4PPFA

Mycobacterium tuberculosis reca citrate bound low temperature structure iia-n
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
327
structure length
310
Chain Sequence
TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Protein RecA, 1st part, 2nd part
total genus 98
structure length 310
sequence length 327
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4ppfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ppfA01
3CNOA 3X1YA 5JFGA 1U94A 2EFGA 2QT0A 4PSKA 1VMAA 1V5WA 2AXNA 4TTRA 3A37A 4KU4A 2ZRBA 1H8ED 4DJTA 2HYIC 2ODNA 2UVQA 1Z8FA 1ELOA 1ZUIA 2BDTA 2QA5A 1G5TA 1RRPA 1JAHA 4CW7A 4BUJA 3THOA 2RGGA 2GJ8A 5F2EA 1DAMA 2W6JA 4NDZA 5FTJA 4L4UA 2BKUA 2GZAA 1ZCAA 1Z0AA 5FOWA 3KKMA 4AYXA 1ZCBA 421PA 4AWXA 1U0JA 4PHGA 4Z54A 1W5TA 1YU9A 2V7QD 1CP2A 2WJJA 3L82B 1YR9A 4P4SB 2O8EB 1CJKC 4B2IA 4TMTA 3RS3A 3Q85A 1XTIA 4W5JA 2ZRGA 3PITA 2V3CC 1HE1C 3C14C 4KFSA 2ZRNA 2XTNA 2BMEA 2OEPA 3ZQ6A 1P9WA 4DKXA 4OK6A 1HURA 2X1VA 3K0FB 1KSGA 5HR5A 4C0AC 2KB0A 3CPHA 1FW6A 4IOKA 2NO1A 3HU1A 2CJWA 2REBA 4Q9IA 4Z1MD 4MGYR 1N6HA 5CK4A 4Q19A 1JPJA 2ZANA 1MT0A 1E9EA 1M7GA 3W5IA 1GDDA 4DB4A 4C0KA 1GM5A 3B1XA 1NY5A 4RCZA 1T0HB 1AKEA 1SQ5A 1VCIA 2J0UB 5B58C 4F4JA 1E2PA 2IYRA 1E0KA 3V4FA 1SHKA 4OQXA 3I1FA 4B75A 3GLHB 4FMDB 3PUZA 1XXHA 5DO9A 1OFUX 1FX0B 1L8QA 3K9GA 2CJWB 1OSNA 3CR7A 4M21A 3ZVMA 3NG1A 2BBTA 5TXGA 2WM9B 3TRFA 8OHMA 5IK2D 5J40A 2FFBA 4M22A 1G8GA 3JZMA 4P32A 2ZU6A 3U6BA 1F5NA 1Z07A 1PVOA 1CJTC 1KHTA 4NCJA 5EZ6B 2P6NA 2QTFA 2ZJ8A 3W3AA 2DR3A 2EFCB 4D4KA 3MSXA 2C9CA 4B3CA 2ZE8A 1J70A 1OF1A 2GCOB 2WIAA 3NC1C 4JSYA 2QAGB 4QOSA 1LF5A 1XCPA 1CS4C 3PR1A 3MGCA 1YQTA 4LPKA 4A6PA 2PMDA 1CR1A 4DT1A 4OI2A 2FF7A 4PANA 1F2UB 4A6XA 2GBLC 2ODEA 2CK3A 3GJ6A 1OB5A 3KXLA 4D80A 2XZLA 4IVPA 3R9WA 4EJSA 3CRW1 1SVIA 4LYHA 4RFVA 4BGDA 5DGXA 2PEYA 1AS3A 1AS2A 2DBYA 4DCTA 2FSIA 1SXJD 2CE2X 4FI3C 5F98A 4HAYA 3QPWA 3SYKA 3U44A 1D9ZA 1RKBA 1AS0A 2CLCX 1E32A 1X86B 4GNKA 3P4YA 2XITA 3AP2A 3T15A 3VX3A 4CGZA 4GOXA 4TLBA 4OHYA 1HV8A 1X6VA 1OXTA 2GF9A 3AVWA 1KMHA 1PUJA 3IQWA 1Z47A 4KXFB 1TQ6A 1KI6A 1GAJA 1AGPA 2A5DA 3GP8A 3SJBA 4PHTA 1FTNA 2ZAMA 1BOFA 1TU3A 1AIPA 5DH9A 4JL8A 1DPFA 1DAHA 3R9IA 3ZDQA 1TF7A 2F3RA 4XOIA 1CF4A 2YOHA 5KDOA 1M7BA 1NRJB 2ZROA 3RRYA 4JL5A 4MRRA 2FA9A 3OZXA 2WSSA 4HZIA 2GCOA 1V43A 2ZSAA 2AD5A 2ZQ5A 4Q5IA 5TVKA 3TGPA 2R8RA 4QBHA 2GXAA 2ECKA 1XX6A 4UXIA 1NI3A 3KJEA 3X1WA 4CEJA 3GLFA 3HPRA 4A15A 3LRPA 2WWGA 3LX5A 3LX8A 3VR1A 2B8WA 4MUBA 5J47A 2JCSA 2KJQA 2OSBA 2KE5A 5HCIA 4PZZA 2QU8A 4FMCB 2Q3FA 3N5CA 4IDOA 2WWXA 2WJVA 3HU2A 4WXPA 3PEYA 3RHFA 3CR8A 4BFWA 3LV8A 2QNRA 2CLDX 1RJ9A 5ELXA 1AM4D 3KFXA 3D6TB 2ONJA 3OEHA 1E1RD 4NCNA 1DG1G 4M1KA 1KK1A 4HLQB 3L0PA 3RSLA 3EX7C 4BASA 3MAAC 4Q4LA 5FBQB 1NLYA 1FX0A 4NYJQ 3LWNA 2GJ9A 3FPAA 4C3ZA 1T3LA 2EFHB 3FB4A 4G5RA 1Z0JA 1F6BA 5KSOA 4XVUA 1TNDA 1JJVA 1HA3A 1OHHD 4P3YA 1JQLB 2VP0A 2ZS8A 1CJMA 3NBYC 1U8ZA 3K9LA 4P4TA 1OV4A 3ETLA 2WV9A 3UG6A 4GPTA 1W36B 2A5YB 2W6ID 1G7CA 1XPRA 4C4PA 3EXAA 3LBNA 1LFDB 4V02A 5KOYA 2FFQA 2C96A 3TAHA 3ZS8A 3PENA 2XNDA 3QXXA 4KODA 4KFUA 1OIXA 3MRSA 3MWLA 5EP4A 4R71A 4BEBA 3KQHA 3TUJC 2OLJA 2XNSA 4TLCA 5EP2A 5EXTA 3WYGA 5A5GA 4G5GA 4RD1A 5D3QA 4LSGA 4D0NA 1XCGB 3CUEF 5A0FA 4D26A 2FG5A 3K0AB 5LDDC 2Q9AA 3E70C 1RPZA 3R8CA 1L2TA 2QBYA 1G7RA 5AUOB 3QE0A 1D5CA 2H5EA 3TW8B 2QRZA 1IXZA 3VR4A 1GTVA 3TQCA 2P2LA 1EG7A 1NY6A 4KSBA 5AK0A 721PA 3WP1B 5B30A 1J8YF 2QSZA 2P0EA 2XNDD 4NL4H 2W0SA 2ZUBA 3LLMA 2OO7A 3I8XA 2ZJ5A 4EJSB 4Q1DA 2WPDD 2DWPA 2YNMA 1G20E 1JR3D 2ORVA 4WXRA 4Q47A 2FSHA 4HB2A 5FOXA 1KDRA 4OI4A 1YR7A 2RGEA 4LK2A 3DPUA 4MITA 4ASUD 4EQ6A 3A1VA 5DYGA 2B8TA 2RMKA 2Z83A 1OXSC 4G5SA 3PUWA 1NVVR 4LC1A 1Z06A 3IPXA 3I73A 2IYXA 2ZI9A 5EUMA 2BEJA 5FI0B 5J4VA 2OUKA 4ZIRB 4GI7A 4JT2A 4DBLC 1Q3HA 2WJIA 4M9QA 1ESNA 5KSZA 2P6RA 2IYZA 3IEVA 4PQYA 4JLKA 4TQ9A 4ZKEA 4URXR 2RGCA 1CRPA 3VKHA 1E2QA 1GL9B 3IPYA 1XJCA 5BN5A 2PJRA 3A4NA 2DY1A 3BFXA 2BJVA 4O2RA 2JJ8A 4XD7D 2V9PA 2FWRA 3REFA 2PT7A 2V7QA 3OE7A 3HP1A 4K81B 1SVSA 1VIYA 1ODFA 2IYSA 2FSGA 1LW7A 3LW8A 4QM7A 3P26A 3NH9A 3QVVA 5E95A 4RZXA 4PSVA 4R2IA 2ZJZA 3NC0C 2X19A 3ZZ0A 2EYUA 2G0NA 3EPJA 2OLKA 2IW3A 4V0LA 2NO7A 4XD7A 5BN4A 3QJYA 4P33A 3L8YA 1XTSA 4MRNA 3ICEA 1VPLA 3BE4A 4LBYA 1GRRA 4HYYA 4D4JA 3GFOA 3PCRB 3CH4B 3CRMA 3KZ1E 1DADA 1KK3A 2MSEB 3CM0A 2W2TA 2XX3A 1NMZA 2VF7A 3AH8A 3R8FA 3K0FA 4I1SA 4A4DA 1KI3A 1TX4B 1VYTA 3KQLA 4DDWA 3B2EA 1ZM4A 2PCLA 1NKSA 4HUQA 3WMEA 2OV2A 5JJLA 3QI2A 4R2HA 4P4SA 5FL7D 2O8EA 4GP7A 3WNCA 3KUCA 1GIAA 1NSFA 1XDBA 1GOTA 2D06A 2X77A 3BK7A 3IKJA 2W58A 4IDHA 1R6BX 4RKEA 3R20A 5F3WB 4I1VA 3PUYA 1Q12A 1MRNA 1UFQA 3WYAA 2RGNC 4PR0A 1YHNA 2LWIA 1F60A 4WZAE 4X8LA 3LQQA 4M1OA 4M8NE 1X8JA 2BEKA 4IEEA 4AK9A 4L9WA 4L5BA 4WVFA 4OYHA 3GLGE 4FXPA 3L0IB 1E3MA 2HXYA 1E1QA 1M7HA 3TIFA 1WXQA 1R7RA 2TMKA 4JBXA 4TLEA 5AR1A 2CBZA 4JZKA 3PEUA 2XJ9A 5FL7A 521PA 1MABA 5J5CA 4BFSA 3C7KA 4B3BA 1UAAA 1QVAA 4QGAA 3A1UA 2JLUA 3NHBA 2JGNA 2YHSA 4TTQA 1T6NA 4GT1A 2W00A 4DLTA 4YLGA 1R5BA 4FWIB 5AJVB 2JLXA 2FN4A 4BFZA 1S1MA 2ZRKA 1NSTA 4Q4AA 