4PQ0A

Crystal structure of pob3 middle domain at 1.65a
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
242
structure length
233
Chain Sequence
b'ADIGEVAGDAIVSFQDVFFTTPRGRYDIDIYKNSIRLRGKTYEYKLQHRQIQRIVSLPKADDIHHLLVLAIEPPLRQGQTTYPFLVLQFQKDEETEVQLNLEDEDYEENYKDKLKKQYDAKTHIVLSHVLKGLTDRRVIVPGEYKSKYDQCAVSCSFKANEGYLYPLDNAFFFLTKPTLYIPFSDVSMVNISRTFDLEVVLRSNRGSTTFANISKEEQQLLEQFLKSKNLRVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FACT complex subunit POB3
publication title Crystal structure of POB3 middle domain at 1.65A
rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication, transcription
total genus 53
structure length 233
sequence length 242
ec nomenclature
pdb deposition date 2014-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4pq0A02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 4pq0A01
1M7RA 3PG7A 2D11A 3KSYA 1ZC3B 2W2WA 2YT1A 4A6FB 3UZTA 4YONA 4HAXB 4HAUB 2J59M 5JHGA 3VIAA 1MK9B 5DHFB 3DXEA 2YS1A 3P7ZA 1WJMA 1P3RA 1TJ6A 2DLWA 3PEGA 2X18A 2J0MA 1BTNA 1FHWA 1V5MA 2RLOA 2LYDA 2R09A 1EAZA 2IFSA 4IOYX 4HATB 1NTVA 4Z2MB 1DDVA 3BJIA 1UNQA 1Y5OA 2D9XA 5HE2A 2W2XC 3O96A 1H10A 1WJ1A 4KHBB 2QKLA 2COCA 3U8ZA 4XWXA 5HE3A 2KUPA 5DH9B 3OANA 3GYOA 3PZDA 4K81A 1MK7B 2CRFA 2DA0A 5DHAB 5LOPB 2DTCA 2VKIA 3PP2A 4HAZB 2RVBB 2Z0OA 5JP4A 4DBBA 4K2OA 5D3XA 2DHJA 3MPXA 1RJ2A 2GCJA 1U2BA 4C0AA 2K2JA 2DYQA 5C6RA 2I1KA 5EFXA 1DROA 3ULCA 1KI1B 5J3YA 2YF0A 2YVCA 3IVFA 3HK0A 2RSGA 2ELBA 2ROZB 2I1JA 2UZRA 3A8QA 1PFJA 2I5CA 3FSSA 1K5GB 1MAIA 2HE7A 2DHIA 2HTHB 2KGXB 3N7CA 1MIXA 2E2XA 1UNRA 1SHCA 3PSCA 4KHOA 4A6KA 1NU2A 3M1IB 4ZRKA 3SNHA 1W1GA 4K2PA 1UNPA 2K2UA 1FGZA 2RGNB 1V89A 1GC7A 3AJ4A 1AQCA 3PVWA 4IAPA 4MK0A 1BTKA 2GCLA 3ZVRA 2G35A 1GC6A 5CLLB 1EF1A 4GMVA 3KRWA 2ROVA 5JLJB 1MIZB 3SUZA 1ZM0A 2YS5A 1ZSQA 2COAA 1WVHA 3WYFB 4A5KA 1MPHA 2OQBA 3DXCA 1UPRA 3P6AA 2P0DA 2IYBA 2EC1A 4CHMA 1XODA 3ODXA 2CAYA 2LKOA 2CODA 4TKNA 3DXDA 1TQZA 1X05A 1P5TA 1Q67A 1WGQA 2YSZA 1PMSA 2BCJA 3KY9A 1J0WA 1Y19B 4HB3B 4GN1A 2GJYA 3SV1A 2MKRA 2MFQA 2I5FA 5GOWB 5C5BA 2H7DA 2P8VA 2EMSA 2UVMA 3AU5A 4A6HA 2P0HA 1NTYA 4HAVB 4ZRJA 2DKQA 1XD4A 1U5DA 5C79A 2H7EA 3VOQA 1GG3A 3HW2B 3TFMA 3ULBA 2YRYA 2DX1A 1U5FA 1X1GA 5D3WA 1LW3A 5HE0A 1WG7A 2Y8FA 1XKEA 1XX0A 1H4RA 2JP2A 1X86A 3ML4A 4L6EA 2L1CA 2DHKA 4CHJA 1V5PA 2XQNM 2J0KA 2CY5A 5J3QA 1WGUA 4A6FA 4WVFB 1I2HA 1SGHA 4Z2NA 5JHHA 1WI1A 3D8FA 1OY2A 2DN6A 1IRSA 3T06A 5J3TA 2YS3A 4PNKA 2D9WA 3F5RA 4HB2B 1BWNA 1E5WA 4TYZA 1M7EA 2AEHA 4Y94A 3KZ1A 2MDXA 2CY4A 2EJ8A 5CLQB 1XCGA 5D27A 5D3VA 4DX8A 3AU4A 2LULA 1FHOA 2LG1A 2V76A 1QQGA 2NZ8B 2EMTA 2VSZA 5HE1A 4B6HA 1KZGA 1OQNA 3TVVA 1U27A 1W1DA 2NMBA 2N0YA 5C16A 3FM8C 1FAOA 4EJNA 2DKPA 4GZUA 4H8SA 4BBKA 2J0JA 1PLSA 5FI1A 3GYPA 4WJ7A 5KCVA 5LONB 1ZVRA 3RCPA 2DFKA 1N3HA 1V5UA 3TO1A 2D9YA 4K17A 3G9WA 1I7AA 4GXBA 4NSWA 3CXBB 4HDQA 4DX90 1Z87A 2QKMA 4PQ0A 2D2QA 1XR0B 3MDBC 3QIJA 2M38A 1V61A 1OMWA 2VRWB 1U5EA 3QBVB 1FHXA 3BINA 1J19A 3CIKA 3WA0A 2FJLA 4HAYB 4F7HA 1X1FA 5KQ1A 2D4QA 3D8EA 4GPTB 2COFA 2N23A 2RNRB 1AWEA 