4PQ0A

Crystal structure of pob3 middle domain at 1.65a
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
242
structure length
233
Chain Sequence
ADIGEVAGDAIVSFQDVFFTTPRGRYDIDIYKNSIRLRGKTYEYKLQHRQIQRIVSLPKADDIHHLLVLAIEPPLRQGQTTYPFLVLQFQKDEETEVQLNLEDEDYEENYKDKLKKQYDAKTHIVLSHVLKGLTDRRVIVPGEYKSKYDQCAVSCSFKANEGYLYPLDNAFFFLTKPTLYIPFSDVSMVNISRTFDLEVVLRSNRGSTTFANISKEEQQLLEQFLKSKNLRVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FACT complex subunit POB3
publication title Crystal structure of POB3 middle domain at 1.65A
rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication, transcription
total genus 53
structure length 233
sequence length 242
ec nomenclature
pdb deposition date 2014-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4pq0A02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 4pq0A01
2DKPA 2K2UA 4HAUB 3QBVB 1BWNA 2GCJA 2ZPYA 2DHKA 5KCVA 1AWEA 1Q67A 2P0HA 4H8SA 2N0YA 3WYFB 5D3XA 1XODA 2FJLA 4Y94A 2DYNA 1GC6A 2ELAA 1E5WA 1V89A 3V5WA 2Y7BA 2VRWB 4EMOA 3DXCA 2L2IA 2Z0PA 1U5DA 3ZVRA 4HAYB 1ZSQA 2JP2A 2IYBA 2J59M 1XD4A 4HAWB 2R09A 1MIXA 4HATB 4K81A 4HHVA 1KZGA 1UNQA 4B6HA 1BAKA 1FHXA 1H10A 2D9VA 1NU2A 4F7UP 3SYXA 1NTVA 2K2JA 2KGXB 3VOQA 1LW3A 4KHAA 3TW1A 5JLJB 2DA0A 2RUKB 4HDQA 2ROVA 2I5FA 1FGZA 1Y5OA 4DX90 4GZUA 2OQBA 5FI0A 5D3YA 1X1GA 1P6SA 2CY4A 1UPRA 3PP2A 3CIKA 3LJUX 1OY2A 1X86A 5L81A 1ZC3B 1M7RA 1OQNA 4WSFA 5DI9B 3F0WA 4K2PA 1P3RA 1UNRA 4ZRJA 1FOEA 3A98B 3ML4A 2GS0A 2X18A 4GMXB 4PQ0A 4CHJA 1RJ2A 1X11A 4EJNA 4DBBA 1V88A 3DXDA 1DDWA 1TJ6A 3HQCA 5DIFB 1P5TA 3AJ4A 5J3QA 3ODXA 3O96A 4WVFB 3SUZA 2DHIA 1H4RA 1KZ7A 4YONA 3A8QA 2CAYA 1M7EA 1NI2A 3KZ1A 2MDXA 1EGXA 3RCPA 2N23A 3T06A 5D3VA 1XR0B 1SHCA 2R0DA 3WA0A 1MPHA 2I1JA 3ZDTA 2VKIA 5FI1A 2YS5A 4GPTB 1K5GB 1KI1B 3D8FA 1BTKA 1J19A 3FEHA 1N3HA 1Y19B 1PFJA 1U5FA 4YL8A 1MK7B 1TXDA 1EF1A 1V5UA 3FM8C 3M1IB 2LG1A 3D8DA 2Y8GA 5HE3A 1MIZB 2I5CA 1AQCA 1W1HA 4EKUA 5C5BA 3U7DA 2D11A 4PNKA 1ZC4B 2DFKA 2KUPA 3GYPA 4C0AA 2EMTA 1IRSA 4IFSA 4A6HA 5C6RA 4WJ7A 2CODA 2J0JA 4K2OA 2V76A 2J0MA 2D2QA 2HE7A 2DX1A 1MAIA 3AU4A 4KHBB 5CLQB 1GC7A 2IFSA 1GG3A 2P8VA 2NZ8B 5DHFB 3PZDA 1MK9B 1V5PA 4HB2B 1WJ1A 2Z0OA 1FGYA 4NY0A 2M14A 5KQ4A 2UVMA 1I7AA 3KRXA 2CY5A 3U8ZA 1DDVA 2W2XC 1J0WA 3TO1A 1UNPA 1SGHA 3AU5A 2I1KA 1W1GA 5HE2A 4HDOA 1U2BA 2YS3A 3PVWA 4MY6A 4P7IA 2LULA 3KSYA 5GOWB 2D9ZA 5EFXA 5C5BB 1ISNA 2DN6A 1WGQA 4XWXA 3ULBA 2COFA 2YS1A 4CYEA 2RVBB 1FAOA 3PSCA 2NMBA 1K5DB 4HAXB 3KY9A 1WJMA 3SNHA 2RLOA 2AEHA 1FHOA 3PG7A 5JHGA 2LOXA 4DXAB 2ROZB 4CHMA 5KQ1A 1ZVRA 2RGNB 2LKOA 2AL6A 1B55A 1MKEA 1U27A 1Z87A 2PZ1A 4A6KA 2DKQA 1FHWA 1UPQA 2EC1A 4HB0B 4KAXB 3QIJA 1X1FA 2P0DA 2YSZA 2Z0QA 3IVFA 2D10A 4HAVB 3P7ZA 3SO6A 2MKRA 2COAA 4ZRKA 1TQZA 3OANA 1XX0A 2UZRA 3BINA 3N7CA 1QQGA 2GCLA 4Z2NA 4GN1A 2J0KA 2GJYA 2YT1A 4MT7A 5J3TA 2H7DA 2DYQA 2L1CA 4A6FA 4KVGB 2EJ8A 3TVVA 2ELBA 2Q13A 1U29A 5CLLB 4Z2MB 3G9WA 5JP4A 3DXEA 2YRYA 3ODOA 1FB8A 3BJIA 2EMSA 2W2XD 3QWMA 5C79A 2YVCA 3PEGA 5J3YA 4F7HA 1W1DA 4D0NB 3FSSA 1DDMA 5HE0A 1XCGA 1BTNA 