4PQ8A

Crystal structure of engineered protein, northeast structural genomics consortium target or465
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
241
Chain Sequence
HTITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQGVFEKLTNLTTLNLSNNQLTSLPQGVFERLASLTTLNLSNNQLTSLPQGVFERLTNLTTLNLSNNQLTSLPQGVFERLTNLTTLNLSNNQLTSLPQGVFERLTSLTTLNLSNNQLTSLPQGVFERLTNLKTLNLSNNQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DESIGNED PROTEIN OR465
publication title Crystal Structure of Engineered Protein OR465.
rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 87
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2014-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4pq8A00
2OMWA 1K5GC 3G3AA 5LFNA 5B4PA 2Z62A 1XWDC 5A5CA 2Z63A 1ZIWA 4PKIG 4LXRA 5CMNA 4CILA 4FMZA 4CC4A 4Z64C 1XECA 5GS2B 3UL7A 4L3FA 1O6SA 2XOTA 4Z79A 1U0ND 3P72A 3RJ0A 4C2AB 2OMVA 3W3MA 1K5DC 3UL9A 5AWCA 3C6NB 3RGXA 4OQTA 3WN4A 1PGVA 2O6QA 3WPIA 2RA8A 4TZHA 2Z65A 4FDWA 4LSAA 5CMPA 1DFJI 1W8AA 4BV4R 3RIZA 4CNCA 4UFRA 4H09A 5GS0A 1OOKG 4PQ8A 4Y61B 4Z61C 3O6NA 4R6JA 4I6JB 4RWTC 5B0TA 1H6UA 2Z82A 4CC4C 1H6TA 1YRGA 4R5DA 1A9NA 1FT8A 4LXSA 2OMZA 1Z7XW 5IJBA 3UN9A 4PEQB 1GWBA 3OGLB 4FCGA 3W3NA 3WPEA 1FO1A 3RFEA 4LSXA 3WPCA 2UZXA 4V2EA 2P1QB 3W3KA 4KT1A 3OJAB 4P91A 1OTNA 3RFSA 4R6AA 1OTMA 3VQ1A 4R6FA 1D0BA 4U08A 5GMGA 3E4GA 1M10B 2Z7XA 3W3JA 4LI1A 4J0MA 4MN8B 3KJ4A 3ZYJA 4L3AA 3M19A 3G3BA 1M0ZA 4NKHA 4U06A 2Q4GW 2WQVA 1KOHA 5AWAA 2BNHA 4LSXC 5IYXC 5IJDA 1KOOA 3JB9j 3A79B 2OMTA 4WP6A 2BEXA 2JE1A 4BSUA 2Z81A 4PERA 2WFHA 2Z64A 4U09A 4GT6A 2JQDA 3ULAA 2WQWA 2FT3A 4M7EA 1XEUA 2Z66A 2O6SA 4Q3IA 2RR6A 2P1PB 3UL8A 4R6GA 2ID5A 4GLPA 1OTOA 4KXFB 2P1OB 1M9SA 2OMYA 4ECOA 3ZYIA 3BZ5A 3G04C 5GMFA 3C6OB 1WWLA 2ELLA 3G06A 5AWBA 1O6VA 4RCAB 2V9TB 5AZ5A 4Q3GA 3E3ZA 5FTTB 4G8AA 4RCWA 4C2BB 3WPGA 4LSCA 4V2DA 4M7EC 4J4LA 4P8SA 1LTXA 5B0NA 4AW4A 2A0ZA 4FS7A 4ARRA 4U7LA 4R07A 4QBZA 5GQRK 1OGQA 