4PQ0A

Crystal structure of pob3 middle domain at 1.65a
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
242
structure length
233
Chain Sequence
ADIGEVAGDAIVSFQDVFFTTPRGRYDIDIYKNSIRLRGKTYEYKLQHRQIQRIVSLPKADDIHHLLVLAIEPPLRQGQTTYPFLVLQFQKDEETEVQLNLEDEDYEENYKDKLKKQYDAKTHIVLSHVLKGLTDRRVIVPGEYKSKYDQCAVSCSFKANEGYLYPLDNAFFFLTKPTLYIPFSDVSMVNISRTFDLEVVLRSNRGSTTFANISKEEQQLLEQFLKSKNLRVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of POB3 middle domain at 1.65A
rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication, transcription
molecule keywords FACT complex subunit POB3
total genus 53
structure length 233
sequence length 242
ec nomenclature
pdb deposition date 2014-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4pq0A02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 4pq0A01
3A8PA 1BWNA 1P5TA 3BINA 1V5UA 4HAZB 2N0YA 3SO6A 2YS5A 2Y8GA 4A6HA 3VIAA 1EF1A 2J0JA 5HE0A 2GCJA 1H4RA 4IOYX 4ZRIA 1UNQA 3D8FA 1U5EA 2YF0A 1AQCA 2AEHA 1BTNA 2RVBB 3CXBB 3DXCA 4C0AA 5DI9B 1QC6A 2D11A 3ODWA 2DFKA 3UZTA 5DHAB 1NI2A 1Y5OA 1H10A 2CRFA 4DX8A 5J3YA 5KQ4A 4KHAA 4ZRKA 2KCJA 1FGYA 3WYFB 3ODOA 3AU5A 4Y94A 1ZM0A 1FAOA 3QBVB 3ML4A 2DTCA 3PG7A 1TQZA 3ULCA 1M7EA 2I1JA 2EJ8A 5L81A 1MK9B 4K17A 1WVHA 2Q13A 1SHCA 1X1GA 2YS1A 2ROVA 3NSUA 3ZDTA 1X11A 4GN1A 1PFJA 3LJUX 1FB8A 2M38A 1U2BA 2BCJA 4EKUA 1XX0A 1I2HA 5FI0A 1IRSA 3QWMA 3D8EA 2K2UA 4XWXA 4DBBA 2D9XA 3SUZA 3HK0A 2RNRB 5LOPB 2V76A 3DXEA 2Z0QA 3HQCA 2DX5A 2EMSA 3SV1A 3TFMA 2D9ZA 2DKQA 4MT7A 1FOEA 5J3QA 4BBKA 1GG3A 1X1FA 4GXBA 1P6SA 1EAZA 3VOQA 4WSFA 4IFSA 2OTXA 5HE2A 3HW2B 4HAVB 5JP4A 1WGQA 1V5PA 2GCLA 2ZPYA 1DDMA 2D2QA 2RSGA 1LB1A 3GYPA 3QIJA 2YT1A 1EGXA 5JLJB 4D0NB 2P0DA 1K5GB 3PP2A 2RUKB 3O96A 4CHMA 1W1GA 2YS3A 4GPTB 1MKEA 2W2WA 1V89A 1ZSQA 4KVGB 1MIZB 2D10A 3FM8C 4HDQA 3U8ZA 2AL6A 3KRWA 5HE1A 3SNHA 4DX90 3ODXA 4F7HA 4KAXB 4EMOA 2DKPA 3MPXA 3BJIA 1V5MA 2CY5A 2I5CA 1GC7A 1FHXA 1W1HA 1MK7B 5GOWB 2R09A 3DXDA 3PSCA 2ROZB 4HB3B 5LONB 4TYZA 2IFSA 5C79A 1BAKA 4Z2MB 3WA0A 1DDWA 2ELAA 1X86A 5D3WA 2X18A 2UZRA 4HAUB 4A6KA 2L1CA 2E2XA 1WI1A 5KQ1A 1UNPA 2MFQA 2CAYA 1KZGA 1NTYA 2H7EA 2DYNA 1ZVRA 2EC1A 2QKMA 1ZC4B 2GJYA 5D3YA 3M1IB 4GZUA 2COAA 3A8QA 1TJ6A 1W1DA 4Z2NA 2P0HA 4PNKA 2Y8FA 4EJNA 1UPRA 1XODA 2MWNB 1Z87A 3U7DA 1K5DB 4NSWA 3TO1A 1I7AA 3P7ZA 1V61A 2P0FA 2DA0A 1RJ2A 4WJ7A 5JHHA 4GMXB 2XQNM 2Z0PA 4K2PA 2RLOA 4A5KA 5C6RA 5D3XA 1KI1B 4A6FA 1MAIA 2D9YA 1SGHA 1U5FA 2LULA 2LG1A 4HATB 3V5WA 2GS0A 1OMWA 2COFA 3TVVA 3PVLA 5D27A 5C5BB 1FHOA 2EMTA 1KZ7A 2I5FA 2HE7A 1LW3A 3TCAA 1AWEA 2Z0OA 1MPHA 2DHKA 1PLSA 4MY6A 3KZ1A 3RCPA 4HHVA 2N23A 2DLWA 1QQGA 4PQ0A 2R0DA 4IAPA 2YVCA 2LOXA 2CODA 2K00A 2DX1A 2NMBA 1P3RA 2J0MA 4HDOA 3SYXA 3X23A 1OQNA 1NTVA 5EFXA 1U27A 1U29A 3PZDA 2G35A 5KCVA 3FSSA 2Y7BA 2UVMA 3A98B 4HAWB 1WG7A 3G9WA 3OANA 2K2JA 1Y19B 2W2XD 3ZVRA 2D9WA 4HB2B 4YONA 3FEHA 2MKRA 1DYNA 1WJMA 1UNRA 5DHFB 1ZC3B 4ZRJA 3AU4A 3CIKA 1OY2A 1DROA 1XR0B 4A6FB 3ULBA 4F7GA 2QKLA 2LKOA 3N7CA 5J3TA 2VRWB 4CHJA 2PZ1A 2KUPA 1TXDA 1XCGA 4P7IA 4K2OA 