4PQHA

Crystal structure of glutathione transferase lambda1 from populus trichocarpa
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
214
structure length
214
Chain Sequence
EVLPPVLTSNSEPPPVFDGTTRLYISYTCPYAQRVWITRNCKGLQDKIKLVPIDLQDRPAWYKEKVYPPNKVPSLEHNNEVKGESLDLIKYIDSHFDGPSLFPDDPAKKEFAEDLFSYTGSFSKANNSTFKGEADEAGAAFDYIETALSKFDDGPFFLGQFSLVDIAYAPFIERFQPALLEFKKYDITAGRPKLAAWIEEMNKVEAYNQTRHEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione transferase lambda1
publication title Structural and enzymatic insights into Lambda glutathione transferases from Populus trichocarpa, monomeric enzymes constituting an early divergent class specific to terrestrial plants.
pubmed doi rcsb
source organism Populus trichocarpa
molecule tags Transferase
total genus 79
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4pqhA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4pqhA01
1DE1A 5G1KA 4LA1A 6GSXA 1V57A 5D96A 4ZL8A 1XXUA 1GSUA 4MA9A 3I9V2 1PMTA 1EOHA 3ZVJD 4K6XA 1KBNA 2H6XA 1URMA 4OFTA 2PVQA 3KIJA 3HXSA 2RM5A 3P8WA 3KH9A 1CQGA 4ECCA 3IDVA 3F63A 4F0CA 4TR3A 5D73A 3L0HA 3VK9A 5A5KA 3TRQA 4X1UA 4LMVA 3HDCA 4IJ3A 1UC7A 2JSZA 4WR4A 2VAFA 1XWCA 4KH7A 4DSSA 2GSRA 3TKQA 4ZB8A 1TK8B 2L57A 2YOIA 2FCHA 1F37A 2Z9SA 1N2AA 3A2XA 4BWQA 4K8MA 22GSA 1RK4A 4N10A 20GSA 2PN8A 4ZBDA 4XRDA 4EUYA 2KOKA 3LGCA 3BJ5A 1Z6MA 4KUNA 2VCTA 4HI7A 1WP0A 3Q19A 2CX3A 4OMVA 1ZCPA 1DBYA 1M7TA 2R6KA 3I43A 1KNGA 1ST9A 1X5DA 4IS0A 3U6VA 1XW6A 1MDIA 3EU3A 2VCVA 3O3TA 4MZWA 1WE0A 4FQUA 4J57E 3IAM2 4D73A 4KA0A 4ML6A 1A8YA 1QMVA 3A2VA 3F8UA 18GSA 2WULA 5ID2A 1GUMA 4TR0A 5DBQA 4TXVA 1RQMA 4EKZA 3ZMKA 2DIZA 12GSA 1Z7RA 5ECPB 2AAWA 2MZCA 4JR4A 4ZB9A 