2WQXA 3WPBA 3ZYOA 4CNMA 3OJAA 3WPHA 4EZGA 4R08A 4FD0A 5HZLB 3C6PB 4Q62A 3TSRE 1P9AG 1FS2A 4B8CD 3ULUA 3WPFA 1G9UA 4R58A 2WQUA 4FHOA 3FXIA 3ZYNA 4LI2A 3GOZA 4NKGA 4HQ1A 1P8VA 4Z94G 1JL5A 1O6TA 2CA6A 4V2CA 2Y5QA 1SQ0B 4R09A 5IJCA 3E6JA 3M18A 4R5CA 1M9LA 4PSJA 2UZYA 4YEBB 4AY9X 3PMHG 4XSQA 4MQWX 1IO0A 5AWDA 4IM6A 3REZA 2XWTC 2P1NB 2O6RA 2OMXA 3RW7A 3CIGA 2OMUA 1FQVA 4BSRA 3RW6A 5GMHA 4WYKA 4R0AA 3OGKB 1DS9A 3W3LA 4QXEA 4CP6A 4KNGA 4BSSA 3E2JA 3WPDA 3CVRA 3OGMB 4XOSA 1A4YA 2V9SA 4ECNA 1XKUA 4Z8GA 2R9UA 5D3IA 1OZNA 4QC0A 2JE0A 4K17A 4ARNA 3SB4A 2V70A 2IFGA 3VQ2A 3RFJA 3W3GA 3G39A 3DZEA 3ULVA 4XGOA 5HDHA 1QYYA 2P1MB 3RGZA 2ASSB 2Z7XB 1XCDA 3O53A 2ASTB 1DCEA 1P8TA 3CIYA
chains in the Genus database with same CATH superfamily
2OMWA 1K5GC 3G3AA 5LFNA 5B4PA 2Z62A 1XWDC 5A5CA 2Z63A 1ZIWA 4PKIG 4LXRA 5CMNA 4CILA 4FMZA 4CC4A 4Z64C 1XECA 5GS2B 3UL7A 4L3FA 1O6SA 2XOTA 4Z79A 1U0ND 3P72A 3RJ0A 4C2AB 2OMVA 4NZRM 3W3MA 1K5DC 3UL9A 5AWCA 3C6NB 3RGXA 4OQTA 3WN4A 1PGVA 2O6QA 3WPIA 2RA8A 4TZHA 2Z65A 4FDWA 4LSAA 5CMPA 1DFJI 1W8AA 4BV4R 3RIZA 4CNCA 4UFRA 4H09A 5GS0A 1OOKG 4PQ8A 4Y61B 4Z61C 3O6NA 4R6JA 4I6JB 4RWTC 5B0TA 1H6UA 2Z82A 4CC4C 1H6TA 1YRGA 4R5DA 1A9NA 1FT8A 4LXSA 2OMZA 1Z7XW 5IJBA 3UN9A 4PEQB 1GWBA 3OGLB 4FCGA 3W3NA 3WPEA 1FO1A 3RFEA 4LSXA 3WPCA 2UZXA 4V2EA 2P1QB 3W3KA 4KT1A 3OJAB 4P91A 1OTNA 3RFSA 4R6AA 1OTMA 3VQ1A 4R6FA 1D0BA 4U08A 5GMGA 3E4GA 1M10B 2Z7XA 3W3JA 4LI1A 4J0MA 4MN8B 3KJ4A 3ZYJA 4L3AA 3M19A 3G3BA 1M0ZA 4NKHA 4U06A 2Q4GW 2WQVA 1KOHA 5AWAA 2BNHA 4LSXC 5IYXC 5IJDA 1KOOA 3JB9j 3A79B 2OMTA 4WP6A 2BEXA 2JE1A 4BSUA 2Z81A 4PERA 2WFHA 2Z64A 4U09A 4GT6A 2JQDA 3ULAA 2WQWA 2FT3A 4M7EA 1XEUA 2Z66A 2O6SA 4Q3IA 2RR6A 2P1PB 3UL8A 4R6GA 2ID5A 4GLPA 1OTOA 4KXFB 2P1OB 1M9SA 2OMYA 4ECOA 3ZYIA 3BZ5A 3G04C 5GMFA 4NZTM 3C6OB 1WWLA 2ELLA 3G06A 5AWBA 1O6VA 4RCAB 2V9TB 5AZ5A 4Q3GA 3E3ZA 5FTTB 4G8AA 4RCWA 4C2BB 3WPGA 4LSCA 4V2DA 4M7EC 4J4LA 4P8SA 1LTXA 5B0NA 