2YT0A 1V88A 2FJLA 1DDVA 5DH9B 2VSZA 2J0KA 2YRYA 2DN6A 3KRXA 3P6AA 1B55A 1MIXA 2H7DA 2L2IA 1DBHA 4HB4B 3MDBC 1J0WA 4DXAB 1N3HA 1UEFA 2DYQA 3PVUA 3KY9A 1U5DA 2UZSA 1RRPB 5FI1A 3T06A 2MDXA 2IYBA 2NZ8B 5CLQB 3PEGA 2VKIA 4WVFB 1GC6A 5C5BA 2KGXB 2I1KA 1U5GA 4L6EA 3AJ4A 2DHJA 5HE3A 2YSZA 3KSYA 3F0WA 1Q67A 2CY4A 5DIFB 2LYDA 4MK0A 1ISNA 4HAYB 1WGUA 3GYOA 1WJ1A 1NU2A 1J19A 4NY0A 1EVHA 4YL8A 2LOZA 4F7UP 4K81A 2ELBA 1M7RA 4B6HA 1UPQA 2D4QA 4CYEA 2W2XC 5JHGA 2RGNB 1XKEA 1XD4A 1X05A 4KHOA 2M14A 5D3VA 2DHIA 4H8SA 1BTKA 1PMSA 5CLLB 1E5WA 2JP2A 4HAXB 3F5RA 2P8VA 3D8DA 2ADZA 1FHWA 2D9VA 4TKNA 1FGZA 2OQBA 2COCA 3IVFA 4KHBB 3TW1A 5C16A 3PVWA 4GMVA 2J59M 2HTHB 4HB0B
chains in the Genus database with same CATH superfamily
3A8PA 1BWNA 1P5TA 3BINA 1V5UA 4HAZB 2N0YA 3SO6A 2YS5A 2Y8GA 4A6HA 3VIAA 1EF1A 2J0JA 5HE0A 2GCJA 1H4RA 4IOYX 4ZRIA 1UNQA 3D8FA 1U5EA 2YF0A 1AQCA 2AEHA 1BTNA 2FJUB 2RVBB 3CXBB 3DXCA 4C0AA 5DI9B 1QC6A 2D11A 3ODWA 2DFKA 3UZTA 5DHAB 1NI2A 1Y5OA 1H10A 2CRFA 4DX8A 5J3YA 5KQ4A 4KHAA 3DCXA 4ZRKA 2KCJA 1FGYA 3WYFB 3ODOA 3AU5A 4QJ5B 4Y94A 1ZM0A 1FAOA 3QBVB 3ML4A 2DTCA 3PG7A 1TQZA 3ULCA 1M7EA 2I1JA 2EJ8A 5L81A 1MK9B 4K17A 1WVHA 2KIGA 2Q13A 4D6WA 1SHCA 1X1GA 2YS1A 2ROVA 3NSUA 3ZDTA 1X11A 4GN1A 1PFJA 3LJUX 1FB8A 2M38A 1U2BA 2BCJA 3A58A 4EKUA 1XX0A 1I2HA 5FI0A 1IRSA 3QWMA 3D8EA 2K2UA 4XWXA 4DBBA 2D9XA 3SUZA 3HK0A 2RNRB 5LOPB 2V76A 3DXEA 2Z0QA 3HQCA 2DX5A 2EMSA 3SV1A 3TFMA 2D9ZA 2DKQA 4MT7A 1FOEA 2KR0A 5J3QA 4BBKA 1GG3A 1X1FA 4GXBA 1P6SA 1EAZA 3VOQA 4WSFA 4IFSA 2OTXA 5HE2A 3HW2B 4HSIA 4HAVB 5JP4A 1WGQA 1V5PA 2GCLA 2ZPYA 1DDMA 2D2QA 2RSGA 1LB1A 2K49A 3GYPA 3QIJA 2YT1A 1EGXA 5JLJB 4OT1A 4D0NB 2P0DA 1K5GB 3PP2A 2RUKB 3O96A 4CHMA 1W1GA 2YS3A 4GPTB 1MKEA 2W2WA 1V89A 1ZSQA 4KVGB 1MIZB 2D10A 3FM8C 4HDQA 3U8ZA 2AL6A 3KRWA 1ZYIA 5HE1A 3SNHA 4DX90 3ODXA 4F7HA 4KAXB 4EMOA 2DKPA 3MPXA 3BJIA 3OHMB 1V5MA 2CY5A 2I5CA 1GC7A 4OSNA 1FHXA 1W1HA 1MK7B 5GOWB 2R09A 3DXDA 3PSCA 4QJ3B 3NWFA 2ROZB 4HB3B 5LONB 4TYZA 2IFSA 5C79A 1BAKA 4Z2MB 3WA0A 1DDWA 2ELAA 1X86A 5D3WA 5LG4B 2X18A 2UZRA 4HAUB 4A6KA 2Z4DA 2L1CA 2E2XA 1WI1A 5KQ1A 1UNPA 5I2MA 2MFQA 2CAYA 1KZGA 1NTYA 2H7EA 2DYNA 1ZVRA 2EC1A 2QKMA 1ZC4B 2GJYA 5D3YA 3M1IB 4GZUA 2COAA 3A8QA 1TJ6A 1W1DA 4Z2NA 2P0HA 4PNKA 2Y8FA 4EJNA 1UPRA 3U12A 1XODA 2MWNB 3NW8A 1Z87A 3U7DA 1K5DB 4NSWA 3TO1A 1I7AA 3P7ZA 1V61A 2P0FA 2DA0A 1RJ2A 4WJ7A 5JHHA 4GMXB 3HIEA 2XQNM 2Z0PA 4K2PA 2RLOA 4GNKB 4A5KA 5C6RA 5D3XA 1KI1B 4A6FA 1MAIA 2D9YA 1SGHA 1U5FA 2LULA 2LG1A 4HATB 3V5WA 2GS0A 1OMWA 2YT2A 2COFA 3TVVA 3PVLA 5D27A 5C5BB 1FHOA 2EMTA 1KZ7A 2I5FA 2HE7A 1LW3A 3TCAA 1AWEA 2Z0OA 1MPHA 5IRSA 2NBVA 2DHKA 1PLSA 4MY6A 3KZ1A 3RCPA 4HHVA 2N23A 2DLWA 1QQGA 4PQ0A 2R0DA 4IAPA 2YVCA 2LOXA 2CODA 2K00A 2DX1A 2NMBA 1P3RA 2J0MA 4HDOA 3SYXA 3X23A 1OQNA 1NTVA 5EFXA 1U27A 1U29A 3PZDA 2G35A 2R2YA 5KCVA 3FSSA 2Y7BA 2UVMA 3A98B 5M4YB 4HAWB 1WG7A 3G9WA 1MI1A 3OANA 2K2JA 1Y19B 2Z59A 2W2XD 3ZVRA 2D9WA 4HB2B 4YONA 3FEHA 2MKRA 1DYNA 1WJMA 1UNRA 5DHFB 1ZC3B 3B77A 4ZRJA 3AU4A 4GOUA 3CIKA 1OY2A 1DROA 