3REGA 4KLZA 4YMTA 1JAIA 2O8CB 2R6DA 3T06B 3SZRA 2ZRHA 1II9A 1XJQA 2GVZC 1KNXA 3DVLA 1COWA 2CMKA 1G16A 1CR2A 1PJRA 1O3YA 3QNUA 5TY0A 1TF5A 1HQYE 3SJAA 1E2MA 1I4DD 1S96A 3P1JA 2ZR0A 1E2DA 1TL7C 2WBLC 4ZCMA 4AIIA 4BLTA 3FDIA 2VHCA 4AURA 1M1YE 2BMJA 3AKYA 1W4RA 1TADA 3BC1A 1Z28A 4RFSB 1QHHA 4E22A 4DDTA 4JLDA 4J0QA 2WSSD 4FD2A 1Z0KA 4KYIB 2JDID 4HLUC 2Q6TA 4C0LA 1Q44A 5JHHB 1SVOA 2ZRPA 4PPFA 1GSIA 4KVAA 5EZ5A 5SZKB 3TNFA 2YWFA 4B43A 3NVAA 1A2KC 1Z29A 1ZU4A 2Z4RA 3O47A 3TSZA 3B60A 1NKTA 5TV2A 3V4RA 5JZVA 1ZJ6A 2BCJQ 4TLDA 1E0JA 3GCGA 6Q21A 2D7DA 4A8JC 3MWKA 4PPGA 2RH5A 1A4RA 2NOAA 4S35A 1G8YA 3H2YA 4M1MA 1FNMA 1AKYA 1FFHA 3DHWC 2IS2A 2ZPTX 2FPMA 4N1AA 1R5NA 1E99A 3KJHA 4DSOA 4EKDA 2RGXA 1E0SA 4NYJR 1YRAA 5IF9A 4B76A 3NTUA 2VP9A 2RCNA 3UG7A 1WBBA 3QXHA 1EGAA 2VHQA 2IX3A 2O0HA 2FGKA 1PUIA 1RYFA 4Q18A 4C7OB 4YMWA 4Z51A 2FPLA 4GZMA 2VEDA 4FINA 5IRCD 4A82A 1XJ0A 4C0BA 4HSEA 2SHKA 3WBKA 1CJVC 3BIFA 3T5GA 3K9NA 4EAQA 4DHEA 3UANA 4MA4A 4EUNA 4F38A 5CDFA 1F3OA 1KTVA 1WMSA 2EVWX 2YYZA 3FKSA 1HTWA 4JLPA 4LJ9A 4O2LA 5FTKA 3RABA 1BYIA 3QKSA 1NVUQ 4A1FA 3IO3A 3ZJYA 1NVWQ 2YWEA 4D6PA 3A1WA 4BFVA 4M1WA 4OJKA 5AJYA 5L3RA 2GK6A 5GVRA 4HUTA 1TAGA 2Z4SA 3SDZA 3BJIC 2GZDA 5CIWA 3I61A 4RD4A 4DZZA 4NU0A 2FZLA 5TMPA 4PC7A 1CBUA 1KGDA 2GRJA 2HCJB 1KSJA 4LJ7A 1NJFA 3VKWA 3TUZC 4MDFA 1U2RA 1MR3F 2PBRA 5UKDA 3UWKA 3KKOA 2D4HA 3QF7A 2FE4A 2QAGA 4AKEA 2ZETA 1E69A 2REXB 2BWJA 2ODBA 4ARZB 3ZQJA 1EX6A 3RWOA 5A4JA 4Q7LA 4LJ4A 2NPIA 1E2NA 3I3SR 2H57A 2ZI6A 1EWRA 3U7EB 2ZRLA 2JLZA 1FOEB 3V00A 4LPSA 1I2DA 4B44A 3AVUA 2A3RA 1JQJC 3VMFA 1F48A 5JMTA 1US8A 2C8VA 3X2SA 5M04A 4TSFD 4CEHB 4TT3D 4C2TA 5FTMA 2F43B 3EZ6A 1IHUA 1P2TA 4JLMA 5HZHA 4NH0A 1Q1BA 2GESA 2HYDA 1XZQA 4KSCA 4B71A 4OKSA 1P60A 2ASEA 3MG9A 4JVSB 2E87A 2J0SA 4JJKA 3RRZA 5DNYB 4NCIA 1TQ2A 1AGRA 2JLRA 4JBYA 2YWHA 2ZJOA 3RC3A 1HUQA 1D9XA 2NO0A 3DM5A 4DCVA 3TKLA 4M4SA 4B47A 4UQOA 1G18A 3T1TA 2G77B 4HAXA 3KL4A 4ZDIA 3A1TA 4EPXA 3AF4A 3CKLA 1W0JA 2ERYA 3B85A 1FPMA 1M8PA 2DHRA 4UNSA 2ORIA 4LX0A 4TMWA 821PA 1U8YA 4F93B 4NPHA 2OBMA 2R6FA 1QG2A 3SFZA 2RGDA 3PV0A 2IS6A 2OHFA 1KI4A 4M9ZA 2WWIA 1XB2A 5KYKA 1IXSB 2QY9A 3GLFB 3LVQE 3KTAA 1UPTA 2ZJAA 3BS4A 1KI6B 5B64A 4EPRA 3PVSA 4TYQA 3PUVA 2PZGA 2HXSA 4UNQA 4LOAA 4LRWA 121PA 1IJFA 5DN6A 2A5GA 3QKUA 1MO5A 1YE8A 3HR7A 3MCAA 4KAXA 2WKPA 3SQWA 3H84A 1R4AA 2C95A 3BB4A 1VIAA 4IXMA 3P32A 3EIQA 3QKRA 3U7HB 1CRQA 1X1RA 3OF5A 4I1UA 4DCNA 1XPUA 1H8HA 1BYUA 3FE2A 3RNLA 1QHYA 2IL1A 3N70A 4ZDJA 2ZUDA 4DT1B 1F2TB 2QGNA 3DL0A 3GJ3A 4MYCA 3B13B 4RZ3A 5ANRB 3T1VA 1W36D 2VSOA 2W6IA 4W5WA 4MKGA 2VHTA 3ADBA 2OILA 3GEHA 1VG9B 1ZRHA 2AR7A 2DYKA 4HDCA 2NTYC 1XBTA 4Q7MB 2EWWA 1KSFX 1LS6A 3GMTA 4MGZR 3UMSA 3K09C 4LJYA 4LV5B 1SXJC 4NYIQ 2OBLA 3I72A 2F7SA 3CRRA 3AVYA 3DO6A 3E5HA 4L8GA 3MUFA 1P9RA 2VQSA 3C4JA 1U98A 4RD6A 1HT2E 4WIAA 3TR0A 4C9BA 5JWRA 1UBGA 2F9LA 3SHWA 3AUYA 2WIBA 3K0CC 2ZUCA 2XAUA 3UWOA 4B6FA 1XMJA 2C04A 2QMOA 3GEEA 3PXGA 1Q0UA 1OIVA 1XEWY 1EFRD 2ZE6A 4JLJA 3VFDA 4IDNA 5K8UA 2J0VA 3BBPA 2CHQA 3C8UA 5DN6D 4FWTA 3OHMA 1CXZA 5EE9A 4QM6A 2HEIA 3NIBA 4NCHA 3AGPA 1X1SA 2WJGA 4DSUA 4ACAA 2FX3A 3B7GA 3CZQA 2K5UA 4N0DA 1A2BA 1G19A 1IXRC 4QG7A 1XTJA 3ZIAD 1YZTA 3Q8XB 1ANKA 1KDTA 4OK3A 1FQKA 2AHOA 1EWQA 2AXPA 1LS1A 4JBWA 3TJZA 1WP9A 4H1VA 4HB0A 3SYLA 1W46A 2JIZA 1WDTA 5GADl 1XXHE 2BBSA 5FOTA 2WJHA 5EP1A 5LB4A 2VH5R 2IYYA 4PZYA 3VHLB 3WHKA 1CEEA 2RAPA 1P5ZB 1UF9A 1X8KA 4PAMA 4DIDA 3ZZUA 2YOGA 2ZYWX 3BAFA 2BM0A 2IEYA 4DLXA 1WF3A 1KI2A 3E1SA 1GRQA 5JRJA 3FMOB 1FL9A 4QBFA 2C03A 5K8LA 2ONKA 5L3QB 2P5SA 2JEOA 4KBGA 4US1R 2LKCA 4WAUA 1P9NA 5L8VA 3M1IA 4IVQA 1KO5A 3U3KA 2WHXA 1RIFA 4B74A 3OFND 4QGFA 2G6BA 2IHYA 3BFVA 1XD9A 3NWJA 2XEXA 4MKFA 3M4YA 3RSOA 4A0RA 1J99A 2VIIA 4PAOA 4LV8B 3RS5A 1SXJA 1XMIA 4B2PA 4M1SA 1N0UA 3LY5A 2ATVA 2ERXA 4TSFA 4B2LA 2BMDA 3TQFA 2QG6A 3KTAB 5GVSA 3NKVA 1P7CA 1IQPA 3WMGA 2HCBA 1Z5ZA 3W5JA 1IY2A 2AWNA 4AKIA 4RJLA 1R5OA 4KCGA 4BLOA 2I4IA 4HATA 4D25A 1AQYA 1BH2A 5BWMA 3OE7D 4V0MA 1DAKA 4BZXA 2OFXA 1KNQA 1D2EA 1J8MF 1XF9A 3KJIA 4PX9A 4PC1A 2AK3A 3AQ4A 4OL0A 1E4VA 2OZEA 5CB8A 1KY2A 4DLSA 3WYFA 2GAAA 2QM8A 1KJYA 1PLJA 5CLLA 3B1VA 3FFAA 4IW3B 1VG0B 5CLQA 3LW7A 4HI0E 4LHZA 5DHAA 3PUXA 1GNRA 4ZIRA 2JLSA 5H68A 1AN0A 1BMFD 5H8WA 3B1WA 3GFTA 4W7SA 1N0WA 3CBQA 5C18A 5KO2A 3G0HA 2GJAA 1R0XA 3EAQA 4HZUB 3KJGA 3GLIB 4CEHA 1Q1QA 2XOKA 1OH8A 4DXAA 2ZJYA 1N5IA 2IS1A 5KU1A 4HAUA 2GVDC 3D8BA 4OQLA 2BHRA 2W83A 1JALA 1KO4A 1SXJB 4LYFA 4UNPA 4EPWA 2DWOA 3A58B 2JDIA 4UNNA 1N2CE 3R7WA 4B3XA 1NG1A 5GJVC 4G5QA 4I4LA 1OXXK 4QNRA 1ZM3A 5FPSA 1HE8B 4DVGA 4IKEA 5KUTA 1B23P 3I92A 1DTSA 2O5VA 2RHMA 1R2QA 1YZQA 2G83A 2QENA 3GLIA 2IXFA 5LPNA 2JA1A 3U3OA 1JEDA 1UEJA 2YKGA 3U4QB 5JWOA 4BQSA 5FH9A 1KI9A 2VLIA 2B92A 3NHAA 2GEUA 1ZC4A 4LUCA 1N6NA 3EW9A 3HWSA 3LLUA 2R2AA 4RKFA 1YZNA 3AV0B 3RYTC 4IOJA 4KFTA 3CONA 2CHGA 3AUXA 1ZD1A 2FGJA 5P21A 3TE6A 4A8JA 5KHOC 1QG4A 4ESHA 1TF2A 2BCGY 1FP7A 2QTHA 3Q3JB 4GMXA 4I1OA 5FR2A 4Q7KA 4ZO4A 4A9AA 4M9XA 5FOSA 2WWHA 1G4AE 1R0YA 5FUVA 1QHIA 4JYCA 4LBWA 5CJ2A 4DLYA 4RZ2A 