4PQ9A

Crystal structure of a beta-1,3-glucanase from mycobacterium marinum
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
233
structure length
233
Chain Sequence
b'QSGPYLFHDEFDGPAGSAPDSSKWTVARAREEMKDPTYWERPENVGQYRDDRQNVFLDGKSNLVIRAAKDGGTYYAGKIQSPWRGGIGHTWEARIKFDCLTAGCWPAWWLGNQDRGEIDIIEWYGNGSWPSATTVHAKANGSEWKTRNVALDSGWHTWRCQWDETGMRFWQDYAEGAQPYFTVAAHSLPDWPFNDPGYTVFPVLNLAVAGSGGGDPRPGSYPAQMLVDWVRVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,3-glucanase
publication title Crystal Structure of a Beta-1,3-glucanase from Mycobacterium marinum
rcsb
source organism Mycobacterium marinum
molecule tags Hydrolase
total genus 52
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4pq9A00
1MZ6A 2JKBA 1V6MA 3ZXFA 3AYAA 3V0AA 1JW6A 5GLWA 2WT1A 3BODA 1W6OA 1WLWA 3D4KA 2WT0A 1LHVA 2EAKA 3HR9A 1Z0HA 1MS3A 3N3HA 2CYFA 2E7QA 2ENRA 2VW0A 4Y1YA 1SBFA 1GZWA 1Q8OA 1ULDA 5E8AA 3AZXA 2WKKA 4GA9A 4H55A 3CNAA 3ZSLA 4AGVA 4ITCA 1IKPA 1AX2A 1BXHA 1WUVA 5DZGA 1S0CA 2A75A 1MVQA 1ONAA 2GMPA 4FPKA 5CBLA 2UWBA 3NWKA 4U2AA 4DRVA 3U4XA 3UL2A 2GNDA 2P34A 2DVBA 1F9KA 4LBOA 1MS0A 4ISQA 1AX0A 2ZKNA 4HANA 1CR7A 4BM8A 2A70A 2ZHLA 3AZWA 3MPPG 3HN1A 5CA6A 5JOXA 1N1TA 4YM1A 2ZGKA 3V0BB 2UURA 4AGRA 1N3OA 4XBLA 3W59A 2JE7A 2SLIA 2R0HA 1GZCA 3PMEA 3POWA 3ILNA 1W0PA 5GLVA 5IK4A 1ULFA 1G9AA 2P3IA 1GV9A 4K21A 2ZGMA 4XJUA 4GKXA 4K20A 5DZEA 2AH2A 3RMXA 3SLIA 4C1WA 1AJKA 3AZZA 2DUOA 5KXBA 3WUCA 4CZSA 4UW5A 2R1BA 3QLQA 3USUA 4F83A 1O4ZA 2DURA 3W58A 1LGCA 4XJ8A 1QDOA 2VU9A 1W0OA 1MZ5A 1WW6A 1H30A 1JHNA 4FPJA 1U0AA 4Y20A 1V6NA 2R0FA 4JCKA 4YM2A 4MYEA 3WV6A 1C1LA 3MW3A 1AXKA 1SLAA 3WG4A 1UX6A 2XB6C 3WG1A 3AP4A 4P9XA 1A78A 2DVGA 5DG1A 3WDTA 2A71A 2P3KA 1UL9A 3WDYA 2OUJA 5JMCA 1AF9A 1ULEA 2P2KA 4K1YA 1WW7A 1WD3A 2BQPA 3UJQA 2YZ4A 3T1MA 1MR5A 2FHRA 3OBRA 1GNHA 2ZGPA 1UMZA 2FMDA 2ZMKA 1KDMA 4ISRA 4R9CA 3WHTA 2AR6A 2LALA 2AENA 3O12A 1H9WA 2EF6A 1SLTA 1AVBA 1QOTA 3H0OA 4P14A 1YIFA 3ZSMA 1NXD1 4FPGA 3N7KA 1APNA 3V0BA 3R4SA 1KJRA 4XJWA 3A0KA 2W39A 1AXZA 3ASIA 1GZWB 3MW2A 5T5OA 1QDCA 1LU1A 1N47A 2ARXA 2GNBA 2OW4A 5FREA 2DVAA 5LK5A 3GNEA 3LCPA 2YY1A 3OBTA 3UK9A 2R49A 4PQ9A 1IS5A 1G9FA 5JLVA 2JECA 1LHOA 5JOZA 4XILA 1IS6A 4Y1ZA 3DUIA 3SH5A 4YGBA 2ZMLA 1ENSA 1R1ZA 2B7YA 4AWDA 1FNZA 4Y24A 1W6QB 1V00A 2HYKA 4LBQD 1VAVA 2ZACA 3SNMA 1MS5A 3QCWA 2OVUA 4U36A 2GN7A 4JRAA 1BKZA 2KM2A 1DBNA 1DIWA 5DXDA 3IM0A 4Y26A 1QU0A 1DYPA 1SCSA 3SH4A 1S0FA 1LOAA 2D3SA 2NMOA 3ENRA 3AXEA 4FOVA 4XXAA 5T52A 1DQ1A 2ZBJA 3WG3A 2OUHA 2NN8A 2W52A 3KQRA 5H9PA 3ZYRA 1MS4A 1S0EA 1DLLA 3OY8A 2EXJA 2Z42A 5EWSA 3KM5A 4I30A 3Q9OA 1H9PA 4M3CF 2D44A 1W6MB 1QKQA 3VKNA 2UWAA 4BLJA 3AP7A 3IKWA 1XQNA 3USUB 2D6KA 1CIWA 2SBAA 4XJAA 4ATEA 1QMJA 3A4UA 5T54A 5E89A 3TB0A 3FFZA 3DGTA 3FUQA 5DUWA 4XE9A 4M3CB 4Y20B 5JDBA 5DUVA 5FRAA 5JVVA 1MVEA 1S0DA 2JDZA 1LENA 2ZHKA 1UPSA 2EXIA 5DUXA 1N1SA 4K1ZA 1QF3A 1DFQA 2H0BA 3AK0A 4LBLA 2YROA 1URXA 2PHTA 1W6NA 2R16A 2ZGSA 2AREA 1FYUA 4W65A 2I2SA 3TAYA 3VKLA 4D69A 1BYHA 5KXEA 2NP0A 5KXDA 1LOFA 2NMNA 1W6QA 4YZ1A 3FLRA 1DHKB 1I1EA 4XIOA 2E51A 4TZDA 1WW4A 1DGLA 1LHWA 1VALA 3WNXA 4LBKA 4PBPA 4YG3A 4XTPA 3AYDA 4YZ5A 1G8WA 1GKBA 1PZ7A 2WQZC 1HLCA 4AYUA 3POYA 4BQ1A 3GALA 1LU2A 5GZEA 1J1TA 1S0IA 2A3WA 4RL7A 1LHUA 4GKYA 3ZSJA 3BTAA 3N36A 4Y1XA 5IK8A 4FQZA 4XJ9A 5CNAA 3LSEA 4JC1A 1FATA 1OQ1A 3M3CA 4Q2FA 5EYYA 1CONA 5SV8A 1W6MA 3LSDA 1C57A 1UZZA 2A6YA 2LTNA 2PHWA 3AJYA 1IKQA 5GZDA 3FLPA 4UW3A 3WG2A 3B01A 3NV4A 1LECA 1RINA 4YW3A 4PBOA 3PJQA 4YZ2A 4GXLA 4FOQA 4XBNA 4DQAA 3N7MA 4YFZA 3RRDA 4DFSA 3UJOA 5T5LA 5GZGA 2CWSA 2WJSA 4M3CA 3N7LA 1WW5A 2WNEA 5T5JA 5CB7A 1LCLA 3RMYA 2DUPA 4XMAA 4WZFA 5H9SA 2A3XA 1RIRA 1D2SA 4HL0A 1DQ5A 2YMZA 4Q8LA 3OY8B 1YXWA 2ES3A 2E7TA 1SBEA 4FPYA 1SLCA 1Y7BA 1UAIA 4LBQA 2CWMA 3BIWE 5GLZA 4P9WA 4CRQA 4SLIA 1DQ0A 1AZDA 3NV2A 2GN3A 2XG3A 1F31A 4YW5A 1LESA 1S0JA 5GLTA 3RQ0A 4BLIA 3MEPA 3OPZA 1S1AA 2DTWA 2ZGQA 4YGEA 1GSLA 2ZZJA 3MW4A 1LHNA 4XYXA 5EYXA 3T2TA 4IQPA 2ZHNA 3WHUA 2NYYA 2PHRA 3O0WA 1ENQA 1JOJA 1ULGA 2DTYA 2ZMNA 3INAA 4Y1UA 4BOWA 1EPWA 3AZVA 2EIGA 1Q8PA 3ZSKA 2GDFA 5H9RA 1BQPA 5CAZA 1SBDA 1W6NB 1VAMA 4FPHA 4R9BA 4DPNA 1O4YA 4M00A 4DS0A 4BMBA 2D3PA 3M3QA 4P9YA 3HMYA 3WOGA 5F9TA 1V6OA 3FLTA 4XXPA 2R1DA 1G7YA 1CPNA 1BJQA 1YRZA 5T5PA 4M3CE 3NV1A 1V6LA 4YGCA 2ERFA 4GWMA 4Q8KA 1FV2A 3PVOA 2A3YA 3IPVB 4AVSA 4ASMB 3M3EA 1A3KA 1MACA 1Q56A 2VY0A 1WD4A 2JD4A 2WSUA 5DUUA 3I4IA 2A6WA 1QOSA 1FAYA 3O5SA 1N3QA 1IS4A 2EXHA 1GYKA 1RITA 1JN2P 4YW2A 2DU0A 4M01A 3V64A 3M3OA 4LBJA 1LOEA 1N1YA 2GNMA 1C1FA 1FV3A 1UZYA 3L2YA 1JXNA 1W6PA 1V6KA 1VLNA 2DV9A 2W68A 1S0BA 4RA0A 3R05A 1AXYA 1HQLA 1F5FA 1WCSA 4YFWA 4FP3A 3VKOA 3WDWA 1OFSA 2ZGOA 3PVEA 3N35A 4FP2A 5T50A 2D6NA 4ZXKA 4FOYA 5HCFA 5BYNA 2PHUA 3B69A 4Z8BA 2VXRA 3NV3A 5GALA 5EXOA 2WLQA 1Q8QA 5GZFA 3ILRA 4AVTA 2CTVA 4XHBA 1LOFC 1GNZA 2CY6A 4YW4A 4LBQB 5F5QA 3WDVA 1ZM1A 2AUYA 1Z78A 1MS9A 2ZA9A 2ZGUA 4FOWA 4YM3A 5HCAA 1D0HA 2UWCA 2VH9A 1LOGA 1KRIA 1HQWA 3SITA 1CQ9A 1AJOA 1LOBA 4CTEA 4KBBA 2GNTA 4XIKA 4XMIA 3IPVA 3ZXLA 1MS1A 5T55A 4ATFA 3WDXA 1WBLA 1IOAA 2D6OX 5GM0A 2ZAAA 2RHPA 2D3RA 