1XR0B 4A6FB 3NWDA 3ULBA 2QKLA 2LKOA 3N7CA 4F7GA 5J3TA 2VRWB 4CHJA 2PZ1A 2KUPA 1TXDA 1XCGA 4P7IA 4DIXA 3FVCA 4K2OA 4QXAB 2YT0A 1V88A 2FJLA 1DDVA 5DH9B 2VSZA 2J0KA 2YRYA 2DN6A 3KRXA 3P6AA 1B55A 1MIXA 2H7DA 2L2IA 1DBHA 4HB4B 3MDBC 2K8EA 1J0WA 4DXAB 1N3HA 3NWAA 1UEFA 2DYQA 3PVUA 3KY9A 1U5DA 2UZSA 1RRPB 5FI1A 3T06A 4CSQA 2MDXA 5I2SA 2IYBA 2NZ8B 5CLQB 3PEGA 2VKIA 4WVFB 1GC6A 5C5BA 2KGXB 2I1KA 1U5GA 4L6EA 3AJ4A 2DHJA 5HE3A 2YSZA 3KSYA 3F0WA 1Q67A 2CY4A 5DIFB 2LYDA 4KHBA 4MK0A 1ISNA 2GUMA 4HAYB 1WGUA 3GYOA 1WJ1A 1NU2A 1J19A 4NY0A 3HSAA 1EVHA 4YL8A 2LOZA 4F7UP 4K81A 2ELBA 1M7RA 4B6HA 1UPQA 2D4QA 4CYEA 2ZKMX 2W2XC 5JHGA 2RGNB 1XKEA 1XD4A 1X05A 4KHOA 2M14A 5D3VA 2DHIA 2RRFA 4H8SA 1BTKA 2Z14A 1PMSA 5CLLB 2KIEA 1E5WA 2JP2A 4HAXB 4QJ4B 3F5RA 2P8VA 2Z13A 3D8DA 2ADZA 1FHWA 2D9VA 4TKNA 1FGZA 2OQBA 2COCA 3IVFA 4KHBB 3TW1A 5C16A 1T77A 3PVWA 2KUQA 4GMVA 4L1RA 2J59M 2HTHB 4HB0B
chains in the Genus database with same CATH topology
3A8PA 1BWNA 1P5TA 3BINA 1V5UA 4HAZB 2N0YA 3SO6A 2YS5A 2Y8GA 4A6HA 3VIAA 1EF1A 2J0JA 5HE0A 2GCJA 1H4RA 4IOYX 4ZRIA 1UNQA 3D8FA 1U5EA 2YF0A 1AQCA 2AEHA 1BTNA 2RVBB 2FJUB 3CXBB 3DXCA 4C0AA 5DI9B 1QC6A 2D11A 3ODWA 2DFKA 3UZTA 5DHAB 1NI2A 1Y5OA 1H10A 2CRFA 4DX8A 5J3YA 5KQ4A 4KHAA 4ZRKA 2KCJA 1FGYA 3WYFB 3ODOA 3AU5A 4QJ5B 4Y94A 1ZM0A 1FAOA 3QBVB 3ML4A 2DTCA 3PG7A 1TQZA 3ULCA 1M7EA 2I1JA 2EJ8A 5L81A 1MK9B 4K17A 1WVHA 2Q13A 2KIGA 4D6WA 1SHCA 1X1GA 2YS1A 2ROVA 3NSUA 3ZDTA 1X11A 4GN1A 1PFJA 3LJUX 1FB8A 2M38A 1U2BA 2BCJA 3A58A 4EKUA 1XX0A 1I2HA 5FI0A 1IRSA 3QWMA 3D8EA 2K2UA 4XWXA 4DBBA 2D9XA 3SUZA 3HK0A 2RNRB 5LOPB 2V76A 3DXEA 2Z0QA 3HQCA 2DX5A 2EMSA 3SV1A 3TFMA 2D9ZA 2DKQA 4MT7A 1FOEA 2KR0A 5J3QA 4BBKA 1GG3A 1X1FA 4GXBA 1P6SA 1EAZA 3VOQA 4WSFA 4IFSA 2OTXA 5HE2A 3HW2B 4HSIA 4HAVB 5JP4A 1WGQA 1V5PA 2GCLA 2ZPYA 1DDMA 2D2QA 2RSGA 1LB1A 2K49A 3GYPA 3QIJA 2YT1A 1EGXA 5JLJB 4OT1A 4D0NB 2P0DA 1K5GB 3PP2A 2RUKB 3O96A 4CHMA 1W1GA 2YS3A 4GPTB 1MKEA 2W2WA 1V89A 1ZSQA 4KVGB 1MIZB 2D10A 3FM8C 4HDQA 3U8ZA 2AL6A 3KRWA 1ZYIA 5HE1A 3SNHA 4DX90 3ODXA 4F7HA 4KAXB 4EMOA 2DKPA 3MPXA 3BJIA 3OHMB 1V5MA 2CY5A 2I5CA 1GC7A 4OSNA 1FHXA 1W1HA 1MK7B 5GOWB 2R09A 3DXDA 3PSCA 4QJ3B 3NWFA 2ROZB 4HB3B 5LONB 4TYZA 2IFSA 5C79A 1BAKA 4Z2MB 3WA0A 1DDWA 2ELAA 1X86A 5D3WA 5LG4B 2X18A 2UZRA 4HAUB 4A6KA 2Z4DA 2L1CA 2E2XA 1WI1A 5KQ1A 1UNPA 5I2MA 2MFQA 2CAYA 1KZGA 1NTYA 2H7EA 2DYNA 1ZVRA 2EC1A 2QKMA 1ZC4B 2GJYA 5D3YA 3M1IB 4GZUA 2COAA 3A8QA 1TJ6A 1W1DA 4Z2NA 2P0HA 4PNKA 2Y8FA 4EJNA 1UPRA 3U12A 1XODA 2MWNB 3NW8A 1Z87A 3U7DA 1K5DB 4NSWA 3TO1A 1I7AA 3P7ZA 1V61A 2P0FA 2DA0A 1RJ2A 4WJ7A 5JHHA 4GMXB 3HIEA 2XQNM 2Z0PA 4K2PA 2RLOA 4A5KA 4GNKB 5C6RA 5D3XA 1KI1B 4A6FA 1MAIA 2D9YA 1SGHA 1U5FA 2LULA 2LG1A 4HATB 3V5WA 2GS0A 1OMWA 2YT2A 2COFA 3TVVA 3PVLA 5D27A 5C5BB 1FHOA 2EMTA 1KZ7A 2I5FA 2HE7A 1LW3A 3TCAA 1AWEA 2Z0OA 1MPHA 5IRSA 2NBVA 2DHKA 1PLSA 4MY6A 3KZ1A 3RCPA 4HHVA 2N23A 2DLWA 1QQGA 4PQ0A 2R0DA 4IAPA 2YVCA 2LOXA 2CODA 2K00A 2DX1A 2NMBA 1P3RA 2J0MA 4HDOA 3SYXA 3X23A 1OQNA 1NTVA 5EFXA 1U27A 1U29A 3PZDA 2G35A 2R2YA 