4JT4A 3KQKA 1JXOA 1KDPA 2NO9A 1UBEA 4IXNA 3AB3A 3H1TA 3AVQA 1M34E 4DB2A 2WKRA 2HT1A 2F1RA 3A36A 2WVJA 1H8EA 3BH7A 1G3UA 4HZUA 1PLKA 3ICQB 2BBWA 1E1RA 3B9QA 5GJCA 5L3SA 1AQUA 4PPQA 2NMVA 2QP9X 1ZUHA 2D3WA 1O87A 2VP2A 2O8DA 2PH1A 1US8B 3NBXX 2P6UA 4DIEA 1FMLA 4ZV4A 1EX7A 2JJ1A 1C1YA 2NGRA 4TQAA 3KUDA 2KWIA 2A2ZA 2GJKA 2N1BA 4PFSA 3GLHA 4AC9A 1U81A 3IUYA 2VP5A 4H1UA 1UDWA 3BXZA 4HDOB 3B5JA 2CCJA 2HF8A 2XZPA 1G7SA 3FHCB 4TMKA 3TH5A 4MKIA 1SXJE 5JRZA 3DM9B 5E7JA 1E1QD 4BLSA 2VP6A 3PEVA 4PZLA 3BB1A 1GL6A 1WE2A 1CU1A 4A8JB 1X8LA 2NPFA 4TQUS 5HKKD 3WRYC 3RS4A 4HAZA 4HLCA 1U0LA 2IC5A 1ZAKA 4A2WA 1H65A 2IUUA 1UBFA 2QTVB 2I1VB 4MUAA 3AP1A 3VHXA 2OXCA 4PHHA 2R65A 4DEXA 2XB4A 1KMHB 3W90A 4CDGA 4B35A 3RC8A 2YJTD 4DC9A 4DRZA 2ZE5A 2XJ4A 3CX7A 5EE5B 3TBKA 1XRJA 4AKHA 4EPTA 2DFKB 1KIMA 3I5YA 2MSCB 3IGFA 2VSFA 4XJXA 3U61B 3W8NA 1AZTA 4JLVA 3VNUA 2G1JA 5HKKA 2VF8A 1TUEA 1E2JA 4Y0AA 5G53C 1PLLA 3SOPA 1ESMA 3QXCA 4URUR 5JBQA 4X8MA 2VTKA 3DKVA 3UKDA 4UXJA 3RRMA 3WP0A 1E2FA 3L43A 2LKDA 2QP3A 1ZM9A 2IEZA 1ZNYA 1GKUB 1FUUA 1LY1A 5KNBA 1XFAA 1YRBA 1S9DA 2QEQA 3FMIA 1E6CA 4TL6A 5BW8A 1Q3TA 2G9NA 4WOPA 2GEDA 3RLFA 4YDSA 5CDFE 2ZTSA 3ASZA 3N2EA 4H9GA 4NYMQ 2FPKA 3T1QA 5EP3A 3GLGB 4WBSA 3SEAA 2D7CA 3SE0A 4RZUA 4YMUA 3JVVA 4OI0A 1S4QA 3MWYW 4LJAA 1Z0DA 3DOEA 3EC2A 4QHYA 5AUPB 4TLAA 3RRNA 3WNDA 4P31A 2DCUA 4V03A 4G1UC 4AG5A 2ZI3A 1IN7A 1M2OB 2ZI4A 4LGMA 3BGWA 3THYA 5JEEA 4LCBA 2WMNB 3B78A 3CF2A 2ZEJA 2GDJA 3VNVA 4Q1BA 3PEWA 2DB3A 3LFUA 1GZSA 3UIEA 1G21E 2HT6A 4DLWA 3LXXA 2V6JA 4W9MC 4R98A 3GJ8A 3BERA 3QQ5A 1K5DA 3A4MA 2D74A 3EG5A 3KFVA 4TL7A 3EZ7A 3NXSA 4IVRA 2DFNA 3AP3A 4QJ3A 4AKGA 1W44A 5FUWA 4PO1A 1S2MA 1TMKA 5KDLA 3TR5A 4CIDA 4GMDA 3BB3A 2FOLA 2WTUA 2IYTA 3THWB 4LJ5A 2JJ2A 3SN6A 1KI8A 3AKDA 3R9XA 1KZGB 1CKEA 4FCWA 2IF0A 4KYUA 1VG1A 3AVPA 4LHVA 3LAWA 1GWNA 2GEVA 3K8YA 1Y63A 4RD2A 1JPNA 4YMSA 1P2VA 3SQXA 1Z83A 1DARA 3VX4A 3WRXC 4PSAA 1UBCA 1W1WA 1C9KA 1KI1A 3ZS9A 2GCNA 2Z43A 1SZPA 1T91A 1KO7A 3HU3A 2JJ1D 1SGWA 4CYMA 1IY0A 4MRSA 1DS6A 2A78A 4ZPXA 3GLIE 2J1LA 1Q22A 2OCAA 1NIJA 1W4AA 2V8OA 1EFUA 4Q9KA 2QL6A 4IDPA 4ARZA 2BMFA 5FPTA 2HUPA 1WA5A 1ZC3A 2VSXA 4X8HA 1P2UA 2GXQA 1Z6GA 4IEIA 2W2XA 1EFRA 2YV5A 4QRHA 5FBWB 4XSGA 3QXJA 5JCPA 2O8BB 4RD3A 5E3HA 4GFDA 1RW4A 1X3SA 3EPLA 1IM2A 2ZI5A 2Q9CA 1J7KA 4NHOA 1AJEA 3CNLA 2HLDA 2I3BA 1YVDA 4TYYA 4PQFA 5LD2C 1NN1A 1FMJA 2ZITA 1YZGA 1GVNB 1E79A 1GP2A 2XOKD 1G5RA 1NBME 1DE0A 2KBEA 2IWHA 4CT4B 3VQTA 1VECA 3EWSA 4XTCS 3F8TA 4BRUA 4PO8A 2WPDA 1DELA 2E9SA 2C9YA 1QHNA 3ZD6A 1DVRA 4BFXA 4GBMA 3SJZA 2O8FA 3B82A 2NO6A 1ZIPA 3WNBA 3EC1A 4EQ6B 1LB1B 1RJ9B 2CL0X 1Z08A 1TQDA 4XSHA 2H8KA 5D3MA 1WCV1 3WXMA 4C0JA 2G88A 4JSTA 1A1VA 3M6AA 1JJ7A 4PAQA 3SHFA 1II8A 2IYWA 4DCUA 1G4UR 3B1YA 4FN5A 1WBDA 1DBSA 1VCOA 2R6CA 1AA9A 2FEMA 5DHFA 1IN8A 4JIMA 2GZHA 1N5KA 4KBFA 4O25A 2VPPA 4DDUA 2GCPA 4YDHB 3MFYA 2FDCA 2XSZD 3Q9LA 3ZD7A 1UKZA 3FKQA 1GKYA 3QEJA 1JR3A 4Q4JB 1I4TD 2J87A 2C2HA 4Q1EA 3ZLJA 1UJ2A 4YONB 1N6LA 2F1JA 2F1HA 3K9HA 3U6KA 1HH4A 4Q9LA 1HT1E 5CYOA 3KXIA 1AK2A 2WOOA 3C41J 3AEZA 1M6NA 2J5XA 1MABB 1VG8A 2MMGA 3CRVA 2GETA 1WB9A 4MYUA 4EPYA 3OAAA 2YOFA 4Q9HA 3RWMB 3CRQA 3AF3A 1VHLA 5AUNB 2AL7A 2BJWA 4URVR 5KNDA 1DAFA 1R8QA 2VRWA 2F55A 3P20A 2VYFA 4JMPA 4LY6A 4F92B 1S3SA 3NBFA 1KDOA 3TSWA 3GD7A 1OXUA 2J45A 4WZBE 2BVNA 2X2FA 2YINC 1SVMA 1UKVY 4XTRA 4PO9A 1G291 1MV5A 2IF2A 1LVGA 5FI1B 4LYAA 4IDQA 3AF0A 1IN4A 3I8SA 2A30A 5FOVA 1ZINA 1NVVQ 2OAP1 2ZRJA 3W6OA 4BE7B 1EESA 4PHFA 1II8B 2WWWA 1B0UA 2J7PA 4B32A 2ZRCA 1QRAA 2F43A 1XU4A 2GBLA 3T61A 2C77A 1CR0A 2FSFA 3F3YA 1OH6A 1XEFA 1S0UA 1FQJA 4KFRA 2H16A 1IBRA 3TMKA 5C4MA 2OFOA 5BQ5A 3AKEA 4KITB 1E9DA 3BORA 3IILA 4G5OA 4HB3A 2IYLD 5JWHA 3CX8A 3W8RA 4XVRA 1OPXA 1W36C 2PZFA 1GILA 1E2EA 2B6HA 3HJNA 2GXSA 4DLZA 2QUZA 1OYWA 3CF6R 3FYHA 1LNZA 1G8PA 3EA5A 5KTYA 3K0SA 1T8TA 1OT3A 1IN6A 3CLVA 1E79D 1U8AA 3TUIC 2HDNB 5J4YA 1G5PA 2ZYVX 5DE3A 4C0SA 2PX3A 3D31A 2IA5A 5EXXA 4KHZA 2ZXUA 1XMSA 1N6OA 3QIAA 4MKHA 3LA6A 3LNCA 1XPOA 3U3RA 1UM8A 5DIFA 5KSPA 3IBGA 1XEWX 2HV8A 1N6IA 1TUIA 4G3XA 2WWFA 4ERNA 5H70A 1AA3A 1Z6TA 5EE1A 1I4LD 5CIQA 3FKSD 5AJXA 2QE7A 3EA0A 3QPVA 1T3SA 3F0TA 1T5IA 4U5XA 3U3MA 4A0FA 2V1UA 4F4IA 2L0XA 3RDPA 4QKQA 2EFEB 2CVHA 2QQ0A 2H18A 4QHSA 2QMHA 5GJWC 3WY9A 4DCSA 1Q20A 3NDPA 2HLDD 3NEYA 4Z8XA 4R7ZA 3K09A 1UDXA 5B2ZA 4S2EA 2AWOA 1SVKA 4ESVA 1NBMD 1S9HA 1L4UA 3TSOA 1KY3A 2RGNA 1SHZA 1E9CA 1K8RA 4R9UC 4XWOA 4UKDA 1Z3IX 1E0AA 1E9FA 3FVQA 3L0SA 3QOFA 1E9BA 1RE0A 1P4SA 5HTKA 4NYMR 3SJCA 2PCJA 4D0GA 4GDFA 5JJKA 3BRWD 5L3SB 4JLAA 5DLQC 3CB4A 3S1AA 3KKPA 1IAQA 2J3EA 3T35A 2IHBA 5E7MA 1CJUC 1OLOA 4C7OA 1LV7A 1U0HC 3BH0A 4AY2A 4D81A 3QG1A 1A5TA 3CPJB 2CHVA 1JBKA 4OHZA 2QMEA 4ZCLA 1N6PA 3ND8A 1ZU5A 2C5LA 3RAPR 1OFHA 4NE2A 1P6XA 4C0QC 3K70C 4MQBA 1U99A 5DI9A 2GWHA 1KSHA 4TT3A 2IBMA 2J46A 5KPJA 2A7QA 2ZVPX 1Q21A 1KOFA 2GF0A 5EE0A 1CULC 3VU9A 5CM9C 4RCYA 5AJWA 3UATA 1T3HA 1TEVA 5EQTA 2WAXA 1P3JA 4LV6A 3FHOA 5GJBA 3U5ZB 5HCNA 4U7DA 3O8CA 2MSDB 2YZ2A 5EXPA 1ZM2A 3MMPA 1UEIA 2PL3A 1YZLA 4PTLA 3QSYA 1S3GA 