1SK0A 1XWAA 4FYCA 2QSIA 4IP1A 5ID2B 2CVBA 1Z5YE 1MEKA 2C0GA 2OKAA 2V2GA 3GKXA 4N11A 4RQXA 5DJMA 1EWXA 4L8EA 5J3RA 1EOGA 5CNWA 3GHAA 1XVWA 2I81A 7GSSA 3CXGA 1BAYA 2GSQA 2OBIA 5ECNB 3CRUA 4GSTA 1VF2A 4MF5A 4I97A 3H8QA 3F6DA 2XC2A 1YEPA 2X99A 3CSIA 1EEMA 1V58A 3GL3A 4HJ2A 4MCUA 1AQWA 1OKDA 4OO5A 3DGQA 1K3OA 3IE3A 2I3YA 2P5RA 2X8HA 5ECIB 5G31A 1SJ6A 4P3YB 1PD21 4AGSA 3LWAA 3QCPA 1OYJA 4N0VA 4EE0A 1O8XA 2P5QA 2IPAA 2EIRA 3HJPA 3L9VA 1ERUA 1XW5A 2VOCA 2LSTA 4TXOA 3R3EA 3M1GA 4MF7A 3UARA 2H0GA 3M8NA 6GSSA 1YF1A 2NPBA 1HNBA 2GSSA 2GT5A 5KN0A 2RM6A 1YY7A 3QAGA 4TXOB 3BCIA 3C1SA 4BPYA 1AC1A 4GSSA 5AIVA 2XHFA 4KGIA 1M2BA 2AV4A 4HS1A 3ZZXA 5BMUA 1XOAA 1HQOA 4ZL7A 2R2JA 2MMNA 1AIUA 2G0FA 4PQIA 1GLPA 3R2QA 3AY8A 3ME8A 2HE3A 4X43A 2A2RA 2FY6A 2DC5A 5DVBA 2JZTA 5GAPD 3LFLA 2CZ3A 2H6YA 2R4VA 1T4ZA 3WD6A 1F2EA 1PA3A 3HD5A 1PL1A 5JWOB 1XPVA 4G0KA 1K0AA 4FYBA 1B4PA 4K0GA 3IXRA 4O32A 5H5QA 4ACSA 2B5YA 4F0BA 4IJIA 4JEDA 5J9BA 1FB0A 4Q5NA 1FB6A 5F0GA 1T7PB 5D8IA 4ILFA 1G0TA 4KCEA 3US3A 3TJJA 1H4OA 4I2TA 1M9AA 2P31A 2ALBA 2HYXA 6GSWA 1QK8A 3KTBA 3G7IA 1OKTA 2GLRA 3M0FA 5IMAA 1LJRA 4G0LA 5ENUA 3ZYWA 3NIVA 1ERWA 3A5WA 3MNGA 1AW9A 4IN0A 1E2YA 1GP1A 4ZXGA 3HVXA 3M9KA 3JCML 3ZLPA 3F0IA 1TRVA 3DD3A 2VCQA 2AJQB 1ZZYA 3ZRDA 6GSVA 5CRWA 1NHYA 3EE2A 1QQ2A 3UL3A 4RI7A 4KSMA 2KLXA 2N5BA 2NVLA 2E0QA 1WMJA 4OWYA 2ZUPA 1BEDA 4KCAA 4QL9A 5G5FA 3SBCA 13GSA 3HZ4A 4K7OA 16GSA 5IOXA 5J5NA 3TOTA 1B4QA 4MJCA 2FLSA 1MDKA 3W8JA 5C04A 4G9HA 5KN3A 3UAPA 3CSHA 2O87A 1ACVA 2LQQA 5DALB 3TKSC 3D0ZA 3KCMA 1YJ6A 3WGEA 4ZBBA 3TGZA 4XTSA 1XZOA 4I5QA 3TJFA 4HU9A 2JADA 3PPUA 3GKMA 1K0OA 1FVKA 2IMEA 5D9VA 4XIHA 3QOUA 1AAZA 2HXKA 3O76A 3GUSA 4F03A 1SK2A 3LXTA 