4PQ8A

Crystal structure of engineered protein, northeast structural genomics consortium target or465
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
241
Chain Sequence
b'HTITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQGVFEKLTNLTTLNLSNNQLTSLPQGVFERLASLTTLNLSNNQLTSLPQGVFERLTNLTTLNLSNNQLTSLPQGVFERLTNLTTLNLSNNQLTSLPQGVFERLTSLTTLNLSNNQLTSLPQGVFERLTNLKTLNLSNNQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DESIGNED PROTEIN OR465
publication title Crystal Structure of Engineered Protein OR465.
rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 87
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2014-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4pq8A00
5CMNA 1M9LA 3G3BA 4C2AB 5GMGA 1M9SA 3WPIA 5HDHA 4TZHA 1G9UA 3RIZA 3ZYJA 4Q3IA 3O53A 4R09A 5B4PA 4U09A 5B0TA 1OOKG 3RFEA 3A79B 3GOZA 4V2CA 1K5DC 1QYYA 3ULVA 2P1OB 4LSXC 4R0AA 3G04C 3WPGA 1LTXA 2P1PB 1OTMA 3WPEA 4WP6A 4QC0A 1ZIWA 2O6QA 4KT1A 1IO0A 2IFGA 4PKIG 2ID5A 3RGZA 2R9UA 3PMHG 4R07A 3REZA 2WQUA 4R58A 3ULAA 3WPDA 3M18A 4R6AA 4PSJA 1O6VA 1SQ0B 2XOTA 3FXIA 4U7LA 1H6UA 4R6FA 3OGMB 4FMZA 4CILA 1A9NA 1H6TA 3KJ4A 4Q3GA 1Z7XW 1OTNA 4NKHA 4BV4R 4U06A 1XCDA 4KXFB 4AY9X 4J4LA 2Z81A 4LSXA 4FDWA 4AW4A 4UFRA 3TSRE 3C6NB 3RFSA 3WPHA 3G39A 2UZXA 4QXEA 4MQWX 3BZ5A 4BSRA 4LXRA 3ZYNA 4MN8B 3O6NA 2Y5QA 2P1MB 2ASTB 4Z8GA 1DCEA 3JB9j 2JE1A 2Z66A 5GMHA 4M7EA 5LFNA 4J0MA 1P8TA 4LSCA 4CC4A 4V2DA 4EZGA 3W3LA 3E3ZA 4LSAA 2A0ZA 5GQRK 2WQVA 3W3MA 4IM6A 4C2BB 5D3IA 1W8AA 2RR6A 1DFJI 4Y61B 5AWBA 4LXSA 4LI2A 4WYKA 3CIGA 4CNCA 3W3KA 4Q62A 1U0ND 2WQWA 3ZYOA 4PEQB 4G8AA 1WWLA 4R08A 2P1QB 1P9AG 3RGXA 3G06A 3OGKB 3RJ0A 1FO1A 4I6JB 5IJBA 2JQDA 4H09A 3OJAB 1OZNA 4FD0A 4B8CD 2XWTC 3OJAA 4Z94G 4OQTA 2OMXA 1XECA 1DS9A 2Z82A 3RW6A 2WFHA 3E6JA 4ARRA 3OGLB 2RA8A 4LI1A 1FQVA 2V9TB 2ELLA 4FS7A 2UZYA 4FHOA 3WPFA 1A4YA 3P72A 3RW7A 1XWDC 1M0ZA 2OMTA 4FCGA 3WPCA 5IJDA 4L3FA 4XOSA 3DZEA 2V70A 4KNGA 