5KCVA 3FSSA 2Y7BA 2UVMA 3A98B 5M4YB 4HAWB 1WG7A 3G9WA 3OANA 2K2JA 1Y19B 2Z59A 2W2XD 3ZVRA 2D9WA 4HB2B 4YONA 3FEHA 2MKRA 1DYNA 1WJMA 1UNRA 5DHFB 1ZC3B 4ZRJA 3AU4A 4GOUA 3CIKA 1OY2A 1DROA 1XR0B 4A6FB 3ULBA 4F7GA 2QKLA 2LKOA 3N7CA 3NWDA 5J3TA 2VRWB 4CHJA 2PZ1A 2KUPA 1TXDA 1XCGA 4P7IA 4DIXA 3FVCA 4K2OA 4QXAB 2YT0A 1V88A 2FJLA 1DDVA 5DH9B 2VSZA 2J0KA 2YRYA 2DN6A 3KRXA 3P6AA 1B55A 1MIXA 2H7DA 2L2IA 1DBHA 4HB4B 3MDBC 2K8EA 1J0WA 4DXAB 1N3HA 3NWAA 1UEFA 2DYQA 3PVUA 3KY9A 1U5DA 2UZSA 1RRPB 5FI1A 3T06A 4CSQA 2MDXA 5I2SA 2IYBA 2NZ8B 5CLQB 3PEGA 2VKIA 4WVFB 1GC6A 5C5BA 2KGXB 2I1KA 1U5GA 4L6EA 3AJ4A 2DHJA 5HE3A 2YSZA 3KSYA 3F0WA 1Q67A 2CY4A 5DIFB 2LYDA 4KHBA 4MK0A 1ISNA 4HAYB 2GUMA 1WGUA 3GYOA 1WJ1A 1NU2A 1J19A 4NY0A 1EVHA 4YL8A 2LOZA 4F7UP 4K81A 2ELBA 1M7RA 4B6HA 1UPQA 2D4QA 4CYEA 2ZKMX 2W2XC 5JHGA 2RGNB 1XKEA 1XD4A 1X05A 4KHOA 2M14A 5D3VA 2DHIA 2RRFA 4H8SA 1BTKA 2Z14A 1PMSA 5CLLB 2KIEA 1E5WA 2JP2A 4HAXB 4QJ4B 3F5RA 2P8VA 2Z13A 3D8DA 2ADZA 1FHWA 2D9VA 4TKNA 1FGZA 2OQBA 2COCA 3IVFA 4KHBB 3TW1A 5C16A 3PVWA 4GMVA 2KUQA 4L1RA 2J59M 2HTHB 4HB0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8P A;  1BWN A;  1P5T A;  3BIN A;  1V5U A;  4HAZ B;  2N0Y A;  3SO6 A;  2YS5 A;  2Y8G A;  4A6H A;  3VIA A;  1EF1 A;  2J0J A;  5HE0 A;  2GCJ A;  1H4R A;  4IOY X;  4ZRI A;  1UNQ A;  3D8F A;  1U5E A;  2YF0 A;  1AQC A;  2AEH A;  1BTN A;  2RVB B;  3CXB B;  3DXC A;  4C0A A;  5DI9 B;  1QC6 A;  2D11 A;  3ODW A;  2DFK A;  3UZT A;  5DHA B;  1NI2 A;  1Y5O A;  1H10 A;  2CRF A;  4DX8 A;  5J3Y A;  5KQ4 A;  4KHA A;  4ZRK A;  2KCJ A;  1FGY A;  3WYF B;  3ODO A;  3AU5 A;  4Y94 A;  1ZM0 A;  1FAO A;  3QBV B;  3ML4 A;  2DTC A;  3PG7 A;  1TQZ A;  3ULC A;  1M7E A;  2I1J A;  2EJ8 A;  5L81 A;  1MK9 B;  4K17 A;  1WVH A;  2Q13 A;  1SHC A;  1X1G A;  2YS1 A;  2ROV A;  3NSU A;  3ZDT A;  1X11 A;  4GN1 A;  1PFJ A;  3LJU X;  1FB8 A;  2M38 A;  1U2B A;  2BCJ A;  4EKU A;  1XX0 A;  1I2H A;  5FI0 A;  1IRS A;  3QWM A;  3D8E A;  2K2U A;  4XWX A;  4DBB A;  2D9X A;  3SUZ A;  3HK0 A;  2RNR B;  5LOP B;  2V76 A;  3DXE A;  2Z0Q A;  3HQC A;  2DX5 A;  2EMS A;  3SV1 A;  3TFM A;  2D9Z A;  2DKQ A;  4MT7 A;  1FOE A;  5J3Q A;  4BBK A;  1GG3 A;  1X1F A;  4GXB A;  1P6S A;  1EAZ A;  3VOQ A;  4WSF A;  4IFS A;  2OTX A;  5HE2 A;  3HW2 B;  4HAV B;  5JP4 A;  1WGQ A;  1V5P A;  2GCL A;  2ZPY A;  1DDM A;  2D2Q A;  2RSG A;  1LB1 A;  3GYP A;  3QIJ A;  2YT1 A;  1EGX A;  5JLJ B;  4D0N B;  2P0D A;  1K5G B;  3PP2 A;  2RUK B;  3O96 A;  4CHM A;  1W1G A;  2YS3 A;  4GPT B;  1MKE A;  2W2W A;  1V89 A;  1ZSQ A;  4KVG B;  1MIZ B;  2D10 A;  3FM8 C;  4HDQ A;  3U8Z A;  2AL6 A;  3KRW A;  5HE1 A;  3SNH A;  4DX9 0;  3ODX A;  4F7H A;  4KAX B;  4EMO A;  2DKP A;  3MPX A;  3BJI A;  1V5M A;  2CY5 A;  2I5C A;  1GC7 A;  1FHX A;  1W1H A;  1MK7 B;  5GOW B;  2R09 A;  3DXD A;  3PSC A;  2ROZ B;  4HB3 B;  5LON B;  4TYZ A;  2IFS A;  5C79 A;  1BAK A;  4Z2M B;  3WA0 A;  1DDW A;  2ELA A;  1X86 A;  5D3W A;  2X18 A;  2UZR A;  4HAU B;  4A6K A;  2L1C A;  2E2X A;  1WI1 A;  5KQ1 A;  