1CJPA 2DUQA 2ZHMA 4L8QA 4FPOB 5GJ6A 1JBCA 3R4UA 1MS8A 4Y22A 1SLBA 3AP9A 4DRRA 2PHFA 1LGBA 1TEIA 3AFKA 4FVVA 5DZFA 1AX1A 1CPMA 4LBMA 3O0XA 3OJBA 3WCRA 1LJ7A 3B3QE 5DG2A 1YO8A 2ZGLA 1N1VA 2AGSA 2DVDA 3D5OA 2D7FA 1BZWA 1QOOA 3JUUA 1CN1A 1C4RA 1GICA 3ZPYA 3WCSA 3POSA 4C1XA 3OYWB 2NM1A 2JE9A 1DZQA 5JOYA 1G9DA 1KDKA 1UKGA 3JU9A 1WLDA 4FPCA 3V65A 4Q1PA 3SISA 1GLHA 2CL2A 2DVFA 2VW2A 3SH3A 3D6EA 2DYCA 2ZABA 4AGGA 1DQ4A 1QGLA 3AP5A 3AX4A 1B09A 1NLSA 4Q1RA 3B9CA 4YLZA 3ZXEA 4BPZA 3ZXKA 1CVNA 1FNYA 1PZ9A 2A5ZA 4UW4A 1JYIA 5H9QA 4OZXA 3M2MA 2GMMA 2DU1A 1YYNA 1V6IA 4NOTA 1LEMA 3AXDA 5E88A 1W6PB 5IT6A 3RG0A 1V6JA 4XJZA 3WUDA 2C9AA 2GALA 3VKFC 1ENRA 4FQ4A 3APBA 3O0VA 1I3HA 2D6PA 3M1HA 3RSJA 2ZGNA 4YZ4A 2V5YA 2YXSA 2ARBA 1SACA 2ZGRA 4Y1VA 2A6ZA 4R9AA 1PZ8A 5HCBA 5IK5A 3A0NA 3AP6A 1LEDA 2D43A 1G9BA 3AYEA 4YZ3A 2EXKA 3BOPA 4XTMA 2YV8A 4XOGA 4XHXA 3VUOA 2EALA 1LODA 2A6VA 4WVWA 2WSVA 1LOCA 4YW1A 1LGNA 5IK7A 3V0AB 3FBYA 2ZGTA 1ZA4A 4FPEA 3WZ1A 3N7JA 1YI7A 1W6OB 3WLUA 2E53A 2P3JA 5GLUA 2VUAA 4BMEA 1GBGA 1S0GA 3OYWA 1JUIA 2JJ6A 3T1LA 4FPLA 5GZCA 1WBFA 4XZPA 1G9CA 1KJLA 3AYCA 5JOWA 5KXCA 2PELA 2DWRA 2P37A 4PCRA 4UW6A 1SCRA 1SFYA 3ZXJA 3RS6A 4Y22B 1QNWA 2AYHA 1VIWB 1HDKA 3FUOA 1KQRA 1QNYA 3B00A 1G86A 2TEPA 1ULCA 4PF5A 3ZYPA 4AVVA 1GANA 1N3PA 3AJZA 4XBQA 4GALA 2CNAA 4GWNA 4Q27A 2D6MA 1LTEA 1OKQA 4WVVA 1KITA 1Q8VA 4TYSA 2A6XA 2C5DA 3ILFA 3I8TA 3ATGA 1DQ2A 1X50A 4R9DA 3WVJA 1DYKA 3IN9A 2E6VA 4YGDA 2UU8A 2VW1A 2WT2A 2V73A 1UN1A 4LBNA 4YG6A 3VKMA 1WLCA 2A7AA 2GMEA 4WV8A 5L73A 1JYCA 4YG0A 2Q5TA 1IS3A 3OGGA 1A8DA 2PHXA 1DQ6A 3VV1A 4NO4A 5IUQA 3ZVXA 1FX5A 2NZ9A 3C2UA 3PVNA 1SLIA 4ZKTB 1GZ9A 1Q8SA 2D6LX 3AZYA 4FPFA 5AVAA 1LULA 1SLLA 1HKDA 1CESA 3WDUA 3IMNA 2W08A 4YM0A 4XDQA 4Q26A 2G4IA
chains in the Genus database with same CATH superfamily
1MZ6A 2JKBA 2PA7A 2WABA 3R0RA 5SV5A 5F39A 3U07A 3F2ZA 4PIYA 3WW1A 4B4PA 4EE2A 1BEV2 3V0AA 2YFZA 1R1A1 3CQOA 5LBCA 4CP9A 1HRV3 1GU3A 2WT0A 1LHVA 4N53B 1QQP2 2BFUS 4NMIA 4MV2A 3FE5A 4HBNA 1AR73 1Z0HA 3N3HA 3DXUA 2E7QA 1SBFA 1K3IA 4BYYA 5JSOA 3ACLA 2Y33A 5E8AA 3AZXA 2VOXA 4GA9A 3ZSLA 5JZGA 1IKPA 3VHRA 4CDXC 1AX2A 4CUCA 1S2EA 1MVQA 2GMPA 3S0MA 5C70A 5FPZA 4ZHNA 5FTTC 3FMGA 2R063 3U4XA 4HN0A 1EUUA 4UFLA 4AI3A 4P5HA 3HT1A 3LF7A 4QM9A 1L7LA 4V2WA 2W5FA 2WQ4A 1K5MB 3DL3A 3P5BA 4YVWB 4QM8A 2JB4A 1WCUA 2X29A 2OIIA 4DEVA 2PYTA 1AX0A 4HANA 4OZOA 1W9SA 4BM8A 1OLRA 5FP7A 2A70A 4XFAA 3AL6A 1OOPC 4FXKB 1XSRA 3HN1A 5IVFA 5JWPA 1K42A 5AFBA 1N1TA 2GH2A 1UF2C 2JG8A 2UURA 4AVCA 3UYJA 2CAVA 2OS2A 4WM7C 4HK8A 1WCDJ 4P08A 1UOJA 5FP9A 5A1AA 4B1LA 2R0HA 2OXBA 3RYKA 1ASJ2 1W0PA 2VTXJ 4Z2WA 2RDRA 2BFUL 5GLVA 4QX2A 3EMRA 4BQYA 4MUVA 1G9AA 1W0NA 1QJU2 1GV9A 2RVAA 4PLOA 2ZGMA 4S2GA 3QBQA 4CE8A 4C1WA 4K20A 5DZEA 2AH2A 3RMXA 5FY5A 3B02A 1AJKA 4A7YA 5FBJA 2XGXA 3WUCA 2FMYA 3JXSA 3RJRA 2DURA 4MGZE 4AHXA 1LGCA 1F15A 3W20A 3SKVA 4Z1VA 3GHMA 4XUTA 4CA9A 3THDA 5C71A 1W0OA 1GP5A 1MZ5A 2OPKA 1WW6A 1HN0A 5A32B 1H6XA 4JRLA 4Y20A 4DINB 1V6NA 4YM2A 2YBSA 1QJX1 3NL1A 5F3IA 1SLAA 2IXKA 1UX6A 3WG4A 4COUA 3FN9A 3AP4A 5ABJC 2DVGA 2HWF2 4INDA 2RR13 5FK8A 3W9AA 1ND2A 2EICA 1UL9A 1VBC3 2OUJA 5JMCA 2WRAA 1FMD3 2TNFA 4GH4B 1FOD2 2XBO2 5IWFA 1QXPA 5IVBA 1WD3A 4OMCA 3T3YA 2BQPA 4ASKA 4GMP3 5LZ6A 2YC0A 4P9GA 2VZRA 3OBRA 1UMZA 4BK4A 1ZZ9A 4ISRA 3PUIA 3CJIA 1R64A 2LALA 1Z7S2 4QD2A 1GNYA 1H9WA 4LK6A 2EF6A 4AI9A 4LO6B 1YLLA 1AVBA 2DCKA 2VQAA 3H0OA 3KS7A 1VBE3 3MLJA 4FFGA 2X5IB 4N43C 4ES8A 1Z7S3 3VBFC 4AVBA 1APNA 1QQP1 3N9MA 5F2SA 3V0BA 1KJRA 3THCA 1AXZA 2BNMA 1NCRB 4DMIA 5J1XA 2YBKA 2JG9A 2C9KA 2X8KA 3T4HB 5F7UA 2BGPA 2ARXA 5FREA 5KC5A 2WUHA 4EWEA 5A7WB 2WNUC 3UK9A 1WMFA 4DXRA 5JLVA 3VDCA 2QQOA 1ZA7A 1XNCA 1OLMA 5FZMA 1NA1B 2ZAHA 3MUY1 4JTOA 4YGBA 2B7YA 1R1ZA 1CAVA 2VMIA 2WS92 5HXMA 1JYXA 5J7MA 2VM9A 4MXWB 1IG0A 4XW3A 1D4M2 4HOOA 4AQTA 3NAPB 2Y6HA 4CXYA 4XFFA 2XUMA 1CZTA 2Z5WA 2D5HA 2KM2A 4QPGA 3BYWA 5HBAA 3FBMA 2JEMA 1QU0A 3I97A 1SCSA 1S0FA 2D3SA 2EA7A 3ZN6A 3IBMA 5L9VA 2HWC2 2ZBJA 3EYPA 2W2IA 1BMV1 3K3NA 2OT7A 1YFXA 1KS5A 1QJU1 4Q4W2 3VBOC 2IFRA 3WW2A 2CDOA 5FYZA 4A7KA 5C4WB 4Q0SA 3AP7A 1XQNA 3USUB 4BQ2A 1S55A 2D6KA 3DPRB 4CEYB 1CIWA 4NIAA 2SBAA 1PGL1 2HEYF 2VE1A 3CLPA 4HONA 4WM8A 5A7QA 5T54A 4CDQB 2VUCA 3TEXA 2WO3A 3A22A 3VBRB 1NG0A 1Q5OA 3U37A 2Y6FA 2ZHKA 3FL7A 1R083 2RJ2A 2MNGA 5CKMA 4ZU7A 3DYMA 5E1RA 2YROA 1FOD1 2XBO1 1URXA 2PHTA 2YGLA 3CDZB 2AREA 1FYUA 4IV1C 4W65A 3TAYA 4BQXA 1BYHA 1ZYBA 4MGYE 5FLJA 3MGUA 1LRHA 3N9OA 5KXDA 5J48A 2NP0A 1UIKA 1HQNA 3POGA 4XVHA 2BUKA 2VO5A 4AHWA 1J3RA 1RYYA 1DHKB 2IVJA 2MPFA 3CBNA 2PLV2 1I1EA 3G6JB 3Q8EA 1DGLA 5HV0A 4YG3A 2WZ8A 3AYDA 3FZ3A 1H8TA 3POJA 1PZ7A 2WWJA 4K40A 2WQZC 4YVSC 5IHRA 3T30A 2OKXA 3POYA 3GCXA 4W6XA 2HWB2 3IWZA 3WNKA 4FFFA 4OUSA 5JR2A 5EPAA 2VMEA 3T2PA 4W4ZA 1S0IA 1W8HA 1LHUA 4TTGA 3ITQA 1XB9A 2IXCA 4FO9A 1PIV1 1ALYA 4JC1A 4O65A 1OQ1A 5BPXA 3ZFFB 1UD1A 3TEYA 5KWRA 5SV8A 1W6MA 5BNPC 3LSDA 4QHZA 2A6YA 3AJYA 4Y4RA 2IUWA 4IESA 1MQTB 5FJKA 5FY9A 3B01A 1VBB3 1LECA 4LUMA 4W6YA 4YW3A 1COV3 1D4M1 1US3A 3T2OA 4OI2A 4UBGA 4XUNA 3N7MA 1IZ3A 3RRDA 4YFZA 5GZGA 5LK7B 2VJXA 