3NSUA 1U5EA 2DHJA 2P0FA 1WI1A 1LB1A 2YF0A 3D8EA 3TFMA 2D4QA 1WVHA 5LONB 3ODWA 2ADZA 2LYDA 4L6EA 2YT0A 4HB3B 4GXBA 1PMSA 1I2HA 4GMVA 5D3WA 1OMWA 5D27A 2LOZA 4A5KA 4HB4B 1X05A 2KCJA 2MWNB 1EVHA 2CRFA 2E2XA 4F7GA 4A6FB 3VIAA 2DX5A 3ULCA 3F5RA 1U5GA 4IOYX 5DH9B 1EAZA 1DROA 4DX8A 4KHOA 2W2WA 5DHAB 4TYZA 2D9XA 1V61A 1QC6A 4HAZB 1DBHA 1XKEA 2DTCA 2QKLA 5JHHA 2M38A 3PVUA 1DYNA 2Y8FA 3P6AA 2BCJA 2COCA 3HW2B 3A8PA 4NSWA 1ZM0A 4IAPA 2MFQA 2DLWA 1NTYA 2VSZA 2RSGA 2UZSA 3MDBC 1RRPB 3SV1A 2OTXA 4K17A 1V5MA 1WG7A 2D9WA 4TKNA 5HE1A 2H7EA 4MK0A 5LOPB 4BBKA 3PVLA 1PLSA 2QKMA 2K00A 3UZTA 2G35A 3GYOA 1UEFA 2XQNM 3TCAA 1WGUA 3HK0A 2HTHB 4ZRIA 2RNRB 3KRWA 5C16A 3MPXA 3CXBB 3X23A 2D9YA
chains in the Genus database with same CATH superfamily
2DKPA 2K2UA 4HAUB 3QBVB 1BWNA 2GCJA 2ZPYA 2DHKA 5KCVA 5IRSA 1AWEA 1Q67A 2P0HA 4H8SA 2N0YA 3WYFB 5D3XA 1XODA 2FJLA 4Y94A 2DYNA 1GC6A 2ELAA 1E5WA 1V89A 3V5WA 2Y7BA 2VRWB 4EMOA 3DXCA 2L2IA 2Z0PA 1U5DA 3OHMB 3ZVRA 4HAYB 1ZSQA 2JP2A 2IYBA 2J59M 1XD4A 4HAWB 2R09A 1MIXA 4HATB 4K81A 4HHVA 1KZGA 1UNQA 2Z59A 4B6HA 1BAKA 4D6WA 1FHXA 1H10A 2D9VA 1NU2A 4F7UP 3SYXA 1NTVA 2K2JA 2KGXB 3VOQA 1LW3A 4KHAA 3TW1A 5JLJB 2DA0A 2RUKB 4HDQA 2ROVA 2I5FA 1FGZA 1Y5OA 4DX90 4GZUA 2OQBA 3U12A 5FI0A 5D3YA 1X1GA 1P6SA 2CY4A 1UPRA 3PP2A 3CIKA 3LJUX 1OY2A 1X86A 5L81A 1ZC3B 1M7RA 1OQNA 4WSFA 5DI9B 2KUQA 3F0WA 4K2PA 1P3RA 1UNRA 4ZRJA 1FOEA 3A98B 3ML4A 2GS0A 2X18A 4GMXB 4PQ0A 4CHJA 1RJ2A 2K8EA 1X11A 4EJNA 4DBBA 1V88A 3DXDA 1DDWA 1TJ6A 3HQCA 5DIFB 1P5TA 2YT2A 3AJ4A 5J3QA 3ODXA 3O96A 4WVFB 3SUZA 2DHIA 1H4RA 1KZ7A 4KHBA 4YONA 3A8QA 2CAYA 1M7EA 1NI2A 3KZ1A 2MDXA 1EGXA 3RCPA 2N23A 3T06A 5D3VA 1XR0B 1SHCA 3HIEA 2R0DA 3WA0A 1MPHA 2I1JA 3ZDTA 2VKIA 5FI1A 2YS5A 4GPTB 1K5GB 1KI1B 3D8FA 1BTKA 1J19A 3FEHA 1N3HA 2KIGA 1Y19B 1PFJA 1U5FA 4YL8A 1MK7B 1TXDA 1EF1A 1V5UA 3FM8C 3M1IB 2LG1A 3D8DA 2Y8GA 4CSQA 5HE3A 1MIZB 2I5CA 1AQCA 1W1HA 4EKUA 5C5BA 3U7DA 2D11A 4PNKA 1ZC4B 2DFKA 2FJUB 2KUPA 3GYPA 4C0AA 2EMTA 1IRSA 4OSNA 4IFSA 4A6HA 5C6RA 4WJ7A 2CODA 2J0JA 4K2OA 2V76A 2J0MA 5I2SA 2D2QA 2HE7A 2DX1A 1MAIA 3A58A 3AU4A 4KHBB 5CLQB 1GC7A 2IFSA 1GG3A 2P8VA 2NZ8B 5DHFB 3PZDA 1MK9B 1V5PA 4HB2B 1WJ1A 2Z0OA 1FGYA 4NY0A 2M14A 5KQ4A 2UVMA 1I7AA 3KRXA 1T77A 2CY5A 3U8ZA 1DDVA 2RRFA 2W2XC 1J0WA 3TO1A 1UNPA 1SGHA 3AU5A 2I1KA 1W1GA 5HE2A 4HDOA 1U2BA 2YS3A 3PVWA 4MY6A 4P7IA 2LULA 3KSYA 5GOWB 2D9ZA 5EFXA 5C5BB 1ISNA 2DN6A 1WGQA 4XWXA 3ULBA 2COFA 2KIEA 2YS1A 4CYEA 2RVBB 1FAOA 4QXAB 3PSCA 2NMBA 1K5DB 4HAXB 2R2YA 3KY9A 1WJMA 3SNHA 2RLOA 2AEHA 2Z4DA 1FHOA 3PG7A 3DCXA 5JHGA 2LOXA 3FVCA 4DXAB 2ROZB 4CHMA 5KQ1A 2GUMA 3NWFA 1ZVRA 2RGNB 2LKOA 2AL6A 1B55A 1MKEA 4HSIA 1U27A 1Z87A 2PZ1A 4A6KA 2DKQA 1FHWA 1UPQA 2EC1A 4HB0B 4KAXB 3QIJA 1X1FA 2P0DA 2YSZA 2Z0QA 3IVFA 2D10A 4HAVB 3P7ZA 2NBVA 3SO6A 2MKRA 2COAA 4ZRKA 1TQZA 3OANA 1XX0A 2UZRA 3BINA 3N7CA 1QQGA 2GCLA 4Z2NA 4GN1A 2J0KA 2GJYA 2YT1A 4MT7A 5J3TA 2H7DA 2DYQA 2L1CA 4A6FA 4KVGB 2EJ8A 3TVVA 5I2MA 2ELBA 2Q13A 1U29A 4OT1A 5CLLB 4Z2MB 3G9WA 5JP4A 3DXEA 4QJ5B 3NW8A 2YRYA 3ODOA 1FB8A 