4AW4A 2A0ZA 4FS7A 4ARRA 4U7LA 4R07A 4QBZA 5GQRK 1OGQA 2WQXA 3WPBA 3ZYOA 4CNMA 3OJAA 3WPHA 4EZGA 4R08A 4FD0A 5HZLB 3C6PB 4Q62A 3TSRE 1P9AG 1FS2A 4B8CD 3ULUA 3WPFA 1G9UA 4R58A 2WQUA 4FHOA 3FXIA 3ZYNA 4LI2A 3GOZA 4NKGA 4HQ1A 1P8VA 4Z94G 1JL5A 1O6TA 2CA6A 4V2CA 2Y5QA 1SQ0B 4R09A 5IJCA 3E6JA 3M18A 4R5CA 1M9LA 4PSJA 2UZYA 4YEBB 4AY9X 3PMHG 4XSQA 4MQWX 1IO0A 5AWDA 4IM6A 3REZA 2XWTC 2P1NB 2O6RA 2OMXA 3RW7A 3CIGA 2OMUA 1FQVA 4BSRA 3RW6A 5GMHA 4WYKA 4R0AA 3OGKB 1DS9A 3W3LA 4QXEA 4CP6A 4KNGA 4BSSA 3E2JA 3WPDA 3CVRA 3OGMB 4XOSA 1A4YA 2V9SA 4ECNA 1XKUA 4Z8GA 2R9UA 5D3IA 1OZNA 4QC0A 2JE0A 4K17A 4ARNA 3SB4A 2V70A 2IFGA 3VQ2A 3RFJA 3W3GA 3G39A 3DZEA 3ULVA 4XGOA 5HDHA 1QYYA 2P1MB 3RGZA 2ASSB 2Z7XB 1XCDA 3O53A 2ASTB 1DCEA 1P8TA 3CIYA
chains in the Genus database with same CATH topology
2OMWA 1K5GC 3G3AA 5LFNA 5B4PA 2Z62A 1XWDC 5A5CA 2Z63A 1ZIWA 4PKIG 4LXRA 5CMNA 4CILA 4FMZA 4CC4A 4Z64C 1XECA 5GS2B 3UL7A 4L3FA 1O6SA 2XOTA 4Z79A 1U0ND 3P72A 3RJ0A 4C2AB 2OMVA 3W3MA 1K5DC 3UL9A 5AWCA 3C6NB 3RGXA 4OQTA 3WN4A 1PGVA 2O6QA 3WPIA 2RA8A 4TZHA 2Z65A 4FDWA 4LSAA 5CMPA 1DFJI 1W8AA 4BV4R 3RIZA 4CNCA 4UFRA 4H09A 5GS0A 1OOKG 4PQ8A 4Y61B 4Z61C 3O6NA 4R6JA 4I6JB 4RWTC 5B0TA 1H6UA 2Z82A 4CC4C 1H6TA 1YRGA 4R5DA 1A9NA 1FT8A 4LXSA 2OMZA 1Z7XW 5IJBA 3UN9A 4PEQB 1GWBA 3OGLB 4FCGA 3W3NA 3WPEA 1FO1A 3RFEA 4LSXA 3WPCA 2UZXA 4V2EA 2P1QB 3W3KA 4KT1A 3OJAB 4P91A 1OTNA 3RFSA 4R6AA 1OTMA 3VQ1A 4R6FA 1D0BA 4U08A 5GMGA 3E4GA 1M10B 2Z7XA 3W3JA 4LI1A 4J0MA 4MN8B 3KJ4A 3ZYJA 4L3AA 3M19A 3G3BA 1M0ZA 4NKHA 4U06A 2Q4GW 2WQVA 1KOHA 5AWAA 2BNHA 4LSXC 5IYXC 5IJDA 1KOOA 3JB9j 3A79B 2OMTA 4WP6A 2BEXA 2JE1A 4BSUA 2Z81A 4PERA 2WFHA 2Z64A 4U09A 4GT6A 2JQDA 3ULAA 2WQWA 2FT3A 4M7EA 1XEUA 2Z66A 2O6SA 4Q3IA 2RR6A 2P1PB 3UL8A 4R6GA 2ID5A 4GLPA 1OTOA 4KXFB 2P1OB 1M9SA 2OMYA 4ECOA 3ZYIA 3BZ5A 3G04C 5GMFA 3C6OB 1WWLA 2ELLA 3G06A 5AWBA 1O6VA 4RCAB 2V9TB 5AZ5A 4Q3GA 3E3ZA 5FTTB 4G8AA 4RCWA 4C2BB 3WPGA 