2JDAA 2RS52 4M3CA 4Q0QA 1VRH2 1E5IA 4RS5C 4YWAA 1WW5A 2WNEA 5T5JA 2R6QA 4CCCA 1CD3G 4TN7A 3H8RA 2HJIA 1NE4A 1KFUL 1E5RA 1PO23 1AYM3 4A3XA 4BXFA 4DY5A 5LY2A 4LULA 2ES3A 4Q4W1 1YFWA 3I3MA 3MIBA 3JBG2 4EN8B 1ZVFA 4QGLA 1UOBA 4JAAA 4IL7A 5DDJ1 5G04L 3GZAA 2NPIA 3E5QA 2ZJCA 2OA2A 4IE4A 3MHZA 1DQ0A 4PLNA 3WQBA 5JCTA 4YW5A 4BLIA 4UT5A 3MEPA 2BW8A 3OPZA 3DYOA 2DTWA 3GCWA 4QXBA 4YGEA 3WHUA 3MW4A 2RS32 4IQPA 1ULPA 3IAPA 4AR2A 1VPHA 4OHVA 1TNRA 1W8ZA 2BNNA 2P17A 4ZY9A 2EIGA 1Q8PA 5J98B 4XFCA 1QH6A 1SBDA 1YWKA 1ZNPA 5FZFA 3MV01 4DPNA 4TSVA 5FBZA 4CDWA 3JD71 4M4PA 4R4ZA 2B45X 4CCLA 3D82A 4P9YA 2WA4A 3VBUA 1QHDA 4MGIE 1OD5A 5AC92 4N9IA 5A7OA 2W1UA 4PIZA 2C0ZA 3FLTA 2R1DA 2CGNA 1CPNA 5T5PA 3UV9A 3NV1A 1V6LA 1GQHA 5FMBA 4FTEA 4AVSA 4NIGA 4COYA 1Q56A 3MF9A 1EV12 2JD4A 4NHMA 4G3YC 2A6WA 3O5SA 4OLLA 4XFGA 1GR3A 2ET1A 1GYKA 2C4XA 2WL1A 2YPDA 4P9LA 1JN2P 1SPPB 4V1PA 5F5IA 5F8PA 5L9BA 1JI6A 1RUH2 2D40A 2E7AA 3OUJA 5FMCA 1RMU2 1OQDA 1XU1A 3CO2A 3NMBA 4Z82A 1V6KA 4AI2A 4YFWA 1AXYA 1WCSA 2BOIA 1DGRN 1W8NA 4Q4X2 2F6BA 2VAUA 2QVSB 3PVEA 4XF3A 5FZ7A 2FCUA 4FP2A 4RYDA 5LBEA 4ZXKA 5FIXA 4L2NA 4LA2A 2JE8A 2RS51 4S2DA 5EJ1B 1VRH1 4LHNA 3R6SA 1F4AA 1J1LA 4DB5A 1PK6B 2DF7A 2EAAA 4DY3A 5K7PA 4B4QA 2FZ2A 1CZVA 1Q8QA 3I2GA 4W6WA 1TZOA 3GBGA 5JPNB 4XF1A 1RUOA 2W1SA 1GNZA 3TN93 1U5ZA 1DGRA 3K51A 2FZ1A 3I2DA 5CYYA 1Y43B 1GFF2 2RM23 1POV0 3NW4A 1MS9A 2HWD3 2ZA9A 3U10A 3WP4A 1T2XA 1CX4A 1F4HA 3X29B 2ZGUA 5C9AA 2VH9A 1MEC3 2VMHA 4RSUA 1HQWA 1KRIA 1LOBA 2BU9A 4JKLA 2GZWA 3GJAA 2Q1ZB 3ZXLA 5A33B 4RHV3 2RS31 2XLGA 4QX3A 5LCWL 1IOAA 2D6OX 2Z4FA 5GM0A 3HJRA 2D3RA 2WZR1 4IV3A 2J7MA 5JI9A 4LUKA 2QQIA 1ZBE3 2XL9A 4AFCA 4HT1T 1RXFA 2X05A 4CEWA 1AHSA 2OZJA 1AX1A 1CPMA 1AR63 1POV1 1W9WA 2QFEA 4N9HA 1YO8A 2CHHA 3C7GA 1HB3A 4ES9A 1W2TA 3WQ7A 2D7FA 1QOOA 3VZLA 1AYN2 1CN1A 1C4RA 3ETQA 4YSFA 2VXJA 4HG6B 3JQWA 5FZOA 1TE1B 1ZBA2 4E4ZA 3OYWB 2JE9A 3LA3A 4QGNA 1UKGA 4XUOA 4FPCA 1HRI1 1RUJ3 4Q1PA 2DVFA 1XSQA 5JMOA 1XU2A 4Q4V3 3M3IA 2ZABA 4IEUA 4AGGA 1EV11 5ANNA 2WLPA 5KHGA 3KB5A 1XE7A 1B09A 1JTZX 4XUPA 1RHI2 4QPIB 1HN1A 2OQ6A 1EP0A 3OGRA 1RUH1 4CYDA 5I8SA 3VBSB 4OZXA 5EV7A 2GMMA 1RHI3 3RYRA 1YYNA 4AEDB 1V6IA 4NOTA 4ZZ8A 5D21A 1IHMA 5E88A 3EHKA 5FZKA 3MIFA 3LA7A 1IPSA 4FFIA 4ZPIA 3RG0A 4ASLA 4BE3A 3W21A 3POFA 4XFHA 3S30A 2QDRA 2VBDA 3APBA 4QX8A 2D6PA 2R30A 1NCQC 2ZGNA 4YZ4A 1O3SA 3KHBA 2B5HA 3LPGA 2OZ6A 2ZGRA 1SACA 4LKDA 1SMVA 5FZBA 1CAUB 3HN3A 3LEIA 3PTYA 3MZHA 3A0NA 1KD7A 1G9BA 3AYEA 4CPBD 3ELNA 4XOGA 2YV8A 1XNBA 1K5MA 4YVWA 1C8NA 4XDPA 1NLQA 2WFPA 1S2KA 3RZLA 2Y0OA 2ZGTA 3I54A 5BUVA 1W6OB 2DFCA 3LEGA 3S7IA 5GLUA 1BK0A 4QHOA 3VBHC 3OUHA 3GJBA 4E9KA 2JJ6A 3T1LA 4B4RA 5CG8A 2EVXA 4JGYC 4Q29A 1TMF3 1UY2A 1WBFA 3DYPA 3LEKA 3AYCA 1ODNA 3I2KA 1D2QA 1L3JA 4S2HA 2Y8KA 5EZWA 1RUG2 2P37A 5ERLA 1RJ8A 4UW6A 1SCRA 1SFYA 2VNGA 4QXKA 4AW7A 1B35A 4Y22B 3RS6A 1QNWA 4CDXB 1PMJX 1HDKA 3FUOA 1J3QA 1KQRA 4QQOA 3PIJA 3WP6A 1G86A 2TEPA 1ULCA 4PF5A 3UETA 3WNLA 1GANA 2CNAA 3H3ZA 4L11A 3AB0A 5FYCA 3PL0A 2C5DA 3I8TA 3ATGA 1DQ2A 1UIJA 1X50A 4KWLA 4Y33A 4URTA 4YNIA 4OFGA 1DYKA 2BGOA 4I0AA 2XH6A 5FPXA 2V72A 4XF0A 5JXJA 1XE8A 4YG6A 5FP8A 3SCGA 3VD9A 1WLCA 1ZBA1 4WV8A 1OOPB 5L73A 3WD5A 4CXWA 1HB4A 4YG0A 1VB2A 2W3JA 1IS3A 1EPZA 1ZRIA 5FQ0B 1O5UA 3ZYJB 2QQWA 1NX9A 2ZX1A 4PIXA 3U11A 3VV1A 4WM7B 1W06A 2VUJA 2XKOA 4GULA 4ZS3A 4OI0A 4GB32 1PO11 3AZYA 5AVAA 1A34A 2B9VA 3GM8A 4JZRA 1CJDA 4H7LA 2E32A 1WCQA 4XETA 1YC61 1K5JA 4LITA 4Q26A 2G4IA 2R0FA 5T50A 1V6MA 2VZUA 4C90A 3ZXFA 2Q8OA 4O9EA 3H7JA 4A6OA 2WT1A 2J1SA 1I5PA 1WLWA 3BOWA 2X5IA 3ON7A 4RFRB 5KC6A 1OSGA 2YDEA 2ZEZA 4AQSA 3K3OA 3RI8A 5JZGC 1ZZ8A 1VBD2 2A73B 1ULDA 2WFF3 3KT7A 4HETA 4AGVA 1RUE2 4H55A 4LKSA 3HIFA 4ITCA 3M4FA 5CFDA 2WO2A 3Q8AA 1ONAA 5HV4A 5ABJB 3NWKA 2R042 4P00B 2CSGA 3OBZA 4QKNA 1VMFA 3UL2A 4QKFA 2XWBB 5KHJA 3J9SA 1NE6A 2D97A 2P34A 3AMQA 3DXTA 4NHKA 3OPTA 4FTSA 1MS0A 3ZXGA 2O8OA 4ISQA 5FZ8A 4NIIA 3I2IA 4V2VA 3AZWA 1VBA2 2E31A 2Q4SA 2Y60A 3CZUA 3HBKA 2DCJA 3OSDA 1PVC3 4HVRA 5FXXA 1N3OA 3DECA 4XBLA 4OHZA 2VCCA 4KH9A 1HXS1 1W2UA 5F5CA 3OOXA 3VBFB 4AK3A 1GQGA 2Y6JA 3PMEA 4XEZA 3ZXDA 3C7EA 3POWA 3ACGA 4EZ4A 3ILNA 3CZJA 1VMHA 4YYOA 1RUG1 3D0JA 3S7EA 5IK4A 5DPNA 1V9U2 3J8F2 4K21A 5CVRA 5M0TA 1UNBA 1JZ2A 1HV0A 3HQRA 1DGWX 1QXJA 3AZZA 3LKJA 4NR1A 2WNUB 1D0GA 4CZSA 3ACIA 4AEJA 3LAGA 2R1BA 1NUKA 4UW5A 3USUA 4F83A 1O4ZA 4D3WA 3DPRA 3LE0A 3AKRA 4CEYA 4CDQA 4JDOA 4XJ8A 5EQUA 1O8PA 2VZOA 4BXSV 4AXOA 1UZVA 2RS12 5FO8B 5DAPA 1UY4A 4NPRA 4FPJA 3IDAA 3VBRA 4CCEA 4JCKA 3WW3A 3MW3A 1AXKA 1RUD2 4QPWA 2P3KA 1C8M2 1QY4A 1PM4A 2P5BA 2VZSA 4K1YA 2AZ5A 4GB31 4LEJA 3CJIC 2I74A 2FCVA 3UJQA 2YZ4A 3T1MA 4AE2A 2FHRA 4N7UA 2FMDA 3NJXA 3VBOB 4UF0B 3U0ZA 3FX3A 3LFMA 4PDWA 2W1WA 3O12A 4OQ8A 3LZZA 4LORA 1QOTA 4SBVA 5CG9A 2VVFA 2YGMA 2DFBA 3N7KA 1EAH2 3H8OA 2W39A 2D98A 4GIQA 5F3CA 2R072 1VBD1 1EAH3 1QDCA 3E6DA 1LU1A 4LK7A 2GNBA 1RUE1 2OW4A 5BNNA 1QJY2 2VBBA 4MXVA 2VMCA 5CIRA 1LAJA 2YUEA 4PQ9A 1UU5A 2WA3A 2Y64A 4L0PA 1I5ZA 3NNJA 2QQKA 4XILA 1IS6A 4JDNA 3ZIXA 3JB4C 1DGWA 3O1RA 3RPQA 4RGKA 1MQTA 4IV1B 3ABZA 3M70A 1UU4A 1V00A 1OXCA 