1UNP A;  2MFQ A;  2CAY A;  1KZG A;  1NTY A;  2H7E A;  2DYN A;  1ZVR A;  2EC1 A;  2QKM A;  1ZC4 B;  2GJY A;  5D3Y A;  3M1I B;  4GZU A;  2COA A;  3A8Q A;  1TJ6 A;  1W1D A;  4Z2N A;  2P0H A;  4PNK A;  2Y8F A;  4EJN A;  1UPR A;  1XOD A;  2MWN B;  1Z87 A;  3U7D A;  1K5D B;  4NSW A;  3TO1 A;  1I7A A;  3P7Z A;  1V61 A;  2P0F A;  2DA0 A;  1RJ2 A;  4WJ7 A;  5JHH A;  4GMX B;  2XQN M;  2Z0P A;  4K2P A;  2RLO A;  4A5K A;  5C6R A;  5D3X A;  1KI1 B;  4A6F A;  1MAI A;  2D9Y A;  1SGH A;  1U5F A;  2LUL A;  2LG1 A;  4HAT B;  3V5W A;  2GS0 A;  1OMW A;  2COF A;  3TVV A;  3PVL A;  5D27 A;  5C5B B;  1FHO A;  2EMT A;  1KZ7 A;  2I5F A;  2HE7 A;  1LW3 A;  3TCA A;  1AWE A;  2Z0O A;  1MPH A;  2DHK A;  1PLS A;  4MY6 A;  3KZ1 A;  3RCP A;  4HHV A;  2N23 A;  2DLW A;  1QQG A;  4PQ0 A;  2R0D A;  4IAP A;  2YVC A;  2LOX A;  2COD A;  2K00 A;  2DX1 A;  2NMB A;  1P3R A;  2J0M A;  4HDO A;  3SYX A;  3X23 A;  1OQN A;  1NTV A;  5EFX A;  1U27 A;  1U29 A;  3PZD A;  2G35 A;  5KCV A;  3FSS A;  2Y7B A;  2UVM A;  3A98 B;  4HAW B;  1WG7 A;  3G9W A;  3OAN A;  2K2J A;  1Y19 B;  2W2X D;  3ZVR A;  2D9W A;  4HB2 B;  4YON A;  3FEH A;  2MKR A;  1DYN A;  1WJM A;  1UNR A;  5DHF B;  1ZC3 B;  4ZRJ A;  3AU4 A;  3CIK A;  1OY2 A;  1DRO A;  1XR0 B;  4A6F B;  3ULB A;  4F7G A;  2QKL A;  2LKO A;  3N7C A;  5J3T A;  2VRW B;  4CHJ A;  2PZ1 A;  2KUP A;  1TXD A;  1XCG A;  4P7I A;  4K2O A;  2YT0 A;  1V88 A;  2FJL A;  1DDV A;  5DH9 B;  2VSZ A;  2J0K A;  2YRY A;  2DN6 A;  3KRX A;  3P6A A;  1B55 A;  1MIX A;  2H7D A;  2L2I A;  1DBH A;  4HB4 B;  3MDB C;  1J0W A;  4DXA B;  1N3H A;  1UEF A;  2DYQ A;  3PVU A;  3KY9 A;  1U5D A;  2UZS A;  1RRP B;  5FI1 A;  3T06 A;  2MDX A;  2IYB A;  2NZ8 B;  5CLQ B;  3PEG A;  2VKI A;  4WVF B;  1GC6 A;  5C5B A;  2KGX B;  2I1K A;  1U5G A;  4L6E A;  3AJ4 A;  2DHJ A;  5HE3 A;  2YSZ A;  3KSY A;  3F0W A;  1Q67 A;  2CY4 A;  5DIF B;  2LYD A;  4MK0 A;  1ISN A;  4HAY B;  1WGU A;  3GYO A;  1WJ1 A;  1NU2 A;  1J19 A;  4NY0 A;  1EVH A;  4YL8 A;  2LOZ A;  4F7U P;  4K81 A;  2ELB A;  1M7R A;  4B6H A;  1UPQ A;  2D4Q A;  4CYE A;  2W2X C;  5JHG A;  2RGN B;  1XKE A;  1XD4 A;  1X05 A;  4KHO A;  2M14 A;  5D3V A;  2DHI A;  4H8S A;  1BTK A;  1PMS A;  5CLL B;  1E5W A;  2JP2 A;  4HAX B;  3F5R A;  2P8V A;  3D8D A;  2ADZ A;  1FHW A;  2D9V A;  4TKN A;  1FGZ A;  2OQB A;  2COC A;  3IVF A;  4KHB B;  3TW1 A;  5C16 A;  3PVW A;  4GMV A;  2J59 M;  2HTH B;  4HB0 B; 
#chains in the Genus database with same CATH topology
 3A8P A;  1BWN A;  1P5T A;  3BIN A;  1V5U A;  4HAZ B;  2N0Y A;  3SO6 A;  2YS5 A;  2Y8G A;  4A6H A;  3VIA A;  1EF1 A;  2J0J A;  5HE0 A;  2GCJ A;  1H4R A;  4IOY X;  4ZRI A;  1UNQ A;  3D8F A;  1U5E A;  2YF0 A;  1AQC A;  2AEH A;  1BTN A;  2FJU B;  2RVB B;  3CXB B;  3DXC A;  4C0A A;  5DI9 B;  1QC6 A;  2D11 A;  3ODW A;  2DFK A;  3UZT A;  5DHA B;  1NI2 A;  1Y5O A;  1H10 A;  2CRF A;  4DX8 A;  5J3Y A;  5KQ4 A;  4KHA A;  3DCX A;  4ZRK A;  2KCJ A;  1FGY A;  3WYF B;  3ODO A;  3AU5 A;  4QJ5 B;  4Y94 A;  1ZM0 A;  1FAO A;  3QBV B;  3ML4 