4LSCA 4V2DA 4M7EC 4J4LA 4P8SA 1LTXA 5B0NA 4AW4A 2A0ZA 4FS7A 4ARRA 4U7LA 4R07A 4QBZA 5GQRK 1OGQA 2WQXA 3WPBA 3ZYOA 4CNMA 3OJAA 3WPHA 4EZGA 4R08A 4FD0A 5HZLB 3C6PB 4Q62A 3TSRE 1P9AG 1FS2A 4B8CD 3ULUA 3WPFA 1G9UA 4R58A 2WQUA 4FHOA 3FXIA 3ZYNA 4LI2A 3GOZA 4NKGA 4HQ1A 1P8VA 4Z94G 1JL5A 1O6TA 2CA6A 4V2CA 2Y5QA 1SQ0B 4R09A 5IJCA 3E6JA 3M18A 4R5CA 1M9LA 4PSJA 2UZYA 4YEBB 4AY9X 3PMHG 4XSQA 4MQWX 1IO0A 5AWDA 4IM6A 3REZA 2XWTC 2P1NB 2O6RA 2OMXA 3RW7A 3CIGA 2OMUA 1FQVA 4BSRA 3RW6A 5GMHA 4WYKA 4R0AA 3OGKB 1DS9A 3W3LA 4QXEA 4CP6A 4KNGA 4BSSA 3E2JA 3WPDA 3CVRA 3OGMB 4XOSA 1A4YA 2V9SA 4ECNA 1XKUA 4Z8GA 2R9UA 5D3IA 1OZNA 4QC0A 2JE0A 4K17A 4ARNA 3SB4A 2V70A 2IFGA 3VQ2A 3RFJA 3W3GA 3G39A 3DZEA 3ULVA 4XGOA 5HDHA 1QYYA 2P1MB 3RGZA 2ASSB 2Z7XB 1XCDA 3O53A 2ASTB 1DCEA 1P8TA 3CIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OMW A;  1K5G C;  3G3A A;  5LFN A;  5B4P A;  2Z62 A;  1XWD C;  5A5C A;  2Z63 A;  1ZIW A;  4PKI G;  4LXR A;  5CMN A;  4CIL A;  4FMZ A;  4CC4 A;  4Z64 C;  1XEC A;  5GS2 B;  3UL7 A;  4L3F A;  1O6S A;  2XOT A;  4Z79 A;  1U0N D;  3P72 A;  3RJ0 A;  4C2A B;  2OMV A;  3W3M A;  1K5D C;  3UL9 A;  5AWC A;  3C6N B;  3RGX A;  4OQT A;  3WN4 A;  1PGV A;  2O6Q A;  3WPI A;  2RA8 A;  4TZH A;  2Z65 A;  4FDW A;  4LSA A;  5CMP A;  1DFJ I;  1W8A A;  4BV4 R;  3RIZ A;  4CNC A;  4UFR A;  4H09 A;  5GS0 A;  1OOK G;  4PQ8 A;  4Y61 B;  4Z61 C;  3O6N A;  4R6J A;  4I6J B;  4RWT C;  5B0T A;  1H6U A;  2Z82 A;  4CC4 C;  1H6T A;  1YRG A;  4R5D A;  1A9N A;  1FT8 A;  4LXS A;  2OMZ A;  1Z7X W;  5IJB A;  3UN9 A;  4PEQ B;  1GWB A;  3OGL B;  4FCG A;  3W3N A;  3WPE A;  1FO1 A;  3RFE A;  4LSX A;  3WPC A;  2UZX A;  4V2E A;  2P1Q B;  3W3K A;  4KT1 A;  3OJA B;  4P91 A;  1OTN A;  3RFS A;  4R6A A;  1OTM A;  3VQ1 A;  4R6F A;  1D0B A;  4U08 A;  5GMG A;  3E4G A;  1M10 B;  2Z7X A;  3W3J A;  4LI1 A;  4J0M A;  4MN8 B;  3KJ4 A;  3ZYJ A;  4L3A A;  3M19 A;  3G3B A;  1M0Z A;  4NKH A;  