2Q13A 2Z0QA 4WSFA 1MKEA 4MT7A 2D9ZA 3ZDTA 5L81A 3X23A 4MY6A 1BAKA 1KZ7A 1UEFA 2P0FA 3HQCA 2M14A 1DYNA 4KAXB 1DDMA 3NSUA 1EGXA 1DDWA 2AL6A 1U5GA 1LB1A 2DYNA 1UPQA 4F7GA 4NY0A 3KRXA 3ODOA 2D9VA 4IFSA 3A8PA 4KHAA 1DBHA 1NI2A 4HAWB 1B55A 1K5DB 3FEHA 4EKUA 1ISNA 1FGYA 4DXAB 3PVLA 2LOZA 4EMOA 2K00A 1TXDA 3A98B 4KVGB 2GS0A 3ODWA 2LOXA 4HB4B 5C5BB 2MWNB 4P7IA 3D8DA 2ADZA 3V5WA 1P6SA 2ELAA 2OTXA 2UZSA 3SO6A 1FB8A 2DX5A 1U29A 5DIFB 2ZPYA 1RRPB 1X11A 4HB0B 3F0WA 5FI0A 5DI9B 4YL8A 2Y8GA 3U7DA 4F7UP 2Y7BA 2PZ1A 5KQ4A 2Z0PA 2W2XD 2YT0A 3PVUA 3TW1A 4HDOA 3LJUX 4D0NB 4CYEA 1QC6A 2KCJA 2D10A 3TCAA 2R0DA 2RUKB 3SYXA 1EVHA 4HHVA 5D3YA 2L2IA 4GMXB 1FOEA 1ZC4B 3QWMA 1W1HA 1V88A 4ZRIA
chains in the Genus database with same CATH superfamily
1M7RA 3PG7A 3FVCA 2D11A 3KSYA 1ZC3B 2W2WA 2YT1A 4A6FB 3UZTA 4YONA 4HAXB 4HAUB 2J59M 5JHGA 3VIAA 1MK9B 5DHFB 3DXEA 2YS1A 3P7ZA 1WJMA 1P3RA 2Z59A 1TJ6A 2DLWA 3PEGA 2X18A 2J0MA 1BTNA 1FHWA 1V5MA 5M4YB 2RLOA 2LYDA 5I2MA 2R09A 1EAZA 2IFSA 4IOYX 4HATB 1NTVA 4Z2MB 1DDVA 3BJIA 1UNQA 1Y5OA 2D9XA 5HE2A 2W2XC 3O96A 1H10A 1WJ1A 4KHBB 2GUMA 2QKLA 2COCA 3U8ZA 3DCXA 4XWXA 5HE3A 2KUPA 2KR0A 5DH9B 3OANA 3GYOA 3PZDA 4K81A 1MK7B 2CRFA 2DA0A 5DHAB 5LOPB 2DTCA 2VKIA 3PP2A 4HAZB 2RVBB 2Z0OA 5JP4A 4DBBA 4OT1A 4K2OA 5D3XA 2DHJA 3MPXA 1RJ2A 2GCJA 1U2BA 4C0AA 2K2JA 2DYQA 5C6RA 2I1KA 5EFXA 1DROA 3ULCA 1KI1B 5J3YA 2YF0A 2Z13A 2YVCA 3IVFA 3HK0A 2RSGA 2ELBA 2ROZB 2I1JA 2UZRA 3B77A 3A8QA 1PFJA 2I5CA 3FSSA 1K5GB 1MAIA 2HE7A 2DHIA 2HTHB 2KGXB 3N7CA 1MIXA 2E2XA 1UNRA 1SHCA 3PSCA 4KHOA 4A6KA 1NU2A 3M1IB 4ZRKA 3SNHA 1W1GA 4K2PA 1UNPA 2K2UA 1FGZA 2KUQA 2RGNB 1V89A 3NWAA 1GC7A 3AJ4A 1AQCA 3PVWA 4IAPA 4MK0A 1BTKA 4D6WA 2GCLA 3ZVRA 2G35A 1GC6A 5CLLB 1EF1A 4GMVA 3KRWA 2ROVA 5JLJB 1MIZB 3SUZA 1ZM0A 2YS5A 1ZSQA 2COAA 1WVHA 3WYFB 4A5KA 1MPHA 2OQBA 3DXCA 1UPRA 3P6AA 2P0DA 2IYBA 2EC1A 4CHMA 1XODA 3ODXA 2CAYA 2LKOA 2CODA 4TKNA 3DXDA 1TQZA 1X05A 1P5TA 1Q67A 1WGQA 2YSZA 1PMSA 5IRSA 2BCJA 3KY9A 1J0WA 1Y19B 4GOUA 4HB3B 2K49A 4GN1A 2GJYA 3SV1A 2MKRA 2MFQA 2I5FA 5GOWB 5C5BA 2H7DA 2P8VA 2EMSA 2UVMA 3AU5A 4A6HA 2P0HA 1NTYA 1ZYIA 4HAVB 4ZRJA 2DKQA 1XD4A 1U5DA 5C79A 2RRFA 2H7EA 3VOQA 4QJ5B 1GG3A 3HW2B 3TFMA 3ULBA 2YRYA 2DX1A 1U5FA 4L1RA 1X1GA 5D3WA 1LW3A 5HE0A 1WG7A 2Y8FA 1XKEA 1XX0A 1H4RA 2JP2A 1X86A 3ML4A 4L6EA 2L1CA 2FJUB 2DHKA 4CHJA 1V5PA 2XQNM 2J0KA 2CY5A 5J3QA 1WGUA 4A6FA 4WVFB 1I2HA 1SGHA 4Z2NA 5JHHA 1WI1A 4QXAB 3D8FA 1OY2A 2DN6A 1IRSA 3T06A 5J3TA 2YS3A 4PNKA 2D9WA 3F5RA 4HB2B 3A58A 1BWNA 1E5WA 4TYZA 1M7EA 2AEHA 4Y94A 4HSIA 3KZ1A 2MDXA 2CY4A 2EJ8A 4GNKB 5CLQB 1XCGA 5D27A 5D3VA 4DX8A 3AU4A 2LULA 1FHOA 2LG1A 2V76A 1QQGA 2NZ8B 2EMTA 2VSZA 5HE1A 4B6HA 1KZGA 1OQNA 3HSAA 3TVVA 1U27A 1W1DA 2NMBA 2N0YA 5C16A 3FM8C 1FAOA 4EJNA 2DKPA 4GZUA 4H8SA 4BBKA 2J0JA 1PLSA 5FI1A 4OSNA 3GYPA 4WJ7A 5KCVA 5LONB 1ZVRA 3RCPA 2DFKA 1N3HA 3NWDA 3OHMB 1V5UA 3TO1A 2D9YA 4K17A 3G9WA 1I7AA 1MI1A 4GXBA 4NSWA 3CXBB 4HDQA 4DX90 1Z87A 2QKMA 4PQ0A 2D2QA 1XR0B 3U12A 3MDBC 3QIJA 2M38A 1V61A 1OMWA 2VRWB 1U5EA 3QBVB 1FHXA 3BINA 