A;  2DTC A;  3PG7 A;  1TQZ A;  3ULC A;  1M7E A;  2I1J A;  2EJ8 A;  5L81 A;  1MK9 B;  4K17 A;  1WVH A;  2KIG A;  2Q13 A;  4D6W A;  1SHC A;  1X1G A;  2YS1 A;  2ROV A;  3NSU A;  3ZDT A;  1X11 A;  4GN1 A;  1PFJ A;  3LJU X;  1FB8 A;  2M38 A;  1U2B A;  2BCJ A;  3A58 A;  4EKU A;  1XX0 A;  1I2H A;  5FI0 A;  1IRS A;  3QWM A;  3D8E A;  2K2U A;  4XWX A;  4DBB A;  2D9X A;  3SUZ A;  3HK0 A;  2RNR B;  5LOP B;  2V76 A;  3DXE A;  2Z0Q A;  3HQC A;  2DX5 A;  2EMS A;  3SV1 A;  3TFM A;  2D9Z A;  2DKQ A;  4MT7 A;  1FOE A;  2KR0 A;  5J3Q A;  4BBK A;  1GG3 A;  1X1F A;  4GXB A;  1P6S A;  1EAZ A;  3VOQ A;  4WSF A;  4IFS A;  2OTX A;  5HE2 A;  3HW2 B;  4HSI A;  4HAV B;  5JP4 A;  1WGQ A;  1V5P A;  2GCL A;  2ZPY A;  1DDM A;  2D2Q A;  2RSG A;  1LB1 A;  2K49 A;  3GYP A;  3QIJ A;  2YT1 A;  1EGX A;  5JLJ B;  4OT1 A;  4D0N B;  2P0D A;  1K5G B;  3PP2 A;  2RUK B;  3O96 A;  4CHM A;  1W1G A;  2YS3 A;  4GPT B;  1MKE A;  2W2W A;  1V89 A;  1ZSQ A;  4KVG B;  1MIZ B;  2D10 A;  3FM8 C;  4HDQ A;  3U8Z A;  2AL6 A;  3KRW A;  1ZYI A;  5HE1 A;  3SNH A;  4DX9 0;  3ODX A;  4F7H A;  4KAX B;  4EMO A;  2DKP A;  3MPX A;  3BJI A;  3OHM B;  1V5M A;  2CY5 A;  2I5C A;  1GC7 A;  4OSN A;  1FHX A;  1W1H A;  1MK7 B;  5GOW B;  2R09 A;  3DXD A;  3PSC A;  4QJ3 B;  3NWF A;  2ROZ B;  4HB3 B;  5LON B;  4TYZ A;  2IFS A;  5C79 A;  1BAK A;  4Z2M B;  3WA0 A;  1DDW A;  2ELA A;  1X86 A;  5D3W A;  5LG4 B;  2X18 A;  2UZR A;  4HAU B;  4A6K A;  2Z4D A;  2L1C A;  2E2X A;  1WI1 A;  5KQ1 A;  1UNP A;  5I2M A;  2MFQ A;  2CAY A;  1KZG A;  1NTY A;  2H7E A;  2DYN A;  1ZVR A;  2EC1 A;  2QKM A;  1ZC4 B;  2GJY A;  5D3Y A;  3M1I B;  4GZU A;  2COA A;  3A8Q A;  1TJ6 A;  1W1D A;  4Z2N A;  2P0H A;  4PNK A;  2Y8F A;  4EJN A;  1UPR A;  3U12 A;  1XOD A;  2MWN B;  3NW8 A;  1Z87 A;  3U7D A;  1K5D B;  4NSW A;  3TO1 A;  1I7A A;  3P7Z A;  1V61 A;  2P0F A;  2DA0 A;  1RJ2 A;  4WJ7 A;  5JHH A;  4GMX B;  3HIE A;  2XQN M;  2Z0P A;  4K2P A;  2RLO A;  4GNK B;  4A5K A;  5C6R A;  5D3X A;  1KI1 B;  4A6F A;  1MAI A;  2D9Y A;  1SGH A;  1U5F A;  2LUL A;  2LG1 A;  4HAT B;  3V5W A;  2GS0 A;  1OMW A;  2YT2 A;  2COF A;  3TVV A;  3PVL A;  5D27 A;  5C5B B;  1FHO A;  2EMT A;  1KZ7 A;  2I5F A;  2HE7 A;  1LW3 A;  3TCA A;  1AWE A;  2Z0O A;  1MPH A;  5IRS A;  2NBV A;  2DHK A;  1PLS A;  4MY6 A;  3KZ1 A;  3RCP A;  4HHV A;  2N23 A;  2DLW A;  1QQG A;  4PQ0 A;  2R0D A;  4IAP A;  2YVC A;  2LOX A;  2COD A;  2K00 A;  2DX1 A;  2NMB A;  1P3R A;  2J0M A;  4HDO A;  3SYX A;  3X23 A;  1OQN A;  1NTV A;  5EFX A;  1U27 A;  1U29 A;  3PZD A;  2G35 A;  2R2Y A;  5KCV A;  3FSS A;  2Y7B A;  2UVM A;  3A98 B;  5M4Y B;  4HAW B;  1WG7 A;  3G9W A;  1MI1 A;  3OAN A;  2K2J A;  1Y19 B;  2Z59 A;  2W2X D;  3ZVR A;  2D9W A;  4HB2 B;  4YON A;  3FEH A;  2MKR A;  1DYN A;  1WJM A;  1UNR A;  5DHF B;  1ZC3 B;  3B77 A;  4ZRJ A;  3AU4 A;  4GOU A;  3CIK A;  1OY2 A;  1DRO A;  1XR0 B;  4A6F B;  3NWD A;  3ULB A;  2QKL A;  2LKO A;  3N7C A;  4F7G A;  5J3T A;  2VRW B;  4CHJ A;  2PZ1 A;  2KUP A;  1TXD A;  1XCG A;  4P7I A;  4DIX