3BJIA 2EMSA 2W2XD 3QWMA 5C79A 2YVCA 3PEGA 5J3YA 4F7HA 1W1DA 4D0NB 3FSSA 1DDMA 5HE0A 1XCGA 5M4YB 1BTNA 3NSUA 1U5EA 4GNKB 4GOUA 2DHJA 2P0FA 1WI1A 1LB1A 2YF0A 3D8EA 3TFMA 2D4QA 1WVHA 5LONB 3ODWA 2Z13A 2ADZA 2LYDA 4L6EA 3HSAA 2YT0A 4HB3B 4GXBA 1PMSA 1I2HA 4GMVA 5D3WA 1OMWA 3NWAA 5D27A 2LOZA 4A5KA 4HB4B 1X05A 2KCJA 5LG4B 2MWNB 1EVHA 2CRFA 2E2XA 3NWDA 4F7GA 4A6FB 3VIAA 2DX5A 2Z14A 3ULCA 3F5RA 1U5GA 4IOYX 5DH9B 1EAZA 1DROA 4DX8A 4KHOA 2W2WA 5DHAB 4TYZA 2D9XA 1V61A 1QC6A 4HAZB 1DBHA 1XKEA 2DTCA 2QKLA 5JHHA 2M38A 3PVUA 1DYNA 2Y8FA 3P6AA 2BCJA 2COCA 3HW2B 3A8PA 4NSWA 1ZM0A 4IAPA 2MFQA 2DLWA 1NTYA 2VSZA 2RSGA 4DIXA 4L1RA 2KR0A 4QJ3B 2UZSA 3MDBC 2ZKMX 1RRPB 3SV1A 2OTXA 4K17A 1V5MA 1WG7A 2D9WA 4TKNA 5HE1A 1MI1A 2H7EA 4MK0A 5LOPB 1ZYIA 4BBKA 3PVLA 1PLSA 2QKMA 2K00A 3UZTA 2G35A 3GYOA 1UEFA 4QJ4B 2XQNM 3TCAA 1WGUA 3HK0A 2HTHB 4ZRIA 2K49A 2RNRB 3KRWA 5C16A 3MPXA 3CXBB 3X23A 3B77A 2D9YA
chains in the Genus database with same CATH topology
2DKPA 2K2UA 4HAUB 3QBVB 1BWNA 2GCJA 2ZPYA 2DHKA 5KCVA 1AWEA 5IRSA 1Q67A 2P0HA 4H8SA 2N0YA 3WYFB 5D3XA 1XODA 2FJLA 4Y94A 2DYNA 1GC6A 2ELAA 1E5WA 1V89A 3V5WA 2Y7BA 2VRWB 4EMOA 3DXCA 2L2IA 2Z0PA 1U5DA 3OHMB 3ZVRA 4HAYB 1ZSQA 2JP2A 2IYBA 2J59M 1XD4A 4HAWB 2R09A 1MIXA 4HATB 4K81A 4HHVA 1KZGA 1UNQA 2Z59A 4B6HA 1BAKA 4D6WA 1FHXA 1H10A 2D9VA 1NU2A 4F7UP 3SYXA 1NTVA 2K2JA 2KGXB 3VOQA 1LW3A 4KHAA 3TW1A 5JLJB 2DA0A 2RUKB 4HDQA 2ROVA 2I5FA 1FGZA 1Y5OA 4DX90 4GZUA 2OQBA 3U12A 5FI0A 5D3YA 1X1GA 1P6SA 2CY4A 1UPRA 3PP2A 3CIKA 3LJUX 1OY2A 1X86A 5L81A 1ZC3B 1M7RA 1OQNA 4WSFA 5DI9B 3F0WA 4K2PA 2KUQA 1P3RA 1UNRA 4ZRJA 1FOEA 3A98B 3ML4A 2GS0A 2X18A 4GMXB 4PQ0A 4CHJA 1RJ2A 2K8EA 1X11A 4EJNA 4DBBA 1V88A 3DXDA 1DDWA 1TJ6A 3HQCA 5DIFB 1P5TA 2YT2A 3AJ4A 5J3QA 3ODXA 3O96A 4WVFB 3SUZA 2DHIA 1H4RA 1KZ7A 4KHBA 4YONA 3A8QA 2CAYA 1M7EA 1NI2A 3KZ1A 2MDXA 1EGXA 3RCPA 2N23A 3T06A 5D3VA 1XR0B 1SHCA 3HIEA 2R0DA 3WA0A 1MPHA 2I1JA 3ZDTA 2VKIA 5FI1A 2YS5A 4GPTB 1K5GB 1KI1B 3D8FA 1BTKA 1J19A 3FEHA 1N3HA 2KIGA 1Y19B 1PFJA 1U5FA 4YL8A 1MK7B 1TXDA 1EF1A 1V5UA 3FM8C 3M1IB 2LG1A 3D8DA 2Y8GA 4CSQA 5HE3A 1MIZB 2I5CA 1AQCA 1W1HA 4EKUA 5C5BA 3U7DA 2D11A 4PNKA 1ZC4B 2DFKA 2FJUB 2KUPA 3GYPA 4C0AA 2EMTA 1IRSA 4OSNA 4IFSA 4A6HA 5C6RA 4WJ7A 2CODA 2J0JA 4K2OA 2V76A 2J0MA 5I2SA 2D2QA 2HE7A 2DX1A 1MAIA 3AU4A 4KHBB 3A58A 5CLQB 1GC7A 2IFSA 1GG3A 2P8VA 2NZ8B 5DHFB 3PZDA 1MK9B 1V5PA 4HB2B 1WJ1A 2Z0OA 1FGYA 4NY0A 2M14A 5KQ4A 2UVMA 1I7AA 3KRXA 2CY5A 3U8ZA 1DDVA 2RRFA 2W2XC 1J0WA 3TO1A 1UNPA 1SGHA 3AU5A 2I1KA 1W1GA 5HE2A 4HDOA 1U2BA 2YS3A 3PVWA 4MY6A 4P7IA 2LULA 3KSYA 5GOWB 2D9ZA 5EFXA 5C5BB 1ISNA 2DN6A 1WGQA 4XWXA 3ULBA 2COFA 2KIEA 2YS1A 4CYEA 2RVBB 1FAOA 4QXAB 3PSCA 2NMBA 1K5DB 4HAXB 2R2YA 3KY9A 1WJMA 3SNHA 2RLOA 2AEHA 2Z4DA 1FHOA 3PG7A 5JHGA 2LOXA 4DXAB 3FVCA 2ROZB 4CHMA 5KQ1A 2GUMA 3NWFA 1ZVRA 2RGNB 2LKOA 2AL6A 1B55A 1MKEA 4HSIA 1U27A 1Z87A 2PZ1A 4A6KA 2DKQA 1FHWA 1UPQA 2EC1A 4HB0B 4KAXB 3QIJA 1X1FA 2P0DA 2YSZA 2Z0QA 3IVFA 2D10A 4HAVB 3P7ZA 2NBVA 3SO6A 2MKRA 2COAA 4ZRKA 1TQZA 3OANA 1XX0A 2UZRA 3BINA 