2HT9A 1X9WB 2C3NA 3PR8A 2H8LA 2NTOA 2HZEB 3GMFA 1OC3A 4GSNA 3HY2A 4OO4A 4WKWA 4NAXA 1YF0A 4OCEA 1G6YA 2GQMA 1V2AA 3L4NA 3E0UA 2E2MA 3IV4A 4I6XA 2HRAA 5IMFA 1K0BA 2H75A 2FD3A 1F9MA 2B5EA 8GSSA 5IQYA 2YWNA 4Q5FA 4DEJA 2HSYA 3IA1A 3GTUA 1DUGA 1W4VA 1A0RP 5D9TA 2L59A 2H66A 3FKFA 3APOA 3RAZA 3PGTA 2PMTA 2MMZA 2YWMA 2FNOA 5G1LA 2RUFA 2HFDA 5ECKB 4KAEA 1V40A 4OFMA 3GSTA 3F4SA 2KHPA 3MWHA 4MPGA 3QAWA 1M2DA 1TDIA 1TXXA 3EC3A 2HRFA 3QDNA 1IYHA 3Q74A 2WZ9A 5AISA 1T8EB 4ULXA 1GNEA 1AQXA 1EZKA 2AB6A 4WBJA 2H76A 1FAAA 3KJYA 1LU4A 2V1MA 3HHVA 1EGOA 11GSA 1X0RA 3ZTLA 5IMVA 3TKSA 4KB3A 2YANA 5DAKB 3KM6A 5DCHA 4H86A 1MTCA 1G6WA 2L5OA 4JZQA 4IW9A 4KDXA 1EEJA 4NV5A 4EC0A 4AJ6A 3HVSA 2V32A 2L4QA 4V1Ag 2MYGA 3FW2A 1JFUA 1FG4A 1K0MA 5LNKe 4USSA 1PKZA 1F3BA 1B9XC 5HR2A 1SKSB 2GQLA 1GH2A 2DJ0A 1XFLA 1C72A 3E9JB 1Q98A 1R5AA 4IBPA 1PKWA 2N5FA 2LNSA 1K3YA 3WYWA 1PGTA 3LYKA 5JWQB 5JCWA 4HQZA 2PBJA 4IELA 2FA4A 2YZHA 2HRNA 5CRDA 5IPHA 3F6FA 3WT2A 3CTGA 1F6MC 3P2AA 1K3LA 2YWOA 3A2WA 1ABAA 4O7HA 5ECLB 5FWGA 1U3AA 4HQSA 3H79A 4AF2A 2KP2A 4OFNA 2JACA 1VF3A 4I8BA 1E6BA 2F3MA 5CREA 4TN8A 1UVZA 3VI5A 4Q5QA 2ES7A 4E8EA 2GT6A 3ZITA 1TTZA 4K2DA 2G2QA 1BG5A 4HU7A 2BMXA 5B8AA 3ZMLA 1SL0B 4MMMA 4MJAA 4WXTA 5CAXA 1JLWA 2F8AA 2PVOC 5ECMB 1SYRA 4BVXB 1J0FA 3FR6A 3D6IA 3VWWA 3GKNA 4Q5RA 4XHMA 3APQA 1X5CA 2DMMA 4LLRA 5AGYA 4QQ7A 1M99A 2K18A 4PURA 1X9SB 2I9HA 2QGVA 3QAVA 2HSNB 1A23A 2GVPA 4GQCA 1NHOA 4HEA2 4EDZA 2HRKA 2O89A 1GRXA 5B8BA 5HFGA 1A2JA 2YV7A 1XBSA 1TRSA 4QL7A 4GCIA 2YNXA 3RPPA 19GSA 1GSQA 4TR1B 6GSYA 1TI3A 1BJXA 2BJXA 4L0UA 1YQ1A 1M9BA 1GL8A 2HRKB 3EMXA 3TJKA 4BL7B 4CW9A 5IMZA 1PN9A 3QPMA 3WGXA 1QGVA 2HSHA 1CQHA 3QR6A 4PQHA 2VL9A 5IOWA 3D4TA 