A;  3FVC A;  4K2O A;  4QXA B;  2YT0 A;  1V88 A;  2FJL A;  1DDV A;  5DH9 B;  2VSZ A;  2J0K A;  2YRY A;  2DN6 A;  3KRX A;  3P6A A;  1B55 A;  1MIX A;  2H7D A;  2L2I A;  1DBH A;  4HB4 B;  3MDB C;  2K8E A;  1J0W A;  4DXA B;  1N3H A;  3NWA A;  1UEF A;  2DYQ A;  3PVU A;  3KY9 A;  1U5D A;  2UZS A;  1RRP B;  5FI1 A;  3T06 A;  4CSQ A;  2MDX A;  5I2S A;  2IYB A;  2NZ8 B;  5CLQ B;  3PEG A;  2VKI A;  4WVF B;  1GC6 A;  5C5B A;  2KGX B;  2I1K A;  1U5G A;  4L6E A;  3AJ4 A;  2DHJ A;  5HE3 A;  2YSZ A;  3KSY A;  3F0W A;  1Q67 A;  2CY4 A;  5DIF B;  2LYD A;  4KHB A;  4MK0 A;  1ISN A;  2GUM A;  4HAY B;  1WGU A;  3GYO A;  1WJ1 A;  1NU2 A;  1J19 A;  4NY0 A;  3HSA A;  1EVH A;  4YL8 A;  2LOZ A;  4F7U P;  4K81 A;  2ELB A;  1M7R A;  4B6H A;  1UPQ A;  2D4Q A;  4CYE A;  2ZKM X;  2W2X C;  5JHG A;  2RGN B;  1XKE A;  1XD4 A;  1X05 A;  4KHO A;  2M14 A;  5D3V A;  2DHI A;  2RRF A;  4H8S A;  1BTK A;  2Z14 A;  1PMS A;  5CLL B;  2KIE A;  1E5W A;  2JP2 A;  4HAX B;  4QJ4 B;  3F5R A;  2P8V A;  2Z13 A;  3D8D A;  2ADZ A;  1FHW A;  2D9V A;  4TKN A;  1FGZ A;  2OQB A;  2COC A;  3IVF A;  4KHB B;  3TW1 A;  5C16 A;  1T77 A;  3PVW A;  2KUQ A;  4GMV A;  4L1R A;  2J59 M;  2HTH B;  4HB0 B; 
#chains in the Genus database with same CATH homology
 3A8P A;  1BWN A;  1P5T A;  3BIN A;  1V5U A;  4HAZ B;  2N0Y A;  3SO6 A;  2YS5 A;  2Y8G A;  4A6H A;  3VIA A;  1EF1 A;  2J0J A;  5HE0 A;  2GCJ A;  1H4R A;  4IOY X;  4ZRI A;  1UNQ A;  3D8F A;  1U5E A;  2YF0 A;  1AQC A;  2AEH A;  1BTN A;  2RVB B;  2FJU B;  3CXB B;  3DXC A;  4C0A A;  5DI9 B;  1QC6 A;  2D11 A;  3ODW A;  2DFK A;  3UZT A;  5DHA B;  1NI2 A;  1Y5O A;  1H10 A;  2CRF A;  4DX8 A;  5J3Y A;  5KQ4 A;  4KHA A;  4ZRK A;  2KCJ A;  1FGY A;  3WYF B;  3ODO A;  3AU5 A;  4QJ5 B;  4Y94 A;  1ZM0 A;  1FAO A;  3QBV B;  3ML4 A;  2DTC A;  3PG7 A;  1TQZ A;  3ULC A;  1M7E A;  2I1J A;  2EJ8 A;  5L81 A;  1MK9 B;  4K17 A;  1WVH A;  2Q13 A;  2KIG A;  4D6W A;  1SHC A;  1X1G A;  2YS1 A;  2ROV A;  3NSU A;  3ZDT A;  1X11 A;  4GN1 A;  1PFJ A;  3LJU X;  1FB8 A;  2M38 A;  1U2B A;  2BCJ A;  3A58 A;  4EKU A;  1XX0 A;  1I2H A;  5FI0 A;  1IRS A;  3QWM A;  3D8E A;  2K2U A;  4XWX A;  4DBB A;  2D9X A;  3SUZ A;  3HK0 A;  2RNR B;  5LOP B;  2V76 A;  3DXE A;  2Z0Q A;  3HQC A;  2DX5 A;  2EMS A;  3SV1 A;  3TFM A;  2D9Z A;  2DKQ A;  4MT7 A;  1FOE A;  2KR0 A;  5J3Q A;  4BBK A;  1GG3 A;  1X1F A;  4GXB A;  1P6S A;  1EAZ A;  3VOQ A;  4WSF A;  4IFS A;  2OTX A;  5HE2 A;  3HW2 B;  4HSI A;  4HAV B;  5JP4 A;  1WGQ A;  1V5P A;  2GCL A;  2ZPY A;  1DDM A;  2D2Q A;  2RSG A;  1LB1 A;  2K49 A;  3GYP A;  3QIJ A;  2YT1 A;  1EGX A;  5JLJ B;  4OT1 A;  4D0N B;  2P0D A;  1K5G B;  3PP2 A;  2RUK B;  3O96 A;  4CHM A;  1W1G A;  2YS3 A;  4GPT B;  1MKE A;  2W2W A;  1V89 A;  1ZSQ A;  4KVG B;  1MIZ B;  2D10 A;  3FM8 C;  4HDQ A;  3U8Z A;  2AL6 A;  3KRW A;  1ZYI A;  5HE1 A;  3SNH A;  4DX9 0;  3ODX A;  4F7H A;  4KAX B;  4EMO A;  2DKP A;  3MPX A;  3BJI A;  3OHM B;  1V5M A;  2CY5 A;  2I5C A;  1GC7 A;  4OSN A;  1FHX A;  1W1H A;  1MK7 B;  