4U06 A;  2Q4G W;  2WQV A;  1KOH A;  5AWA A;  2BNH A;  4LSX C;  5IYX C;  5IJD A;  1KOO A;  3JB9 j;  3A79 B;  2OMT A;  4WP6 A;  2BEX A;  2JE1 A;  4BSU A;  2Z81 A;  4PER A;  2WFH A;  2Z64 A;  4U09 A;  4GT6 A;  2JQD A;  3ULA A;  2WQW A;  2FT3 A;  4M7E A;  1XEU A;  2Z66 A;  2O6S A;  4Q3I A;  2RR6 A;  2P1P B;  3UL8 A;  4R6G A;  2ID5 A;  4GLP A;  1OTO A;  4KXF B;  2P1O B;  1M9S A;  2OMY A;  4ECO A;  3ZYI A;  3BZ5 A;  3G04 C;  5GMF A;  3C6O B;  1WWL A;  2ELL A;  3G06 A;  5AWB A;  1O6V A;  4RCA B;  2V9T B;  5AZ5 A;  4Q3G A;  3E3Z A;  5FTT B;  4G8A A;  4RCW A;  4C2B B;  3WPG A;  4LSC A;  4V2D A;  4M7E C;  4J4L A;  4P8S A;  1LTX A;  5B0N A;  4AW4 A;  2A0Z A;  4FS7 A;  4ARR A;  4U7L A;  4R07 A;  4QBZ A;  5GQR K;  1OGQ A;  2WQX A;  3WPB A;  3ZYO A;  4CNM A;  3OJA A;  3WPH A;  4EZG A;  4R08 A;  4FD0 A;  5HZL B;  3C6P B;  4Q62 A;  3TSR E;  1P9A G;  1FS2 A;  4B8C D;  3ULU A;  3WPF A;  1G9U A;  4R58 A;  2WQU A;  4FHO A;  3FXI A;  3ZYN A;  4LI2 A;  3GOZ A;  4NKG A;  4HQ1 A;  1P8V A;  4Z94 G;  1JL5 A;  1O6T A;  2CA6 A;  4V2C A;  2Y5Q A;  1SQ0 B;  4R09 A;  5IJC A;  3E6J A;  3M18 A;  4R5C A;  1M9L A;  4PSJ A;  2UZY A;  4YEB B;  4AY9 X;  3PMH G;  4XSQ A;  4MQW X;  1IO0 A;  5AWD A;  4IM6 A;  3REZ A;  2XWT C;  2P1N B;  2O6R A;  2OMX A;  3RW7 A;  3CIG A;  2OMU A;  1FQV A;  4BSR A;  3RW6 A;  5GMH A;  4WYK A;  4R0A A;  3OGK B;  1DS9 A;  3W3L A;  4QXE A;  4CP6 A;  4KNG A;  4BSS A;  3E2J A;  3WPD A;  3CVR A;  3OGM B;  4XOS A;  1A4Y A;  2V9S A;  4ECN A;  1XKU A;  4Z8G A;  2R9U A;  5D3I A;  1OZN A;  4QC0 A;  2JE0 A;  4K17 A;  4ARN A;  3SB4 A;  2V70 A;  2IFG A;  3VQ2 A;  3RFJ A;  3W3G A;  3G39 A;  3DZE A;  3ULV A;  4XGO A;  5HDH A;  1QYY A;  2P1M B;  3RGZ A;  2ASS B;  2Z7X B;  1XCD A;  3O53 A;  2AST B;  1DCE A;  1P8T A;  3CIY A; 
#chains in the Genus database with same CATH topology