3N7CA 1QQGA 2GCLA 4Z2NA 4GN1A 2J0KA 2GJYA 2YT1A 4MT7A 5J3TA 2H7DA 2DYQA 2L1CA 4A6FA 4KVGB 2EJ8A 3TVVA 5I2MA 2ELBA 2Q13A 1U29A 5CLLB 4OT1A 4Z2MB 3G9WA 5JP4A 3DXEA 4QJ5B 3NW8A 2YRYA 3ODOA 1FB8A 3BJIA 2EMSA 2W2XD 3QWMA 5C79A 2YVCA 3PEGA 5J3YA 4F7HA 1W1DA 4D0NB 3FSSA 1DDMA 5HE0A 1XCGA 5M4YB 1BTNA 3NSUA 1U5EA 4GNKB 4GOUA 2DHJA 2P0FA 1WI1A 1LB1A 2YF0A 3D8EA 3TFMA 2D4QA 1WVHA 5LONB 3ODWA 2Z13A 2ADZA 2LYDA 4L6EA 2YT0A 4HB3B 4GXBA 1PMSA 1I2HA 4GMVA 5D3WA 1OMWA 3NWAA 5D27A 2LOZA 4A5KA 4HB4B 1X05A 2KCJA 5LG4B 2MWNB 1EVHA 2CRFA 2E2XA 4F7GA 3NWDA 4A6FB 3VIAA 2DX5A 3ULCA 2Z14A 3F5RA 1U5GA 4IOYX 5DH9B 1EAZA 1DROA 4DX8A 4KHOA 2W2WA 5DHAB 4TYZA 2D9XA 1V61A 1QC6A 4HAZB 1DBHA 1XKEA 2DTCA 2QKLA 5JHHA 2M38A 3PVUA 1DYNA 2Y8FA 3P6AA 2BCJA 2COCA 3HW2B 3A8PA 4NSWA 1ZM0A 4IAPA 2MFQA 2DLWA 1NTYA 2VSZA 2RSGA 4DIXA 4L1RA 2KR0A 4QJ3B 2UZSA 3MDBC 2ZKMX 1RRPB 3SV1A 2OTXA 4K17A 1V5MA 1WG7A 2D9WA 4TKNA 5HE1A 2H7EA 4MK0A 5LOPB 1ZYIA 4BBKA 3PVLA 1PLSA 2QKMA 2K00A 3UZTA 2G35A 3GYOA 1UEFA 4QJ4B 2XQNM 3TCAA 1WGUA 3HK0A 2HTHB 4ZRIA 2K49A 2RNRB 3KRWA 5C16A 3MPXA 3CXBB 3X23A 2D9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKP A;  2K2U A;  4HAU B;  3QBV B;  1BWN A;  2GCJ A;  2ZPY A;  2DHK A;  5KCV A;  1AWE A;  1Q67 A;  2P0H A;  4H8S A;  2N0Y A;  3WYF B;  5D3X A;  1XOD A;  2FJL A;  4Y94 A;  2DYN A;  1GC6 A;  2ELA A;  1E5W A;  1V89 A;  3V5W A;  2Y7B A;  2VRW B;  4EMO A;  3DXC A;  2L2I A;  2Z0P A;  1U5D A;  3ZVR A;  4HAY B;  1ZSQ A;  2JP2 A;  2IYB A;  2J59 M;  1XD4 A;  4HAW B;  2R09 A;  1MIX A;  4HAT B;  4K81 A;  4HHV A;  1KZG A;  1UNQ A;  4B6H A;  1BAK A;  1FHX A;  1H10 A;  2D9V A;  1NU2 A;  4F7U P;  3SYX A;  1NTV A;  2K2J A;  2KGX B;  3VOQ A;  1LW3 A;  4KHA A;  3TW1 A;  5JLJ B;  2DA0 A;  2RUK B;  4HDQ A;  2ROV A;  2I5F A;  1FGZ A;  1Y5O A;  4DX9 0;  4GZU A;  2OQB A;  5FI0 A;  5D3Y A;  1X1G A;  1P6S A;  2CY4 A;  1UPR A;  3PP2 A;  3CIK A;  3LJU X;  1OY2 A;  1X86 A;  5L81 A;  1ZC3 B;  1M7R A;  1OQN A;  4WSF A;  5DI9 B;  3F0W A;  4K2P A;  1P3R A;  1UNR A;  4ZRJ A;  1FOE A;  3A98 B;  3ML4 A;  2GS0 A;  2X18 A;  4GMX B;  4PQ0 A;  4CHJ A;  1RJ2 A;  1X11 A;  4EJN A;  4DBB A;  1V88 A;  3DXD A;  1DDW A;  1TJ6 A;  3HQC A;  5DIF B;  1P5T A;  3AJ4 A;  5J3Q A;  3ODX A;  3O96 A;  4WVF B;  3SUZ A;  2DHI A;  1H4R A;  1KZ7 A;  4YON A;  3A8Q A;  2CAY A;  1M7E A;  1NI2 A;  3KZ1 A;  2MDX A;  1EGX A;  3RCP A;  2N23 A;  3T06 A;  5D3V A;  1XR0 B;  1SHC A;  2R0D A;  3WA0 A;  1MPH A;  2I1J A;  3ZDT A;  2VKI A;  5FI1 A;  2YS5 A;  4GPT B;  1K5G B;  1KI1 B;  3D8F A;  1BTK A;  1J19 A;  3FEH A;  1N3H A;  1Y19 B;  1PFJ A;  1U5F A;  4YL8 A;  1MK7 B;  1TXD A;  1EF1 A;  1V5U A;  3FM8 C;  3M1I B;  2LG1 A;  3D8D A;  2Y8G A;  5HE3 A;  1MIZ B;  2I5C A;  1AQC A;  1W1H A;  4EKU A;  5C5B A;  3U7D A;  2D11 A;  4PNK A;  1ZC4 B;  2DFK A;  2KUP A;  3GYP A;  4C0A A;  2EMT A;  1IRS A;  4IFS A;  4A6H A;  5C6R A;  4WJ7 A;  2COD A;  2J0J A;  4K2O A;  2V76 A;  2J0M A;  2D2Q A;  2HE7 A;  2DX1 A;  1MAI A;  3AU4 A;  4KHB B;  5CLQ B;  1GC7 A;  