4LBQD 4F3JA 1WLTA 3HVDA 2HEWF 4E8CA 1VBA1 2FDHA 1AR93 1DCSA 1F8VA 1R091 2OPWA 3T0BA 3ZOIA 5BY5A 4CCOA 1DBNA 1DIWA 1HB1A 1RJ7A 2WN3A 2YPJA 3ZN4A 1SQ4A 2XJVA 4GWJA 1X8EA 1JZ3A 3PUQA 4YVSB 3AXEA 5JXHA 3ZFGA 3WG3A 1W8FA 2RMU1 2NN8A 2W52A 3KQRA 1M06G 2XMLA 1S0EA 2C24A 3NRUA 1V9U1 3J8F1 2VL4A 5EWSA 4QB2A 4C0BA 5F3EA 4LO4B 1K12A 5CFCC 1QKQA 1HRV2 2UWAA 4IEQA 4PHZA 3ME2A 1DZTA 4RR3C 1H2KA 1JYVA 3BALA 2QQJA 1AR72 5BNPB 3Q8BA 4O9GA 4ATEA 1X33A 5E89A 3VDDA 2UY9A 3RVHA 1OC1A 5CADA 1O3QA 3DGTA 2CGOA 4XE9A 5DUVA 1JHJA 5JVVA 1MVEA 1S0DA 2JENA 1YJKA 1XC6A 2AEZA 4LOSA 5CKQA 3EQEA 3SMHA 2EXIA 5DUXA 2HKXA 4MGQA 2R062 4RS5B 2VQTA 1C8M1 1CZSA 2H0BA 3U14A 2XXZA 1AUYA 2VTFA 3WW4A 2R16A 3SCHA 4D69A 3N9LA 5A7NA 5KXEA 5K0UC 2LW8A 4JQTA 3KCXA 2TBVA 1YQ8A 1PX4A 4I2OA 3KCCA 1W6QA 2Y38A 4LO7A 4IEPA 3V56A 3ETPA 1HW5A 2W46A 3MUZ1 3WT3A 1RUNA 1RVF3 1JZ8A 3ES1A 4TZDA 3WNXA 4NAOA 4LBKA 4PBPA 2ADDA 4F8AA 2UYAA 1X8MA 3P1IA 4CDUC 4BDVB 1JZ5A 4AYUA 2R071 2QKDA 4BQ1A 4B29A 4DUXA 3BGAA 1LU2A 4XUQA 5FPVA 4QHBA 1J1TA 4Y5Z0 1W2OA 5L7OC 2A3WA 4GKYA 3CHXA 1OKOA 2JKXA 4JV4A 3ZPOA 4LO8A 1FATA 4NPMA 4Q2FA 3B94A 5EYYA 1CONA 1XOYA 2ZTNA 2VCAA 1LR5A 1QJZA 2JICA 2WIIB 4UW3A 3WG2A 3RI9A 5FY8A 4R8HA 1NZIA 1CAWA 2Y26A 3NV4A 3PIGA 1RINA 4FI9A 4NAMA 4BQ5A 4EWDA 3ZLIA 4FOQA 1SEFA 2XQXA 1O3TA 2FDJA 2H0VA 4D6RA 2AEYA 4DFSA 2CWSA 5FZGA 2AC1A 2WJSA 3NNLA 2RR12 4E2QA 1VBC2 4JHTA 4K7JA 4I3GA 1FMD2 5LA2A 4D6SA 1PK6A 4EYUA 5JSPA 3WR0A 5FFOC 4MVTA 2Q1FA 1D2SA 3FC0A 1DQ5A 3ZDVA 3A23A 3HNBM 4XQWA 1RUC3 4FPYA 4IE6A 5FXWA 1UAIA 1O6UA 4D8MA 2CWMA 4TXWA 1VBE2 1HRV1 3LIHA 2ZKLA 4P9WA 2W94A 3ZFEC 4RQPA 1WCKA 3NQHA 4SLIA 1BEV1 4ZU5A 1AR71 2VMDA 3NNMA 3NV2A 3ZMNA 2PFWA 1F31A 3RQ0A 4BK5A 5FYBA 4AFMA 1F35A 3BPZA 2MHFA 3HQXA 1LHNA 4X8PA 3O0WA 2FQPA 1ENQA 1OLQA 2DTYA 2ZMNA 3INAA 3KT4A 3R4DB 4Y1UA 4BOWA 4D94A 1REEA 1XBFA 3M7AA 1ACCA 1JU3A 3PNAA 4HN1A 3ZSKA 4QQPA 4FCAA 5H9RA 2JDNA 3OBAA 2PTMA 4IERA 3VBUC 4FPHA 1KEXA 4K8RB 1JZ6A 4ZS2A 4GD4A 1GZTA 5A7PA 1L7QA 1JU4A 3H1WA 2WZEA 3N9NA 4K6BA 1HX6A 4C0HA 1XNDA 3HMYA 3WOGA 5F9TA 3UKTA 4XXPA 2K2SA 5BNOA 1YQ6A 2OQ7A 2WNVB 3IPVB 4ASMB 3LD8A 3M3EA 1A3KA 1MACA 4IW3A 2VY0A 1WD4A 5EFUA 1CWPA 2WSUA 5A6ZA 2WWUA 4CU9A 1ASJ1 2EXHA 1C3HA 4JTNA 3ZKYA 4QPIA 4QXCA 2D93A 2DU0A 3V64A 4LBJA 2D5FA 5JAXA 1IGOA 1E5HA 1QIQA 1UQXA 2GNMA 4AEDA 4QXHA 1J83A 1ND3C 1OFNA 3TWIA 1XYOA 1ENXA 3KV9A 4RA0A 2W68A 1BHGA 4H3WA 1S0BA 3WDWA 1HQLA 2GC0A 1QJEA 3FHIB 5C5TA 3N35A 3AFGA 1R082 5HCFA 5LY1A 2RR11 4LHSA 5FYYA 4DUVA 2ZX4A 5F1RA 1VBC1 4QWNA 1FMD1 4DXTA 2RE9A 4DNYA 1PGW2 3NV3A 3MIDA 2HWF1 5EXOA 1ZZ7A 1PGSA 2FDFA 5GZFA 4AVTA 5B4NA 5HCHA 3FJSA 1XRUA 3H3LA 2ORXA 1LOFC 1AL0G 4NWWA 5A3MA 4LBQB 5BNQA 2LM3A 5C8CA 2Y0IA 5C9AC 3D3AA 1Z78A 4UFHA 5DDJ3 1JZ4A 1Z7S1 5I0RA 1O4TA 4KGGA 2VZ1A 4NRPA 4YM3A 5HCAA 2UY8A 3SITA 1CQ9A 5FDBA 4CTEA 4MADA 1POQA 4KBBA 3TNQA 3KGLA 5A6XA 4XIKA 1MS1A 5T55A 3OF1A 4CCKA 1OH3A 3HNYM 3UKNA 1OUSA 3VHNA 4Y5SA 2RHPA 2JB8A 4CEWC 1CJPA 4BQWA 4FPOB 1JBCA 1NCQB 2BEOA 4Y22A 4CDXA 3AP9A 4DRRA 4EV0A 3AFKA 5LB6A 5K4LA 1BBT3 4IEYA 5F5AA 5BXXA 4LBMA 4ZZ5A 3OJBA 3WCRA 1MZFA 5KBFA 3KVAA 1VBB2 1E5SA 1IG3A 1COV2 3JD73 2IXLA 2DVDA 2WS91 4GZ9A 4JKKA 3T0AA 3WQ0A 1OHFA 3POSA 2ARCA 2E9QA 4LTAA 2NM1A 1KDKA 3VBHB 1WLDA 1F5JA 2VOVA 1PO22 5L36A 1ULOA 2ORZA 4WM7A 1AYM2 2Q0AA 3DF0A 5DAXA 4JGYB 1DQ4A 1DU3D 2BBAA 3AP5A 2H6BA 3AX4A 3LIGA 4UXAA 3UESA 4DIQA 1NLSA 4QQLA 2HWC1 3B9CA 3K48A 1YI9A 4YLZA 5A80A 1CVNA 1PZ9A 3ZXKA 2YU1A 2VOWA 3TYJA 5CZKA 1JYIA 5FP3A 1GWMA 5H9QA 5E6HA 4JGZA 4I02A 4IEXA 5FMOS 4HFSA 3AXDA 1UO9A 1YUDA 4X6RB 4QQHA 1LNSA 4Y3OA 2QQVA 1OA4A 3J7LA 3KGZA 3RGBA 4NIDA 2C9AA 4NJ4A 2J42A 3I59B 3G7DA 4XF9A 1AR83 1G6NA 2XHKA 5FZHA 1I3HA 1R081 3M1HA 3RSJA 5EHDA 4E2GA 4KGQA 5HCBA 3VD4A 1RTVA 4R9AA 2XVGA 3K4AA 3AMPA 4IE7A 4OCTA 5ABJA 3VZMA 4IEVA 1X36A 3WF1A 3AP6A 1LEDA 2D43A 1SZBA 1OA3A 3Q8CA 4YZ3A 2EXKA 3VUOA 4XHXA 5D8AA 5JIUA 1LODA 4WVWA 2BBVA 3U4SA 1I9RA 1H4GA 1L7RA 3V0AB 2B39A 4OQ9A 2R7EB 5ISLA 1YI7A 4N8MA 3WLUA 3K77A 1GBGA 2G9FA 2PLV1 2XLFA 2J1TA 4N43A 3NJZA 5FMOL 3BTZA 5FO7B 2HYXA 1G9CA 1KJLA 5JZGB 2P1BA 1B35C 5FZ4A 1TME2 3BUCA 1PX3A 4ET7A 2FBEA 2HWB1 3MIEA 4CUGA 4AFAA 1M4WA 5FPAA 3MF6A 4BU2A 2WZR3 3ZXJA 2RDQA 3W5NA 1VIWB 4C91A 1TME3 4IEWA 5EP9A 2V4VA 3ZYPA 4QKBA 1NZCA 1H2LA 1W9FA 4BHPA 4FAHA 3NKGA 2WWSA 4IGQA 1POV3 4OI1A 1OKQA 2XJQA 1Q8VA 1COV1 4DUWA 5I0DA 1UYZA 4Q0UA 3SEEA 3OGJA 2EIDA 1GP4A 4J6GA 2E6VA 2WN2A 3PU3A 4YGDA 3WY6A 5F6KA 3MLKA 4LBNA 2V5DA 3C3VA 3ZYGA 3VKMA 4IUGA 5IAXA 1S4CA 1JYCA 5FZ9A 2XHNA 2WAAA 3ZO0B 2JDUA 2DCTA 1PO21 4NO4A 5KR7A 5C33A 3C2UA 4Q4Y3 1GZ9A 1Q8SA 2D6LX 4XCBA 4KNCA 3TN92 1SLLA 1CESA 1PMHX 4LXLA 5CKNA 1HB2A 2RM22 4XDQA 2HWD2 3OGSA 2WNOA 3VBOA 2ZOEB 4D7SA 1XE0A 4J1XA 5J96B 3JBG1 5JR7B 4QX0A 1UZ0A 5GLWA 1MEC2 1SDDB 3BODA 5TSWA 2VULA 5C7GA 2WNVC 3HR9A 5LW9A 1MS3A 4RHV2 3S5QA 2ENRA 2VW0A 5B2GB 3BTXA 1LKNA 3VD7A 3PUSA 1VB4A 2WKKA 1DG6A 4AL9A 1XYNA 3PHMA 2QUOA 1ZBE2 4NVPA 5DZGA 1S0CA 2QTWB 2UWBA 1AR62 3WXPA 2BOJA 3FWEA 3PVBB 4COZA 2Q1MA 4DRVA 4QMAA 3PDQA 3LGRA 3ZKUA 1YCIA 3GBWA 1OBNA 1F9KA 2DVBA 1HV1A 3CJIB 