2R62A 4TYNA 3IIKA 5DISB 4AYTA 2H1LA 4TMZA 3OEHD 5JS8A 2QM7A 2OESA 2ZRIA 3T1OA 1NG9A 4E09A 1G1MA 2FV8A 2O52A 4PC2A 4YXWD 2W2VA 1CTQA 3QVUA 4OQFA 4HB4A 3SC3A 1BMFA 5JCZA 1SKYB 3K53A 2GAOA 3LQRA 3OEEA 3P27A 5CK5A 3D7MA 1GKIA 5E4FA 3HR8A 1P61B 1NN3A 4I81A 3W6PA 4ZKDA 3J81k 1R0ZA 1DG3A 1R0WA 2CL7X 1F2UA 1G3RA 1QVRA 1W49A 4M1TA 3VTKA 1S1CA 5JI2E 1OE0A 4B34A 1RRCA 5JEDA 4UNRA 1VHTA 3GJ5A 1IN5A 1OXVA 5G3YA 2YC4C 4C0HA 2G1KA 2QT1A 2RKOA 1NL3A 2OFWA 1Z2CA 4M53A 3BFKA 4B3GA 4ABYA 2JAQA 1JR6A 3QKSB 1KMQA 2C9OA 4UJ5A 1N6RA 3IHWA 4US2R 1HYQA 3THWA 2QRNA 3ZH9B 1D8TA 2D62A 3T5DA 4F91B 2HJGA 5LB2A 3OEED 1LF0A 1XTRA 1N5JA 1P75A 1WQ1R 1Q1EA 1YR6A 4HLDA 3U44B 3CO5A 2P65A 3IIJA 2F1IA 2V6IA 3G5UA 4F4CA 1DO2A 1A7JA 3AVOA 4POAA 1JNYA 2DFTA 2HJVA 3K1JA 4TYPA 2VP4A 4BLPA 3PIRA 3ZZTA 3U7GA 1QBKC 1U90A 1MRSA 4JLOA 1D2MA 1CLUA 1SKYE 3VU9B 4BECA 2VBCA 3BH6A 2O8BA 3AF1A 2XGJA 1YJ5A 1TPZA 4YXWA 3QUSA 1JXMA 1BIFA 1C4OA 4QBGB 3EIHA 3PG5A 3RS2A 3KDSE 3AVVA 2J7KA 2CNWA 4MGIR 4CEJB 1OW3B 1R8SA 3WMFA 2NIPA 4O0MA 3VR2A 2ZAOA 1LTQA 1VYVA 2WMOB 2D2EA 3X1ZA 2QBYB 1DEKA 5H1YA 2WZQA 5HZKA 4PQRA 3WHLA 5F9FA 5K8TA 3U7FB 1TQ4A 2EQBA 3VAAA 2ZM5A 3PJRA 3SI7A 3HYRA 3NDBB 1S8FA 2PZEA 3QF4A 5FFMA 5C2JB 3THXB 4MRPA 5CB6A 2BC9A 4CVNA 4M2LA 4FW9A 4II7A 4DUGA 3TK1A 4B6EA 1W0KA 1P72A 2NG1A 4URYR 1PZNA 3GPLA 3QENA 4Q7JB 1RFLA 2G0TA 1BKDR 3QEOA 2R44A 4US0R 1KZ7B 2CLSA 1GNQA 2XB2A 3B6EA 4XH9B 1BO6A 1ZUNB 4L16A 4OK5A 4FIDA 4Q4JA 5JS7A 5E7IA 5FPYA 3KQUA 4JLBA 3T12A 1E2LA 4TMVA 1ZD8A 3X1DA 2AK2A 4LBZA 2OCPA 2GA8A 3QKTA 2EWVA 1TU4A 3LBIA 5EE3A 4AI6A 1N5LA 3MD0A 1QDEA 2A5JA 1XD2B 2FU5C 3ADDA 5FR1A 2V4ZA 5LD2B 2PEZA 4C30A 3AGQA 2R9VA 4P4UA 4CRWB 2C99A 2IYQA 1G3MA 4BZPA 5JJIA 1L4YA 4D4MA 4UXHA 2VA8A 4YQFA 3ZYCA 2AD1A 4NKRA 4BEJA 3I4LA 3OAAD 4Q4HA 3U60B 4IOMA 1DAGA 3DOFA 4LI0A 1W48A 5HPYB 4KJZA 1KO8A 1XP8A 4QXAA 4LC0A 2OE2A 1E2IA 4URWR 1NVXQ 1G41A 1U9IA 3VR6A 5HE9A 2Q9BA 4EFMA 1E2HA 4Q02A 1CIPA 4M0LA 4V0NA 2AFHE 2ORWA 1Q57A 4DLUA 1OIWA 1H8HD 3I62A 5KSYA 4Q1CA 4RSGA 3O8BA 3EWAA 4FMDF 5G40A 1NMYA 1RRFA 2CL6X 1Z63A 1E96A 1I2MA 1KKMA 4GL2A 1M74A 1RVDA 5FBRB 5IT5A 1Q1ZA 1NN5A 4K8OA 3L0OA 1UADA 4BWYA 3H86A 2JLWA 2O0JA 1W47A 2XZOA 1G7TA 5FUXA 4AD8A 4Z8YA 3UMFA 4OBEA 1MO3A 2Q21A 3L8ZA 3DZDA 1E2GA 1G6HA 1XD2A 4BLQA 1QHHB 3HYTA 1E98A 3LO5A 5F9HA 1W2HA 4AYWA 5IDVA 3W6NA 2QMUA 3QPUA 4E03A 2CCGA 3GLFE 3HPQA 1NMXA 2WWYA 4FCTA 4B3FX 2EYQA 5HE8A 3BD9A 4JVLA 5CITA 2QP4A 3GQBA 2QPTA 4TTPA 2OT3B 3LH5A 4BZQA 3GFPA 5EUQB 2UKDA 4TYWA 4FMCF 3KQNA 1DO0A 2FEOA 5SZHB 2ZS9A 4KO8A 5SZIA 4XIGS 5JECA 3IQXA 4D0LB 3TVDA 4EJSC 2FFHA 2OCBA 2XTZA 4OJQA 2B7BA 1U9IC 5FBLB 1WRBA 4QGHA 1HQCA 3ONWA 1YZUA 1XEXB 3X1XA 2F6RA 3NH6A 3UK6A 1OH7A 2XTMA 1YZKA 3TVTA 2P3SA 1ZYUA 1HEIA 3IO5A 3LDAA 4A2QA 2H92A 2CNWD 4KVGA 4I99A 1MKYA 2KBFA 5JI3E 3Q72A 2V55B 3IHLA 2JLQA 3UPUA 1P73A 3CNNA 1KI7A 1FNNA 3FMFA 2XXAB 2ANBA 1YR8A 3DEFA 3E2IA 4XWAA 2ZYTX 1ZW6A 3OIWA 5AJZA 3ZGXA 4Q1AA 3B9PA 3CX6A 5C4GB 5CYPA 1T9HA 4QGGA 4NMMA 4ZI3A 4CF7A 221PA 2JASA 4B33A 2X8AA 3GJ0A 5G3ZA 4BFTA 1GL7A 1QHSA 2JLYA 1ZM7A 2H17A 4TL9A 2YWGA 4OQNA 2PLRA 4OI1A 2ZIAA 4LYJA 4WW0A 4RFSA 1KKLA 2AFIE 4Y0VA 1Z0IA 4MRVA 4QFMA 5FL3A 3K70B 3GLGA 4HAWA 1T4GA 1RRGA 1E9SA 1KYIA 1E2KA 3QG5A 4E07A 2ZR7A 3AKCA 4DSTA 1AZSC 2JIZD 4HEJA 2RGAA 1NP6A 3EZ9A 1K6MA 4Q03A 3JZAA 4G0NA 5FBVB 2ZVQX 4Q4HB 4QJ4A 4Z1MA 3C16C 1EFCA 3THYB 3SS8A 3FTQA 5FPHA 4CT5A 4M9SA 1CR4A 5KNCA 2WSMA 2NQ2C 3Q5DA 1FUKA 3EPKA 1NIPA 2UZIR 3A6PC 4DLVA 1P2SA 3FMPB 3NEJA 3RANA 4DDVA 2IK8A 4Q1FA 3QBVA 1XD8A 1XXHB 2IUTA 2Q0HA 2EU8A 2O8CA 5B57C 2QAGC 1IONA 1N25A 3KB2A 4TN1A 4GP6A 3FHTA 4NP6A 4GOJA 4BRWA 1JB1A 3ZVNA 2N46A 2OAQ1 3W9YA 1G9XA 5KPDA 1A82A 1YKSA 2R6GA 5IHPA 1QHGA 1Y3AA 3T34A 1W4BA 4NYIR 3VR5A 4X8OA 3A1SA 3VKGA 3LBHA 3L2OB 2JJ2D 4A36A 3ECCA 4B73A 1QHXA 2ZSDA 5DSZA 2ODWA 3SBDA 4TL8A 3O8RA 2ZYUX 4G01B 2Q3HA 4JKYA 4LHWA 5FUYA 2YVUA 2WAYA 3OIUA 3QXSA 2V1XA 1SKQA 2REOA 3PQCA 4OQMA 3AVTA 2FMXA 3CW2A 3MLEA 3AVXA 1GNPA 4D2IA 2ZI7A 4Q48A 1G64A 4N0EA 1DOAA 5KDDA 3OIVA 2Z0MA 3FOZA 3C15C 4P0TA 4OHVA 1OFIA 2IYUA 1T0JB 5J4KA 1FZQA 3WBJA 2VO1A 1T8UA 2QGZA 3OESA 1JI0A 4V0KA 3LD9A 3GEIA 3OIYA 3QBTA 3UMRA 3HDTA 4ACBA 2QZ4A 2RB4A 3BWDD 2AN9A 1Z2AA 4LBVA 4OHWA 1G3IA 1NBMA 3GJ4A 1GG2A 2CCKA 2CDNA 1SVWA 3I5XA 2BV3A 2ZSEA 4GSYA 4DWJA 4A0HA 3EIEA 3W34A 1DAIA 4MYTA 5FPKA 2BBOA 5LBIA 3JVUA 3RVBA 4MH0R 3LVRE 3FFBA 2NZJA 3RS7A 1VYUA 1G8FA 1W0KD 1XCMA 2OG2A 2AKAB 2QE7D 1MO4A 3KXKA 2ZREA 3V9PA 2JLVA 1IJEA 1SVLA 1W4CA 1Z22A 1NN0A 5C1BA 2JATA 4Q66C 2QORA 2N42A 2BOVA 4OHXA 1OH5A 1T5LA 3DDCA 4E5UA 2FFAA 4JVNA 4D4LA 4HLUA 2GHIA 3DKPA 4WA7A 1W2GA 4LZZA 4UJ3A 5TDHA 4GRAA 1EFTA 3SNHA 1N3BA 4B3DA 2IS4A 4U02A 4JVMA 1KK0A 1KO1A 1OYYA 1HY3A 2PMKA 4M1YA 4QHTA 2W6JD 4BPBA 4URZR 2G3YA 2GNOA 4TMXA 1W0JD 1EFHA 2AX4A 3EASA 3M0EA 1ZD9A 1QZXA 3UXMA 3D3QA 4KI0A 5EXSA 4L15A 3LXRA 1ONBA 1EXMA 4NZYA 4WZ6A 5AWFC 4O3MA 2RGBA 3W3ZB 3IIMA 1MH1A 2X2EA 5C46F 4MYHA 1Z0FA 4YMVA 2KI5A 1N6KA 1KJZA 4BLRA 4JYBA 2QROA 4CEIA 2E1RA 4RVCA 1XZPA 2QPAA 2ZRAA 4PC6A 4KV9A 2QQEA 1R10A 