5GOW B;  2R09 A;  3DXD A;  3PSC A;  4QJ3 B;  3NWF A;  2ROZ B;  4HB3 B;  5LON B;  4TYZ A;  2IFS A;  5C79 A;  1BAK A;  4Z2M B;  3WA0 A;  1DDW A;  2ELA A;  1X86 A;  5D3W A;  5LG4 B;  2X18 A;  2UZR A;  4HAU B;  4A6K A;  2Z4D A;  2L1C A;  2E2X A;  1WI1 A;  5KQ1 A;  1UNP A;  5I2M A;  2MFQ A;  2CAY A;  1KZG A;  1NTY A;  2H7E A;  2DYN A;  1ZVR A;  2EC1 A;  2QKM A;  1ZC4 B;  2GJY A;  5D3Y A;  3M1I B;  4GZU A;  2COA A;  3A8Q A;  1TJ6 A;  1W1D A;  4Z2N A;  2P0H A;  4PNK A;  2Y8F A;  4EJN A;  1UPR A;  3U12 A;  1XOD A;  2MWN B;  3NW8 A;  1Z87 A;  3U7D A;  1K5D B;  4NSW A;  3TO1 A;  1I7A A;  3P7Z A;  1V61 A;  2P0F A;  2DA0 A;  1RJ2 A;  4WJ7 A;  5JHH A;  4GMX B;  3HIE A;  2XQN M;  2Z0P A;  4K2P A;  2RLO A;  4A5K A;  4GNK B;  5C6R A;  5D3X A;  1KI1 B;  4A6F A;  1MAI A;  2D9Y A;  1SGH A;  1U5F A;  2LUL A;  2LG1 A;  4HAT B;  3V5W A;  2GS0 A;  1OMW A;  2YT2 A;  2COF A;  3TVV A;  3PVL A;  5D27 A;  5C5B B;  1FHO A;  2EMT A;  1KZ7 A;  2I5F A;  2HE7 A;  1LW3 A;  3TCA A;  1AWE A;  2Z0O A;  1MPH A;  5IRS A;  2NBV A;  2DHK A;  1PLS A;  4MY6 A;  3KZ1 A;  3RCP A;  4HHV A;  2N23 A;  2DLW A;  1QQG A;  4PQ0 A;  2R0D A;  4IAP A;  2YVC A;  2LOX A;  2COD A;  2K00 A;  2DX1 A;  2NMB A;  1P3R A;  2J0M A;  4HDO A;  3SYX A;  3X23 A;  1OQN A;  1NTV A;  5EFX A;  1U27 A;  1U29 A;  3PZD A;  2G35 A;  2R2Y A;  5KCV A;  3FSS A;  2Y7B A;  2UVM A;  3A98 B;  5M4Y B;  4HAW B;  1WG7 A;  3G9W A;  3OAN A;  2K2J A;  1Y19 B;  2Z59 A;  2W2X D;  3ZVR A;  2D9W A;  4HB2 B;  4YON A;  3FEH A;  2MKR A;  1DYN A;  1WJM A;  1UNR A;  5DHF B;  1ZC3 B;  4ZRJ A;  3AU4 A;  4GOU A;  3CIK A;  1OY2 A;  1DRO A;  1XR0 B;  4A6F B;  3ULB A;  4F7G A;  2QKL A;  2LKO A;  3N7C A;  3NWD A;  5J3T A;  2VRW B;  4CHJ A;  2PZ1 A;  2KUP A;  1TXD A;  1XCG A;  4P7I A;  4DIX A;  3FVC A;  4K2O A;  4QXA B;  2YT0 A;  1V88 A;  2FJL A;  1DDV A;  5DH9 B;  2VSZ A;  2J0K A;  2YRY A;  2DN6 A;  3KRX A;  3P6A A;  1B55 A;  1MIX A;  2H7D A;  2L2I A;  1DBH A;  4HB4 B;  3MDB C;  2K8E A;  1J0W A;  4DXA B;  1N3H A;  3NWA A;  1UEF A;  2DYQ A;  3PVU A;  3KY9 A;  1U5D A;  2UZS A;  1RRP B;  5FI1 A;  3T06 A;  4CSQ A;  2MDX A;  5I2S A;  2IYB A;  2NZ8 B;  5CLQ B;  3PEG A;  2VKI A;  4WVF B;  1GC6 A;  5C5B A;  2KGX B;  2I1K A;  1U5G A;  4L6E A;  3AJ4 A;  2DHJ A;  5HE3 A;  2YSZ A;  3KSY A;  3F0W A;  1Q67 A;  2CY4 A;  5DIF B;  2LYD A;  4KHB A;  4MK0 A;  1ISN A;  4HAY B;  2GUM A;  1WGU A;  3GYO A;  1WJ1 A;  1NU2 A;  1J19 A;  4NY0 A;  1EVH A;  4YL8 A;  2LOZ A;  4F7U P;  4K81 A;  2ELB A;  1M7R A;  4B6H A;  1UPQ A;  2D4Q A;  4CYE A;  2ZKM X;  2W2X C;  5JHG A;  2RGN B;  1XKE A;  1XD4 A;  1X05 A;  4KHO A;  2M14 A;  5D3V A;  2DHI A;  2RRF A;  4H8S A;  1BTK A;  2Z14 A;  1PMS A;  5CLL B;  2KIE A;  1E5W A;  2JP2 A;  4HAX B;  4QJ4 B;  3F5R A;  2P8V A;  2Z13 A;  3D8D A;  2ADZ A;  1FHW A;  2D9V A;  4TKN A;  1FGZ A;  2OQB A;  2COC A;  3IVF A;  4KHB B;  3TW1 A;  5C16 A;  3PVW A;  4GMV A;  2KUQ A;  4L1R A;  2J59 M;  2HTH B;  4HB0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...