3W3JA 4Z64C 4R6JA 3UN9A 2CA6A 1XKUA 2OMWA 3C6OB 1PGVA 4Z61C 4U08A 1JL5A 3UL7A 3C6PB 5AWDA 3SB4A 4BSUA 3E2JA 4XGOA 4ARNA 2P1NB 4GT6A 4BSSA 4HQ1A 4R5DA 5IJCA 4RWTC 1KOOA 1YRGA 2BEXA 5GMFA 2Z65A 3VQ2A 1OTOA 2O6RA 5AZ5A 4P8SA 1P8VA 2Z63A 1O6TA 1K5GC 3ZYIA 2Q4GW 5GS0A 2OMZA 3G3AA 2ASSB 2OMVA 4RCWA 1D0BA 5B0NA 5IYXC 2O6SA 3W3GA 4GLPA 4NKGA 4R6GA 2JE0A 3WPBA 4PQ8A 1XEUA 2OMYA 3VQ1A 2WQXA 2Z62A 3UL9A 4P91A 4YEBB 4Z79A 2FT3A 5GS2B 1KOHA 2BNHA 2Z64A 4CNMA 4K17A 4RCAB 3RFJA 1O6SA 4M7EC 1FT8A 5HZLB 4ECOA 2V9SA 3M19A 1GWBA 3W3NA 4ECNA 4CC4C 3UL8A 1OGQA 5AWAA 5AWCA 3E4GA 4XSQA 3CIYA 1M10B 4CP6A 5FTTB 5A5CA 3ULUA 2Z7XB 5CMPA 3WN4A 2OMUA 4V2EA 4L3AA 3CVRA 2Z7XA 4PERA 1FS2A 4R5CA 4QBZA
chains in the Genus database with same CATH superfamily
5CMNA 1M9LA 3G3BA 4C2AB 5GMGA 1M9SA 3WPIA 5HDHA 4TZHA 1G9UA 3RIZA 3ZYJA 4Q3IA 3O53A 4R09A 5B4PA 4U09A 5B0TA 1OOKG 3RFEA 3A79B 3GOZA 4V2CA 1K5DC 1QYYA 3ULVA 2P1OB 4LSXC 4R0AA 3G04C 3WPGA 1LTXA 2P1PB 1OTMA 3WPEA 4WP6A 4QC0A 1ZIWA 2O6QA 4KT1A 1IO0A 2IFGA 4PKIG 2ID5A 3RGZA 2R9UA 3PMHG 4R07A 3REZA 2WQUA 4R58A 3ULAA 3WPDA 3M18A 4R6AA 4PSJA 1O6VA 1SQ0B 2XOTA 3FXIA 4U7LA 1H6UA 4R6FA 3OGMB 4FMZA 4CILA 1A9NA 1H6TA 3KJ4A 4Q3GA 1Z7XW 1OTNA 4NKHA 4BV4R 4U06A 1XCDA 4KXFB 4AY9X 4J4LA 2Z81A 4LSXA 4FDWA 4AW4A 4UFRA 3TSRE 3C6NB 3RFSA 3WPHA 3G39A 2UZXA 4QXEA 4MQWX 3BZ5A 4BSRA 4LXRA 3ZYNA 4MN8B 3O6NA 2Y5QA 2P1MB 2ASTB 4Z8GA 1DCEA 3JB9j 2JE1A 2Z66A 5GMHA 4M7EA 5LFNA 4J0MA 1P8TA 4LSCA 4CC4A 4V2DA 4EZGA 3W3LA 3E3ZA 4LSAA 2A0ZA 5GQRK 2WQVA 3W3MA 4IM6A 4C2BB 5D3IA 1W8AA 2RR6A 1DFJI 4Y61B 5AWBA 4LXSA 4LI2A 4WYKA 3CIGA 4CNCA 3W3KA 4Q62A 1U0ND 2WQWA 3ZYOA 4PEQB 4G8AA 1WWLA 4R08A 2P1QB 1P9AG 3RGXA 3G06A 3OGKB 3RJ0A 1FO1A 4I6JB 5IJBA 2JQDA 4H09A 3OJAB 1OZNA 4FD0A 4B8CD 2XWTC 3OJAA 4Z94G 4OQTA 2OMXA 1XECA 1DS9A 4NZRM 2Z82A 3RW6A 2WFHA 3E6JA 4ARRA 3OGLB 2RA8A 4LI1A 1FQVA 2V9TB 2ELLA 4FS7A 2UZYA 4FHOA 3WPFA 1A4YA 3P72A 3RW7A 1XWDC 1M0ZA 2OMTA 