3SBEA 4DLRA 3K0CA 1VCNA 4QC2A 2IT1A 1FP6A 3DMNA 2ZE7A 3IBYA 2ZRDA 2I1QA 3ASYA 4PPNA 4HDQB 2Z6VA 2P5TB 1K5GA 2A9KA 5G41A 1GRNA 2OBNA 4ZDWA 4ZDKA 3ZVLA 3B8HA 3OFNA 3SR0A 3SYNA 3Q7PA 3TW4A 2EW1A 2NZ8A 4IRUB 3TAUA 1NF3A 2CEAA 4NTZA 2WJYA 4C2UA 5FTLA 3CIOA 2YC2C 5DI3B 2EFDB 4CEIB 1IOZA 1ZNWA 1VCMA 4Q01A 4Q00A 4TWZA 4ITRC 1ZNZA 2ZJ2A 2B7CA 1XMVA 1ZNXA 4A2PA 2XSZA 4JKIA 3H4MA 5JHGB 1UKYA 2D2FA 3Q7QA 3I32A 4ASUA 2FH5B 4Q21A 3KB1A 1DAEA 3G82C 5L3QA 4RD0A 4ZCIA 2O8DB 2GK7A 4IOLA 1BS1A 3FWYA 1P62B 2GXUA 1NLZA 1GUAA 3O8DA 2XXAA 2J7PD 3EZFA 4LHXA 1RC8A 2GJSA 2ZRMA 3U3JA 2C78A 4XWKA 1ETUA 1NLFA 4L9SA 4LDJA 4A0GA 4TZ0A 1KJWA 1JECA 2QSYA 2OXRA 2GTPA 3QY0A 2J0UA 3TLXA 1ZIOA 2OCYC 2FNAA 3ADCA 3N2IA 2ATXA 3CWQA 4JLNA 2IXGA 2R6AA 2ZSBA 4U00A 1QF9A 4D82A 5JSZB 5TB5A 1Z6XA 4JJZA 4EFNA 4V0OA 2PX0A 4IHQA 4QNMA 3K70D 3K0AA 4HUQB 4BFYA 1E9AA 5J4LA 1E9RA 4DSNA 2WKQA 2F9MA 1J2JA 4JL6A 4QL3A 3CPEA 5JLJA 1OB2A 3C5HA 3GJ7A 1UKEA 2BKEA 4GZLA 1D2NA 1XWIA 2RHDA 4LWZA 1ZVQA 3A8TA 1JR3E 1PV4A 4LJ6A 2DFLA 4EFLA 4EDHA 3DZ8A 4LHYA 4NBSA 5BXQC 2W0MA 2C98A 3KKNA 2O8FB 1VDZA 3A4LA 2IWRA 2V54A 4DEYA 5IK2A 4F7WA 3AM1A 3RS0A 3SU8A 4HAVA 5SZJA 5CJPA 3GLHE 4IFBA 2P67A 1MOZA 5DI3A 5AUQA 2WICA 1RZ3A 2KSQA 2Y8EA 4ZI2A 1W7AA 2BIFA 2MMCA 1XNJA 2ZRFA 1OJLA 3FGNA 3P4XA 3ZVRA 4A92A 4W5HA 3S1AB 5DYIA 3CF0A 3VR3A 3THXA 1KAGA 1KAOA 1F2TA 3CWZA 2DWQA 1COWD 1NJGA 2WOJA 1IY1A 2J41A 5FTNA 4KLNA 2HF9A 4MGKR 4DUGD 1GITA 2ZSFA 2QN6A 4Q4AB 3EARA 3AF2A 4ON9A 2CVFA 2PT5A 5EJEA 3ADKA 4EIWA 3F5FA 4IFEA 4NONA 1KK2A 2GKSA 5CM8B 2FZ4A 3DMDA 2PLFA 5K8IA 4Q9JA 5TARA 1E4YA 3KX2A 4PC3A 2A5FA 3K0EA 2BM1A 4YC7A 2LCFA 4BFUA 2QAJA 1XTQA 3C5CA 1L7VC 2ZU0C 2Z5FA 5BYJA 2UZ3A 1ZP6A 3MJHA 1N0VC 2DPXA 2H7VA 4GOKA 1J90A 4K46A 3U4QA 3PFIA 3CZPA 3GJXC 3QF4B 4MDEA 4N3NA 4V0ME 1ZBDA 1OHHA 2F3TA 2IXEA 3QKRB 3Q5EA 5BYKA 3IEUA 1VTKA 4NCKA 2O0KA 1OKKA 3IDQA 4PXAA 4RY2A 4AG6A 621PA 2ZR9A 2J59A 5FOUA 1ZMXA 2IYVA 1XEXA 1MO6A 1TEXA 4LJ8A 2CXXA 3KKQA 1TTTA 1W5SA 3CH5A 1EK0A 4CZ2A 2B21A 2VL7A 2AKYA 2CE7A 2QPOA 1FTSA 3EPHA 2ZJBA 1NNEA 4FCVA 3H0KA 3EZ2A 3SFVA 2OM2A 1GFIA 1SULA 1G6OA 5D3MB 1OKKD 4ILEA 1VKJA 1D6JA 2IUSA 3ND9A 4JS0A 5JSZA 5L3VA 1Z6AA 2FJUA 2GILA 4B48A 3U2QA 4TZ6A 2VHJA 2ANCA 3R7WB 5J4HA 2VHUA 3MWJA 3B1ZA 1II0A 1G8HA 1XTKA 3MJRA 2Q3MA 1G17A 1G3QA 1JEEA 4FMBB 4QBIA 3NBZC 3BOSA 1E94E 1RYHA 2QI9C 2J0QA 4XVQA 2PJZA 4IJMA 2CK3D 2ZS7A 3ZIAA 2J9RA 1OFTA 4QJ5A 4EPVA 5BN3A 1Z6YA
chains in the Genus database with same CATH superfamily
1A7AA 3W1WA 4RHEA 3X2FA 2CSUA 3NQ41 1ZEMA 2ZIXB 4H15A 4HX9A 4LZOA 5DCWA 3GLQA 1UWCA 2FWJA 1V5WA 1RZUA 3EXG2 2ZRBA 3JQ9C 4YTEA 1P74A 4E33A 4YAGA 3OQHA 2ODNA 1Z8FA 3EVGA 2UXCB 1FNDA 1ADYA 4CW7A 1ZUIA 4UD2A 1UBJS 2CNBA 2TMDA 2RGGA 3THOA 5JDCC 3BHNA 3L41A 1B2LA 2Y66A 2B1GA 4Z7QB 5A03A 2BKUA 5EMJA 3DVAA 2OO5A 1NOJA 4AYXA 3K71B 1WAMA 3U7IA 5A5DA 5JAMA 1W5TA 1YU9A 2Y99A 2WJJA 4P4SB 1LW6E 3EDYA 4FR5A 4TXHA 3WIUA 1Z4LA 1T0UA 2P9GA 4R5MA 4NECA 3RS3A 1ZISA 3Q85A 4PSCA 2JFGA 4W5JA 3RLIA 3PITA 4FKMA 2W6MA 3QFHA 2QN1A 3C14C 3ESBA 4HX5A 3W8EA 2ZRNA 3ZY5A 3ZQ6A 1P9WA 4LYYA 1KSGA 4YRJA 4ZZ0A 3LGAA 1C0KA 3BZWA 3A9TA 2KB0A 5TQVA 3WIVA 2HSWA 3O1JC 4IOKA 4FILA 1H0HA 1XRRA 2GGSA 3EAGA 5JXHA 1K2WA 1T9BA 1ECPA 1OZGA 2WP0A 3K4PA 2V74B 1UMCB 5JPDA 1DRKA 2ZANA 1MT0A 3PUJA 4RZIA 1JWBB 3ESXA 1J2YA 4DQDA 5KREA 1W85B 4L2IA 3RFCA 4C0KA 1HO3A 1H2XA 5DLDA 3HSSA 1NY5A 1I3OA 3HN2A 3MGGA 3LUGA 4L6AA 4ZK6A 1AKEA 3KQMA 1VCIA 1BQEA 3MILA 2J0UB 2LXNA 1CUXA 2BFBA 2AG1A 2FG6C 1W85A 1IZYA 2JGDB 2Z2ZA 3EQ8A 3GLHB 2WW8A 3I1FA 4FMDB 3IBFA 4UC0A 5CT8A 5DNWA 4BXOA 1LDYA 5DNDA 1XXHA 2B2NA 1OFUX 3I45A 3RR2A 1L8QA 4E5NA 1DDGA 3IRVA 3QHPA 4L5CA 2B4RO 1R88A 1I2CA 2QVCA 4KKXB 4L8FA 2Q8NA 4ZYTA 2VNKA 4CIVA 3NOXA 1ZWKA 3CR7A 4D4IA 5DNVA 1NC3A 3OH8A 4KQJA 3RYIA 3I9V6 4CKYA 1RP7A 3OX2A 3X3HA 3PYLA 1EK2A 3NG1A 2BBTA 5TXGA 1M75A 1O03A 5J63A 3R3VA 5IK2D 4Q6WA 4WBNA 4M22A 4PCVA 1G8GA 1ORTA 3JZMA 2D13A 3ZU6A 3GB9A 1YR2A 2JGDA 2I3GA 1VJDA 1E92A 4TVBA 3RIYA 2OD7A 2IH5A 2AQKA 4X85A 1PVOA 1KE2A 5GGXA 2I6FA 2HFJA 2QDKA 1A9XB 4M6WA 4OH1A 2ET6A 4COKA 5KU7A 3I2JA 2IW1A 2DR3A 2EFCB 2MTBA 3BAZA 4G1CA 4D4KA 4AB1A 5T8KA 1RHUA 1Y7TA 1JLRA 5FD8A 2NSDA 1G21A 2GCOB 5LA6F 3TTSA 4JSYA 4BFUA 2CLFB 4J0FA 1RNLA 4QOSA 5KQGA 1Z7WA 3FOWA 3UWDA 3HBFA 4X91A 2JGFA 4UHBA 4A5OA 4DPLA 5GONA 2X1HA 4H0CA 1RQPA 2PMDA 3HM9A 3S6JA 3COSA 1U3WA 3TMAA 3A6GA 4FTWA 4MYSA 4A6XA 2Y1KA 4X20A 1O58A 2HHCA 2JBAA 2YXDA 3D3WA 2CK3A 2DR0A 3SEZA 4Q7QA 4AQYB 4DUYB 3PSAA 2K2WA 3T3NA 1YAHA 3DB1A 1L5OA 1NXWA 5DBFA 3T3EA 3W2GA 1E7SA 1NXPA 1PR0A 2E5WA 4LYHA 3VKUA 4BGDA 1GY8A 1Z5WA 1Z6QA 2CLIB 2EZ4A 2CE2X 4FI3C 3MVEA 4LOJA 4AJPA 2R7MA 5IKPA 2HFKA 1RKBA 2D1YA 4O4LF 2VPTA 2XTJA 4AROA 3AIIA 2TRSB 3WFJA 1KDVA 3AP2A 5JTTA 4EG8A 3TDKA 1I0LA 2F3UA 4UM7A 3EVFA 4I6JA 5EWJB 1EU1A 1Z73A 3JWPA 3FDZA 4OHFA 4D9FA 2HMVA 4E5KA 4ECAA 1OXTA 1QCYA 2B4QA 2F64A 5BSVA 2BRUC 3IQWA 1Z47A 1O0CA 1TQ6A 5E7QA 4QEKA 4YP7A 1AGPA 1RM0A 2N3ZA 3SXUA 1K75A 4JGBA 2JVIA 1QPGA 5CNKA 3RM3A 1M2OA 5L45A 4PPYA 4GRDA 4RHYA 3LJKA 4YCBA 3VV3A 2ZAMA 