA 1KIQB 4XP1H 4R90H 1I8KB 1IT9L 1H3GA 3SDAA 3KPRA 5L2KD 2YBRB 3SDYL 1MCRA 4DAGL 1EAPA 5EU5B 2ZOLA 3QDAA 5I71B 2DQTL 4GRWH 1N6UA 3G5ZB 1S7VB 2YKLH 3SKMB 2I60L 3MJ9A 1XF5B 3WXVL 4DKEH 2AJYH 4YHMH 1LEGB 3W11D 4JDTH 1I7ZA 2KZ1B 5EC2A 5FOBB 3V4PL 4N0RA 5E99L 1UKQA 5IQ7L 1I8LA 4TUJB 1PG7L 1T1YA 3BIBX 4K3DL 1L7IH 1YEKH 3GMLB 4K23H 2LVEA 4NZUH 1AY1L 2BVUA 1YQ2A 1RURL 4NQCB 3VXRB 3PXJA 1U58A 4XP1L 1Q9LA 4NUJB 2Q8BH 1HILA 4X4MA 4RX4A 5JLZB 4GMTH 2IFGA 4PJFE 1EGJA 5SWSD 4PD4J 1BWMA 4G6KH 4P23B 1TZIA 1J1PH 3UCRA 1DZBA 1P5UA 1MSPA 4X4XB 2Z92B 4GAJH 4XXCA 5GZOD 2Y9RT 4O00A 1FNLA 1FZKA 5ESAA 3GMPB 4P5MB 1HINL 1QLRB 4JDTL 4Z7WA 2BOCA 3SDCA 1XGPA 2YPVH 3D85D 5IJKC 1L7IL 2AEIT 4YUEH 5A2IH 2PUQT 3LQZA 1Y6NR 3QEQB 2QLVB 1CD1B 3QUYB 2F58H 43CAB 1NCUA 1ZHLA 3NA9H 1XF3B 2Q8BL 4OCNC 2W38A 1YPZE 1G9NH 1EFXA 4GMTL 4I18B 4Y4FD 4P2QE 1A9BA 3OHXA 2YD4A 5GJSH 1YEFL 2AXJA 2O5XH 3GMQB 5E6ZA 1DDHA 4G8FA 3STLA 5CGMA 4X9HA 2VDML 2WINB 4OT1H 3BZDA 2GCYB 3GBML 5HDQH 1W2KT 3E6FA 4NWUL 2DQCH 3BDYH 4S0SD 5I1IH 5IIEA 3OXSB 2O5ZH 1VFBB 3ULUC 3H9SA 1FN4A 3I9GL 1B0RB 3DIFB 5MEQB 3LKRB 3MBEC 3DXAB 2F58L 3B5HA 4XZUB 4N1HB 1BIIA 1UADC 1ZHNB 2AJZA 1WIOA 3UTQB 1K85A 3TBTB 4Q6YA 2R2EA 4MSWB 1OP3K 2YRZA 4ZS7H 1CFTB 3GDBA 1XIWA 1A4JA 2O5XL 1AIFA 5ETUA 2WWMD 1FNGB 3HMWL 5CJOL 4YK4C 3E1F1 3LKPB 4P2YA 3MV8B 2EDOA 2GJ6B 4LP4A 5HDQL 4GG6E 1WFNA 3LN9A 3BDYL 5E03A 5I1IL 4Y5XC 2BHZA 1JGDB 2HFGH 4NKIH 1KIQA 1I8KA 4MVBC 1JV5B 2H32H 3R0NA 1EO8L 1IAII 2PR4H 3SPVB 1YMME 5EU5A 5EBWB 5EIQA 5IMLB 5GJTH 4L4VD 3X17A 2VYRE 1S7VA 4P46B 3BAEL 5HDBF 3SKMA 1DL7L 1XF5A 3IXTB 1PLGH 2NLJB 4NRXB 1A0QH 1RUKH 5DJXB 