4LBOA 2G1MA 2YYOA 4OI4A 3OPWA 2ZKNA 5FMDA 3LEMA 4N90A 3MPPG 1BVVA 2PXJA 5AC91 1UOGA 3V0BB 1RUJ2 2OYZA 1W04A 5FLIA 3BU7A 4Q4V2 5LA9A 4ARXA 3WF3A 1H2MA 2JE7A 1IQAA 3EB7A 1GZCA 3NNFA 4HKOA 2FDGA 4Y5TA 1S2BA 4MH0E 1RC6A 1RUI2 3ST7A 1ULFA 2ZX2A 3HEIA 2P3IA 2HBUA 4XJUA 4GKXA 4LMFA 4AQ6A 4YARA 1FPN3 1RUI3 5FXZA 5FJHA 1CAVB 3TEWA 4EWAA 1MZEA 1Y9QA 1RMU1 2VZTA 1UYXA 4BQ4A 3RZKA 1WMEA 3E6CC 4N53A 3P3PA 2XJUA 4QAWA 3K2OA 1H30A 4LT5A 1EUTA 1JMUB 1U0AA 4A41A 5A1LA 2QQMA 4QPGB 4MYEA 4Q4X1 3WV6A 1C1LA 2QZ2A 4EN9B 4KWUA 3S5AA 3WG1A 4P9XA 1A78A 5C3QA 3WDTA 4RS5A 3WDYA 3LA2A 3UT0A 1ULEA 4OUEA 1NT0A 2P2KA 1WW7A 5I0UA 2HWE3 3TN91 4HSLA 4PDWC 1W05A 4KMQA 2PAKA 4R9CA 2F17A 4JKMA 1KXGA 1UY1A 2HWD1 4XURA 3S6PA 2WINB 4QX1A 5FYUA 3VZOA 5IJRA 1SFPA 2GSYA 4R52A 3USSA 5CFCB 1SLTA 2C26A 4L92A 2HLEA 1KFXL 1MEC1 1YIFA 4WM8B 2VVEA 1NXD1 1W9TA 3ZSMA 3VDBA 3RZHA 3WNPA 4RR3B 3H8XA 1TMF2 2PQSA 3R4SA 4XJWA 5BNNC 3A0KA 5JUVA 2P3YA 2VECA 3D0SA 4PI0A 3ASIA 4QQ2A 3M8LA 1GZWB 3MW2A 3ZX7A 4I09A 1JODA 3BCWA 2DVAA 4PI2A 5LK5A 5AFEA 3OD4A 1ZBE1 3LCPA 3OBTA 5JXIA 1OVSA 3CMGA 1G9FA 2VOTA 2JECA 3KVBA 5JOZA 4QGMA 1NAEA 3HT2A 3DUIA 2XR4A 2ZMLA 1ENSA 2W92A 1FNZA 3LQCA 4JHZA 3P3NA 4DXZA 5K0UB 2HYKA 5LBFA 3SNMA 1VAVA 2ZACA 5CU1A 1MS5A 2BRTA 3DKWA 3EBRA 3QCWA 3VZKA 3E1F1 2J1AA 1AYN1 4JRAA 5A32A 2IZWA 1PVXA 1RUJ1 1BKZA 3EJKA 3PMSA 3ZFGC 5DXDA 4Q4V1 2BJSA 3IM0A 1HXS3 2V09A 3K4ZA 3OTFA 1DYPA 4XDOA 4Y26A 1LOAA 2MEV2 3ENRA 5T52A 4CDUB 4FOVA 1JOBA 5C3PA 5A3OA 4GH4A 4HLTA 3ZYRA 2DCYA 4CCMA 4OUMA 3DN7A 2MEV3 3KM5A 4I30A 5FY7A 4H7MA 5L7OB 3H8UA 1RHI1 2VNVA 3BI3A 4HKLA 3OEBA 1W6MB 5DABA 3VDDC 1JOPA 2GC3A 2RDNA 3KWVA 1BLZA 1AL23 2QE3A 4WZCA 4MGSA 4XJAA 4BA6A 4CCDA 3A4UA 2JDKA 3B5LB 5FAXA 2WFF2 3ZXAC 5A6YA 3WNOA 4OHXA 3FFZA 1W2AX 3WF2A 4GJZA 4M3CB 1NCRA 5JDBA 5FRAA 4GJYA 1LENA 3I3QA 1UPSA 4NHLA 3K46A 1N1SA 4K1ZA 5C5UA 3HNMA 4LBLA 2XJSA 5A7WA 3T08A 1CGPA 4GQ7A 2J1VA 1EYBA 1OLME 2ZGSA 3J7NA 3VKLA 2I2SA 2C1FA 3UGGA 1NA1A 1O3RA 3VLBB 1Y9GA 4DXSA 2OX0A 1UYYA 4CP1A 2PAMA 2ZZQA 1PVC2 3FLRA 4MXWA 4WBBA 2JG8C 4XACA 5DAVA 4YZ1A 5FPBA 2I07B 1I6XA 3NAPA 1WW4A 2JWPA 1VALA 1VMJA 5F6LB 3ZFEB 4AG4A 4QB1A 5FO9B 2TUNA 4LE3A 3C7HA 4XTPA 3THTA 1GKBA 2QZ3A 4A44A 1ZRRA 3N4MA 3KZ4C 3BPSA 1HIXA 4GWIA 4NROA 1NQDA 1O59A 4D6QA 4RL7A 5FZ6A 4FQZA 4XJ9A 2WO7A 3T09A 4A2UA 1XNTA 3LFIA 5C4WA 4CDWB 4MX3A 3AKSA 3BVCA 1C57A 1UZZA 2LTNA 2VC9A 2PHWA 1VJ2A 1IKQA 4Q0VA 1BCXA 3GZTB 5GZDA 3VBUB 4MSVA 4B1MA 4E27A 2WQ8A 1OMIA 5C3SA 4PBOA 2O8QA 4YZ2A 4XBNA 3U1XA 2BPA2 4DQAA 4Z2AA 3UJOA 5T5LA 4IDZA 1R093 2LRPA 4D0QA 1ND2C 1NY72 3DEMA 3HOBA 3N7LA 5L19A 4ARYA 5CB7A 3RMYA 1RUF2 2DUPA 1PM7A 4M0NA 1IPJA 4XMAA 3RZMA 4WZFA 2CU5A 5H9SA 1RIRA 2V4AA 2VNOA 2RMU3 4HL0A 1RUF3 4Q8LA 5FYSA 3OY8B 1YXWA 5FR3A 2E7TA 1SBEA 2P4EA 2Z69A 4LBQA 5I8TA 4QU1A 4RQPC 2J1RA 3DV8A 2GC1A 1J84A 1UX7A 4IE0A 5IAVA 4UI9L 1PHMA 5A3WA 3RJ2X 4O61A 1R1A3 2QCSB 3A21A 1ND3B 1AZDA 1QH7A 2GN3A 2XPJA 2YB7A 2JG9C 1H0BA 1LESA 1S0JA 3I2JA 5FYMA 5GLTA 5IVEA 3AC0A 1GSLA 4AHYA 4P02B 3RWNA 1XPWA 2ZHNA 3OUIA 3BN6A 2PHRA 1JOJA 1WA4A 5HI0A 4JQRA 3TRSB 2ID4A 4HMZA 1NCQA 1O8SA 3AZVA 3ZSEA 2B4KA 1ZRFA 2GDFA 4NHYA 3J7HA 1BQPA 3O1UA 1W6NB 2QDNA 2R041 4R9BA 3ZFFA 4FT8A 4PF1A 1T6GC 5FUIA 4CSWA 3RNSA 4DS0A 4MZUA 3GYDA 5GKAC 3OB8A 5BNOC 1AR92 2VCBA 1SHWB 2FCTA 2ZX3A 3KD4A 4JVAA 1PVC1 4KQ7A 5C9AB 4QPGC 3HPNA 1G7YA 1YRZA 3NVCA 4M3CE 3ACFA 4YGCA 2ERFA 4GWMA 4B3NA 2QQNA 3AMMA 4GAZA 5I93A 4EZHA 4IEOA 3H1YA 4QKDA 2HH9A 1WWYA 4JGYA 5DUUA 5FOBB 1QOSA 1N3QA 1IS4A 3H9AA 4MOAA 1RITA 2JDPA 1GOGA 3C7OA 4AOCA 4CEWB 4I01A 3MI8A 4FFHA 1LOEA 3SEPA 5LWBA 1GUIA 1N1YA 4UFIA 1XXNA 4WM8C 1WGPA 5A7SA 1C1FA 1UZYA 2PMWB 3L2YA 3ZYHA 2VZVA 3LPFA 4XAAA 1JXNA 4KBZA 3N9QA 3R05A 1W90A 1F5FA 5G05L 3VKOA 4FP3A 4LE4A 5FZOB 1QJX2 2PHLA 5JI7A 4IGPA 3ZYFA 5A6QA 4QT6A 4KWJA 2KR2A 2RS11 2D6NA 1HJFA 1UYPA 2QBXA 3WF4A 1NY71 5A3PA 1QJX3 3RDIA 1RUD1 3H3UA 2VXRA 3O1VA 2FD8A 4QPYA 5A3NA 2XKPA 5GALA 2IFWA 3PLQA 5FY0A 4K3UA 1W8UA 2WLQA 4HKWA 3ILRA 2EIEA 2G9ZA 3ZMOA 5C8CC 2CTVA 4OYUA 3I3EA 3CEWA 3MBWA 4XHBA 4AEMA 2W47A 4CUAA 2XDVA 4MG2A 1OQEA 3O1TA 4HVOA 5A3UA 4MHRA 5F5QA 5FZDA 3LOIA 3LOBA 4BCUA 1ZM1A 1RVF2 5IATA 1CX1A 3T0DA 2QQLA 1RGSA 5T3NA 2O0OA 1BEV3 1H8TC 2JIGA 3SHRA 1LOGA 2VG9A 3UKVA 2RG4A 1EAH1 1QQP3 4Q5OA 1WBLA 5D2AA 5C3OA 2ZAAA 1W3VA 2O1QA 4NIHA 4I0WB 2ZHMA 2DUQA 2Y6KA 1QJY1 3P6BA 1MS8A 3OGVA 1SLBA 1VAKA 3EO6A 5F37A 2PHFA 1LGBA 1SPPA 3VD5A 2Z2SB 2GAUA 2VOKA 2PHDA 4ONUA 5IVVA 2ZGLA 3FHQA 3DCQA 1N1VA 2BP6A 3J4UH 2YC4A 1H6YA 4AFBA 1BZWA 1AR91 3ZYIB 1GICA 1SFNA 1UCXA 3WCSA 1REFA 5KHHA 4YW6A 5IVJA 1G9DA 4XF4A 4CCJA 2VR4A 5FZ3A 3MPBA 3SISA 4E2SA 2CL2A 4RFT0 3POBA 1BMV2 2B46X 3BIEA 5L9RA 2YU2A 1RUC2 1B35B 3I2FA 1ASJ3 1NOVA 4JGZC 1MPXA 3ZXEA 4BPZA 2BTVC 4A3ZA 1QJU3 5APAA 3AVRA 1KS4A 2O14A 1PGL2 2RV9A 3N9PA 4S2FA 1LEMA 5FKBA 4AVAA 1HJGA 3IAQA 1W6PB 3SXWA 5IT6A 5LEKA 1V6JA 1X9PA 1H1AA 4KU8A 1IQDC 4UYBA 4QDQA 4XJZA 5HXVA 4B8EA 1UMHA 3VKFC 3B9IA 1ENRA 4FQ4A 3O0VA 4PJYA 3VDAA 4LLOA 5LA0A 5A33A 1Q43A 5C6CA 5C8WA 3B93A 2IC1A 4MGTA 2Q30A 2ARBA 2W95A 2XJRA 4RGAA 5FPLA 4CVUA 1PZ8A 5J3UA 