4FCGA 3WPCA 5IJDA 4L3FA 4NZTM 4XOSA 3DZEA 2V70A 4KNGA 3W3JA 4Z64C 4R6JA 3UN9A 2CA6A 1XKUA 2OMWA 3C6OB 1PGVA 4Z61C 4U08A 1JL5A 3UL7A 3C6PB 5AWDA 3SB4A 4BSUA 3E2JA 4XGOA 4ARNA 2P1NB 4GT6A 4BSSA 4HQ1A 4R5DA 5IJCA 4RWTC 1KOOA 1YRGA 2BEXA 5GMFA 2Z65A 3VQ2A 1OTOA 2O6RA 5AZ5A 4P8SA 1P8VA 2Z63A 1O6TA 1K5GC 3ZYIA 2Q4GW 5GS0A 2OMZA 3G3AA 2ASSB 2OMVA 4RCWA 1D0BA 5B0NA 5IYXC 2O6SA 3W3GA 4GLPA 4NKGA 4R6GA 2JE0A 3WPBA 4PQ8A 1XEUA 2OMYA 3VQ1A 2WQXA 2Z62A 3UL9A 4P91A 4YEBB 4Z79A 2FT3A 5GS2B 1KOHA 2BNHA 2Z64A 4CNMA 4K17A 4RCAB 3RFJA 1O6SA 4M7EC 1FT8A 5HZLB 4ECOA 2V9SA 3M19A 1GWBA 3W3NA 4ECNA 4CC4C 3UL8A 1OGQA 5AWAA 5AWCA 3E4GA 4XSQA 3CIYA 1M10B 4CP6A 5FTTB 5A5CA 3ULUA 2Z7XB 5CMPA 3WN4A 2OMUA 4V2EA 4L3AA 3CVRA 2Z7XA 4PERA 1FS2A 4R5CA 4QBZA
chains in the Genus database with same CATH topology
5CMNA 1M9LA 3G3BA 4C2AB 5GMGA 1M9SA 3WPIA 5HDHA 4TZHA 1G9UA 3RIZA 3ZYJA 4Q3IA 3O53A 4R09A 5B4PA 4U09A 5B0TA 1OOKG 3RFEA 3A79B 3GOZA 4V2CA 1K5DC 1QYYA 3ULVA 2P1OB 4LSXC 4R0AA 3G04C 3WPGA 1LTXA 2P1PB 1OTMA 3WPEA 4WP6A 4QC0A 1ZIWA 2O6QA 4KT1A 1IO0A 2IFGA 4PKIG 2ID5A 3RGZA 2R9UA 3PMHG 4R07A 3REZA 2WQUA 4R58A 3ULAA 3WPDA 3M18A 4R6AA 4PSJA 1O6VA 1SQ0B 2XOTA 3FXIA 4U7LA 1H6UA 4R6FA 3OGMB 4FMZA 4CILA 1A9NA 1H6TA 3KJ4A 4Q3GA 1Z7XW 1OTNA 4NKHA 4BV4R 4U06A 1XCDA 4KXFB 4AY9X 4J4LA 2Z81A 4LSXA 4FDWA 4AW4A 4UFRA 3TSRE 3C6NB 3RFSA 3WPHA 3G39A 2UZXA 4QXEA 4MQWX 3BZ5A 4BSRA 4LXRA 3ZYNA 4MN8B 3O6NA 2Y5QA 2P1MB 2ASTB 4Z8GA 1DCEA 3JB9j 2JE1A 2Z66A 5GMHA 4M7EA 5LFNA 4J0MA 1P8TA 4LSCA 4CC4A 4V2DA 4EZGA 3W3LA 3E3ZA 4LSAA 2A0ZA 5GQRK 2WQVA 3W3MA 4IM6A 4C2BB 5D3IA 1W8AA 2RR6A 1DFJI 4Y61B 5AWBA 4LXSA 4LI2A 4WYKA 3CIGA 4CNCA 3W3KA 4Q62A 1U0ND 2WQWA 3ZYOA 4PEQB 4G8AA 1WWLA 4R08A 2P1QB 1P9AG 3RGXA 3G06A 3OGKB 3RJ0A 1FO1A 4I6JB 5IJBA 2JQDA 4H09A 3OJAB 1OZNA 4FD0A 4B8CD 2XWTC 3OJAA 4Z94G 4OQTA 2OMXA 1XECA 1DS9A 2Z82A 3RW6A 2WFHA 3E6JA 4ARRA 3OGLB 2RA8A 4LI1A 1FQVA 2V9TB 2ELLA 4FS7A 2UZYA 4FHOA 