4QCIB 1LEGA 2R69L 4WHDA 5GHWL 4NZTH 4N0YH 4IRZH 5IVXB 5IESH 1UM5H 5J6HB 3B9DA 4K94C 1X9QA 1ZVSB 4HWBA 4FFWC 3AFLA 4NQCA 3VXRA 3IU4L 3MUY1 4NUJA 5JLZA 4Z8FH 4EN3C 1NC2B 5CBEB 5JPMB 5L8KB 2AVGA 3VGDA 4GXUN 3EJYD 1QFWH 4HLZH 4P23A 3BP6A 4JKWA 2SEBB 4MD0B 5CUSL 3SDAD 3KPRD 4U3HA 2JCCE 1KFAH 5L88L 4HKZA 4QLRA 4X4XA 2Z92A 4CJ1A 2VDPH 1IZJA 4PJGF 5D9SB 3ULUL 3GMPA 2CIKB 4P5MA 3MRRB 5D2NB 5D93B 4IOSD 4JM2F 3O0RL 4OLXH 1QLRA 4NZTL 4K2UH 3ZDZE 4IRZL 5FXCH 1BVLA 1UM5L 5IESL 2VQTA 5J06A 5JUEH 1G0XA 3QEQA 2J1KA 4NBYB 1CD1A 5D96B 1ZT4B 4IM8A 2X6MA 2ITDA 1XF3A 1WAAF 1BAFH 3C6LC 4I18A 3HRPA 1LE9B 3ABZA 3EW3B 2WWKT 1QFWL 4DKAA 5I8EB 4RX4D 4GAFB 5DVOA 3FQWB 4Q9CA 5J9PA 3EO0B 4BZ2L 5FA3B 2DLHA 4HGKC 5E6IC 3OB8A 3EJJX 1AR1C 5FGBA 2DF3A 2LAGB 1DE4A 3OXSA 2NY0B 4MA1C 1VFBA 4NJ9H 3B9EA 2MNUA 1NL0H 1B0RA 2CQVA 3QWOA 4JREB 3SDCD 3DIFA 3U7AA 2BX5A 3LKRA 3DXAA 1C7SA 4Z5RB 4XZUA 1ZHNA 1MREH 5GRUH 1BAFL 1IJ9A 3KLAB 1CFTA 4NGHH 5D1ZD 5E2UH 3RWDB 1BIHA 1EFXD 4K94L 3Q6FB 1P1ZB 1FNGA 4IBLT 1F8TL 3T3MF 5DUPL 3MV8A 5GIRA 2N1KA 2GJ6A 4JKPH 3ULVF 4KV5E 1RSFA 4UILL 4YHKH 3VE0B 4ALAH 3O41A 5E2WH 4M48L 4KY1H 1JGDA 5GRVL 4ONFH 4LHQB 4NJ9L 3T3PF 3NFSL 4ZD3H 4LRNL 1JV5A 4AK1A 3H9SD 1FNSH 2EYSB 1CTNA 4NQSB 5EBWA 1AKJB 1R6VA 5IMLA 5GRUL 2X4OB 2ADIB 3IXTA 3VW3H 4M5YH 1N26A 2NLJA 4NGHL 4NRXA 5DJXA 3B83A 2OR9H 4QCIA 3V6FB 5E2VH 1BFSA 2V7NB 3CPLA 1XIWD 2X40A 1HNFA 2HT4D 4G3YH 5J6HA 4KAQH 4P4KB 1INQB 5J3HC 3RDTC 1S78C 1ZVSA 2QV2A 4JKMA 4Y89A 2LQRA 3LCYA 3QAZB 4WHYG 3VG9C 2GTWB 2P7TB 3CFJB 3VRJA 4DCQB 4S2SB 5CBEA 5JPMA 2NY4D 1P7HL 5J11C 2JIXB 3O81A 5C08A 5SWZB 1FNSL 4B53A 4ERSL 2Z8VC 