2WR9A 2HWF3 5D8AC 2R061 1X7NA 1BK1A 2E26A 1NKGA 3AKQA 4CDWC 1GOFA 4BIOA 2F4LA 1FOD3 2XBO3 2ADEA 2PN5A 4XTMA 4QX5A 1ZREA 1LOCA 3UGFA 3ZR6A 4D7YA 4YW1A 2JIJA 5IK7A 1ZA4A 4FPEA 3WZ1A 3N7JA 1RVF1 5FZ0A 1YQCA 4M0HA 4DOUA 3QACA 4BZ4A 2E53A 3GHNA 4KG8A 1JYTA 4TLGA 4BMEA 4FSJA 3THPA 1S0GA 2VQ0A 3OYWA 5FZLA 1JUIA 2H6CA 4FPLA 1A8MA 5FUPA 2F4PA 5DAWA 5CFDB 5JOWA 5KXCA 2PELA 2DWRA 4LKEA 1OD3A 4IEZA 1PIV2 4KI5M 4NE9A 2AYHA 4AEKA 1CAXB 3MICA 4AVVA 1U5XA 1N3PA 4GMP0 1PIV3 4GALA 4G9SB 3ZN5A 3VBSA 3NKTA 2EIBA 4Q27A 2D6MA 1DF0A 1LTEA 4M4RA 1KITA 4XPVA 1QXRA 2A6XA 4E4HA 3ILFA 4FBFA 3WVJA 5JSRA 4UFJA 3H50A 3H7YA 4RN5A 2WS93 2RJLA 2ZCWA 3CF6E 3IN9A 3K75B 4BJ0A 2UU8A 4PQQA 4XFIA 2WT2A 2A1XA 2V73A 4KWKA 1D4M3 3NO8A 3WX5A 5EIYB 3KLSA 2GMEA 5FZ1A 2Q5TA 3J26N 3OGGA 5LATA 1A8DA 1OUXA 2PHXA 2Z79A 3CJXA 5IUQA 2VQUA 4MGKE 1D7PM 1CAUA 4NWVA 1SLIA 4MHUA 4ZKTB 1RUC1 4GMP1 4FPFA 1LULA 3GF6A 1HKDA 2HWC3 2YHJA 3IMMA 3VL9A 3I49A 1ST8A 2W08A 3H42B 3IB3A 4YM0A 5DDJ2 5FY1A 4Q4W3 1W39A 4LPLA 2BWCA 5I91A 3AYAA 2W1QA 1JW6A 4LKFA 4MO3M 5CFCA 3RZGA 1VBE1 2ZS6B 3VZJA 1W6OA 3BKZA 4O7XA 3D4KA 3RFRA 5FWJA 4RR3A 5FP4A 2EAKA 4E4SA 2VZQA 2GH8A 4Y1YA 2CYFA 3HBZA 3KF5A 5DMYA 2L9LA 2WC2A 1GZWA 1Q8OA 4P5YA 4IETA 1QWRA 1DYOA 3CNAA 2J1UA 1JH5A 2WZPP 4IV3C 5FUNA 1WUVA 1BXHA 5A3LA 1KGYA 2A75A 2HBTA 2WYSA 4FPKA 5CBLA 1BBT2 1WA6X 4U2AA 3I2OA 5EJZB 1O91A 2ETEA 3ACHA 4J25A 2GNDA 5FZCA 3JD72 2IWGB 5FKCA 5FY4A 4CU6A 1YNAA 4NN0A 3HQUA 4PDWB 5K0UA 3HAGA 1CR7A 2VBPA 4L99A 2VGDA 2ZHLA 4NUBA 3E6BA 3WQ1A 2DCZA 5A3TA 5CA6A 4YM1A 5JOXA 2ZGKA 4WVMB 4AGRA 2PLV3 4YRDA 4CU7A 3ECQA 1OOPA 2RDSA 3W59A 2SLIA 4EROA 1H4HA 5BNNB 5FQ0A 1ZRDA 4CDUA 2W91A 3ZR5A 2ILMA 1DLCA 3WF0A 3TEZA 2BERA 1YEWA 2HWB3 5I8YA 4BISA 4IGOA 1JZ7A 2IXJA 1XNAA 2AACA 3SLIA 5LRRA 1OF4A 2VTXA 2W0XA 5L7OA 2DUOA 3L9JT 5KXBA 2XONA 2X10A 4R4XA 5IFPA 2XJTA 3QLQA 3A7QA 4N53C 2ZEXA 3W58A 2VD7A 3E97A 1QDOA 2VU9A 4LJHA 1AR82 4HPKB 3CU7A 1JHNA 2BVVA 4ZONA 3POIA 2XB6C 4EN0A 5J37A 1NLRA 2RS53 5DG1A 2A71A 1VRH3 4KU7A 3ZFGB 2CDPA 1AF9A 1SDWA 1FT9A 1PGW1 5E16A 2Q8CA 5FPUA 5LA1A 3BTYA 2ET7A 4HSJA 2X09A 1K5MC 4YVWC 1MR5A 3MFAA 1GNHA 1A6CA 2ZGPA 3NSTA 1PMIA 1KDMA 2ZMKA 3WHTA 4DO0A 4BIFA 5A70A 2AR6A 4QDRA 1H1IA 2AENA 3JBG3 3MO4A 2J22A 2I45A 1W2NA 4CP9B 1UOFA 4P14A 4ORFA 4FPGA 3VDDB 2BV4A 3ZFEA 4UBHA 3ZYBA 3OCPA 5KHKA 4LA3A 3PURA 1W99A 1JUHA 3VBFA 5T5OA 3KQ4B 1N47A 2WZR2 2Y6LA 4HZFA 5F3GA 4NRMA 4QB6A 3MLLA 2IVIB 3GNEA 2RS33 1ZZ6A 2YY1A 1VP6A 2GP3A 4PLMA 2P6CA 2R49A 1WMDA 3B7MA 3JQXA 1BBT1 1IS5A 4MLOA 1LHOA 2NQYA 3IZOA 4Y1ZA 2WNUA 3SH5A 3HD8B 1W8TA 5DQ0A 4AWDA 1U12A 2CAUA 5DN2A 3AVSA 4CP0A 1RL3A 1TVGA 3KV4A 4Y24A 1W6QB 1C5IA 1VBB1 5FYIA 5ACA1 2ZXQA 4A42A 5IW0A 4RGGA 2OVUA 4CP2A 4XFBA 4U36A 2GN7A 1T6BX 5AC93 2JG8B 1HRI2 4Z92B 4URAA 1VRBA 1OH4A 4AAXA 1WKYA 3PTRB 4GH4C 4Q4Y2 3SH4A 4XC9A 1HRI3 2NMOA 1UMIA 3O1SA 4XXAA 3GZUC 1DQ1A 1AYM1 2B42B 2OUHA 4QDSA 3CIHA 5H9PA 1MS4A 1EV13 1DLLA 1SG3A 2EXJA 3OY8A 2Z42A 1PNGA 3IT8A 3Q9OA 3CKHA 1H9PA 4M3CF 1YFUA 2D44A 3VKNA 4BLJA 3IKWA 4UF0A 1RUH3 4AHZA 2X5IC 2ZEWA 2VUDA 4HVQA 1CAWB 1RMU3 2XQRA 4TLFA 1QMJA 5F32A 3QOPA 3WP3A 1ND3A 1NCRC 1PNFA 3LB9A 1RB8G 1Y3TA 2QQUA 3TB0A 1AR81 2IXIA 3FUQA 5DUWA 3AL5A 4Y20B 3RWKX 5CFDC 2QJVA 2JDZA 4Q4X3 4X8NA 1UPIA 4L97A 1OPMA 5FCCA 2BDRA 5FOJB 1ND2B 5A1FA 2FDIA 1QF3A 1DFQA 2RJKA 3AK0A 1NA1C 3GXUA 4P9IA 1GWKA 1W6NA 4YW7A 1H2NA 4WVZA 3I2HA 3VB9A 4LOTA 4W8JA 3WINE 4P9JA 2UYBA 1LOFA 1O7FA 3NAPC 4IV1A 5FK7A 3ZM8A 2NMNA 3T4VA 4RQPB 4CUBA 4UWDA 4XIOA 2E51A 1TNFA 1LHWA 3OG2A 3WP5A 4YZ5A 2WDBA 1G8WA 1TQ5A 3PUAA 1O5LA 1HLCA 4BB3A 4NRQA 2JG9B 1Y9MA 3MFCA 1W3XA 3GGLA 3GALA 1OT5A 1H1MA 3MIHA 3O7OA 3QH6A 5GZEA 2E63A 4YVSA 3MYXA 1YFYA 3J7MA 4CPBA 5FZEA 1TME1 1FPN2 2QQPA 1V0AA 4OHYA 3ZSJA 1WZXA 3BTAA 2QNKA 3N36A 4Y1XA 4BWOA 4EQVA 5C4WC 1OF3A 5K8SA 5IK8A 4LHKA 5CNAA 3LSEA 3L2HA 1W8WA 3M3CA 3DPRC 3NNGA 2Q8DA 4CEYC 2XOMA 2BWAA 4CDQC 4I3PA 3FLPA 4Z07A 3TNPB 1UW8A 3AMNA 4FTBA 3ES4A 5I0TA 5BNPA 4I0BA 4X6QB 5D1IA 3PJQA 3VBRC 5J36A 2G19A 4ZU4A 4GXLA 3VHOA 4QX7A 3W5MA 5BNOB 2B8MA 2BNOA 1AYN3 5ACA2 1J3PA 1QEXA 3IDEA 2ZPXA 3TBDA 4AI0A 4NHXA 1ZBA3 1LCLA 2BVBA 3LWCA 4A6SA 4Q4Y1 1J58A 3NJVA 1PO12 5EJ3A 5ACA3 4PT6A 5LASA 4JX0A 2HWE2 3ZN6B 2A3XA 4HXCA 2WYFA 4E4DX 3PUHA 2YMZA 1PO13 1SLCA 1Y7BA 3BB6A 4B7EA 3IIIA 2WBKA 5FXVA 4K9SA 1DZRA 3BIWE 2RM21 4AI1A 5IFTA 4BH9A 2JDMA 5GLZA 2JDYA 3TOJA 3FHAA 4CRQA 3KT1A 4IXLA 4CXXA 2XG3A 4AZZA 3LDRA 4LO5B 1DDLA 3SQOA 1S1AA 2KXLA 2ZGQA 1RXGA 2ZZJA 5EYXA 4XYXA 4RHV1 3T2TA 3MIGA 3WEZA 3OEAA 4UFMA 1EY2A 2NYYA 1ULGA 2DBIA 3KF3A 1UY0A 1JS9A 1EPWA 5K9YA 3ZFFC 4FAGA 1YHFA 1AR61 5CAZA 1VAMA 1MQTC 4G4FA 1O4YA 3E5XA 3IDBB 4LR4A 4M00A 1GMMA 3VL8A 5C8CB 1Q3EA 4BMBA 2D3PA 3M3QA 2VNRA 1FXZA 1V6OA 3E5UA 1BJQA 5AVPA 3WSOA 3JB8A 1HXS2 3ORJA 4Q8KA 5FWEA 1FV2A 3I3BA 3POEA 3PVOA 1H8TB 2A3YA 2XWJB 2XVLA 3EXUA 4AF9A 1NXMA 2XUEA 3I4IA 1FAYA 4E8DA 5FZIA 1FPN1 1RUI1 3VGIA 3VN4A 1RUG3 1TG7A 4M01A 4YW2A 5LRSA 3M3OA 1ZZBA 2LS6A 1AL22 2YFUA 3URFA 5JPMB 1FV3A 2YC2A 3LDBA 5DAQA 1W6PA 1YIPA 1VLNA 2DV9A 3I7DA 5C3RA 1K45A 1W28A 2XLAA 3U78A 4DZGA 1OFSA 2ZGOA 