3WPFA 1A4YA 3P72A 3RW7A 1XWDC 1M0ZA 2OMTA 4FCGA 3WPCA 5IJDA 4L3FA 4XOSA 3DZEA 2V70A 4KNGA 3W3JA 4Z64C 4R6JA 3UN9A 2CA6A 1XKUA 2OMWA 3C6OB 1PGVA 4Z61C 4U08A 1JL5A 3UL7A 3C6PB 5AWDA 3SB4A 4BSUA 3E2JA 4XGOA 4ARNA 2P1NB 4GT6A 4BSSA 4HQ1A 4R5DA 5IJCA 4RWTC 1KOOA 1YRGA 2BEXA 5GMFA 2Z65A 3VQ2A 1OTOA 2O6RA 5AZ5A 4P8SA 1P8VA 2Z63A 1O6TA 1K5GC 3ZYIA 2Q4GW 5GS0A 2OMZA 3G3AA 2ASSB 2OMVA 4RCWA 1D0BA 5B0NA 5IYXC 2O6SA 3W3GA 4GLPA 4NKGA 4R6GA 2JE0A 3WPBA 4PQ8A 1XEUA 2OMYA 3VQ1A 2WQXA 2Z62A 3UL9A 4P91A 4YEBB 4Z79A 2FT3A 5GS2B 1KOHA 2BNHA 2Z64A 4CNMA 4K17A 4RCAB 3RFJA 1O6SA 4M7EC 1FT8A 5HZLB 4ECOA 2V9SA 3M19A 1GWBA 3W3NA 4ECNA 4CC4C 3UL8A 1OGQA 5AWAA 5AWCA 3E4GA 4XSQA 3CIYA 1M10B 4CP6A 5FTTB 5A5CA 3ULUA 2Z7XB 5CMPA 3WN4A 2OMUA 4V2EA 4L3AA 3CVRA 2Z7XA 4PERA 1FS2A 4R5CA 4QBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMN A;  1M9L A;  3G3B A;  4C2A B;  5GMG A;  1M9S A;  3WPI A;  5HDH A;  4TZH A;  1G9U A;  3RIZ A;  3ZYJ A;  4Q3I A;  3O53 A;  4R09 A;  5B4P A;  4U09 A;  5B0T A;  1OOK G;  3RFE A;  3A79 B;  3GOZ A;  4V2C A;  1K5D C;  1QYY A;  3ULV A;  2P1O B;  4LSX C;  4R0A A;  3G04 C;  3WPG A;  1LTX A;  2P1P B;  1OTM A;  3WPE A;  4WP6 A;  4QC0 A;  1ZIW A;  2O6Q A;  4KT1 A;  1IO0 A;  2IFG A;  4PKI G;  2ID5 A;  3RGZ A;  2R9U A;  3PMH G;  4R07 A;  3REZ A;  2WQU A;  4R58 A;  3ULA A;  3WPD A;  3M18 A;  4R6A A;  4PSJ A;  1O6V A;  1SQ0 B;  2XOT A;  3FXI A;  4U7L A;  1H6U A;  4R6F A;  3OGM B;  4FMZ A;  4CIL A;  1A9N A;  1H6T A;  3KJ4 A;  4Q3G A;  1Z7X W;  1OTN A;  4NKH A;  4BV4 R;  4U06 A;  1XCD A;  4KXF B;  4AY9 X;  4J4L A;  2Z81 A;  4LSX A;  4FDW A;  4AW4 A;  4UFR A;  3TSR E;  3C6N B;  3RFS A;  3WPH A;  3G39 A;  2UZX A;  4QXE A;  4MQW X;  3BZ5 A;  4BSR A;  4LXR A;  3ZYN A;  4MN8 B;  3O6N A;  2Y5Q A;  2P1M B;  2AST B;  4Z8G A;  1DCE A;  3JB9 j;  2JE1 A;  2Z66 A;  5GMH A;  4M7E A;  5LFN A;  4J0M A;  1P8T A;  4LSC A;  4CC4 A;  4V2D A;  4EZG A;  3W3L A;  