1EV4A 1YEXA 5A4UA 3ERWA 2H73A 2H1BA 4PGTA 4ZILA 10GSA 3KMOA 2H30A 2IMFA 3M9JA 4X0XA 1SKWB 5COHA 4ECJA 2B1LA 2VLTA 5L71A 4KNDA 5JWRB 3BCKA 3ZIVA 1WJKA 4AJ8A 3HJOA 1DE2A 1KTEA 4PXOA 4KSOA 3HJMA 4G10A 1TK0B 4MDCA 2CV4A 2IWTA 2CVDA 3D22A 3E3EA 4POKA 1GLQA 2YN1A 4IQAA 1TJDA 4GF0A 2VCWA 4OD7A 1OVNA 4NPBA 2M46A 2YCDA 3KGKA 2OJLA 5IO2A 3DKSA 3ISOA 4POBA 5EL8A 1B48A 5B6MA 2FWFA 4HZ2A 3OR5A 3UVHA 3IPZA 3MDKA 3GNJA 3DYRA 4XS6A 5H5RA 2VUPA 4V1Ap 3I6AA 3IC8A 5DQYA 3GURA 4MK3A 3TRPA 2XBIA 1GSSA 1F3AA 2TRXA 1THXA 1W89A 1R4WA 2FWGA 4MZCA 5EPFA 2H19A 1Q4JA 3EINA 1YZXA 1RW1A 4K7IA 4PNFA 5F05A 3KMNA 5HFKA 4L0WA 1GULA 1T3BA 5G2ZA 6GSUA 1VGLA 4FH8A 3ZREA 4LL4B 4O92A 3ZFBA 2IJYA 3M3MA 1XWGA 1BX9A 1B9YC 2DBCA 4WBRD 3CSJA 3TCOA 3PH9A 2V6KA 2TRCP 1SENA 2CZ2A 1DSBA 5C00A 3F4RA 3EVIA 3IOSA 2H74A 4DSQA 5GSTA 5IMDA 3UBLA 4PUFC 3ERGA 4F9ZA 3ZVJA 1EGRA 1GUKA 2I4AA 1OC8A 2LV3A 1FHEA 1OE8A 1WRYA 3J7Yb 3Q18A 3IK9A 1U6TA 3ERFA 3GH6A 4KF9A 2WS2A 3WT1A 2CQ9A 1ZGNA 3Q6OA 4YQUA 3F9UA 5D93A 1J08A 1YDKA 1ML6A 2LJAA 1WPIA 5CO3A 4EL1A 4XS4B 2WGRA 1MD4A 4MABA 4TRXA 3D21A 5KEJA 4GLTA 2LRTA 5HQPA 1GTIA 5DCGA 4NHZA 3LORA 2H0IA 2MBTA 4GWRA 4YQVA 1FOVA 4TR4A 3FYGA 4HOJA 3KH7A 4NXIA 5F06A 2YJ7A 3EWLA 2B7KA 3DWVA 1S3CA 2LKUA 4MH2A 5EY6A 5FT3A 2FA8A 2H6ZA 2H1AA 5DALA 4PTSA 5ECRB 2C0EA 3H1NA 3F3RA 3LXZA 5ECOB 2WCIA 3QD9A 4ZL9A 1TW9A 3UMAA 1K0NA 1TK5B 5B6NA 4EF0A 3RBTA 2GZYA 2HQTA 3CYNA 5G5EA 2DJJA 1ERTA 3TJBA 1O6JA 1FVJA 2RLIA 4JR6A 1PX7A 3EMPA 5DJLA 3MSZA 3DVWA 1LBKA 3VLNA 5ECHB 3H4KA 4V2MA 1T4YA 1EP8A 3D5JA 3DXBA 2L6DA 1A2MA 2CA8A 2I1UA 5J9CA 4K0NA 1K0DA 4EVMA 2CT6A 2HZEA 2OA7A 3KP8A 1ZYQB 4EO3A 3N9JA 1MDJA 2OE0A 2R37A 2LNTA 1Z9HA 3UOMA 1QUWA 4BA7A 