4DLKA 3PBKA 4KO4S 4MQ4A 1EFPB 4UTOA 3E9DA 2E5LB 3HQ4O 1CF4A 2Z8YA 4H08A 1CCWA 4F8EA 1M7BA 5KDOA 3C8DA 1X80B 2HK8A 3RRYA 1FP1D 2F00A 3HB1A 5B53A 1JLHA 1LTKA 4LRSB 4MRRA 1GR0A 1V43A 2AD5A 2X3UA 2ZQ5A 5TVKA 3A9SA 1R6TA 3P94A 3RRJA 5LYJF 5LZ9A 4P58A 5A6SB 3TLEA 3UT5A 5BSGA 2QLTA 4PRYA 3HPRA 3ANTA 4NCXA 4DRXB 3LRPA 3VKFA 2YCBA 2QTAA 2E4UA 4MUBA 3RT7A 2KJQA 4QUKA 1EAYA 2DPYA 3WB2A 2KE5A 1WNFA 4L8VA 1QSGA 1QIGA 2Q1WA 1MG0A 3PNSA 2Q3FA 4FMCB 5HCIA 2WWXA 2ACWA 2WJVA 4DYHA 1L5QA 2JAXA 3CIFA 3HU2A 3GI1A 2YUTA 3R3ZA 3CR8A 4MJ7A 4RK1A 3RHFA 4EG7A 4YCSA 1PNOA 1RJ9A 2CMDA 1AM4D 3KOYA 3LRXA 4MLZA 4UFNA 5AW8A 5LOVF 3NATA 3D6TB 3HB0A 3F7TA 4J0CA 4LDNA 2O5RA 3A28A 5BSKA 3WRWA 3MD9A 3H1PA 1T2DA 2OOKA 2Q1UA 4GMGA 1YH3A 4JC8A 4RU1A 3W5SA 2B20A 4ZOEA 4B9AA 3EX7C 4CJXA 4IKOA 4Y1RB 5FBQB 4EYKA 5FYQA 4DMUB 2X4IA 3TX6A 4C3ZA 1Z0JA 1U65A 4E5YA 1F6BA 1DBIA 5AIAA 4XVUA 1MIHA 3NORA 5CH3A 3E7DA 3NC4A 5GAJA 2GN1A 1RTTA 1K2VN 2VHXA 4KO3S 4BNVA 3NBYC 4OAQA 3HJAA 3O75A 4U7TB 1AO0A 4YUYA 1OV4A 1IG3A 2WV9A 3SSOA 3T4XA 3UG6A 1W36B 4RBNA 2A9VA 1XL0A 1C1DB 1OBCA 3GLRA 4IJWA 2VXYA 3AZPA 3IJPA 4XWYA 3KT0A 4AMZA 4AN1A 4G24A 5I4BA 3QXXA 2SCUA 5BSRA 1OIXA 2AW3A 2J08A 5EP4A 4R71A 5KHAA 4BEBA 3KQHA 5IVDA 4TLCA 1LNQA 4G5GA 2AS0A 4BRZA 3AL2A 1XDWA 4LSGA 2DHEA 3VV2A 1ISMA 1C50A 1RI5A 3AOEA 3M9LA 5I3CA 2E37A 2FG5A 3B8EA 4UBOA 1V8ZA 2Q9AA 3JQDA 2SKDA 2YHAA 3MTIA 1HGXA 4LJSA 5EZYB 3EUAA 5B5SA 3R8CA 1KPGA 3ZHXA 4FHZA 1GNSA 3QE0A 2IYEA 4ZQFA 4EA9A 3L1KA 2RJOA 1IXZA 2XUGA 1I1OA 2XA1A 1JFVA 3SICE 2P2LA 2RDMA 4FP9A 4AQDA 3WRVA 1VSBA 1YRHA 3GH3A 1DXHA 2RSLA 5DCYA 3RSGA 8OHMA 3GA0A 1E64A 2XNDD 3E3NA 3JQFA 3OCWA 3QFRA 3U80A 2W0SA 4QOEA 3QWBA 5IU6A 2OO7A 3I8XA 4L8YA 3D43A 5LM3A 1G20E 1Y8QB 3ESQA 4BO9A 3H7AA 3SC2A 3UWMA 1GG9A 3M8KA 3NHUA 4L50A 2C0CA 4K9RA 4MVJA 4R8MA 4N12A 1H9CA 1G9TA 4KRGA 4LK2A 3DPUA 3JQ8B 1Y8RA 4IQ4A 4ASUD 4DE5A 1L4KA 1L5ZA 1P0MA 2VK2A 4DIUA 3IA7A 4EECA 2DCMA 1SXGA 4RHTA 3WLLA 2OCXA 2BL4A 2LNDA 1NVVR 4EG1A 1PO7A 4LZWA 2J09A 3LT2A 1E2UA 2JLBA 4GGOA 5FI0B 2CUNA 2OKGA 3TZCA 4ZIRB 1QQ7A 3NWEA 2WJIA 4HNVA 1ESNA 5KSZA 4UBJA 2P6RA 5AK6A 4ZYUA 3I2GA 2DFDA 2I2DA 4QIHA 2WKSA 1R4ZA 3QY9A 3BEDA 3OM9A 4JLKA 3P2IA 4OXIA 3BCRA 4YJ2F 3VKHA 2OGUA 3Q3VA 1XJCA 3Q4GA 1T9GS 3KQTA 5BN5A 4GPZA 3BFXA 4XD7D 5HM6A 3DMHA 1RWBA 1ZCFA 2B7LA 4K81B 2FX5A 2ON6A 1YR3A 4O2BA 4IV8A 2H2DA 5DRTA 1ODFA 2XDQB 2FSGA 4YAWA 3DZJA 4AJKA 5A06A 1L4FA 2VSQA 4BEVA 4CMCA 5FPPA 4RZXA 2AMVA 4PSVA 4IIYA 2HA0A 1FEZA 3GGSA 5KJFA 3D2BA 1C0IA 5K6AA 2AOXA 3ORRA 5I4KA 1I7NA 3BSSA 2O2HA 1U4NA 1LV8A 3PHHA 4OU4A 5FWAA 3C3KA 4D4HA 3I9MA 3KVYA 2OLKA 4V0LA 4CMJA 5FA8A 1NVTA 3L8YA 1H6CA 4OQYA 3ZW9A 3DF9A 4MRNA 2WNIA 4RDHA 2XIQA 3ZUPA 2JIDA 3L9WA 5T6BA 3BE4A 1ONSA 3G8DA 3RJMA 1QLWA 1GRRA 1BSVA 4DMRA 3AJRA 4TTVA 1EA7A 4PZAA 4D4JA 1BJRE 1FYFA 1D4ZA 1H1LB 2DG2A 3CRMA 4ZO6A 3MWEA 5DM4A 3VRHA 1YK0A 3KZ1E 1K1EA 2MSEB 3QWAA 5F77A 2XX3A 5LQKA 3S7ZA 3KT3A 2VF7A 4PLGA 4E21A 5DPMA 4NATA 1KEPA 2FXIA 3HLYA 1OLXB 3MJ4A 1T15A 3QPCA 3UB2A 3AL3A 5E4TA 1KI3A 2KLBA 2P27A 2X6TA 3Q3CA 2BY4A 3Q3GE 4PG4A 3R76A 3T7SA 2XYVA 4JENA 5KS2A 5B3JC 3RH0A 3L46A 3RTBA 4HUQA 2Z2JA 4IJKA 4WNIA 5IS2A 3DONA 1E3JA 5FL7D 4GP7A 3TZBA 3ZI7A 5EQJB 1E1KA 2JNWA 1CQJA 3BGOS 4IDHA 4CMKA 4XJVA 3CZ5A 3KDPA 2V7BA 3OJLA 2Z3VA 3BWXA 3HL4A 4I1VA 4I3HA 1WW3A 3EFOB 3P0EA 4YJGA 3WYAA 2QXUA 4PR0A 2PD3A 5I7VA 2LD4A 3L1UA 4M8NE 1X8JA 1V2GA 3BRQA 3LQ1A 3HDJA 1BHO1 1QPZA 5C7OO 3IHTA 4YJFB 4J16C 4MV4A 1T2EA 1E1QA 3RJTA 1M7HA 2XGOA 1WXQA 1R7RA 2TMKA 4ZCTA 5AR1A 1KVUA 5CT9A 1OR8A 1U1GA 4QT0A 1IPEA 3E0QA 3PEUA 4BQQA 3A9VA 2DKFA 4LF7B 1RADA 4KE8A 1QX4A 1LK7A 3C7KA 1T8YA 3HKEA 3OMXA 3PNLA 4JQZA 3RV3A 3SMVA 4P2BA 4Q3DA 5COQA 3M6LA 2JIBA 3RC8A 3EFOA 1ZCZA 2YHSA 4JBLA 3I64A 1T6NA 3MUEA 4LXTA 4RANA 4TTQA 5DW0A 4BCDA 4CLHA 1DBPA 4D3ZA 2AA3A 2ZWIA 4XSVA 5JBNA 5DEIA 1EK1A 4J91A 2NTVA 3HBAA 4ZT5A 4YR9A 2EJWA 4BFZA 4X65B 4Q4AA 4TUYB 1F0PA 5CLHA 3REGA 1ZOIA 4LFCB 4P81A 3TX2A 2W5UA 2O8CB 2NSJA 4L22A 1FFGA 4GPAA 4OB6A 3T06B 1NHWA 2YWJA 3L8FA 1NXOA 1EGQA 2VCEA 3DVLA 3MCZA 1ZVKA 1EM8B 3FAKA 4FYKA 4I55F 4L27A 2I71A 4ND2A 2CMKA 1QM5A 1O94C 4HEA6 1H2EA 2VJCA 4IV5A 1U2GC 1FNCA 4K28A 4LDZA 1Y3DE 3H2GA 4K0KB 1OY1A 1MFPA 2VC2B 1S6YA 5TY0A 1YL7A 2WVGA 3HNOA 3PC6A 5TPZA 3INTA 3HXLA 4OGWA 2IY7A 4GQAA 1ZGAA 1Q7BA 4OSOA 1I4DD 1RXCA 2F3QA 3P1JA 2G82A 1TL7C 1X70A 1F7VA 1V7ZA 4A8TA 5B7NA 5IZCA 4D0SA 4M98A 2DT8A 2OHOA 3NHWA 3JQGA 1QOQB 2WF6A 3OP4A 3UAVA 3BC1A 1IE3A 1TW3A 2HQRA 3NHFA 1VJ5A 1U1DA 2WJ6A 4WE3A 4RFSB 1J2TA 4N7JA 1QHHA 5IBRA 3UMBA 5JNVA 2N0SA 4BVEA 2UUCB 1FB5A 4WV3A 4J0QA 2WSSD 4JK3A 3UOWA 3ZGOA 4DVJA 1YMQA 4LZLA 5JZBA 4HLUC 4MW9A 2WDZA 1QKJA 4DL9A 5JHHB 4I9NA 3WAKA 5EXDA 2ZRPA 3RKUA 1XF1A 3MCUA 4NAVA 2B5OA 2GZRA 2CLMB 3ZWNA 4OLJA 4XYGA 4ICIA 4UMDA 4KVZA 5LJIA 5AW3A 2BP7B 5K0CA 2PRSA 1NKTA 2AHRA 1NURA 2BCJQ 3CZCA 2X9GA 1L4HA 3HADA 2XNCA 3SFTA 4PPGA 1O08A 2RH5A 2NOAA 3L4EA 4S35A 2NV6A 3ROFA 4JEUA 6PFKA 3B6KA 3L02A 3LT4A 1CDZA 4M1MA 4WK0B 2TECE 1FFHA 1TKAA 3DHWC 1IL0A 3RTAA 2ZPTX 2PGAA 2BGTA 1WLYA 2X0NA 3LY9A 