3E3Z A;  4LSA A;  2A0Z A;  5GQR K;  2WQV A;  3W3M A;  4IM6 A;  4C2B B;  5D3I A;  1W8A A;  2RR6 A;  1DFJ I;  4Y61 B;  5AWB A;  4LXS A;  4LI2 A;  4WYK A;  3CIG A;  4CNC A;  3W3K A;  4Q62 A;  1U0N D;  2WQW A;  3ZYO A;  4PEQ B;  4G8A A;  1WWL A;  4R08 A;  2P1Q B;  1P9A G;  3RGX A;  3G06 A;  3OGK B;  3RJ0 A;  1FO1 A;  4I6J B;  5IJB A;  2JQD A;  4H09 A;  3OJA B;  1OZN A;  4FD0 A;  4B8C D;  2XWT C;  3OJA A;  4Z94 G;  4OQT A;  2OMX A;  1XEC A;  1DS9 A;  2Z82 A;  3RW6 A;  2WFH A;  3E6J A;  4ARR A;  3OGL B;  2RA8 A;  4LI1 A;  1FQV A;  2V9T B;  2ELL A;  4FS7 A;  2UZY A;  4FHO A;  3WPF A;  1A4Y A;  3P72 A;  3RW7 A;  1XWD C;  1M0Z A;  2OMT A;  4FCG A;  3WPC A;  5IJD A;  4L3F A;  4XOS A;  3DZE A;  2V70 A;  4KNG A;  3W3J A;  4Z64 C;  4R6J A;  3UN9 A;  2CA6 A;  1XKU A;  2OMW A;  3C6O B;  1PGV A;  4Z61 C;  4U08 A;  1JL5 A;  3UL7 A;  3C6P B;  5AWD A;  3SB4 A;  4BSU A;  3E2J A;  4XGO A;  4ARN A;  2P1N B;  4GT6 A;  4BSS A;  4HQ1 A;  4R5D A;  5IJC A;  4RWT C;  1KOO A;  1YRG A;  2BEX A;  5GMF A;  2Z65 A;  3VQ2 A;  1OTO A;  2O6R A;  5AZ5 A;  4P8S A;  1P8V A;  2Z63 A;  1O6T A;  1K5G C;  3ZYI A;  2Q4G W;  5GS0 A;  2OMZ A;  3G3A A;  2ASS B;  2OMV A;  4RCW A;  1D0B A;  5B0N A;  5IYX C;  2O6S A;  3W3G A;  4GLP A;  4NKG A;  4R6G A;  2JE0 A;  3WPB A;  4PQ8 A;  1XEU A;  2OMY A;  3VQ1 A;  2WQX A;  2Z62 A;  3UL9 A;  4P91 A;  4YEB B;  4Z79 A;  2FT3 A;  5GS2 B;  1KOH A;  2BNH A;  2Z64 A;  4CNM A;  4K17 A;  4RCA B;  3RFJ A;  1O6S A;  4M7E C;  1FT8 A;  5HZL B;  4ECO A;  2V9S A;  3M19 A;  1GWB A;  3W3N A;  4ECN A;  4CC4 C;  3UL8 A;  1OGQ A;  5AWA A;  5AWC A;  3E4G A;  4XSQ A;  3CIY A;  1M10 B;  4CP6 A;  5FTT B;  5A5C A;  3ULU A;  2Z7X B;  5CMP A;  3WN4 A;  2OMU A;  4V2E A;  4L3A A;  3CVR A;  2Z7X A;  4PER A;  1FS2 A;  4R5C A;  4QBZ A; 
#chains in the Genus database with same CATH topology