 2OMW A;  1K5G C;  3G3A A;  5LFN A;  5B4P A;  2Z62 A;  1XWD C;  5A5C A;  2Z63 A;  1ZIW A;  4PKI G;  4LXR A;  5CMN A;  4CIL A;  4FMZ A;  4CC4 A;  4Z64 C;  1XEC A;  5GS2 B;  3UL7 A;  4L3F A;  1O6S A;  2XOT A;  4Z79 A;  1U0N D;  3P72 A;  3RJ0 A;  4C2A B;  2OMV A;  4NZR M;  3W3M A;  1K5D C;  3UL9 A;  5AWC A;  3C6N B;  3RGX A;  4OQT A;  3WN4 A;  1PGV A;  2O6Q A;  3WPI A;  2RA8 A;  4TZH A;  2Z65 A;  4FDW A;  4LSA A;  5CMP A;  1DFJ I;  1W8A A;  4BV4 R;  3RIZ A;  4CNC A;  4UFR A;  4H09 A;  5GS0 A;  1OOK G;  4PQ8 A;  4Y61 B;  4Z61 C;  3O6N A;  4R6J A;  4I6J B;  4RWT C;  5B0T A;  1H6U A;  2Z82 A;  4CC4 C;  1H6T A;  1YRG A;  4R5D A;  1A9N A;  1FT8 A;  4LXS A;  2OMZ A;  1Z7X W;  5IJB A;  3UN9 A;  4PEQ B;  1GWB A;  3OGL B;  4FCG A;  3W3N A;  3WPE A;  1FO1 A;  3RFE A;  4LSX A;  3WPC A;  2UZX A;  4V2E A;  2P1Q B;  3W3K A;  4KT1 A;  3OJA B;  4P91 A;  1OTN A;  3RFS A;  4R6A A;  1OTM A;  3VQ1 A;  4R6F A;  1D0B A;  4U08 A;  5GMG A;  3E4G A;  1M10 B;  2Z7X A;  3W3J A;  4LI1 A;  4J0M A;  4MN8 B;  3KJ4 A;  3ZYJ A;  4L3A A;  3M19 A;  3G3B A;  1M0Z A;  4NKH A;  4U06 A;  2Q4G W;  2WQV A;  1KOH A;  5AWA A;  2BNH A;  4LSX C;  5IYX C;  5IJD A;  1KOO A;  3JB9 j;  3A79 B;  2OMT A;  4WP6 A;  2BEX A;  2JE1 A;  4BSU A;  2Z81 A;  4PER A;  2WFH A;  2Z64 A;  4U09 A;  4GT6 A;  2JQD A;  3ULA A;  2WQW A;  2FT3 A;  4M7E A;  1XEU A;  2Z66 A;  2O6S A;  4Q3I A;  2RR6 A;  2P1P B;  3UL8 A;  4R6G A;  2ID5 A;  4GLP A;  1OTO A;  4KXF B;  2P1O B;  1M9S A;  2OMY A;  4ECO A;  3ZYI A;  3BZ5 A;  3G04 C;  5GMF A;  4NZT M;  3C6O B;  1WWL A;  2ELL A;  3G06 A;  5AWB A;  1O6V A;  4RCA B;  2V9T B;  5AZ5 A;  4Q3G A;  3E3Z A;  5FTT B;  4G8A A;  4RCW A;  4C2B B;  3WPG A;  4LSC A;  4V2D A;  4M7E C;  4J4L A;  4P8S A;  1LTX A;  5B0N A;  4AW4 A;  2A0Z A;  4FS7 A;  4ARR A;  4U7L A;  4R07 A;  4QBZ A;  5GQR K;  1OGQ A;  2WQX A;  3WPB A;  3ZYO A;  4CNM A;  3OJA A;  3WPH A;  4EZG A;  4R08 A;  4FD0 A;  5HZL B;  3C6P B;  4Q62 A;  3TSR E;  1P9A G;  1FS2 A;  4B8C D;  3ULU A;  3WPF A;  