4OSPA 4F6RA 1R5NA 1E99A 2Z09A 1MLDA 4WY2A 1T2FA 2RGXA 5JXWA 2YYAA 4NYJR 1BWPA 1YRAA 4WQMA 4Y98A 4YI5A 5IF9A 5K0EA 3DHVA 4FQ5A 1VB3A 3L1JA 3UG7A 4MHTA 1EGAA 1YA4A 1NYTA 3RSZA 3S2YA 4ZHSA 2IX3A 1PUIA 2YHBA 4CKWA 4HGYA 3ESDA 5FWXA 4C7OB 1IN1A 4FINA 5EMHA 3VH2A 4A82A 1YO6A 1QZUA 1XTZA 5HKOA 1ZGJA 1RC0A 3GP5A 3H18A 5GONB 5C1DA 1ODKA 4ZGWA 3AV3A 3NYWA 4I55B 5C3UA 1PAUA 1V4NA 1YS9A 4MA4A 2D6FA 3C6XA 1W6UA 4HLNA 3FIUA 1D7OA 2OQIA 3UA3A 5JASA 1JH8A 2YYZA 4JLPA 2Z30A 2VHEA 4OJMX 4S1NA 3OQNA 4RA9B 4FFVA 3RABA 1CQIA 2CZCA 2W37A 3EXG1 2H00A 2PUJA 3QKSA 1F4PA 1GZ3A 1THMA 2XR1A 4A1FA 2RGRA 1N3YA 3OZAA 3A1WA 4NIMA 4TM7A 5M34A 4OJKA 4C3UA 3UOAB 4HUTA 3LK6A 4EW3A 2OV8A 1UBNA 2A84A 3C6KA 5AHKA 4AF8A 3ZY2A 3AUSA 1GYRA 2ADOA 3BJIC 3LPMA 2WAAA 3EDQA 4UHKA 5IARA 2FZLA 4WK2B 3VDMA 2Q4OA 1WCIA 4DG9A 5BV1A 1H1DA 5BMVB 1O7JA 2HCJB 5ILQA 3OQIA 1YULA 1YOVB 2DH5A 4LJ7A 1NJFA 1O9GA 4RQUA 4X1KB 1GU0A 4QPCA 4MDFA 1T8RA 3DDUA 3L1IA 3MIIA 4JZYA 4PV7A 1I30A 3IP3A 3WIDA 1MEEA 2FK7A 4BMVA 1MORA 2ZB4A 3C97A 1ZKDA 4HWOA 4EY6A 1ZLYA 4GPBA 1JU3A 4ARZB 2ODBA 1E77A 1ES9A 2AEMA 1D2GA 1JKFA 4OV6B 4H18A 4ZVUA 3BG5A 3RSQA 4ER3A 1QRTA 4RCVA 4MS1B 1RZRA 3LLCA 2GCEA 2IODA 5IXJA 3JD2A 2OVFA 1CB0A 3LPCA 3W6ZA 2BSXA 1ORRA 4S1OA 2A3RA 3FLEA 4MB2A 2GR9A 1F48A 2H2AA 5IP5A 3VMFA 4OHMA 4ALLA 2YIJA 5M04A 2NT3A 1UWKA 1O5OA 1Z37A 4P2GA 5CFMA 4C2TA 1NF9A 1SKAA 4P3NA 3VDQA 4JOQA 3LUBA 3LFHA 3VC3A 1F3LA 4TYMA 4ZRNA 4GZ6A 3RK4A 4QWWA 2PXCA 1UEXC 3RGGA 4RULA 4NH0A 3H5WA 2HYDA 2F8SA 4D44A 3DFMA 2FKNA 3L7JA 1RRVA 2FP4A 4OKSA 1ZI8A 1BAPA 1Q6ZA 3ROQA 2ASEA 3SBXA 1L7PA 2XB6A 4JJKA 3L6OO 1PF7E 1ONOA 1TQ2A 4RK4A 1L8AA 1V11B 4HP8A 5BT8A 1RZVA 4U6SA 2NO0A 4X90A 3IVRA 2X0EA 4RM2A 5A2GA 4YPOA 5JG7A 4B47A 4O4JB 4UQOA 3V8EA 3T1TA 4FE7A 4N41A 4HAXA 1QZZA 1XK6A 1ZUD1 4EPXA 5IHXA 4FD3A 3CKLA 2JLYA 2ERYA 3PX3A 1FPMA 1M8PA 3R8FA 2ORIA 4FHDA 4F93B 3IP8A 5KKNB 3EIWA 2IHNA 2O9JA 1HT3A 1CUBA 3WDKA 2OHFA 2ZJ4A 1TTPB 4IIUA 3G9QA 4RHXA 4QPNA 2FWAA 3KALA 3ZHOA 5ADVA 1EWKA 4LWPA 4AMGA 5KYKA 1YB7A 2R0QC 2WU3A 3AEKA 4O4HB 1T0PA 2ES4A 1U3FA 2Q1TA 2VUUA 4U2BA 5C5DA 1UPTA 3BS4A 3E9QA 4R1QA 2HJ9A 2QE6A 1PJCA 4MRMA 1OVGA 4GKBA 1SO8A 1A5ZA 3PUVA 2VDKB 1N2JA 2CSXA 4UNQA 1GPJA 1MAHA 1IJFA 4LOAA 4ZA2A 1SMKA 4AFNA 2ZXEA 3MCAA 3HR7A 2XCOA 4EMSA 1R6UA 1R4AA 4YLYA 1ADGA 3BB4A 2BE7A 1VIAA 4PFKA 3P97A 3UHFA 2C0QA 3B3JA 2H06A 4FBLA 4I1UA 3ME5A 2XVXA 4YO8A 1JEYA 1XPUA 5E0KB 1CZUA 1STOA 2K7FA 3RBAA 2CXSA 5EJAA 3IB6A 3IH5A 2NP6A 3C3CA 3HI6A 2BFPA 2IRWA 1M2HA 1C3OB 3CLUD 5CH8A 3GJ3A 4ARVA 2XBUA 3T1VA 2YL2A 1E63A 1JYSA 1CY0A 2FMKA 2JBAB 3CGWA 2OHHA 2JAOA 1R0BA 4MKGA 1HE2A 2Q3CA 3MNFA 2VHTA 4KDRA 1NBEA 3SQLA 4LXIA 1VG9B 4EJ6A 1B3RA 4CKCA 4X41A 1XBTA 4RAQA 1UPAA 4EK9A 4EYSA 1EHIA 5MN4A 1QH0A 3E5RA 1G0NA 3V8RA 2CJFA 1H05A 1YMUA 1ZI6A 4E0BA 4BNTA 1SXJC 3QRWA 5AVTA 2UYYA 4FVTA 3IMFA 2Q2QA 3AVYA 3CZ9A 3JX9A 4ADSG 1NSYA 2PZ8A 2Q62A 4UE2A 2XCRB 4L07A 2F8LA 3MUFA 4L8GA 1O6FA 1X1AA 1ZZEA 1GNLA 1VMEA 4L4YA 1Y3FE 5A62A 3JD1A 3OE1A 1HT2E 2IYFA 4RD6A 1YTUA 4N3BA 1KQGA 4IIJB 4L4ZA 2F9LA 4MIEA 4J75A 1BROA 3OCYA 3OY7A 4QT4A 1X7WB 4MQMA 4LY0A 2XAUA 5C7IO 1FRQA 1XMJA 2QMOA 2CNOA 1PGJA 1Q0UA 2V7EA 3LSYA 4J7XA 5KI6A 4IDNA 3BBPA 4H1WA 3C8UA 4G0OA 2GM3A 4QRIA 1S89A 1E20A 1UFRA 3N74A 3OHMA 1VFPA 4NC9A 5EE9A 3ECAA 3CXUA 1DXQA 2H7CA 2HEIA 1U63A 4B79A 4IUDS 4NCHA 1C2YA 1X1SA 2WJGA 2FX3A 3CZQA 4B7CA 1IXRC 1G19A 2FZGA 1XTJA 1EWQA 3Q8XB 1KDTA 3ZCSA 1PJSA 2LE0A 3G0BA 2J6IA 3LT5A 3NW9A 4IF6A 3TJZA 1MX9A 3OWOA 1RZRD 1RTKA 2QD1A 3EMBA 1YI0A 3SYLA 2Q5QA 4KV7A 3FCOA 5EP1A 1CEEA 3BIOA 2VH5R 3S70A 3QTTA 1E6MA 1M54A 1P5ZB 1X8KA 1YJ8A 2OC4A 3IUJA 4I3GA 2NVWA 4U7FA 5DDIP 1J00A 4IGIA 4PWZA 3E1SA 1KI2A 3E7WA 1GRQA 3FMOB 2GPSA 2NNWB 2PM8A 5AVXA 3I6MA 1IB6A 2Q8PA 4MEJA 3WDSA 5L3QB 2FDRA 1QIIA 1WDKA 5L8VA 1X2BA 3AR6A 4DMFA 1G5IA 5FA5A 2WHXA 4PYIA 3ZWYA 3OFND 5IDWA 4IIHA 2QUAA 3QU2A 4J3FA 4FFMA 2C7PA 1XD9A 5AI0A 4ZVRA 3TD2A 1J39A 4A0RA 1U7DA 3OF2A 2NZ2A 1J99A 2R00A 3OJWA 3KQVA 2VIIA 4BMCA 1SXJA 2IEDA 4B2PA 1B00A 3GGPA 2YN4A 4DMHA 1DLJA 1PZFA 2ORED 2ATVA 5BNFA 5J5VA 3VMMA 5CLFA 3L49A 3OTIA 4ETIA 4U9HS 5CUQA 2NU9B 1TIPA 3REQA 2A1IA 2APJA 3NKVA 2AW5A 4GQIA 3T52A 3W8DA 4ERNA 2QZJA 3RG2A 1E1CA 1NVKA 4LJRA 4ROSA 1TKCA 3ZDCA 1PS9A 3F2VA 1Z5ZA 4K9PA 3D8HA 2SCUB 3T1NA 1CUEA 1FUIA 5AK4A 3A3PA 3KP1A 2X9LA 4HATA 1E7QA 5BWMA 2ZDHA 2ZIXA 3GV0A 3OE7D 3LPDA 4FIZA 4TTAA 1KNQA 1X0VA 4BZXA 5B2FA 1D2EA 4WFKA 2XDYA 2DAPA 3KJIA 4A73A 5CA0F 2MT9A 3FTDA 2XWBF 3DLTA 1WXWA 1E4VA 2OZEA 4V2IA 2VSNA 2GAAA 1W2WB 3O0DA 4B3MB 5EERA 4WK4B 5A6SA 5CLQA 4DWOA 3V33A 5L3ZA 1A8HA 1DP4A 1EPUA 1SBIA 1DC3A 2JLSA 5DBEX 3KIPA 1O95D 2C5BA 3WYNA 4DC0A 1JLMA 1ISJA 2HDOA 5H8WA 1P17A 5IFLA 4JLSA 4JYPA 5IKOA 4WN3A 4W7SA 5JNLA 1N0WA 5TT0A 3CBQA 1WMDA 4LN1A 5KO2A 3D2CA 2PGDA 3Q2KA 3ZCQA 1A5SB 2QBYA 3LBFA 1R0XA 3EAQA 3GLIB 5EPOA 2AC4A 1DWPA 2RIRA 2XPCA 1OH8A 4KZPA 4DXAA 2ZJYA 4PLPA 2QX8A 3VTFA 2EP8A 1DMRA 2BEVA 2QW0X 5IUJC 3NLLA 5KU1A 2EXXA 2GVDC 1W1IA 2AZDA 1FFEA 2BHRA 4QICA 3D4IA 3SZGA 5CFPA 3V8NA 3A58B 5AM5A 3DLCA 5DFAA 3RUPA 