 5CMN A;  1M9L A;  3G3B A;  4C2A B;  5GMG A;  1M9S A;  3WPI A;  5HDH A;  4TZH A;  1G9U A;  3RIZ A;  3ZYJ A;  4Q3I A;  3O53 A;  4R09 A;  5B4P A;  4U09 A;  5B0T A;  1OOK G;  3RFE A;  3A79 B;  3GOZ A;  4V2C A;  1K5D C;  1QYY A;  3ULV A;  2P1O B;  4LSX C;  4R0A A;  3G04 C;  3WPG A;  1LTX A;  2P1P B;  1OTM A;  3WPE A;  4WP6 A;  4QC0 A;  1ZIW A;  2O6Q A;  4KT1 A;  1IO0 A;  2IFG A;  4PKI G;  2ID5 A;  3RGZ A;  2R9U A;  3PMH G;  4R07 A;  3REZ A;  2WQU A;  4R58 A;  3ULA A;  3WPD A;  3M18 A;  4R6A A;  4PSJ A;  1O6V A;  1SQ0 B;  2XOT A;  3FXI A;  4U7L A;  1H6U A;  4R6F A;  3OGM B;  4FMZ A;  4CIL A;  1A9N A;  1H6T A;  3KJ4 A;  4Q3G A;  1Z7X W;  1OTN A;  4NKH A;  4BV4 R;  4U06 A;  1XCD A;  4KXF B;  4AY9 X;  4J4L A;  2Z81 A;  4LSX A;  4FDW A;  4AW4 A;  4UFR A;  3TSR E;  3C6N B;  3RFS A;  3WPH A;  3G39 A;  2UZX A;  4QXE A;  4MQW X;  3BZ5 A;  4BSR A;  4LXR A;  3ZYN A;  4MN8 B;  3O6N A;  2Y5Q A;  2P1M B;  2AST B;  4Z8G A;  1DCE A;  3JB9 j;  2JE1 A;  2Z66 A;  5GMH A;  4M7E A;  5LFN A;  4J0M A;  1P8T A;  4LSC A;  4CC4 A;  4V2D A;  4EZG A;  3W3L A;  3E3Z A;  4LSA A;  2A0Z A;  5GQR K;  2WQV A;  3W3M A;  4IM6 A;  4C2B B;  5D3I A;  1W8A A;  2RR6 A;  1DFJ I;  4Y61 B;  5AWB A;  4LXS A;  4LI2 A;  4WYK A;  3CIG A;  4CNC A;  3W3K A;  4Q62 A;  1U0N D;  2WQW A;  3ZYO A;  4PEQ B;  4G8A A;  1WWL A;  4R08 A;  2P1Q B;  1P9A G;  3RGX A;  3G06 A;  3OGK B;  3RJ0 A;  1FO1 A;  4I6J B;  5IJB A;  2JQD A;  4H09 A;  3OJA B;  1OZN A;  4FD0 A;  4B8C D;  2XWT C;  3OJA A;  4Z94 G;  4OQT A;  2OMX A;  1XEC A;  1DS9 A;  4NZR M;  2Z82 A;  3RW6 A;  2WFH A;  3E6J A;  4ARR A;  3OGL B;  2RA8 A;  4LI1 A;  1FQV A;  2V9T B;  2ELL A;  4FS7 A;  2UZY A;  4FHO A;  3WPF A;  1A4Y A;  3P72 A;  3RW7 A;  1XWD C;  1M0Z A;  2OMT A;  4FCG A;  3WPC A;  5IJD A;  4L3F A;  4NZT M;  4XOS A;  3DZE A;  2V70 A;  4KNG A;  3W3J A;  4Z64 C;  4R6J A;  3UN9 A;  2CA6 A;  1XKU A;  2OMW A;  3C6O B;  1PGV A;  4Z61 C;  4U08 A;  1JL5 A;  3UL7 A;  3C6P B;  5AWD A;  3SB4 A;  4BSU A;  3E2J A;  4XGO A;  