1G9U A;  4R58 A;  2WQU A;  4FHO A;  3FXI A;  3ZYN A;  4LI2 A;  3GOZ A;  4NKG A;  4HQ1 A;  1P8V A;  4Z94 G;  1JL5 A;  1O6T A;  2CA6 A;  4V2C A;  2Y5Q A;  1SQ0 B;  4R09 A;  5IJC A;  3E6J A;  3M18 A;  4R5C A;  1M9L A;  4PSJ A;  2UZY A;  4YEB B;  4AY9 X;  3PMH G;  4XSQ A;  4MQW X;  1IO0 A;  5AWD A;  4IM6 A;  3REZ A;  2XWT C;  2P1N B;  2O6R A;  2OMX A;  3RW7 A;  3CIG A;  2OMU A;  1FQV A;  4BSR A;  3RW6 A;  5GMH A;  4WYK A;  4R0A A;  3OGK B;  1DS9 A;  3W3L A;  4QXE A;  4CP6 A;  4KNG A;  4BSS A;  3E2J A;  3WPD A;  3CVR A;  3OGM B;  4XOS A;  1A4Y A;  2V9S A;  4ECN A;  1XKU A;  4Z8G A;  2R9U A;  5D3I A;  1OZN A;  4QC0 A;  2JE0 A;  4K17 A;  4ARN A;  3SB4 A;  2V70 A;  2IFG A;  3VQ2 A;  3RFJ A;  3W3G A;  3G39 A;  3DZE A;  3ULV A;  4XGO A;  5HDH A;  1QYY A;  2P1M B;  3RGZ A;  2ASS B;  2Z7X B;  1XCD A;  3O53 A;  2AST B;  1DCE A;  1P8T A;  3CIY A; 
#chains in the Genus database with same CATH homology
 2OMW A;  1K5G C;  3G3A A;  5LFN A;  5B4P A;  2Z62 A;  1XWD C;  5A5C A;  2Z63 A;  1ZIW A;  4PKI G;  4LXR A;  5CMN A;  4CIL A;  4FMZ A;  4CC4 A;  4Z64 C;  1XEC A;  5GS2 B;  3UL7 A;  4L3F A;  1O6S A;  2XOT A;  4Z79 A;  1U0N D;  3P72 A;  3RJ0 A;  4C2A B;  2OMV A;  3W3M A;  1K5D C;  3UL9 A;  5AWC A;  3C6N B;  3RGX A;  4OQT A;  3WN4 A;  1PGV A;  2O6Q A;  3WPI A;  2RA8 A;  4TZH A;  2Z65 A;  4FDW A;  4LSA A;  5CMP A;  1DFJ I;  1W8A A;  4BV4 R;  3RIZ A;  4CNC A;  4UFR A;  4H09 A;  5GS0 A;  1OOK G;  4PQ8 A;  4Y61 B;  4Z61 C;  3O6N A;  4R6J A;  4I6J B;  4RWT C;  5B0T A;  1H6U A;  2Z82 A;  4CC4 C;  1H6T A;  1YRG A;  4R5D A;  1A9N A;  1FT8 A;  4LXS A;  2OMZ A;  1Z7X W;  5IJB A;  3UN9 A;  4PEQ B;  1GWB A;  3OGL B;  4FCG A;  3W3N A;  3WPE A;  1FO1 A;  3RFE A;  4LSX A;  3WPC A;  2UZX A;  4V2E A;  2P1Q B;  3W3K A;  4KT1 A;  3OJA B;  4P91 A;  1OTN A;  3RFS A;  4R6A A;  1OTM A;  3VQ1 A;  4R6F A;  1D0B A;  4U08 A;  5GMG A;  3E4G A;  1M10 B;  2Z7X A;  3W3J A;  4LI1 