1J19A 2NBVA 3CIKA 3WA0A 5LG4B 2FJLA 4HAYB 4F7HA 1X1FA 5KQ1A 2D4QA 3D8EA 4GPTB 2COFA 2N23A 2RNRB 1AWEA 2Q13A 2Z0QA 4WSFA 5I2SA 1MKEA 4MT7A 2D9ZA 3ZDTA 5L81A 3X23A 4MY6A 2KIGA 3NWFA 1BAKA 1KZ7A 1UEFA 2P0FA 3HQCA 2M14A 1DYNA 4KAXB 1DDMA 3NSUA 1EGXA 1DDWA 2AL6A 1U5GA 1LB1A 2DYNA 4QJ4B 1UPQA 2KIEA 4F7GA 4NY0A 3KRXA 3ODOA 2D9VA 4QJ3B 1T77A 4IFSA 3A8PA 4KHAA 1DBHA 1NI2A 4HAWB 1B55A 1K5DB 3FEHA 4EKUA 1ISNA 1FGYA 3HIEA 4DXAB 2YT2A 3PVLA 2LOZA 4EMOA 2K00A 2K8EA 1TXDA 3A98B 4KVGB 2GS0A 3ODWA 2LOXA 4HB4B 5C5BB 2MWNB 2R2YA 4P7IA 4DIXA 3D8DA 2ADZA 3NW8A 3V5WA 2Z14A 1P6SA 2ELAA 2OTXA 2UZSA 3SO6A 1FB8A 2DX5A 1U29A 5DIFB 2ZPYA 1RRPB 1X11A 4HB0B 3F0WA 5FI0A 5DI9B 4YL8A 2Y8GA 3U7DA 4F7UP 2Y7BA 2PZ1A 5KQ4A 2Z0PA 2W2XD 2YT0A 3PVUA 3TW1A 4HDOA 3LJUX 4D0NB 4KHBA 4CYEA 1QC6A 4CSQA 2KCJA 2D10A 3TCAA 2R0DA 2RUKB 2Z4DA 1EVHA 3SYXA 4HHVA 5D3YA 2L2IA 4GMXB 2ZKMX 1FOEA 1ZC4B 3QWMA 1W1HA 1V88A 4ZRIA
chains in the Genus database with same CATH topology
1M7RA 3PG7A 3FVCA 2D11A 3KSYA 1ZC3B 2W2WA 2YT1A 4A6FB 3UZTA 4YONA 4HAXB 4HAUB 2J59M 5JHGA 3VIAA 1MK9B 5DHFB 3DXEA 2YS1A 3P7ZA 1WJMA 1P3RA 2Z59A 1TJ6A 2DLWA 3PEGA 2X18A 2J0MA 1BTNA 1FHWA 1V5MA 5M4YB 2RLOA 2LYDA 5I2MA 2R09A 1EAZA 2IFSA 4IOYX 4HATB 1NTVA 4Z2MB 1DDVA 3BJIA 1UNQA 1Y5OA 2D9XA 5HE2A 2W2XC 3O96A 1H10A 1WJ1A 4KHBB 2GUMA 2QKLA 2COCA 3U8ZA 4XWXA 5HE3A 2KUPA 2KR0A 5DH9B 3OANA 3GYOA 3PZDA 4K81A 1MK7B 2CRFA 2DA0A 5DHAB 5LOPB 2DTCA 2VKIA 3PP2A 4HAZB 2RVBB 2Z0OA 5JP4A 4DBBA 4OT1A 4K2OA 5D3XA 2DHJA 3MPXA 1RJ2A 2GCJA 1U2BA 4C0AA 2K2JA 2DYQA 5C6RA 2I1KA 5EFXA 1DROA 3ULCA 1KI1B 5J3YA 2YF0A 2Z13A 2YVCA 3IVFA 3HK0A 2RSGA 2ELBA 2ROZB 2I1JA 2UZRA 3A8QA 1PFJA 2I5CA 3FSSA 1K5GB 1MAIA 2HE7A 2DHIA 2HTHB 2KGXB 3N7CA 1MIXA 2E2XA 1UNRA 1SHCA 3PSCA 4KHOA 4A6KA 1NU2A 3M1IB 4ZRKA 3SNHA 1W1GA 4K2PA 1UNPA 2K2UA 1FGZA 2KUQA 2RGNB 1V89A 3NWAA 1GC7A 3AJ4A 1AQCA 3PVWA 4IAPA 4MK0A 1BTKA 4D6WA 2GCLA 3ZVRA 2G35A 1GC6A 5CLLB 1EF1A 4GMVA 3KRWA 2ROVA 5JLJB 1MIZB 3SUZA 1ZM0A 2YS5A 1ZSQA 2COAA 1WVHA 3WYFB 4A5KA 1MPHA 2OQBA 3DXCA 1UPRA 3P6AA 2P0DA 2IYBA 2EC1A 4CHMA 1XODA 3ODXA 2CAYA 2LKOA 2CODA 4TKNA 3DXDA 1TQZA 1X05A 1P5TA 1Q67A 1WGQA 2YSZA 1PMSA 5IRSA 2BCJA 3KY9A 1J0WA 1Y19B 4GOUA 4HB3B 2K49A 4GN1A 2GJYA 3SV1A 2MKRA 2MFQA 2I5FA 5GOWB 5C5BA 2H7DA 2P8VA 2EMSA 2UVMA 3AU5A 4A6HA 2P0HA 1NTYA 4HAVB 4ZRJA 1ZYIA 2DKQA 1XD4A 1U5DA 5C79A 2RRFA 2H7EA 3VOQA 4QJ5B 1GG3A 3HW2B 3TFMA 3ULBA 2YRYA 2DX1A 1U5FA 4L1RA 1X1GA 5D3WA 1LW3A 5HE0A 1WG7A 2Y8FA 1XKEA 1XX0A 1H4RA 2JP2A 1X86A 3ML4A 4L6EA 2L1CA 2FJUB 2DHKA 4CHJA 1V5PA 2XQNM 2J0KA 2CY5A 5J3QA 1WGUA 4A6FA 4WVFB 1I2HA 1SGHA 4Z2NA 5JHHA 1WI1A 4QXAB 3D8FA 1OY2A 2DN6A 1IRSA 3T06A 5J3TA 2YS3A 4PNKA 2D9WA 3F5RA 4HB2B 3A58A 1BWNA 1E5WA 4TYZA 1M7EA 2AEHA 4Y94A 4HSIA 3KZ1A 2MDXA 2CY4A 2EJ8A 4GNKB 5CLQB 1XCGA 5D27A 5D3VA 4DX8A 3AU4A 2LULA 1FHOA 2LG1A 2V76A 1QQGA 2NZ8B 2EMTA 2VSZA 5HE1A 4B6HA 1KZGA 1OQNA 3TVVA 1U27A 1W1DA 2NMBA 2N0YA 5C16A 3FM8C 1FAOA 4EJNA 2DKPA 4GZUA 4H8SA 4BBKA 2J0JA 1PLSA 5FI1A 4OSNA 3GYPA 4WJ7A 5KCVA 5LONB 1ZVRA 3RCPA 2DFKA 