2IFS A;  1GG3 A;  2P8V A;  2NZ8 B;  5DHF B;  3PZD A;  1MK9 B;  1V5P A;  4HB2 B;  1WJ1 A;  2Z0O A;  1FGY A;  4NY0 A;  2M14 A;  5KQ4 A;  2UVM A;  1I7A A;  3KRX A;  2CY5 A;  3U8Z A;  1DDV A;  2W2X C;  1J0W A;  3TO1 A;  1UNP A;  1SGH A;  3AU5 A;  2I1K A;  1W1G A;  5HE2 A;  4HDO A;  1U2B A;  2YS3 A;  3PVW A;  4MY6 A;  4P7I A;  2LUL A;  3KSY A;  5GOW B;  2D9Z A;  5EFX A;  5C5B B;  1ISN A;  2DN6 A;  1WGQ A;  4XWX A;  3ULB A;  2COF A;  2YS1 A;  4CYE A;  2RVB B;  1FAO A;  3PSC A;  2NMB A;  1K5D B;  4HAX B;  3KY9 A;  1WJM A;  3SNH A;  2RLO A;  2AEH A;  1FHO A;  3PG7 A;  5JHG A;  2LOX A;  4DXA B;  2ROZ B;  4CHM A;  5KQ1 A;  1ZVR A;  2RGN B;  2LKO A;  2AL6 A;  1B55 A;  1MKE A;  1U27 A;  1Z87 A;  2PZ1 A;  4A6K A;  2DKQ A;  1FHW A;  1UPQ A;  2EC1 A;  4HB0 B;  4KAX B;  3QIJ A;  1X1F A;  2P0D A;  2YSZ A;  2Z0Q A;  3IVF A;  2D10 A;  4HAV B;  3P7Z A;  3SO6 A;  2MKR A;  2COA A;  4ZRK A;  1TQZ A;  3OAN A;  1XX0 A;  2UZR A;  3BIN A;  3N7C A;  1QQG A;  2GCL A;  4Z2N A;  4GN1 A;  2J0K A;  2GJY A;  2YT1 A;  4MT7 A;  5J3T A;  2H7D A;  2DYQ A;  2L1C A;  4A6F A;  4KVG B;  2EJ8 A;  3TVV A;  2ELB A;  2Q13 A;  1U29 A;  5CLL B;  4Z2M B;  3G9W A;  5JP4 A;  3DXE A;  2YRY A;  3ODO A;  1FB8 A;  3BJI A;  2EMS A;  2W2X D;  3QWM A;  5C79 A;  2YVC A;  3PEG A;  5J3Y A;  4F7H A;  1W1D A;  4D0N B;  3FSS A;  1DDM A;  5HE0 A;  1XCG A;  1BTN A;  3NSU A;  1U5E A;  2DHJ A;  2P0F A;  1WI1 A;  1LB1 A;  2YF0 A;  3D8E A;  3TFM A;  2D4Q A;  1WVH A;  5LON B;  3ODW A;  2ADZ A;  2LYD A;  4L6E A;  2YT0 A;  4HB3 B;  4GXB A;  1PMS A;  1I2H A;  4GMV A;  5D3W A;  1OMW A;  5D27 A;  2LOZ A;  4A5K A;  4HB4 B;  1X05 A;  2KCJ A;  2MWN B;  1EVH A;  2CRF A;  2E2X A;  4F7G A;  4A6F B;  3VIA A;  2DX5 A;  3ULC A;  3F5R A;  1U5G A;  4IOY X;  5DH9 B;  1EAZ A;  1DRO A;  4DX8 A;  4KHO A;  2W2W A;  5DHA B;  4TYZ A;  2D9X A;  1V61 A;  1QC6 A;  4HAZ B;  1DBH A;  1XKE A;  2DTC A;  2QKL A;  5JHH A;  2M38 A;  3PVU A;  1DYN A;  2Y8F A;  3P6A A;  2BCJ A;  2COC A;  3HW2 B;  3A8P A;  4NSW A;  1ZM0 A;  4IAP A;  2MFQ A;  2DLW A;  1NTY A;  2VSZ A;  2RSG A;  2UZS A;  3MDB C;  1RRP B;  3SV1 A;  2OTX A;  4K17 A;  1V5M A;  1WG7 A;  2D9W A;  4TKN A;  5HE1 A;  2H7E A;  4MK0 A;  5LOP B;  4BBK A;  3PVL A;  1PLS A;  2QKM A;  2K00 A;  3UZT A;  2G35 A;  3GYO A;  1UEF A;  2XQN M;  3TCA A;  1WGU A;  3HK0 A;  2HTH B;  4ZRI A;  2RNR B;  3KRW A;  5C16 A;  3MPX A;  3CXB B;  3X23 A;  2D9Y A; 
#chains in the Genus database with same CATH topology
 2DKP A;  2K2U A;  4HAU B;  3QBV B;  1BWN A;  2GCJ A;  2ZPY A;  2DHK A;  5KCV A;  5IRS A;  1AWE A;  1Q67 A;  2P0H A;  4H8S A;  2N0Y A;  3WYF B;  5D3X A;  1XOD A;  2FJL A;  4Y94 A;  2DYN A;  1GC6 A;  2ELA A;  1E5W A;  1V89 A;  3V5W A;  2Y7B A;  2VRW B;  4EMO A;  3DXC A;  2L2I A;  2Z0P A;  1U5D A;  3OHM B;  3ZVR A;  4HAY B;  1ZSQ A;  2JP2 A;  2IYB A;  2J59 M;  1XD4 A;  4HAW B;  2R09 A;  1MIX A;  4HAT B;  4K81 A;  4HHV A;  1KZG A;  1UNQ A;  2Z59 A;  4B6H A;  1BAK A;  4D6W A;  1FHX A;  1H10 A;  2D9V A;  1NU2 A;  4F7U P;  