3FK8A 5GSSA 3IAS2 1B8XA 3KEBA 4KW6A 3IHQA 1R26A 2GZPA 1T1VA 4POMA 4HJMA 4GXZA 1U87A 3N5OA 3IRAA 4YAPA 1VF4A 3LYPA 4N0ZA 3CRTA 2MBSA 3RDWA 3GFKA 2EC4A 5E59A 4OCFA 1S3DA 2J23A 1JHBA 3G7YA 4JRRA 2LS5A 1R7HA 2C8UA 3VWUA 1AQVA 1PQNA 2A2SA 1ZL9A 5HR0A 5EVOA 4DVCA 2H1GA 5F8BA 4MH3A 4IGJA 2C1YA 4POLA 5ELAA 1PX6A 2WDUA 2H71A 2AHEA 2HSMB 4K9ZA 1XVQA 5HR3A 1U3IA 2H1DA 5CRGA 2B3SA 1JZRA 3TKSE 3FHKA 1EP7A 1WWJA 2JSYA 3VI7A 1V9WA 3FRCA 5DAKA 2AUVA 1G7EA 1XCCA 1SD8A 4XRAA 3L78A 1A8LA 1KEBA 2UZ8A 1TRUA 3GKKA 3VPQA 2RUEA 2NBSA 2DJ2A 1BQ7A 2X8CA 1NW2A 5ECQB 5LD0A 2C3QA 4RI6A 1O7UA 1U88A 2FWEA 3UIWA 3GL5A 3KP9A 2X64A 4MLYA 1I5GA 3C7MA 2DSAA 3APSA 2O85A 4WR5A 2K8SA 2R3XA 4L5OA 2LRNA 2PU9C 2PWJA 2QKEA 2VL2C 3F3QA 4J2FA 3IR4A 1THOA 4MZBA 2REMA 1SJIA 2PUKC 2KP1A 4G0IA 4Z7XA 4G19A 2J9HA 2XPDA 4KDUA 3IK7A 2K8VA 5JCGA 4MF6A 2M72A 1GSDA 4I2UA 5JCUA 2LQOA 1SJZA 5B7CA 3GV1A 1XIYA 2N5AA 4BVXA 2K6VA 2VCXA 3UJ1A 1HD2A 9GSSA 5F07A 2WJUA 2DMLA 2FWHA 3C71A 1OAZA 3EYTA 2QC7A 1SKRB 2DIYA 5CRHA 3CMIA 2VM2A 4DSSB 1HNCA 2B1KA 1XOBA 4BWSA 4L5LA 2VLVA 2MMOA 1TU7A 1NSWA 1XW9A 4FIWA 3HCZA 3F4TA 2P0GA 3ZFLA 5CYYA 4RUVA 2IMDA 1GSEA 2VM1A 1K0CA 3GSSA 3ME7A 5IM9A 2ON5A 1GSYA 4IKHA 5KN1A 3GX8A 3UVTA 1TU8A 5AIXA 1ZOFA 4JU5A 1GNWA 2DJKA 1SYXA 1ON4A 3TDGA 1AUCA 2M80A 4XCSA 4TR1A 5KN2A 5ECSA 1G7OA 3D4MA 2C0DA 5HFIA 3J7Yk 1BYEA 1GTUA 2C3TA 3HKRA 4MP4A 4BL7A 4JE1A 2ON7A 3KXOA 3WGDA 3W6GA 2C0FA 2VIMA 3FZ4A 2F51A 2KUCA 4IP6A 4YAVA 2HZFA 5CP1A 3RHBA 1VF1A 1O73A 1SD9A 3IBHA 4D73B 4J56E 2GZZA 2LJRA 2B6MA 4O5RA 3RPNA 5FHIA 1TRWA 5IIZA 2ZNMA 4YH2A 2JL4A 3RHCA 2JZSA 4KX4A 1PL2A 2VL2A 3VURA 1Z3EA 2L5LA 2B5XA 2OE1A 5GAND 3GH9A 1ZYEA 1OC9A 3EU4A 4NWYA 2YV9A 4GRFA 4RQRA 