1N3HA 3NWDA 3OHMB 1V5UA 3TO1A 2D9YA 4K17A 3G9WA 1I7AA 4GXBA 4NSWA 3CXBB 4HDQA 4DX90 1Z87A 2QKMA 4PQ0A 2D2QA 1XR0B 3U12A 3MDBC 3QIJA 2M38A 1V61A 1OMWA 2VRWB 1U5EA 3QBVB 1FHXA 3BINA 1J19A 2NBVA 3CIKA 3WA0A 5LG4B 2FJLA 4HAYB 4F7HA 1X1FA 5KQ1A 2D4QA 3D8EA 4GPTB 2COFA 2N23A 2RNRB 1AWEA 2Q13A 2Z0QA 4WSFA 5I2SA 1MKEA 4MT7A 2D9ZA 3ZDTA 5L81A 3X23A 4MY6A 2KIGA 3NWFA 1BAKA 1KZ7A 1UEFA 2P0FA 3HQCA 2M14A 1DYNA 4KAXB 1DDMA 3NSUA 1EGXA 1DDWA 2AL6A 1U5GA 1LB1A 2DYNA 4QJ4B 1UPQA 2KIEA 4F7GA 4NY0A 3KRXA 3ODOA 2D9VA 4QJ3B 4IFSA 3A8PA 4KHAA 1DBHA 1NI2A 4HAWB 1B55A 1K5DB 3FEHA 4EKUA 1ISNA 1FGYA 3HIEA 4DXAB 2YT2A 3PVLA 2LOZA 4EMOA 2K00A 2K8EA 1TXDA 3A98B 4KVGB 2GS0A 3ODWA 2LOXA 4HB4B 5C5BB 2MWNB 2R2YA 4P7IA 4DIXA 3D8DA 2ADZA 3NW8A 3V5WA 2Z14A 1P6SA 2ELAA 2OTXA 2UZSA 3SO6A 1FB8A 2DX5A 1U29A 5DIFB 2ZPYA 1RRPB 1X11A 4HB0B 3F0WA 5FI0A 5DI9B 4YL8A 2Y8GA 3U7DA 4F7UP 2Y7BA 2PZ1A 5KQ4A 2Z0PA 2W2XD 2YT0A 3PVUA 3TW1A 4HDOA 3LJUX 4D0NB 4KHBA 4CYEA 1QC6A 4CSQA 2KCJA 2D10A 3TCAA 2R0DA 2RUKB 3SYXA 1EVHA 2Z4DA 4HHVA 5D3YA 2L2IA 4GMXB 2ZKMX 1FOEA 1ZC4B 3QWMA 1W1HA 1V88A 4ZRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M7R A;  3PG7 A;  2D11 A;  3KSY A;  1ZC3 B;  2W2W A;  2YT1 A;  4A6F B;  3UZT A;  4YON A;  4HAX B;  4HAU B;  2J59 M;  5JHG A;  3VIA A;  1MK9 B;  5DHF B;  3DXE A;  2YS1 A;  3P7Z A;  1WJM A;  1P3R A;  1TJ6 A;  2DLW A;  3PEG A;  2X18 A;  2J0M A;  1BTN A;  1FHW A;  1V5M A;  2RLO A;  2LYD A;  2R09 A;  1EAZ A;  2IFS A;  4IOY X;  4HAT B;  1NTV A;  4Z2M B;  1DDV A;  3BJI A;  1UNQ A;  1Y5O A;  2D9X A;  5HE2 A;  2W2X C;  3O96 A;  1H10 A;  1WJ1 A;  4KHB B;  2QKL A;  2COC A;  3U8Z A;  4XWX A;  5HE3 A;  2KUP A;  5DH9 B;  3OAN A;  3GYO A;  3PZD A;  4K81 A;  1MK7 B;  2CRF A;  2DA0 A;  5DHA B;  5LOP B;  2DTC A;  2VKI A;  3PP2 A;  4HAZ B;  2RVB B;  2Z0O A;  5JP4 A;  4DBB A;  4K2O A;  5D3X A;  2DHJ A;  3MPX A;  1RJ2 A;  2GCJ A;  1U2B A;  4C0A A;  2K2J A;  2DYQ A;  5C6R A;  2I1K A;  5EFX A;  1DRO A;  3ULC A;  1KI1 B;  5J3Y A;  2YF0 A;  2YVC A;  3IVF A;  3HK0 A;  2RSG A;  2ELB A;  2ROZ B;  2I1J A;  2UZR A;  3A8Q A;  1PFJ A;  2I5C A;  3FSS A;  1K5G B;  1MAI A;  2HE7 A;  2DHI A;  2HTH B;  2KGX B;  3N7C A;  1MIX A;  2E2X A;  1UNR A;  1SHC A;  3PSC A;  4KHO A;  4A6K A;  1NU2 A;  3M1I B;  4ZRK A;  3SNH A;  1W1G A;  4K2P A;  1UNP A;  2K2U A;  1FGZ A;  2RGN B;  1V89 A;  1GC7 A;  3AJ4 A;  1AQC A;  3PVW A;  4IAP A;  4MK0 A;  1BTK A;  2GCL A;  3ZVR A;  2G35 A;  1GC6 A;  5CLL B;  1EF1 A;  4GMV A;  3KRW A;  2ROV A;  5JLJ B;  1MIZ B;  3SUZ A;  1ZM0 A;  2YS5 A;  1ZSQ A;  2COA A;  1WVH A;  3WYF B;  4A5K A;  1MPH A;  2OQB A;  3DXC A;  1UPR A;  3P6A A;  2P0D A;  2IYB A;  2EC1 A;  4CHM A;  1XOD A;  3ODX A;  2CAY A;  2LKO A;  2COD A;  4TKN A;  3DXD A;  1TQZ A;  1X05 A;  1P5T A;  1Q67 A;  1WGQ A;  2YSZ A;  1PMS A;  2BCJ A;  3KY9 A;  1J0W A;  1Y19 B;  4HB3 B;  4GN1 A;  2GJY A;  3SV1 A;  2MKR A;  2MFQ A;  2I5F A;  5GOW B;  5C5B A;  2H7D A;  2P8V A;  2EMS A;  2UVM A;  3AU5 A;  4A6H A;  2P0H A;  1NTY A;  4HAV B;  