3SYX A;  1NTV A;  2K2J A;  2KGX B;  3VOQ A;  1LW3 A;  4KHA A;  3TW1 A;  5JLJ B;  2DA0 A;  2RUK B;  4HDQ A;  2ROV A;  2I5F A;  1FGZ A;  1Y5O A;  4DX9 0;  4GZU A;  2OQB A;  3U12 A;  5FI0 A;  5D3Y A;  1X1G A;  1P6S A;  2CY4 A;  1UPR A;  3PP2 A;  3CIK A;  3LJU X;  1OY2 A;  1X86 A;  5L81 A;  1ZC3 B;  1M7R A;  1OQN A;  4WSF A;  5DI9 B;  2KUQ A;  3F0W A;  4K2P A;  1P3R A;  1UNR A;  4ZRJ A;  1FOE A;  3A98 B;  3ML4 A;  2GS0 A;  2X18 A;  4GMX B;  4PQ0 A;  4CHJ A;  1RJ2 A;  2K8E A;  1X11 A;  4EJN A;  4DBB A;  1V88 A;  3DXD A;  1DDW A;  1TJ6 A;  3HQC A;  5DIF B;  1P5T A;  2YT2 A;  3AJ4 A;  5J3Q A;  3ODX A;  3O96 A;  4WVF B;  3SUZ A;  2DHI A;  1H4R A;  1KZ7 A;  4KHB A;  4YON A;  3A8Q A;  2CAY A;  1M7E A;  1NI2 A;  3KZ1 A;  2MDX A;  1EGX A;  3RCP A;  2N23 A;  3T06 A;  5D3V A;  1XR0 B;  1SHC A;  3HIE A;  2R0D A;  3WA0 A;  1MPH A;  2I1J A;  3ZDT A;  2VKI A;  5FI1 A;  2YS5 A;  4GPT B;  1K5G B;  1KI1 B;  3D8F A;  1BTK A;  1J19 A;  3FEH A;  1N3H A;  2KIG A;  1Y19 B;  1PFJ A;  1U5F A;  4YL8 A;  1MK7 B;  1TXD A;  1EF1 A;  1V5U A;  3FM8 C;  3M1I B;  2LG1 A;  3D8D A;  2Y8G A;  4CSQ A;  5HE3 A;  1MIZ B;  2I5C A;  1AQC A;  1W1H A;  4EKU A;  5C5B A;  3U7D A;  2D11 A;  4PNK A;  1ZC4 B;  2DFK A;  2FJU B;  2KUP A;  3GYP A;  4C0A A;  2EMT A;  1IRS A;  4OSN A;  4IFS A;  4A6H A;  5C6R A;  4WJ7 A;  2COD A;  2J0J A;  4K2O A;  2V76 A;  2J0M A;  5I2S A;  2D2Q A;  2HE7 A;  2DX1 A;  1MAI A;  3A58 A;  3AU4 A;  4KHB B;  5CLQ B;  1GC7 A;  2IFS A;  1GG3 A;  2P8V A;  2NZ8 B;  5DHF B;  3PZD A;  1MK9 B;  1V5P A;  4HB2 B;  1WJ1 A;  2Z0O A;  1FGY A;  4NY0 A;  2M14 A;  5KQ4 A;  2UVM A;  1I7A A;  3KRX A;  1T77 A;  2CY5 A;  3U8Z A;  1DDV A;  2RRF A;  2W2X C;  1J0W A;  3TO1 A;  1UNP A;  1SGH A;  3AU5 A;  2I1K A;  1W1G A;  5HE2 A;  4HDO A;  1U2B A;  2YS3 A;  3PVW A;  4MY6 A;  4P7I A;  2LUL A;  3KSY A;  5GOW B;  2D9Z A;  5EFX A;  5C5B B;  1ISN A;  2DN6 A;  1WGQ A;  4XWX A;  3ULB A;  2COF A;  2KIE A;  2YS1 A;  4CYE A;  2RVB B;  1FAO A;  4QXA B;  3PSC A;  2NMB A;  1K5D B;  4HAX B;  2R2Y A;  3KY9 A;  1WJM A;  3SNH A;  2RLO A;  2AEH A;  2Z4D A;  1FHO A;  3PG7 A;  3DCX A;  5JHG A;  2LOX A;  3FVC A;  4DXA B;  2ROZ B;  4CHM A;  5KQ1 A;  2GUM A;  3NWF A;  1ZVR A;  2RGN B;  2LKO A;  2AL6 A;  1B55 A;  1MKE A;  4HSI A;  1U27 A;  1Z87 A;  2PZ1 A;  4A6K A;  2DKQ A;  1FHW A;  1UPQ A;  2EC1 A;  4HB0 B;  4KAX B;  3QIJ A;  1X1F A;  2P0D A;  2YSZ A;  2Z0Q A;  3IVF A;  2D10 A;  4HAV B;  3P7Z A;  2NBV A;  3SO6 A;  2MKR A;  2COA A;  4ZRK A;  1TQZ A;  3OAN A;  1XX0 A;  2UZR A;  3BIN A;  3N7C A;  1QQG A;  2GCL A;  4Z2N A;  4GN1 A;  2J0K A;  2GJY A;  2YT1 A;  4MT7 A;  5J3T A;  2H7D A;  2DYQ A;  2L1C A;  4A6F A;  4KVG B;  2EJ8 A;  3TVV A;  5I2M A;  2ELB A;  2Q13 A;  1U29 A;  4OT1 A;  5CLL B;  4Z2M B;  3G9W A;  5JP4 A;  3DXE A;  4QJ5 B;  3NW8 A;  2YRY A;  3ODO A;  1FB8 A;  3BJI A;  2EMS A;  2W2X D;  3QWM A;  5C79 A;  2YVC A;  3PEG A;  5J3Y A;  4F7H A;  1W1D A;  4D0N B;  3FSS A;  1DDM A;  5HE0 A;  1XCG A;  5M4Y B;  1BTN A;  3NSU A;  