A;  4J0M A;  4MN8 B;  3KJ4 A;  3ZYJ A;  4L3A A;  3M19 A;  3G3B A;  1M0Z A;  4NKH A;  4U06 A;  2Q4G W;  2WQV A;  1KOH A;  5AWA A;  2BNH A;  4LSX C;  5IYX C;  5IJD A;  1KOO A;  3JB9 j;  3A79 B;  2OMT A;  4WP6 A;  2BEX A;  2JE1 A;  4BSU A;  2Z81 A;  4PER A;  2WFH A;  2Z64 A;  4U09 A;  4GT6 A;  2JQD A;  3ULA A;  2WQW A;  2FT3 A;  4M7E A;  1XEU A;  2Z66 A;  2O6S A;  4Q3I A;  2RR6 A;  2P1P B;  3UL8 A;  4R6G A;  2ID5 A;  4GLP A;  1OTO A;  4KXF B;  2P1O B;  1M9S A;  2OMY A;  4ECO A;  3ZYI A;  3BZ5 A;  3G04 C;  5GMF A;  3C6O B;  1WWL A;  2ELL A;  3G06 A;  5AWB A;  1O6V A;  4RCA B;  2V9T B;  5AZ5 A;  4Q3G A;  3E3Z A;  5FTT B;  4G8A A;  4RCW A;  4C2B B;  3WPG A;  4LSC A;  4V2D A;  4M7E C;  4J4L A;  4P8S A;  1LTX A;  5B0N A;  4AW4 A;  2A0Z A;  4FS7 A;  4ARR A;  4U7L A;  4R07 A;  4QBZ A;  5GQR K;  1OGQ A;  2WQX A;  3WPB A;  3ZYO A;  4CNM A;  3OJA A;  3WPH A;  4EZG A;  4R08 A;  4FD0 A;  5HZL B;  3C6P B;  4Q62 A;  3TSR E;  1P9A G;  1FS2 A;  4B8C D;  3ULU A;  3WPF A;  1G9U A;  4R58 A;  2WQU A;  4FHO A;  3FXI A;  3ZYN A;  4LI2 A;  3GOZ A;  4NKG A;  4HQ1 A;  1P8V A;  4Z94 G;  1JL5 A;  1O6T A;  2CA6 A;  4V2C A;  2Y5Q A;  1SQ0 B;  4R09 A;  5IJC A;  3E6J A;  3M18 A;  4R5C A;  1M9L A;  4PSJ A;  2UZY A;  4YEB B;  4AY9 X;  3PMH G;  4XSQ A;  4MQW X;  1IO0 A;  5AWD A;  4IM6 A;  3REZ A;  2XWT C;  2P1N B;  2O6R A;  2OMX A;  3RW7 A;  3CIG A;  2OMU A;  1FQV A;  4BSR A;  3RW6 A;  5GMH A;  4WYK A;  4R0A A;  3OGK B;  1DS9 A;  3W3L A;  4QXE A;  4CP6 A;  4KNG A;  4BSS A;  3E2J A;  3WPD A;  3CVR A;  3OGM B;  4XOS A;  1A4Y A;  2V9S A;  4ECN A;  1XKU A;  4Z8G A;  2R9U A;  5D3I A;  1OZN A;  4QC0 A;  2JE0 A;  4K17 A;  4ARN A;  3SB4 A;  2V70 A;  2IFG A;  3VQ2 A;  3RFJ A;  3W3G A;  3G39 A;  3DZE A;  3ULV A;  4XGO A;  5HDH A;  1QYY A;  2P1M B;  3RGZ A;  2ASS B;  2Z7X B;  1XCD A;  3O53 A;  2AST B;  1DCE A;  1P8T A;  3CIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...