4ZRJ A;  2DKQ A;  1XD4 A;  1U5D A;  5C79 A;  2H7E A;  3VOQ A;  1GG3 A;  3HW2 B;  3TFM A;  3ULB A;  2YRY A;  2DX1 A;  1U5F A;  1X1G A;  5D3W A;  1LW3 A;  5HE0 A;  1WG7 A;  2Y8F A;  1XKE A;  1XX0 A;  1H4R A;  2JP2 A;  1X86 A;  3ML4 A;  4L6E A;  2L1C A;  2DHK A;  4CHJ A;  1V5P A;  2XQN M;  2J0K A;  2CY5 A;  5J3Q A;  1WGU A;  4A6F A;  4WVF B;  1I2H A;  1SGH A;  4Z2N A;  5JHH A;  1WI1 A;  3D8F A;  1OY2 A;  2DN6 A;  1IRS A;  3T06 A;  5J3T A;  2YS3 A;  4PNK A;  2D9W A;  3F5R A;  4HB2 B;  1BWN A;  1E5W A;  4TYZ A;  1M7E A;  2AEH A;  4Y94 A;  3KZ1 A;  2MDX A;  2CY4 A;  2EJ8 A;  5CLQ B;  1XCG A;  5D27 A;  5D3V A;  4DX8 A;  3AU4 A;  2LUL A;  1FHO A;  2LG1 A;  2V76 A;  1QQG A;  2NZ8 B;  2EMT A;  2VSZ A;  5HE1 A;  4B6H A;  1KZG A;  1OQN A;  3TVV A;  1U27 A;  1W1D A;  2NMB A;  2N0Y A;  5C16 A;  3FM8 C;  1FAO A;  4EJN A;  2DKP A;  4GZU A;  4H8S A;  4BBK A;  2J0J A;  1PLS A;  5FI1 A;  3GYP A;  4WJ7 A;  5KCV A;  5LON B;  1ZVR A;  3RCP A;  2DFK A;  1N3H A;  1V5U A;  3TO1 A;  2D9Y A;  4K17 A;  3G9W A;  1I7A A;  4GXB A;  4NSW A;  3CXB B;  4HDQ A;  4DX9 0;  1Z87 A;  2QKM A;  4PQ0 A;  2D2Q A;  1XR0 B;  3MDB C;  3QIJ A;  2M38 A;  1V61 A;  1OMW A;  2VRW B;  1U5E A;  3QBV B;  1FHX A;  3BIN A;  1J19 A;  3CIK A;  3WA0 A;  2FJL A;  4HAY B;  4F7H A;  1X1F A;  5KQ1 A;  2D4Q A;  3D8E A;  4GPT B;  2COF A;  2N23 A;  2RNR B;  1AWE A;  2Q13 A;  2Z0Q A;  4WSF A;  1MKE A;  4MT7 A;  2D9Z A;  3ZDT A;  5L81 A;  3X23 A;  4MY6 A;  1BAK A;  1KZ7 A;  1UEF A;  2P0F A;  3HQC A;  2M14 A;  1DYN A;  4KAX B;  1DDM A;  3NSU A;  1EGX A;  1DDW A;  2AL6 A;  1U5G A;  1LB1 A;  2DYN A;  1UPQ A;  4F7G A;  4NY0 A;  3KRX A;  3ODO A;  2D9V A;  4IFS A;  3A8P A;  4KHA A;  1DBH A;  1NI2 A;  4HAW B;  1B55 A;  1K5D B;  3FEH A;  4EKU A;  1ISN A;  1FGY A;  4DXA B;  3PVL A;  2LOZ A;  4EMO A;  2K00 A;  1TXD A;  3A98 B;  4KVG B;  2GS0 A;  3ODW A;  2LOX A;  4HB4 B;  5C5B B;  2MWN B;  4P7I A;  3D8D A;  2ADZ A;  3V5W A;  1P6S A;  2ELA A;  2OTX A;  2UZS A;  3SO6 A;  1FB8 A;  2DX5 A;  1U29 A;  5DIF B;  2ZPY A;  1RRP B;  1X11 A;  4HB0 B;  3F0W A;  5FI0 A;  5DI9 B;  4YL8 A;  2Y8G A;  3U7D A;  4F7U P;  2Y7B A;  2PZ1 A;  5KQ4 A;  2Z0P A;  2W2X D;  2YT0 A;  3PVU A;  3TW1 A;  4HDO A;  3LJU X;  4D0N B;  4CYE A;  1QC6 A;  2KCJ A;  2D10 A;  3TCA A;  2R0D A;  2RUK B;  3SYX A;  1EVH A;  4HHV A;  5D3Y A;  2L2I A;  4GMX B;  1FOE A;  1ZC4 B;  3QWM A;  1W1H A;  1V88 A;  4ZRI A; 
#chains in the Genus database with same CATH topology
 1M7R A;  3PG7 A;  3FVC A;  2D11 A;  3KSY A;  1ZC3 B;  2W2W A;  2YT1 A;  4A6F B;  3UZT A;  4YON A;  4HAX B;  4HAU B;  2J59 M;  5JHG A;  3VIA A;  1MK9 B;  5DHF B;  3DXE A;  2YS1 A;  3P7Z A;  1WJM A;  1P3R A;  2Z59 A;  1TJ6 A;  2DLW A;  3PEG A;  2X18 A;  2J0M A;  1BTN A;  1FHW A;  1V5M A;  5M4Y B;  2RLO A;  2LYD A;  5I2M A;  2R09 A;  1EAZ A;  2IFS A;  4IOY X;  4HAT B;  1NTV A;  4Z2M B;  1DDV A;  3BJI A;  1UNQ A;  1Y5O A;  2D9X A;  5HE2 A;  2W2X C;  3O96 A;  1H10 A;  1WJ1 A;  4KHB B;  2GUM A;  2QKL A;  2COC A;  3U8Z