2JD9A 4UAPA 4BQ3A 2LUWA 4FOYA 3KV5A 1OURA 5BYNA 2B9UA 2PHUA 3B69A 3SKJE 4META 1U5YA 4Z8BA 1NQJA 1UWWA 2P6HA 2WAOA 3SC7X 4CU8A 4XQ4A 2J1EA 2HWE1 4H2AA 1P8JA 4XZUG 1DP0A 1YQ5A 1UXZA 2IXHA 4GB33 2W9XA 4CCNA 4XABA 2CY6A 4Y4YA 4YW4A 4JGZB 3U75A 1X9TA 1W8OA 2AUYA 3WDVA 2VPVA 4OHWA 2FDKA 4UOJA 3VHPA 1LB2A 1GP6A 4OULA 2ZEYA 3VD3A 2WO1A 3MV11 3C8XA 2Y6GA 4FOWA 1D0HA 2UWCA 3Q8FA 4LIUA 1JYWA 1AJOA 1STMA 4LQRA 3RZJA 1TMF1 2GNTA 2WNVA 3IPVA 4XMIA 3UNPA 3IIAA 1ODMA 1VBD3 4ATFA 3WDXA 3JCIA 5LBBA 3O1PA 2VZ3A 2LROA 1RUE3 4L8QA 5GJ6A 2KA3A 3R4UA 3ROUA 5J09A 4A7ZA 5IVYA 1CAXA 2CGPA 2Y34A 1TEIA 2YBPA 3C7FA 4FVVA 2PAEA 4HK9A 3SCFA 3KCYA 2ZX0A 3H1MA 5DZFA 4COWA 5HPOA 1YJLA 5D8AB 4Q0PA 3O0XA 2R043 1X82A 1LJ7A 3AM2A 3B3QE 5DG2A 4F7ZA 2KD7A 5I0SA 1C28A 3S57A 4EN6B 2AGSA 3D5OA 3K4DA 3JUUA 1R092 3ZPYA 3O14A 4LHLA 5FYVA 4C1XA 3KV6A 1UXXX 1PK6C 4N43B 1DZQA 1VBA3 5BV6A 1VR3A 3IDCB 5CEHA 5JOYA 3JU9A 4FXGB 3RYPA 4AFDA 3V65A 4LNVA 1GLHA 2VW2A 3SH3A 2RMU2 2VCMA 5JXGA 3D6EA 4XAEA 2DYCA 1QGLA 2HEVF 4TWTA 2MEV1 4Q1RA 4YPJA 3WNNA 3NJYA 1C5HA 1XYPA 1BVP1 4K8FA 1OPOA 1FNYA 1UZWA 2A5ZA 3AKTA 4UW4A 3KHCA 1V9U3 3J8F3 5JIAA 1UY3A 3M2MA 2XL7A 1AL21 1R1A2 2DU1A 2C6SA 3QD6A 1OI6A 2ATFA 5FZAA 2DDUA 2BZDA 3WUDA 4A4AA 5CISA 5ANQA 2VZPA 2WFF1 2GALA 2VMFA 5B4XA 1W03A 5F2WA 2E33A 2RS13 4QU2A 4KL1A 3FFQA 1J59A 2XVKA 2V5YA 1V70A 2YXSA 4Y1VA 3T2QA 4AI8A 5IK5A 2A6ZA 1RUD3 1GQPA 4AAPA 4COVA 3KMHA 2NLRA 3F95A 1Y4WA 4NPLA 4JDMA 3ALQA 1C8M3 2PQQA 3I3DA 3KSCA 4DEQA 4J1WA 3ZIWA 3BOPA 2EALA 2A6VA 1UU6A 2WSVA 1NYWA 1OVPA 4EJRA 1REDA 1LGNA 3JZVA 1US2A 3FBYA 3DKQA 2N7GA 2DBNA 1IPKA 3RZZA 1GOHA 2CV6A 3BU0A 2P3JA 3UGHA 1W9YA 2VUAA 2K9ZA 2BYVE 4WVMA 1CIYA 3HWJA 3OD0A 4L9BA 3AKPA 1JYNA 5IVCA 3ZDSA 5FYTA 5FV3A 3VBHA 5GZCA 4XZPA 2Q8EA 2VVDA 3GBFA 4UFKA 4A45A 2R073 1QJFA 3AMHA 5KHIA 4QPIC 3LDKA 4PCRA 3QH7A 4C8DA 4OMDA 2JXAA 1QJY3 4IV3B 3VBSC 1OA2A 2ARAA 1QNYA 1GWLA 3B00A 4N7IA 4W50A 5FLHA 4AEDC 2GU9A 4LIVA 1ZX5A 3AJZA 4XBQA 1ZRCA 2GP5A 1H8VA 2W87A 1ZZCA 2YG0A 4GWNA 4KG0A 3O1OA 1VE0A 1XJAA 4WVVA 1XNKA 3GDBA 4H14A 4TYSA 4ZXEA 1D4VB 4R9DA 3CL1A 2BGCA 3O1MA 4HPKA 3PJYA 2VW1A 1FI2A 1U5IA 4XQDA 5LEJA 1UN1A 2JX9A 4LLFA 2A7AA 2K46A 3I59A 2VMGA 3GZEA 3MDPA 4RD7A 4EN7B 1F2NA 2X53S 1DQ6A 2XJPA 4OVEA 4AQ2A 3ZVXA 1UKRA 4IE5A 1FX5A 1RUF1 2GC2A 3VZNA 2NZ9A 2R32A 3D8CA 3PVNA 5IYYA 1E57A 2JDHA 2G9GA 2K0GA 1YQ2A 5FYHA 3WDUA 3IMNA 3WNMA 3PU8A 4D7TA 4B7KA 4XCAA 1WMXA
chains in the Genus database with same CATH topology
1MZ6A 2JKBA 2PA7A 3R0RA 5SV5A 3U07A 4PIYA 4B4PA 3WW1A 3V0AA 1BEV2 1R1A1 1HRV3 2WT0A 1LHVA 4N53B 1QQP2 2BFUS 4MV2A 3FE5A 4HBNA 1AR73 1Z0HA 3N3HA 2E7QA 1SBFA 4BYYA 5JSOA 3ACLA 5E8AA 3AZXA 2VOXA 4GA9A 3ZSLA 5JZGA 1IKPA 3VHRA 4CDXC 1AX2A 1MVQA 2GMPA 3S0MA 5FPZA 5FTTC 3FMGA 2R063 3U4XA 4HN0A 4AI3A 4P5HA 3HT1A 4QM9A 2WQ4A 1K5MB 3DL3A 4YVWB 4QM8A 2X29A 2OIIA 2PYTA 1AX0A 4HANA 4BM8A 1OLRA 2A70A 4XFAA 1OOPC 4FXKB 3HN1A 5JWPA 5AFBA 1N1TA 2GH2A 1UF2C 2JG8A 2UURA 4AVCA 2CAVA 4WM7C 4HK8A 1WCDJ 2R0HA 3RYKA 1ASJ2 1W0PA 4Z2WA 2BFUL 5GLVA 4MUVA 1G9AA 4PLOA 1QJU2 1GV9A 2ZGMA 4S2GA 3QBQA 4C1WA 4K20A 5DZEA 2AH2A 3RMXA 3B02A 1AJKA 4A7YA 2XGXA 3WUCA 2FMYA 3RJRA 2DURA 4MGZE 4AHXA 1LGCA 4Z1VA 3GHMA 1W0OA 1MZ5A 2OPKA 1WW6A 5A32B 4DINB 4JRLA 4Y20A 1V6NA 4YM2A 1QJX1 3NL1A 1SLAA 2IXKA 1UX6A 3WG4A 4COUA 3AP4A 5ABJC 2DVGA 2HWF2 4INDA 2RR13 3W9AA 1ND2A 1UL9A 1VBC3 2OUJA 5JMCA 1FMD3 2TNFA 4GH4B 1FOD2 2XBO2 1QXPA 1WD3A 2BQPA 4GMP3 2YC0A 4P9GA 3OBRA 1UMZA 1ZZ9A 4ISRA 3CJIA 2LALA 1Z7S2 4QD2A 1H9WA 2EF6A 4LO6B 1YLLA 1AVBA 2DCKA 2VQAA 3H0OA 3KS7A 1VBE3 3MLJA 4N43C 2X5IB 4ES8A 1Z7S3 3VBFC 4AVBA 1APNA 1QQP1 3V0BA 1KJRA 1AXZA 2BNMA 1NCRB 4DMIA 2JG9A 2X8KA 5KC5A 2ARXA 5FREA 4EWEA 2WNUC 3UK9A 1WMFA 5JLVA 1XNCA 1NA1B 2ZAHA 4JTOA 4YGBA 2B7YA 1R1ZA 1CAVA 2VMIA 2WS92 5J7MA 4MXWB 4XW3A 1D4M2 4AQTA 3NAPB 4XFFA 2XUMA 2Z5WA 2D5HA 2KM2A 4QPGA 5HBAA 3FBMA 2JEMA 1QU0A 1SCSA 1S0FA 2D3SA 2EA7A 3ZN6A 3IBMA 2HWC2 2ZBJA 1BMV1 1YFXA 1KS5A 1QJU1 4Q4W2 3VBOC 2IFRA 3WW2A 4A7KA 5C4WB 4Q0SA 3AP7A 1XQNA 3USUB 1S55A 2D6KA 3DPRB 4CEYB 1CIWA 2SBAA 1PGL1 2HEYF 3CLPA 4WM8A 5T54A 4CDQB 3VBRB 1NG0A 1Q5OA 2ZHKA 1R083 2MNGA 4ZU7A 5E1RA 2YROA 1FOD1 2XBO1 1URXA 2PHTA 2YGLA 4IV1C 2AREA 1FYUA 4W65A 3TAYA 1BYHA 1ZYBA 4MGYE 5FLJA 3MGUA 1LRHA 5KXDA 2NP0A 5J48A 1UIKA 1HQNA 2BUKA 4AHWA 1J3RA 1DHKB 2MPFA 2PLV2 1I1EA 3G6JB 1DGLA 4YG3A 3FZ3A 3AYDA 1H8TA 1PZ7A 4K40A 4YVSC 2WQZC 3POYA 4W6XA 2HWB2 3IWZA 4OUSA 1S0IA 1LHUA 2IXCA 4FO9A 1PIV1 1ALYA 4JC1A 1OQ1A 5BPXA 3ZFFB 1UD1A 5KWRA 5SV8A 1W6MA 5BNPC 3LSDA 2A6YA 3AJYA 4IESA 1MQTB 3B01A 1VBB3 1LECA 4LUMA 4W6YA 4YW3A 1COV3 1D4M1 4OI2A 4UBGA 3N7MA 1IZ3A 3RRDA 4YFZA 5GZGA 5LK7B 2RS52 4M3CA 4Q0QA 1VRH2 4RS5C 2WNEA 1WW5A 5T5JA 2R6QA 1CD3G 2HJIA 1NE4A 1KFUL 1PO23 1AYM3 4A3XA 4DY5A 4LULA 2ES3A 4Q4W1 1YFWA 3MIBA 3JBG2 4EN8B 1ZVFA 4QGLA 4JAAA 4IL7A 5DDJ1 3GZAA 2NPIA 3E5QA 2ZJCA 2OA2A 4PLNA 1DQ0A 5JCTA 4YW5A 4BLIA 3MEPA 2BW8A 3OPZA 2DTWA 4YGEA 3WHUA 3MW4A 2RS32 4IQPA 4OHVA 1TNRA 2BNNA 2P17A 2EIGA 1Q8PA 5J98B 4XFCA 1QH6A 1SBDA 1YWKA 1ZNPA 4DPNA 4TSVA 5FBZA 4CDWA 3JD71 4R4ZA 2B45X 