4KO1S 1N92A 4MTLA 1M76A 4FXOA 5F7ZA 1ZM3A 1W1UA 4G8CA 1E3QA 1S2OA 2XMZA 5KUTA 3ILHA 2VT6A 5DULA 1PFKA 1DTSA 5IXYA 4K88A 1ZGZA 3ZWMA 2QENA 3GLIA 1W73A 1EIWA 1ZA2A 2NXWA 1H0SA 3FRHA 2P9QA 3R40A 2XUFA 1IRXA 4H31A 4BQSA 5FH9A 1JE0A 5CVTA 5D6OA 4DCGA 1PDVA 3IEIA 4LS3A 4LUCA 4NENA 1N6NA 3EW9A 3H4TA 3Q88A 1YJBA 2UDPA 3HCRA 1GDHA 1YZNA 2EP7A 3TN7A 5KVAA 4IOJA 4OA5A 4DCPA 1FS6A 5KHOC 4MKRA 1HNNA 3NONA 4NZMA 1WUTA 3ICPA 3ILYA 2QTHA 4G9BA 5FR2A 1G21B 4M9XA 2QTLA 1G4AE 5E1OA 1L6IA 1UBLS 3I9FA 4C4TA 4RZ2A 3UGQA 2R11A 3AOGA 3O2QB 1L1EA 2IVZA 2WD7B 3V1KA 1MNAA 1I9GA 2XBLA 4AY3A 1WD5A 5LZ4A 2HT1A 4BFCA 2Y0PA 2F1RA 3A7DA 2W2QA 4YAKA 3BH7A 3M6VA 3PWZA 4HZUA 5FJJA 1CF9A 2BBWA 4ITUA 4M87A 4CU5A 3W5DA 3ER9A 5L3SA 4Z4FA 4PLZA 1LDBA 2EW2A 2VP2A 4NX2A 2O8DA 1GJRA 1NC1A 2J3IA 1TU0A 1WVMA 3FWNA 4N3GA 2W7TA 3R7AA 1FMLA 1VDMA 5MGNA 3P7MA 2BEUA 2JJ1A 3D1VA 3ULKA 4C7XA 2W42A 2E7ZA 3CH6A 3KT8A 3N9IA 1YGPA 2DH6A 4TQAA 2KWIA 5GY7A 4CCYA 4EJ0A 2EWMA 4LMAA 3MPOA 4ATNA 1IEQA 3IUYA 1SU4A 3BF8A 4O5OA 2FWPA 2HW8A 1G2OA 2WG1A 9MHTA 4B6RA 4PEVA 2EJVA 2CCJA 2HF8A 2OO3A 1G7SA 3IDFA 4EB3A 2I7DA 4FQ8A 3ZW7A 3BKWA 4HNHA 5B1EA 1SXJE 1J49A 1D4AA 2PLWA 1CZLA 3PEVA 3C7TA 3V7YA 1JHUA 1EFPA 2NPFA 5E6SA 3BD7A 4TQUS 3C7DB 1XU9A 2R7NA 3FMGA 4HLCA 1FFAA 2CYCA 2IC5A 2OV4A 5I01A 1ZAKA 1CZNA 1OMOA 3WWCA 1QOZA 2QTVB 4DV5B 1HNZB 2WIJA 5EJ5A 3RUAA 3DMTA 3GWGA 3QPDA 2V7XA 3OPVA 1I8TA 1YXMA 2X14A 4LJLA 3DVQX 1K92A 1XYGA 1Y3BE 1MGOA 2HN9A 2VK1A 4C04A 1TVKB 4DC9A 5CLJA 1GN9A 2I6UA 3P9IA 5FF9A 3U19A 3CX7A 4JY7A 4ZARA 5K3DA 5JARA 1IB0A 3KV3O 3RC9A 4EPTA 1KIMA 3RT1A 5EVJA 1N2CB 5LUAA 3I5YA 1QP8A 2MSCB 5I7RA 2FPWA 4XJXA 3U61B 1AZTA 2FQ1A 4JLVA 2AC7A 2WM8A 3K5WA 5CM2Z 1EUQA 2G1JA 2P0AA 5HKKA 1E5TA 1P1HA 3LP8A 4Z4HA 2GKOA 1QE5A 3IT2A 3OC0A 1AGXA 1NNUA 2PQ6A 3AY0A 5G53C 5C8XA 1BZYA 1EGMB 2XRFA 1XAGA 1PBTA 3C4QA 4H1HA 3UUWA 4URUR 2Q4DA 2FLVA 1HTTA 3RRMA 1E2FA 1M67A 2I99A 3K94A 2R6R1 4EFKA 2KM1A 4F9FA 3K0BA 1GKUB 1FUUA 4IDAA 3KOOA 2AJ8A 1UBMS 1XFAA 2P6OA 3DVRX 3QNWA 4N18A 1ZJ5A 5E4JA 2H1SA 2SKEA 1QANA 5JD3A 1Q3TA 1U8XX 2O20A 1B8PA 1B8UA 2A9OA 3FFWA 4FNGA 4ID3A 4PGGA 3H9UA 2H1RA 4KQKA 3RLFA 5CFZA 4H9GA 1NX6A 4NYMQ 3JWHA 5TMDA 2OD2A 3C6MA 1FLDA 5TPWA 4C87A 4L28A 2FQXA 4LRXA 4U7WA 2D7CA 3SE0A 3DEAA 3PGA1 4YMUA 4M99A 3NHLA 1V9LA 4J8PA 5FORA 4AULA 1S4QA 3MWYW 4B4VA 4JUBA 4D9JA 1B8OA 5AJTA 5I7HA 1CY7A 3MHTA 3AI2A 5EMNA 2P35A 4DREA 2O2EA 4JBNA 2FMFA 5AUPB 5K45A 4MJ3A 2Z9CA 4I4IA 2B6NA 1GTMA 2GCGA 1GFWA 2ZI3A 2P7IA 2Q1YA 2GBGA 4B3RB 5JEEA 2JIPA 4LCBA 2WMNB 3DT6A 1QG0A 3E53A 3B78A 1LCIA 2I67A 3FPEA 3L1VA 3LDUA 1O94A 3O26A 4L76A 3PDJA 1FQWA 5JLAA 3MQFA 4WL0A 4XPIA 4E4YA 4ML3A 2DB3A 1W5BA 3DZIA 4HAIA 4E32A 2PUFA 3KD3A 5CEFA 2R1TB 1W35A 2V6JA 3AEUA 1YQEA 1B16A 1D4OA 3BERA 5BR1A 1GUYA 3QQ5A 1RU3A 2AOUB 2XKKA 1AQ6A 3NXSA 2VAMA 4DCCA 4QREA 3IKLA 1TAHA 3AP3A 4QJ3A 1W44A 2GD1O 1M2EA 4Z3DA 3TR5A 5JZ9A 5GWXA 2XRYA 3THWB 4LJ5A 5K9ZA 4JYZA 3H8SA 4W5QA 2JJ2A 2PT9A 5IJAA 4O29A 3AKDA 3R9XA 3AF5A 1CKEA 1XAJA 1NM5A 2ZWAA 3DMYA 1T5TA 2Y1GA 3EEIA 2DUNA 4RSRA 4KYUA 3AVPA 2FK8A 3FMVA 1GWNA 2IIBA 3G13A 1R9MA 3N8GA 4G1MB 4RZQA 2MJLA 1ARZA 3LOUA 4RD2A 9ABPA 4YMSA 3HHPA 3SQXA 3OZUA 1OROA 4ARBA 4BMPB 3VX4A 1AKUA 4PSAA 3H5NA 4W1QA 5INTA 1QONA 1IPHA 1C9KA 5GGYA 1UJBA 3I0MA 4PGMA 3ZS9A 2P2YA 2Z43A 5BR8B 3OD5A 4NH4A 3KTDA 1DJLA 1CZRA 1J56A 1SGWA 1B1AA 4ZPXA 3S2GA 2JCXA 1V3QE 1JSCA 5JYEA 2G8LA 3FSRA 1WHSB 3DXFA 4MVJI 3JYQA 3GGCA 3MHPA 3E22A 3TCXB 3FPKA 4IDPA 1P8AA 2X42A 2BMFA 4C4RA 3ODGA 1PL0A 1P2UA 5GM1A 1QUFA 2CBGA 1NJ2A 1PP4A 2DPMA 4QRHA 2OORA 2PUTA 1TYAE 3GJQA 3QXJA 4PFQA 5E3HA 2O8BB 2FWMX 4GFDA 4Z0TA 4DJEC 2VATA 1X3SA 3A3NA 1G8KA 1IM2A 3O2SB 1H5UA 3PL5A 4TM8A 4A0SA 5JIBA 3DFZA 3AUAA 5DM2A 2Q9CA 3GBSA 1TUBA 4JSRA 4RIIA 3V46A 3A3YA 1Z36A 2HLDA 2I3BA 4MPRA 4YCJA 1C8VB 4EG5A 1JHRA 4ZC1A 5M5BA 2XYPA 1E4EB 4EENA 1VHWA 2IZ5A 2GBPA 1UK7A 4H7PA 3W4IA 2XOKD 3LQYA 1FU7A 1YVRA 3E03A 3EWSA 3U37A 2VYQA 5EJ8A 1I36A 1ZXBA 3BL6A 5LLSA 2VAPA 2E9SA 2C9YA 1QHNA 3DGFC 5EIEA 3T9FA 3ZD6A 3M2TA 1UUFA 1IY8A 4M86A 1PR5A 5IJ9B 1BE1A 3EC1A 2CL0X 3U4HA 4EQ6B 3MQ2A 1Z08A 4XSHA 4CN8A 1WCV1 1CQZA 3GP3A 4Z1OA 2UZ1A 3O1HB 5CX1A 5H5JA 3SX0A 4D8UA 4BJ3A 1M0EA 3QV2A 2BGGA 4PN3A 4DR4B 2IYWA 2Q2WA 5K03A 5DW3A 5DWQA 4CFZA 4G81A 3T5TA 5AKLA 3GARA 3C98A 5C37A 3B1YA 3GIDA 5A4DA 2R6CA 3CSUA 5FRDA 2NZWA 6REQA 4JIMA 1U2DC 1N5KA 5CA1B 2FDCA 2VBGA 3MFYA 3SHOA 1Z5VA 2BLLA 1P1JA 5CW1A 4JV5B 3SVLA 1U11A 2C1EA 1UKZA 1L7RA 1EEHA 1EQUA 2Y1FA 3DHEA 1CY2A 1JR3A 1HKHA 1OWLA 1T10A 1B3BA 1U6KA 2HRDA 1QGAA 2PTHA 4W82A 2I4RA 5JZSA 3ZLJA 1UJ2A 5CDYA 4YONB 3A14A 1N6LA 2F1JA 4C4SA 1TLFA 3K9HA 2GNAA 3QX7A 1YRLA 4BMDA 3MYYA 4EKEA 3U6KA 2WJPA 3SYMA 1UT5A 3EBPA 5H80A 1HT1E 3BIXA 4QYXA 3QSYA 3KXIA 3L9XA 1RMYA 2WOOA 3C41J 1A71A 4X6UA 2DBRA 3WL6A 2XI4A 4BO4A 5DNCA 1VG8A 1FVOA 2F17A 1WB9A 3QLUC 2VTBA 4Q9AA 5EJGA 4YWJA 1JIUA 4R9NA 1SIOA 3ABSB 4BOYA 4CM4B 3OZEA 1EZZA 3DWIA 5DXAA 2F4VB 3CNEA 1DKMA 3FY4A 2IU3A 3AF3A 4MCHA 1F9EA 3VR0A 1VHLA 3AFMA 4W63A 4DNOA 3NIGB 1AQJA 1R8QA 2IUYA 2XVAA 4EKIA 1G9SA