A;  3DCX A;  4XWX A;  5HE3 A;  2KUP A;  2KR0 A;  5DH9 B;  3OAN A;  3GYO A;  3PZD A;  4K81 A;  1MK7 B;  2CRF A;  2DA0 A;  5DHA B;  5LOP B;  2DTC A;  2VKI A;  3PP2 A;  4HAZ B;  2RVB B;  2Z0O A;  5JP4 A;  4DBB A;  4OT1 A;  4K2O A;  5D3X A;  2DHJ A;  3MPX A;  1RJ2 A;  2GCJ A;  1U2B A;  4C0A A;  2K2J A;  2DYQ A;  5C6R A;  2I1K A;  5EFX A;  1DRO A;  3ULC A;  1KI1 B;  5J3Y A;  2YF0 A;  2Z13 A;  2YVC A;  3IVF A;  3HK0 A;  2RSG A;  2ELB A;  2ROZ B;  2I1J A;  2UZR A;  3B77 A;  3A8Q A;  1PFJ A;  2I5C A;  3FSS A;  1K5G B;  1MAI A;  2HE7 A;  2DHI A;  2HTH B;  2KGX B;  3N7C A;  1MIX A;  2E2X A;  1UNR A;  1SHC A;  3PSC A;  4KHO A;  4A6K A;  1NU2 A;  3M1I B;  4ZRK A;  3SNH A;  1W1G A;  4K2P A;  1UNP A;  2K2U A;  1FGZ A;  2KUQ A;  2RGN B;  1V89 A;  3NWA A;  1GC7 A;  3AJ4 A;  1AQC A;  3PVW A;  4IAP A;  4MK0 A;  1BTK A;  4D6W A;  2GCL A;  3ZVR A;  2G35 A;  1GC6 A;  5CLL B;  1EF1 A;  4GMV A;  3KRW A;  2ROV A;  5JLJ B;  1MIZ B;  3SUZ A;  1ZM0 A;  2YS5 A;  1ZSQ A;  2COA A;  1WVH A;  3WYF B;  4A5K A;  1MPH A;  2OQB A;  3DXC A;  1UPR A;  3P6A A;  2P0D A;  2IYB A;  2EC1 A;  4CHM A;  1XOD A;  3ODX A;  2CAY A;  2LKO A;  2COD A;  4TKN A;  3DXD A;  1TQZ A;  1X05 A;  1P5T A;  1Q67 A;  1WGQ A;  2YSZ A;  1PMS A;  5IRS A;  2BCJ A;  3KY9 A;  1J0W A;  1Y19 B;  4GOU A;  4HB3 B;  2K49 A;  4GN1 A;  2GJY A;  3SV1 A;  2MKR A;  2MFQ A;  2I5F A;  5GOW B;  5C5B A;  2H7D A;  2P8V A;  2EMS A;  2UVM A;  3AU5 A;  4A6H A;  2P0H A;  1NTY A;  1ZYI A;  4HAV B;  4ZRJ A;  2DKQ A;  1XD4 A;  1U5D A;  5C79 A;  2RRF A;  2H7E A;  3VOQ A;  4QJ5 B;  1GG3 A;  3HW2 B;  3TFM A;  3ULB A;  2YRY A;  2DX1 A;  1U5F A;  4L1R A;  1X1G A;  5D3W A;  1LW3 A;  5HE0 A;  1WG7 A;  2Y8F A;  1XKE A;  1XX0 A;  1H4R A;  2JP2 A;  1X86 A;  3ML4 A;  4L6E A;  2L1C A;  2FJU B;  2DHK A;  4CHJ A;  1V5P A;  2XQN M;  2J0K A;  2CY5 A;  5J3Q A;  1WGU A;  4A6F A;  4WVF B;  1I2H A;  1SGH A;  4Z2N A;  5JHH A;  1WI1 A;  4QXA B;  3D8F A;  1OY2 A;  2DN6 A;  1IRS A;  3T06 A;  5J3T A;  2YS3 A;  4PNK A;  2D9W A;  3F5R A;  4HB2 B;  3A58 A;  1BWN A;  1E5W A;  4TYZ A;  1M7E A;  2AEH A;  4Y94 A;  4HSI A;  3KZ1 A;  2MDX A;  2CY4 A;  2EJ8 A;  4GNK B;  5CLQ B;  1XCG A;  5D27 A;  5D3V A;  4DX8 A;  3AU4 A;  2LUL A;  1FHO A;  2LG1 A;  2V76 A;  1QQG A;  2NZ8 B;  2EMT A;  2VSZ A;  5HE1 A;  4B6H A;  1KZG A;  1OQN A;  3HSA A;  3TVV A;  1U27 A;  1W1D A;  2NMB A;  2N0Y A;  5C16 A;  3FM8 C;  1FAO A;  4EJN A;  2DKP A;  4GZU A;  4H8S A;  4BBK A;  2J0J A;  1PLS A;  5FI1 A;  4OSN A;  3GYP A;  4WJ7 A;  5KCV A;  5LON B;  1ZVR A;  3RCP A;  2DFK A;  1N3H A;  3NWD A;  3OHM B;  1V5U A;  3TO1 A;  2D9Y A;  4K17 A;  3G9W A;  1I7A A;  1MI1 A;  4GXB A;  4NSW A;  3CXB B;  4HDQ A;  4DX9 0;  1Z87 A;  2QKM A;  4PQ0 A;  2D2Q A;  1XR0 B;  3U12 A;  3MDB C;  3QIJ A;  2M38 A;  1V61 A;  1OMW A;  2VRW B;  1U5E A;  3QBV B;  1FHX A;  3BIN A;  1J19 A;  2NBV A;  3CIK A;  3WA0 A;  5LG4 B;  2FJL A;  4HAY B;  4F7H A;  1X1F A;  5KQ1 A;  2D4Q A;  3D8E A;  4GPT B;  2COF A;  2N23 A;  2RNR B;  1AWE A;  2Q13 