1U5E A;  4GNK B;  4GOU A;  2DHJ A;  2P0F A;  1WI1 A;  1LB1 A;  2YF0 A;  3D8E A;  3TFM A;  2D4Q A;  1WVH A;  5LON B;  3ODW A;  2Z13 A;  2ADZ A;  2LYD A;  4L6E A;  3HSA A;  2YT0 A;  4HB3 B;  4GXB A;  1PMS A;  1I2H A;  4GMV A;  5D3W A;  1OMW A;  3NWA A;  5D27 A;  2LOZ A;  4A5K A;  4HB4 B;  1X05 A;  2KCJ A;  5LG4 B;  2MWN B;  1EVH A;  2CRF A;  2E2X A;  3NWD A;  4F7G A;  4A6F B;  3VIA A;  2DX5 A;  2Z14 A;  3ULC A;  3F5R A;  1U5G A;  4IOY X;  5DH9 B;  1EAZ A;  1DRO A;  4DX8 A;  4KHO A;  2W2W A;  5DHA B;  4TYZ A;  2D9X A;  1V61 A;  1QC6 A;  4HAZ B;  1DBH A;  1XKE A;  2DTC A;  2QKL A;  5JHH A;  2M38 A;  3PVU A;  1DYN A;  2Y8F A;  3P6A A;  2BCJ A;  2COC A;  3HW2 B;  3A8P A;  4NSW A;  1ZM0 A;  4IAP A;  2MFQ A;  2DLW A;  1NTY A;  2VSZ A;  2RSG A;  4DIX A;  4L1R A;  2KR0 A;  4QJ3 B;  2UZS A;  3MDB C;  2ZKM X;  1RRP B;  3SV1 A;  2OTX A;  4K17 A;  1V5M A;  1WG7 A;  2D9W A;  4TKN A;  5HE1 A;  1MI1 A;  2H7E A;  4MK0 A;  5LOP B;  1ZYI A;  4BBK A;  3PVL A;  1PLS A;  2QKM A;  2K00 A;  3UZT A;  2G35 A;  3GYO A;  1UEF A;  4QJ4 B;  2XQN M;  3TCA A;  1WGU A;  3HK0 A;  2HTH B;  4ZRI A;  2K49 A;  2RNR B;  3KRW A;  5C16 A;  3MPX A;  3CXB B;  3X23 A;  3B77 A;  2D9Y A; 
#chains in the Genus database with same CATH homology
 2DKP A;  2K2U A;  4HAU B;  3QBV B;  1BWN A;  2GCJ A;  2ZPY A;  2DHK A;  5KCV A;  1AWE A;  5IRS A;  1Q67 A;  2P0H A;  4H8S A;  2N0Y A;  3WYF B;  5D3X A;  1XOD A;  2FJL A;  4Y94 A;  2DYN A;  1GC6 A;  2ELA A;  1E5W A;  1V89 A;  3V5W A;  2Y7B A;  2VRW B;  4EMO A;  3DXC A;  2L2I A;  2Z0P A;  1U5D A;  3OHM B;  3ZVR A;  4HAY B;  1ZSQ A;  2JP2 A;  2IYB A;  2J59 M;  1XD4 A;  4HAW B;  2R09 A;  1MIX A;  4HAT B;  4K81 A;  4HHV A;  1KZG A;  1UNQ A;  2Z59 A;  4B6H A;  1BAK A;  4D6W A;  1FHX A;  1H10 A;  2D9V A;  1NU2 A;  4F7U P;  3SYX A;  1NTV A;  2K2J A;  2KGX B;  3VOQ A;  1LW3 A;  4KHA A;  3TW1 A;  5JLJ B;  2DA0 A;  2RUK B;  4HDQ A;  2ROV A;  2I5F A;  1FGZ A;  1Y5O A;  4DX9 0;  4GZU A;  2OQB A;  3U12 A;  5FI0 A;  5D3Y A;  1X1G A;  1P6S A;  2CY4 A;  1UPR A;  3PP2 A;  3CIK A;  3LJU X;  1OY2 A;  1X86 A;  5L81 A;  1ZC3 B;  1M7R A;  1OQN A;  4WSF A;  5DI9 B;  3F0W A;  4K2P A;  2KUQ A;  1P3R A;  1UNR A;  4ZRJ A;  1FOE A;  3A98 B;  3ML4 A;  2GS0 A;  2X18 A;  4GMX B;  4PQ0 A;  4CHJ A;  1RJ2 A;  2K8E A;  1X11 A;  4EJN A;  4DBB A;  1V88 A;  3DXD A;  1DDW A;  1TJ6 A;  3HQC A;  5DIF B;  1P5T A;  2YT2 A;  3AJ4 A;  5J3Q A;  3ODX A;  3O96 A;  4WVF B;  3SUZ A;  2DHI A;  1H4R A;  1KZ7 A;  4KHB A;  4YON A;  3A8Q A;  2CAY A;  1M7E A;  1NI2 A;  3KZ1 A;  2MDX A;  1EGX A;  3RCP A;  2N23 A;  3T06 A;  5D3V A;  1XR0 B;  1SHC A;  3HIE A;  2R0D A;  3WA0 A;  1MPH A;  2I1J A;  3ZDT A;  2VKI A;  5FI1 A;  2YS5 A;  4GPT B;  1K5G B;  1KI1 B;  3D8F A;  1BTK A;  1J19 A;  3FEH A;  1N3H A;  2KIG A;  1Y19 B;  1PFJ A;  1U5F A;  4YL8 A;  1MK7 B;  1TXD A;  1EF1 A;  1V5U A;  3FM8 C;  3M1I B;  2LG1 A;  3D8D A;  2Y8G A;  4CSQ A;  5HE3 A;  1MIZ B;  2I5C A;  1AQC A;  1W1H A;  4EKU A;  5C5B A;  3U7D A;  2D11 A;  4PNK A;  1ZC4 B;  2DFK A;  2FJU B;  2KUP A;  3GYP A;  4C0A A;  2EMT A;  1IRS A;  4OSN A;  4IFS A;  4A6H A;  5C6R A;  4WJ7 A;  2COD A;  2J0J A;  4K2O A;  2V76 A;  2J0M A;  5I2S A;  2D2Q A;  2HE7 A;  2DX1 A;  1MAI A;  3AU4 A;  4KHB B;  3A58 A;  5CLQ B;  1GC7 A;  2IFS A;  1GG3 A;  2P8V A;  2NZ8 B;  5DHF B;  3PZD A;  1MK9 B;  1V5P A;  4HB2 B;  1WJ1 A;  2Z0O A;  1FGY A;  4NY0 A;  2M14 A;  5KQ4 A;  2UVM A;  1I7A A;  3KRX A;  2CY5 A;  3U8Z A;  1DDV A;  2RRF A;  2W2X C;  1J0W A;  3TO1 A;  1UNP A;  1SGH A;  3AU5 A;  2I1K A;  1W1G A;  5HE2 A;  4HDO A;  1U2B A;  2YS3 A;  3PVW A;  4MY6 A;  4P7I A;  2LUL A;  3KSY A;  5GOW B;  2D9Z A;  5EFX A;  5C5B B;  1ISN A;  2DN6 A;  1WGQ A;  4XWX A;  3ULB A;  2COF A;  2KIE A;  2YS1 A;  4CYE A;  2RVB B;  1FAO A;  4QXA B;  3PSC A;  2NMB A;  1K5D B;  4HAX B;  2R2Y A;  3KY9 A;  1WJM A;  3SNH A;  2RLO A;  2AEH A;  2Z4D A;  1FHO A;  3PG7 A;  5JHG A;  2LOX A;  4DXA B;  3FVC A;  2ROZ B;  4CHM A;  5KQ1 A;  2GUM A;  3NWF A;  1ZVR A;  2RGN B;  2LKO A;  2AL6 A;  1B55 A;  1MKE A;  4HSI A;  1U27 A;  1Z87 A;  2PZ1 A;  4A6K A;  2DKQ A;  1FHW A;  1UPQ A;  2EC1 A;  4HB0 B;  4KAX B;  3QIJ A;  1X1F A;  2P0D A;  2YSZ A;  2Z0Q A;  3IVF A;  2D10 A;  4HAV B;  3P7Z A;  2NBV A;  3SO6 A;  2MKR A;  2COA A;  4ZRK A;  1TQZ A;  3OAN A;  1XX0 A;  2UZR A;  3BIN A;  3N7C A;  1QQG A;  2GCL A;  4Z2N A;  4GN1 A;  2J0K A;  2GJY A;  2YT1 A;  4MT7 A;  5J3T A;  2H7D A;  2DYQ A;  2L1C A;  4A6F A;  4KVG B;  2EJ8 A;  3TVV A;  5I2M A;  2ELB A;  2Q13 A;  1U29 A;  5CLL B;  4OT1 A;  4Z2M B;  3G9W A;  5JP4 A;  3DXE A;  4QJ5 B;  3NW8 A;  2YRY A;  3ODO A;  1FB8 A;  3BJI A;  2EMS A;  2W2X D;  3QWM A;  5C79 A;  2YVC A;  3PEG A;  5J3Y A;  4F7H A;  1W1D A;  4D0N B;  3FSS A;  1DDM A;  5HE0 A;  1XCG A;  5M4Y B;  1BTN A;  3NSU A;  1U5E A;  4GNK B;  4GOU A;  2DHJ A;  2P0F A;  1WI1 A;  1LB1 A;  2YF0 A;  3D8E A;  3TFM A;  2D4Q A;  1WVH A;  5LON B;  3ODW A;  2Z13 A;  2ADZ A;  2LYD A;  4L6E A;  2YT0 A;  4HB3 B;  4GXB A;  1PMS A;  1I2H A;  4GMV A;  5D3W A;  1OMW A;  3NWA A;  5D27 A;  2LOZ A;  4A5K A;  4HB4 B;  1X05 A;  2KCJ A;  5LG4 B;  2MWN B;  1EVH A;  2CRF A;  2E2X A;  4F7G A;  3NWD A;  4A6F B;  3VIA A;  2DX5 A;  3ULC A;  2Z14 A;  3F5R A;  1U5G A;  4IOY X;  5DH9 B;  1EAZ A;  1DRO A;  4DX8 A;  4KHO A;  2W2W A;  5DHA B;  4TYZ A;  2D9X A;  1V61 A;  1QC6 A;  4HAZ B;  1DBH A;  1XKE A;  2DTC A;  2QKL A;  5JHH A;  2M38 A;  3PVU A;  1DYN A;  2Y8F A;  3P6A A;  2BCJ A;  2COC A;  3HW2 B;  3A8P A;  4NSW A;  1ZM0 A;  4IAP A;  2MFQ A;  2DLW A;  1NTY A;  2VSZ A;  2RSG A;  4DIX A;  4L1R A;  2KR0 A;  4QJ3 B;  2UZS A;  3MDB C;  2ZKM X;  1RRP B;  3SV1 A;  2OTX A;  4K17 A;  1V5M A;  1WG7 A;  2D9W A;  4TKN A;  5HE1 A;  2H7E A;  4MK0 A;  5LOP B;  1ZYI A;  4BBK A;  3PVL A;  1PLS A;  2QKM A;  2K00 A;  3UZT A;  2G35 A;  3GYO A;  1UEF A;  4QJ4 B;  2XQN M;  3TCA A;  1WGU A;  3HK0 A;  2HTH B;  4ZRI A;  2K49 A;  2RNR B;  3KRW A;  5C16 A;  3MPX A;  3CXB B;  3X23 A;  2D9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...