4TVEA 2YJHA 2EIQA 1EV9A 4TW5A 1UA5A 4GTUA 5A4VA 2LUSA 4JBBA 4V2NA 1TOFA 1HYUA 3GN3A 3BD2A 4LL1B 4MJBA 1TP9A 4GQFA 5DDLA 1OC9B 2NDOA 4TOPA 3L9UA 4ML1A 1X9MB 2IN3A 2GDRA 3TRXA 3SWLA 3HZ8A 3QMXA 2JZRA 2GTUA 2PPTA 3C1RA 4CHSA 2IMIA 5ELGA 4HUAA 2E2GA 3FZ9A 1MD3A 1SU9A 4LMWA 4IQ1A 1SL1B 2RIIA 2L6CA 2B7JA 3IC4A 2DJ3A 1SK1A 3A3TA 2IFQA 1S3AA 1VRSD 1NM3A 4XS1A 3KD0A 2C80A 1WIKA 5ABRA 1T00A 1V98A 2IFQB 2V6OA 4WEYA 1YKCA 1FO5A 2CVKA 1H75A 2DJ1A 3U5RE 3TKRA 3VPTA 1ZMAA 4WF4A 2R5GA 1UN2A 3MAKA 3HYPA 2LTKA 1PSQA 2MMAA 3TOUA 1A24A 2F9SA 4ZB6A 3LQ7A 1TKDB 2IMKA 4YQMA 1M0UA 3K8NA 1R5PA 2DLXA 4ZBAA 2FUG2 1IYIA 1X5EA 1Y25A 5H5SA 2OADA 1ILOA 3VWVA 1Z6NA 3TUEA 4MJEA 1GUHA 1XWBA 3NZNA 5INYA 5IPGA 1ERVA 1M2AA 3TJGA 4NMUA 5GZZB 3L9SA 2IIYA 2XBQA 4ECBA 3C8EA 2YZUA 4KDYA 4FYUA 1WOUA 3PINA 5HR1A 2H0HA 4N30A 3HVVA 2WFCA 1JLVA 4XS4A 3V1WA 1SL2B 2GGTA 3O6TA 1HNAA 3DMLA 3GIXA 2GQKA 1GTAA 3VFIA 1O8WA 5DQSA 2K9FA 3QFAC 1USBA 1N8JA 3ZIJA 2E7PA 4K1FA 3KTLA 4HDEA 2O7KA 2YWIA 1I9DA 4E8HA 4HZ4A 3ZL5A 3GYKA 1GWCA 2VO4A 4NV2A 2H01A 5D9XA 2F8FA 3BBYA 4NHWA 2OE3A 4CDOA 4K7NA 3DVXA 3BOAA 3VWXA 5J41A 17GSA 5E4WA 2OACA 2FGXA 4G2EA 5AN1A 2CX4A 3G7JA 1JZDA 2CAQA 4V2LA 2FHEA 1XWKA 2JU5A 1JZWA 4ID0A 5IO0A 3CBUA 3UEMA 3TB2A 5G30A 2HI7A 1FW1A 4KE3A 2TIRA 2VD0A 2L4CA 4WETA 14GSA 2LRCA 3LG6A 1QFNA 3CTFA 3QFBC 5J4UA 3LJRA 4EDYA 2VLUA 2V41A 1TI1A 2BTOT 1JZOA 2WRTA 3HA9A 3C73A 3S9FA 1QXHA 6GSTA 2GSTA 2H70A 2O8VB 1J9BA 3NOFA 2AYTA 3GRXA 2HNLA 3LEFA 3FZ5A 1A2LA 2LEGA 4F82A 3DRNA 1OE7A 3UBKA 3DIEA 2X8GA 3DEXA 3P90A 3FR9A 5A4WA 1AXDA 4AJ7A 2A4VA 4ZIJA 2GS3A 4FO5A 4WF5A 2PERA 4PX1A 1YKAA 2C4JA 4PNGA 2YP6A 2LJKA 4TKYA 2VD1A 2EIOA 1Z7PA 4IVFA 5LCZA 2XPEA 2CAIA 