A;  2Z0Q A;  4WSF A;  5I2S A;  1MKE A;  4MT7 A;  2D9Z A;  3ZDT A;  5L81 A;  3X23 A;  4MY6 A;  2KIG A;  3NWF A;  1BAK A;  1KZ7 A;  1UEF A;  2P0F A;  3HQC A;  2M14 A;  1DYN A;  4KAX B;  1DDM A;  3NSU A;  1EGX A;  1DDW A;  2AL6 A;  1U5G A;  1LB1 A;  2DYN A;  4QJ4 B;  1UPQ A;  2KIE A;  4F7G A;  4NY0 A;  3KRX A;  3ODO A;  2D9V A;  4QJ3 B;  1T77 A;  4IFS A;  3A8P A;  4KHA A;  1DBH A;  1NI2 A;  4HAW B;  1B55 A;  1K5D B;  3FEH A;  4EKU A;  1ISN A;  1FGY A;  3HIE A;  4DXA B;  2YT2 A;  3PVL A;  2LOZ A;  4EMO A;  2K00 A;  2K8E A;  1TXD A;  3A98 B;  4KVG B;  2GS0 A;  3ODW A;  2LOX A;  4HB4 B;  5C5B B;  2MWN B;  2R2Y A;  4P7I A;  4DIX A;  3D8D A;  2ADZ A;  3NW8 A;  3V5W A;  2Z14 A;  1P6S A;  2ELA A;  2OTX A;  2UZS A;  3SO6 A;  1FB8 A;  2DX5 A;  1U29 A;  5DIF B;  2ZPY A;  1RRP B;  1X11 A;  4HB0 B;  3F0W A;  5FI0 A;  5DI9 B;  4YL8 A;  2Y8G A;  3U7D A;  4F7U P;  2Y7B A;  2PZ1 A;  5KQ4 A;  2Z0P A;  2W2X D;  2YT0 A;  3PVU A;  3TW1 A;  4HDO A;  3LJU X;  4D0N B;  4KHB A;  4CYE A;  1QC6 A;  4CSQ A;  2KCJ A;  2D10 A;  3TCA A;  2R0D A;  2RUK B;  2Z4D A;  1EVH A;  3SYX A;  4HHV A;  5D3Y A;  2L2I A;  4GMX B;  2ZKM X;  1FOE A;  1ZC4 B;  3QWM A;  1W1H A;  1V88 A;  4ZRI A; 
#chains in the Genus database with same CATH homology
 1M7R A;  3PG7 A;  3FVC A;  2D11 A;  3KSY A;  1ZC3 B;  2W2W A;  2YT1 A;  4A6F B;  3UZT A;  4YON A;  4HAX B;  4HAU B;  2J59 M;  5JHG A;  3VIA A;  1MK9 B;  5DHF B;  3DXE A;  2YS1 A;  3P7Z A;  1WJM A;  1P3R A;  2Z59 A;  1TJ6 A;  2DLW A;  3PEG A;  2X18 A;  2J0M A;  1BTN A;  1FHW A;  1V5M A;  5M4Y B;  2RLO A;  2LYD A;  5I2M A;  2R09 A;  1EAZ A;  2IFS A;  4IOY X;  4HAT B;  1NTV A;  4Z2M B;  1DDV A;  3BJI A;  1UNQ A;  1Y5O A;  2D9X A;  5HE2 A;  2W2X C;  3O96 A;  1H10 A;  1WJ1 A;  4KHB B;  2GUM A;  2QKL A;  2COC A;  3U8Z A;  4XWX A;  5HE3 A;  2KUP A;  2KR0 A;  5DH9 B;  3OAN A;  3GYO A;  3PZD A;  4K81 A;  1MK7 B;  2CRF A;  2DA0 A;  5DHA B;  5LOP B;  2DTC A;  2VKI A;  3PP2 A;  4HAZ B;  2RVB B;  2Z0O A;  5JP4 A;  4DBB A;  4OT1 A;  4K2O A;  5D3X A;  2DHJ A;  3MPX A;  1RJ2 A;  2GCJ A;  1U2B A;  4C0A A;  2K2J A;  2DYQ A;  5C6R A;  2I1K A;  5EFX A;  1DRO A;  3ULC A;  1KI1 B;  5J3Y A;  2YF0 A;  2Z13 A;  2YVC A;  3IVF A;  3HK0 A;  2RSG A;  2ELB A;  2ROZ B;  2I1J A;  2UZR A;  3A8Q A;  1PFJ A;  2I5C A;  3FSS A;  1K5G B;  1MAI A;  2HE7 A;  2DHI A;  2HTH B;  2KGX B;  3N7C A;  1MIX A;  2E2X A;  1UNR A;  1SHC A;  3PSC A;  4KHO A;  4A6K A;  1NU2 A;  3M1I B;  4ZRK A;  3SNH A;  1W1G A;  4K2P A;  1UNP A;  2K2U A;  1FGZ A;  2KUQ A;  2RGN B;  1V89 A;  3NWA A;  1GC7 A;  3AJ4 A;  1AQC A;  3PVW A;  4IAP A;  4MK0 A;  1BTK A;  4D6W A;  2GCL A;  3ZVR A;  2G35 A;  1GC6 A;  5CLL B;  1EF1 A;  4GMV A;  3KRW A;  2ROV A;  5JLJ B;  1MIZ B;  3SUZ A;  1ZM0 A;  2YS5 A;  1ZSQ A;  2COA A;  1WVH A;  3WYF B;  4A5K A;  1MPH A;  2OQB A;  3DXC A;  1UPR A;  3P6A A;  2P0D A;  2IYB A;  2EC1 A;  4CHM A;  1XOD A;  3ODX A;  2CAY A;  2LKO A;  2COD A;  4TKN A;  3DXD A;  1TQZ A;  1X05 A;  1P5T A;  1Q67 A;  1WGQ A;  2YSZ A;  1PMS A;  5IRS A;  2BCJ A;  3KY9 A;  1J0W A;  1Y19 B;  4GOU A;  4HB3 B;  2K49 A;  4GN1 A;  2GJY A;  3SV1 A;  2MKR A;  2MFQ A;  2I5F A;  5GOW B;  5C5B A;  2H7D A;  2P8V A;  2EMS A;  2UVM A;  3AU5 A;  4A6H A;  2P0H A;  1NTY A;  4HAV B;  4ZRJ A;  1ZYI A;  2DKQ A;  1XD4 A;  1U5D A;  5C79 A;  2RRF A;  2H7E A;  3VOQ A;  4QJ5 B;  1GG3 A;  3HW2 B;  3TFM A;  3ULB A;  2YRY A;  2DX1 A;  1U5F A;  4L1R A;  1X1G A;  5D3W A;  1LW3 A;  5HE0 A;  1WG7 A;  2Y8F A;  1XKE A;  1XX0 A;  1H4R A;  2JP2 A;  1X86 A;  3ML4 A;  4L6E A;  2L1C A;  2FJU B;  2DHK A;  4CHJ A;  1V5P A;  2XQN M;  2J0K A;  2CY5 A;  5J3Q A;  1WGU A;  4A6F A;  4WVF B;  1I2H A;  1SGH A;  4Z2N A;  5JHH A;  1WI1 A;  4QXA B;  3D8F A;  1OY2 A;  2DN6 A;  1IRS A;  3T06 A;  5J3T A;  2YS3 A;  4PNK A;  2D9W A;  3F5R A;  4HB2 B;  3A58 A;  1BWN A;  1E5W A;  4TYZ A;  1M7E A;  2AEH A;  4Y94 A;  4HSI A;  3KZ1 A;  2MDX A;  2CY4 A;  2EJ8 A;  4GNK B;  5CLQ B;  1XCG A;  5D27 A;  5D3V A;  4DX8 A;  3AU4 A;  2LUL A;  1FHO A;  2LG1 A;  2V76 A;  1QQG A;  2NZ8 B;  2EMT A;  2VSZ A;  5HE1 A;  4B6H A;  1KZG A;  1OQN A;  3TVV A;  1U27 A;  1W1D A;  2NMB A;  2N0Y A;  5C16 A;  3FM8 C;  1FAO A;  4EJN A;  2DKP A;  4GZU A;  4H8S A;  4BBK A;  2J0J A;  1PLS A;  5FI1 A;  4OSN A;  3GYP A;  4WJ7 A;  5KCV A;  5LON B;  1ZVR A;  3RCP A;  2DFK A;  1N3H A;  3NWD A;  3OHM B;  1V5U A;  3TO1 A;  2D9Y A;  4K17 A;  3G9W A;  1I7A A;  4GXB A;  4NSW A;  3CXB B;  4HDQ A;  4DX9 0;  1Z87 A;  2QKM A;  4PQ0 A;  2D2Q A;  1XR0 B;  3U12 A;  3MDB C;  3QIJ A;  2M38 A;  1V61 A;  1OMW A;  2VRW B;  1U5E A;  3QBV B;  1FHX A;  3BIN A;  1J19 A;  2NBV A;  3CIK A;  3WA0 A;  5LG4 B;  2FJL A;  4HAY B;  4F7H A;  1X1F A;  5KQ1 A;  2D4Q A;  3D8E A;  4GPT B;  2COF A;  2N23 A;  2RNR B;  1AWE A;  2Q13 A;  2Z0Q A;  4WSF A;  5I2S A;  1MKE A;  4MT7 A;  2D9Z A;  3ZDT A;  5L81 A;  3X23 A;  4MY6 A;  2KIG A;  3NWF A;  1BAK A;  1KZ7 A;  1UEF A;  2P0F A;  3HQC A;  2M14 A;  1DYN A;  4KAX B;  1DDM A;  3NSU A;  1EGX A;  1DDW A;  2AL6 A;  1U5G A;  1LB1 A;  2DYN A;  4QJ4 B;  1UPQ A;  2KIE A;  4F7G A;  4NY0 A;  3KRX A;  3ODO A;  2D9V A;  4QJ3 B;  4IFS A;  3A8P A;  4KHA A;  1DBH A;  1NI2 A;  4HAW B;  1B55 A;  1K5D B;  3FEH A;  4EKU A;  1ISN A;  1FGY A;  3HIE A;  4DXA B;  2YT2 A;  3PVL A;  2LOZ A;  4EMO A;  2K00 A;  2K8E A;  1TXD A;  3A98 B;  4KVG B;  2GS0 A;  3ODW A;  2LOX A;  4HB4 B;  5C5B B;  2MWN B;  2R2Y A;  4P7I A;  4DIX A;  3D8D A;  2ADZ A;  3NW8 A;  3V5W A;  2Z14 A;  1P6S A;  2ELA A;  2OTX A;  2UZS A;  3SO6 A;  1FB8 A;  2DX5 A;  1U29 A;  5DIF B;  2ZPY A;  1RRP B;  1X11 A;  4HB0 B;  3F0W A;  5FI0 A;  5DI9 B;  4YL8 A;  2Y8G A;  3U7D A;  4F7U P;  2Y7B A;  2PZ1 A;  5KQ4 A;  2Z0P A;  2W2X D;  2YT0 A;  3PVU A;  3TW1 A;  4HDO A;  3LJU X;  4D0N B;  4KHB A;  4CYE A;  1QC6 A;  4CSQ A;  2KCJ A;  2D10 A;  3TCA A;  2R0D A;  2RUK B;  3SYX A;  1EVH A;  2Z4D A;  4HHV A;  5D3Y A;  2L2I A;  4GMX B;  2ZKM X;  1FOE A;  1ZC4 B;  3QWM A;  1W1H A;  1V88 A;  4ZRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...