3D82A 4P9YA 2WA4A 3VBUA 1QHDA 4MGIE 1OD5A 5AC92 4N9IA 4PIZA 2C0ZA 3FLTA 2R1DA 2CGNA 1CPNA 5T5PA 3UV9A 3NV1A 1V6LA 1GQHA 4FTEA 4AVSA 4COYA 1Q56A 3MF9A 1EV12 2JD4A 4NHMA 4G3YC 2A6WA 3O5SA 4OLLA 4XFGA 1GR3A 2ET1A 1GYKA 2WL1A 4P9LA 1JN2P 4V1PA 1RUH2 2D40A 2E7AA 1RMU2 1OQDA 1XU1A 3CO2A 4Z82A 1V6KA 4AI2A 4YFWA 1AXYA 1WCSA 1DGRN 4Q4X2 2F6BA 2QVSB 3PVEA 4XF3A 4FP2A 4ZXKA 4L2NA 4LA2A 2RS51 4S2DA 3R6SA 4DB5A 1VRH1 4LHNA 1J1LA 1PK6B 2DF7A 2EAAA 4DY3A 5K7PA 4B4QA 2FZ2A 1Q8QA 4W6WA 3GBGA 5JPNB 4XF1A 1RUOA 1GNZA 3TN93 1U5ZA 1DGRA 3K51A 2FZ1A 3I2DA 1Y43B 1GFF2 2RM23 1POV0 3NW4A 1MS9A 2HWD3 2ZA9A 3U10A 3WP4A 1CX4A 3X29B 2ZGUA 5C9AA 2VH9A 1MEC3 2VMHA 4RSUA 1HQWA 1KRIA 1LOBA 2GZWA 3ZXLA 2Q1ZB 5A33B 4RHV3 2RS31 2XLGA 1IOAA 2D6OX 5GM0A 2D3RA 2WZR1 4IV3A 5JI9A 4LUKA 2XL9A 1ZBE3 4AFCA 4HT1T 4CEWA 1AHSA 2OZJA 1AX1A 1CPMA 1AR63 1POV1 2QFEA 4N9HA 1YO8A 4ES9A 3WQ7A 2D7FA 1QOOA 3VZLA 1AYN2 1CN1A 1C4RA 3ETQA 4YSFA 3JQWA 1TE1B 1ZBA2 4E4ZA 3OYWB 2JE9A 3LA3A 4QGNA 1UKGA 4FPCA 1HRI1 1RUJ3 4Q1PA 2DVFA 1XU2A 4Q4V3 3M3IA 2ZABA 4IEUA 4AGGA 1EV11 2WLPA 5KHGA 3KB5A 1XE7A 1B09A 1JTZX 1RHI2 4QPIB 1EP0A 4CYDA 1RUH1 5I8SA 3VBSB 4OZXA 5EV7A 2GMMA 1RHI3 3RYRA 1YYNA 4AEDB 1V6IA 4NOTA 1IHMA 5E88A 3EHKA 3MIFA 3LA7A 3RG0A 4ASLA 4BE3A 4XFHA 3S30A 2QDRA 3APBA 2D6PA 2R30A 1NCQC 2ZGNA 4YZ4A 1O3SA 2B5HA 2OZ6A 2ZGRA 1SACA 1SMVA 1CAUB 3PTYA 3MZHA 3A0NA 1KD7A 1G9BA 3AYEA 3ELNA 4XOGA 2YV8A 1XNBA 1K5MA 4YVWA 1C8NA 2WFPA 1S2KA 2Y0OA 2ZGTA 3I54A 5BUVA 1W6OB 2DFCA 3S7IA 5GLUA 3VBHC 4E9KA 2JJ6A 3T1LA 4B4RA 5CG8A 2EVXA 4JGYC 4Q29A 1TMF3 1WBFA 3AYCA 1D2QA 1L3JA 4S2HA 5EZWA 1RUG2 2P37A 1RJ8A 4UW6A 1SCRA 1SFYA 2VNGA 4QXKA 4AW7A 1B35A 4Y22B 3RS6A 1QNWA 4CDXB 1HDKA 3FUOA 1J3QA 1KQRA 4QQOA 3WP6A 2QQPA 1G86A 2TEPA 1ULCA 4PF5A 1GANA 2CNAA 3H3ZA 4L11A 3AB0A 2C5DA 3I8TA 3ATGA 1DQ2A 1UIJA 1X50A 4KWLA 4YNIA 4URTA 5KHHA 4OFGA 1DYKA 4I0AA 2XH6A 5FPXA 4XF0A 1XE8A 4YG6A 3SCGA 1WLCA 1ZBA1 4WV8A 1OOPB 5L73A 3WD5A 4E2GA 4YG0A 1VB2A 1IS3A 1EPZA 5FQ0B 1O5UA 3ZYJB 2ZX1A 3U11A 4PIXA 5ACA1 3VV1A 4WM7B 2VUJA 2XKOA 4GULA 4OI0A 4GB32 1PO11 3AZYA 5AVAA 1CJDA 4H7LA 4XETA 4Q26A 2R0FA 2G4IA 5T50A 1V6MA 4C90A 3ZXFA 2Q8OA 4O9EA 3H7JA 2WT1A 1WLWA 3BOWA 2X5IA 5KC6A 1OSGA 2YDEA 4AQSA 3RI8A 5JZGC 1ZZ8A 1VBD2 2A73B 1ULDA 2WFF3 3KT7A 4HETA 4AGVA 1RUE2 4H55A 3HIFA 4ITCA 3M4FA 5CFDA 1ONAA 5ABJB 3NWKA 2R042 3UL2A 2XWBB 5KHJA 3J9SA 1NE6A 2D97A 2P34A 3AMQA 4NHKA 4FTSA 1MS0A 3ZXGA 2O8OA 4ISQA 3AZWA 1VBA2 2Q4SA 2DCJA 1PVC3 4HVRA 1N3OA 4XBLA 4OHZA 3VBFB 4KH9A 1HXS1 1W2UA 4AK3A 1GQGA 3PMEA 4XEZA 3ZXDA 3POWA 3ILNA 4YYOA 5IK4A 1RUG1 3D0JA 3S7EA 1V9U2 3J8F2 4K21A 5CVRA 1HV0A 1DGWX 1QXJA 3AZZA 3LKJA 4NR1A 2WNUB 1D0GA 4CZSA 4AEJA 3LAGA 2R1BA 4UW5A 3USUA 4F83A 1O4ZA 4D3WA 3DPRA 4CEYA 3AKRA 4CDQA 4JDOA 4XJ8A 4AXOA 2RS12 5FO8B 4NPRA 4FPJA 3VBRA 4JCKA 3WW3A 3MW3A 1AXKA 1RUD2 2P3KA 1C8M2 1QY4A 4K1YA 2AZ5A 4GB31 4LEJA 3CJIC 2I74A 3UJQA 2YZ4A 3T1MA 4AE2A 2FHRA 4N7UA 2FMDA 3VBOB 3U0ZA 3FX3A 4PDWA 3O12A 3LZZA 1QOTA 4SBVA 5CG9A 2VVFA 2YGMA 2DFBA 3N7KA 1EAH2 2W39A 2D98A 4GIQA 2R072 1VBD1 1EAH3 1QDCA 3E6DA 1LU1A 2GNBA 1RUE1 2OW4A 5BNNA 1QJY2 4MXVA 5CIRA 2YUEA 4PQ9A 1UU5A 2WA3A 1I5ZA 4XILA 1IS6A 4JDNA 3ZIXA 3JB4C 1DGWA 3RPQA 1MQTA 4IV1B 3M70A 1UU4A 1V00A 4LBQD 4F3JA 1WLTA 2HEWF 1VBA1 1AR93 1F8VA 1R091 5BY5A 1DBNA 1DIWA 1RJ7A 3ZN4A 2YPJA 1SQ4A 2XJVA 1X8EA 4YVSB 3AXEA 3ZFGA 3WG3A 2RMU1 2W52A 2NN8A 3KQRA 1M06G 1S0EA 1V9U1 3J8F1 5EWSA 4C0BA 4LO4B 5CFCC 1QKQA 1HRV2 2UWAA 4IEQA 3ME2A 1DZTA 4RR3C 1H2KA 3BALA 1AR72 5BNPB 4ATEA 4O9GA 1X33A 5E89A 3VDDA 2UY9A 5CADA 1O3QA 3DGTA 2CGOA 4XE9A 5DUVA 5JVVA 1MVEA 1S0DA 2JENA 1YJKA 3SMHA 3EQEA 2EXIA 5DUXA 2HKXA 2R062 4RS5B 1C8M1 2H0BA 1AUYA 3WW4A 2R16A 3SCHA 4D69A 5KXEA 5K0UC 3KCXA 2TBVA 4I2OA 3KCCA 1W6QA 2Y38A 4LO7A 4IEPA 3V56A 1HW5A 3WT3A 1RUNA 1RVF3 3ES1A 4TZDA 3WNXA 4LBKA 4PBPA 4F8AA 2UYAA 1X8MA 4CDUC 4AYUA 2R071 2QKDA 4BQ1A 4B29A 1LU2A 4QHBA 1J1TA 4Y5Z0 5L7OC 2A3WA 4GKYA 4JV4A 4LO8A 1FATA 4Q2FA 3B94A 5EYYA 1CONA 2ZTNA 1LR5A 1QJZA 2JICA 2WIIB 4UW3A 3WG2A 3RI9A 4R8HA 1CAWA 2Y26A 3NV4A 4EWDA 1RINA 4FOQA 1SEFA 1O3TA 2H0VA 4DFSA 2CWSA 2WJSA 2RR12 4E2QA 1VBC2 4K7JA 4I3GA 1FMD2 5JSPA 1PK6A 3WR0A 5FFOC 4MVTA 1D2SA 3FC0A 1DQ5A 4XQWA 1RUC3 4FPYA 1UAIA 2CWMA 1VBE2 1HRV1 2ZKLA 4P9WA 3ZFEC 4RQPA 1WCKA 4SLIA 4ZU5A 1BEV1 1AR71 3NV2A 3ZMNA 2PFWA 1F31A 3RQ0A 4AFMA 3BPZA 2MHFA 3HQXA 1LHNA 4X8PA 3O0WA 2FQPA 1ENQA 1OLQA 2DTYA 2ZMNA 3INAA 3KT4A 3R4DB 4Y1UA 4BOWA 4D94A 1REEA 3M7AA 4HN1A 3PNAA 3ZSKA 4QQPA 4FCAA 5H9RA 2PTMA 4IERA 3VBUC 4FPHA 3H1WA 4K6BA 1HX6A 4C0HA 1XNDA 3HMYA 3WOGA 5F9TA 3UKTA 4XXPA 2K2SA 5BNOA 2WNVB 3IPVB 4ASMB 3M3EA 1A3KA 1MACA 2VY0A 1WD4A 5EFUA 2WSUA 1ASJ1 2EXHA 1C3HA 4JTNA 4QPIA 2D93A 2DU0A 3V64A 4LBJA 2D5FA 5JAXA 1IGOA 2GNMA 4AEDA 1ND3C 1OFNA 3TWIA 1XYOA 1ENXA 4RA0A 2W68A 4H3WA 1S0BA 3WDWA 1HQLA 2GC0A 3FHIB 3N35A 3AFGA 1R082 5HCFA 2RR11 5F1RA 2ZX4A 1VBC1 1FMD1 2RE9A 4DNYA 1PGW2 3NV3A 3MIDA 2HWF1 5EXOA 1ZZ7A 1PGSA 5GZFA 4AVTA 3FJSA 1XRUA 1LOFC 1AL0G 4NWWA 5A3MA 4LBQB 5BNQA 2LM3A 5C8CA 2Y0IA 5C9AC 1Z78A 5DDJ3 1Z7S1 5I0RA 1O4TA 4KGGA 4YM3A 5HCAA 2UY8A<