2IL3A 1PRXA 3GA4A 3ED3A 2HSMA 3FEUA 3G9BA 3H93A 3FZAA 2H72A 1A0FA 4IHUA 4BVYA 4ECIA 4ISDA 2HLSA 2D2ZA 2YPMA 1O85A 1Y6EA 3FY7A 4EXJA 1O81A 2WB9A 3TKPA 1GSFA 5D9WA 3EURA 2OBKA 4BVYB 1GTBA 3LSZA 2ZCTA 4MPFA 3FR3A 3I69A 2VCZA 3GX0A 4DSRA 2VL3A 3W8SA 3KZQA 4F2IA 2PGTA 3P7XA 5IMCA 3GTUB 4PUAA 4PQ1A
chains in the Genus database with same CATH superfamily
1DE1A 5G1KA 4LA1A 6GSXA 1SVMA 1V57A 4HSCX 5D96A 4ZL8A 1XXUA 1GSUA 4MA9A 3I9V2 1PMTA 1EOHA 3ZVJD 4K6XA 1KBNA 2H6XA 1URMA 5A34A 4OFTA 2PVQA 3KIJA 3HXSA 2RM5A 3P8WA 3KH9A 1CQGA 4ECCA 3IDVA 3F63A 4F0CA 4TR3A 5D73A 3L0HA 3VK9A 5A5KA 3TRQA 4X1UA 4LMVA 3HDCA 4IJ3A 2H1LA 1UC7A 2JSZA 4WR4A 2VAFA 1XWCA 4KH7A 4DSSA 2GSRA 3TKQA 4ZB8A 1TK8B 2L57A 2YOIA 2FCHA 1F37A 2Z9SA 1N2AA 3A2XA 4BWQA 4K8MA 22GSA 1RK4A 4N10A 20GSA 2PN8A 4ZBDA 4XRDA 4EUYA 2KOKA 3LGCA 4K5RA 3BJ5A 1Z6MA 4KUNA 2VCTA 4HI7A 1WP0A 3Q19A 2CX3A 4OMVA 1ZCPA 1DBYA 1M7TA 2R6KA 2X49A 3I43A 1KNGA 1ST9A 1X5DA 4IS0A 3U6VA 1XW6A 1MDIA 3EU3A 4X4JA 2VCVA 3O3TA 4MZWA 1WE0A 4FQUA 4J57E 3IAM2 4D73A 4KA0A 4ML6A 1A8YA 1QMVA 3A2VA 3F8UA 18GSA 2WULA 5ID2A 1GUMA 4TR0A 5DBQA 4TXVA 1RQMA 4EKZA 3ZMKA 2DIZA 12GSA 1Z7RA 5ECPB 2AAWA 4EIQA 2MZCA 4JR4A 4ZB9A 1SK0A 1XWAA 4FYCA 2QSIA 4IP1A 5ID2B 2CVBA 1Z5YE 1MEKA 2C0GA 2OKAA 2V2GA 3GKXA 4N11A 4RQXA 5DJMA 1EWXA 4L8EA 5J3RA 1EOGA 5CNWA 1N25A 3GHAA 1XVWA 2I81A 7GSSA 3CXGA 1BAYA 2GSQA 2OBIA 5ECNB 3CRUA 4GSTA 1VF2A 4MF5A 4I97A 3H8QA 3F6DA 2XC2A 1YEPA 3RFRC 2X99A 3CSIA 1EEMA 1V58A 3GL3A 4HJ2A 4MCUA 1AQWA 1OKDA 4OO5A 3DGQA 1K3OA 4GDFA 3IE3A 2I3YA 2P5RA 2X8HA 5ECIB 5G31A 1SJ6A 4P3YB 1PD21 4AGSA 3LWAA 3QCPA 1OYJA 4N0VA 4EE0A 1O8XA 2P5QA 2IPAA 2EIRA 3HJPA 3L9VA 1ERUA 1XW5A 2VOCA 2LSTA 4TXOA 3R3EA 