4ARN A;  2P1N B;  4GT6 A;  4BSS A;  4HQ1 A;  4R5D A;  5IJC A;  4RWT C;  1KOO A;  1YRG A;  2BEX A;  5GMF A;  2Z65 A;  3VQ2 A;  1OTO A;  2O6R A;  5AZ5 A;  4P8S A;  1P8V A;  2Z63 A;  1O6T A;  1K5G C;  3ZYI A;  2Q4G W;  5GS0 A;  2OMZ A;  3G3A A;  2ASS B;  2OMV A;  4RCW A;  1D0B A;  5B0N A;  5IYX C;  2O6S A;  3W3G A;  4GLP A;  4NKG A;  4R6G A;  2JE0 A;  3WPB A;  4PQ8 A;  1XEU A;  2OMY A;  3VQ1 A;  2WQX A;  2Z62 A;  3UL9 A;  4P91 A;  4YEB B;  4Z79 A;  2FT3 A;  5GS2 B;  1KOH A;  2BNH A;  2Z64 A;  4CNM A;  4K17 A;  4RCA B;  3RFJ A;  1O6S A;  4M7E C;  1FT8 A;  5HZL B;  4ECO A;  2V9S A;  3M19 A;  1GWB A;  3W3N A;  4ECN A;  4CC4 C;  3UL8 A;  1OGQ A;  5AWA A;  5AWC A;  3E4G A;  4XSQ A;  3CIY A;  1M10 B;  4CP6 A;  5FTT B;  5A5C A;  3ULU A;  2Z7X B;  5CMP A;  3WN4 A;  2OMU A;  4V2E A;  4L3A A;  3CVR A;  2Z7X A;  4PER A;  1FS2 A;  4R5C A;  4QBZ A; 
#chains in the Genus database with same CATH homology
 5CMN A;  1M9L A;  3G3B A;  4C2A B;  5GMG A;  1M9S A;  3WPI A;  5HDH A;  4TZH A;  1G9U A;  3RIZ A;  3ZYJ A;  4Q3I A;  3O53 A;  4R09 A;  5B4P A;  4U09 A;  5B0T A;  1OOK G;  3RFE A;  3A79 B;  3GOZ A;  4V2C A;  1K5D C;  1QYY A;  3ULV A;  2P1O B;  4LSX C;  4R0A A;  3G04 C;  3WPG A;  1LTX A;  2P1P B;  1OTM A;  3WPE A;  4WP6 A;  4QC0 A;  1ZIW A;  2O6Q A;  4KT1 A;  1IO0 A;  2IFG A;  4PKI G;  2ID5 A;  3RGZ A;  2R9U A;  3PMH G;  4R07 A;  3REZ A;  2WQU A;  4R58 A;  3ULA A;  3WPD A;  3M18 A;  4R6A A;  4PSJ A;  1O6V A;  1SQ0 B;  2XOT A;  3FXI A;  4U7L A;  1H6U A;  4R6F A;  3OGM B;  4FMZ A;  4CIL A;  1A9N A;  1H6T A;  3KJ4 A;  4Q3G A;  1Z7X W;  1OTN A;  4NKH A;  4BV4 R;  4U06 A;  1XCD A;  4KXF B;  4AY9 X;  4J4L A;  2Z81 A;  4LSX A;  4FDW A;  4AW4 A;  4UFR A;  3TSR E;  3C6N B;  3RFS A;  3WPH A;  3G39 A;  2UZX A;  4QXE A;  4MQW X;  3BZ5 A;  4BSR A;  4LXR A;  3ZYN A;  4MN8 B;  3O6N A;  2Y5Q A;  2P1M B;  2AST B;  4Z8G A;  1DCE A;  3JB9 j;  2JE1 A;  2Z66 A;  5GMH