3VFWB 2SEBA 3V7AG 4XTRD 3EYVA 4MD0A 1L7TH 4OF7A 2WIIA 5JZ7D 1U36A 5GGUB 4JPWH 4WUUB 5HPOA 3ARBB 5D9SA 4M5YL 5F9OL 3MRRA 5D2NA 3TJHD 1RK1B 2DDQH 1UZ6E 5E2VL 4XNXH 2D31B 2RJMA 5DJYB 2BSSB 4ZXBC 3TV3H 1OSZB 3GFUA 4G3YL 1DP0A 3SQOH 4PJCB 4YFLF 3WHE0 4OZIB 2RGSA 5ESQB 5C8JB 2YWZA 3RUGF 5I1EL 1LO2H 1HYRC 1JPST 43C9A 1Q9WB 1ZT4A 2JJSA 2R0LL 1SM3H 2LABA 1MCPH 4G7VH 4X8XA 3HUJF 2H32A 3MZGB 1LE9A 1J8HE 4RFEB 3MNWA 4NQCD 3VXRD 5CJXA 5HVFB 3MMEA 5I8EA 5D7KD 3ZKMC 3BKMH 3MRKB 4L8BB 4NM4H 5F71A 3EO0A 4P23D 5FA3A 3KPNA 4UB0H 3VFUB 4PG9B 5F21B 2KPNA 2DDQL 1CGSH 1U8NB 5DMIL 1KEGL 4IDJL 4LLUB 4Y1AE 5SX5H 4G5ZL 1CVSC 3P77A 2R4RL 5EH1A 3B9KB 1LO2L 4OZGA 1HYSC 4WIQA 3QEQD 3HMXH 1W0WB 1SM3L 3WNLA 2XTJB 1IKFL 3QUYD 4MJ6A 2IC2A 2H2PD 3KLAA 3L9RB 1JI2A 3IFPB 1MCOL 3HNVH 4LLYB 2E7BA 3RWDA 4QGTA 3STZB 2UY6A 1KB5B 3Q6FA 1P1ZA 1DANU 3PV6B 4ETQB 3MA7B 3CLEH 1IGJB 1GGYA 3MLZL 4RCAA 4U1MA 2ZCKH 3VE0A 4HH8A 1IC7L 3D3VB 1TPXB 2C4FU 1T2QH 2NY6C 5F97E 1H9VA 4I0KA 2V2XB 5DC0A 3VWKC 1XF1A 2ICES 1A8JH 2EYSA 2DQIL 3BSZH 3M8OH 4LLQA 4NQSA 5EPMB 1AKJA 1ZEAH 3HMXL 4WWKA 2IQ9H 3O3EB 5GGSY 3DXAD 1I1CA 2X4OA 2XRAH 4F7MB 1J1OH 4KKLC 5C09B 1QFOA 1OAQH 2EDHA 4BFGA 2BXYA 3ZKQD 5CZKA 1A7BA 3V6FA 3VFSB 5MP6H 2K1MA 4WWID 2AJXH 5DWUH 5I9QC 1ZWIB 4PJ7E 1JTPA 3ZDYF 4B41A 4P4KA 5L6YH 3P4MA 3MV8D 3GBNH 1INQA 4ZO9A 1QBAA 2GJ6D 3I3BA 1SY6L 3O2VH 3B2VL 1MCWW 5IK3A 1T2QL 4IOIB 2GTWA 2P7TA 3CFJA 3LKSB 1F4AA 4S2SA 4NQDB 3RBSA 2JIXA 1RUAL 4LLVA 5SWZA 5TQ2L 1U8QB 3M8OL 1KSRA 4JFOB 5IBLD 3K7UA 3P11H 3FO9A 1MNUL 1VPOH 3UTTA 1Z9SA 2XRAL 3TBYB 5GGUA 4RBPK 5I75B 4WUUA 3ARBA 3A6OA 2FBJL 4P46D 4PG2A 4XP5H 1ED3B