A;  4M7E A;  5LFN A;  4J0M A;  1P8T A;  4LSC A;  4CC4 A;  4V2D A;  4EZG A;  3W3L A;  3E3Z A;  4LSA A;  2A0Z A;  5GQR K;  2WQV A;  3W3M A;  4IM6 A;  4C2B B;  5D3I A;  1W8A A;  2RR6 A;  1DFJ I;  4Y61 B;  5AWB A;  4LXS A;  4LI2 A;  4WYK A;  3CIG A;  4CNC A;  3W3K A;  4Q62 A;  1U0N D;  2WQW A;  3ZYO A;  4PEQ B;  4G8A A;  1WWL A;  4R08 A;  2P1Q B;  1P9A G;  3RGX A;  3G06 A;  3OGK B;  3RJ0 A;  1FO1 A;  4I6J B;  5IJB A;  2JQD A;  4H09 A;  3OJA B;  1OZN A;  4FD0 A;  4B8C D;  2XWT C;  3OJA A;  4Z94 G;  4OQT A;  2OMX A;  1XEC A;  1DS9 A;  2Z82 A;  3RW6 A;  2WFH A;  3E6J A;  4ARR A;  3OGL B;  2RA8 A;  4LI1 A;  1FQV A;  2V9T B;  2ELL A;  4FS7 A;  2UZY A;  4FHO A;  3WPF A;  1A4Y A;  3P72 A;  3RW7 A;  1XWD C;  1M0Z A;  2OMT A;  4FCG A;  3WPC A;  5IJD A;  4L3F A;  4XOS A;  3DZE A;  2V70 A;  4KNG A;  3W3J A;  4Z64 C;  4R6J A;  3UN9 A;  2CA6 A;  1XKU A;  2OMW A;  3C6O B;  1PGV A;  4Z61 C;  4U08 A;  1JL5 A;  3UL7 A;  3C6P B;  5AWD A;  3SB4 A;  4BSU A;  3E2J A;  4XGO A;  4ARN A;  2P1N B;  4GT6 A;  4BSS A;  4HQ1 A;  4R5D A;  5IJC A;  4RWT C;  1KOO A;  1YRG A;  2BEX A;  5GMF A;  2Z65 A;  3VQ2 A;  1OTO A;  2O6R A;  5AZ5 A;  4P8S A;  1P8V A;  2Z63 A;  1O6T A;  1K5G C;  3ZYI A;  2Q4G W;  5GS0 A;  2OMZ A;  3G3A A;  2ASS B;  2OMV A;  4RCW A;  1D0B A;  5B0N A;  5IYX C;  2O6S A;  3W3G A;  4GLP A;  4NKG A;  4R6G A;  2JE0 A;  3WPB A;  4PQ8 A;  1XEU A;  2OMY A;  3VQ1 A;  2WQX A;  2Z62 A;  3UL9 A;  4P91 A;  4YEB B;  4Z79 A;  2FT3 A;  5GS2 B;  1KOH A;  2BNH A;  2Z64 A;  4CNM A;  4K17 A;  4RCA B;  3RFJ A;  1O6S A;  4M7E C;  1FT8 A;  5HZL B;  4ECO A;  2V9S A;  3M19 A;  1GWB A;  3W3N A;  4ECN A;  4CC4 C;  3UL8 A;  1OGQ A;  5AWA A;  5AWC A;  3E4G A;  4XSQ A;  3CIY A;  1M10 B;  4CP6 A;  5FTT B;  5A5C A;  3ULU A;  2Z7X B;  5CMP A;  3WN4 A;  2OMU A;  4V2E A;  4L3A A;  3CVR A;  2Z7X A;  4PER A;  1FS2 A;  4R5C A;  4QBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...