3M1GA 3HMJG 4MF7A 3UARA 2H0GA 3M8NA 6GSSA 1YF1A 5A1NA 2NPBA 1HNBA 2GSSA 2GT5A 5KN0A 2RM6A 1YY7A 3QAGA 4TXOB 3BCIA 3C1SA 4BPYA 1AC1A 4GSSA 5AIVA 2XHFA 4KGIA 1M2BA 2AV4A 4HS1A 3ZZXA 5BMUA 1XOAA 1HQOA 1Y1UA 4ZB7A 4ZL7A 2R2JA 4N3ZA 2MMNA 1AIUA 2O36A 2G0FA 4PQIA 1GLPA 3R2QA 3AY8A 3ME8A 2HE3A 4X43A 2A2RA 2FY6A 2DC5A 5BMUB 5DVBA 2JZTA 5GAPD 3LFLA 2CZ3A 2H6YA 2R4VA 1T4ZA 3WD6A 5J47A 1YVLA 1F2EA 1PA3A 3HD5A 1PL1A 4AKIA 5JWOB 1XPVA 4G0KA 1K0AA 2R0PA 4FYBA 1B4PA 4K0GA 3IXRA 4O32A 5H5QA 4ACSA 2B5YA 4F0BA 4IJIA 4JEDA 5J9BA 1FB0A 4Q5NA 1FB6A 5F0GA 1XG8A 1T7PB 5D8IA 4Z2UA 4ILFA 1G0TA 4KCEA 3US3A 2QA1A 3TJJA 1H4OA 4I2TA 1M9AA 2P31A 2ALBA 2HYXA 6GSWA 1QK8A 3KTBA 3G7IA 1OKTA 2GLRA 3M0FA 5IMAA 1LJRA 4E68A 4G0LA 5ENUA 3ZYWA 3NIVA 1ERWA 3A5WA 3MNGA 1AW9A 4IN0A 1I1IP 1E2YA 1GP1A 4ZXGA 3HVXA 3M9KA 3JCML 3ZLPA 3F0IA 1TRVA 4PI0C 3DD3A 2VCQA 2AJQB 1ZZYA 3ZRDA 6GSVA 5CRWA 1NHYA 3EE2A 1QQ2A 3UL3A 4RI7A 4KSMA 2KLXA 2N5BA 2NVLA 2E0QA 1WMJA 4Z2RA 4OWYA 2ZUPA 1BEDA 4KCAA 4QL9A 5G5FA 3SBCA 13GSA 3HZ4A 4K7OA 16GSA 5IOXA 5J5NA 3TOTA 1B4QA 4MJCA 2FLSA 1MDKA 3W8JA 5C04A 4G9HA 5KN3A 4EIPA 4O5QA 2DKIA 3UAPA 3CSHA 2O87A 1ACVA 2LQQA 5DALB 3TKSC 3D0ZA 3KCMA 1YJ6A 3WGEA 4ZBBA 3TGZA 4XTSA 1XZOA 4I5QA 3TJFA 5A5HA 4HU9A 2JADA 3PPUA 3GKMA 1K0OA 5J40A 1FVKA 2R0CA 2IMEA 5D9VA 4XIHA 3QOUA 1AAZA 2HXKA 4CY6A 3O76A 3GUSA 4F03A 1SK2A 3LXTA 2OT3A 2HT9A 1X9WB 2C3NA 3PR8A 2H8LA 2NTOA 2HZEB 3GMFA 1OC3A 4GSNA 3HY2A 4OO4A 4WKWA 4NAXA 1YF0A 4OCEA 1G6YA 2GQMA 1V2AA 3L4NA 2WZSA 3E0UA 1ZYNA 2E2MA 3IV4A 4I6XA 2HRAA 5IMFA 1K0BA 2H75A 2FD3A 1F9MA 2B5EA 8GSSA 5IQYA 2YWNA 4Q5FA 4DEJA 2HSYA 3IA1A 3GTUA 1DUGA 1W4VA 1A0RP 5D9TA 2L59A 2H66A 3FKFA 3APOA 3RAZA 3PGTA 2PMTA 2MMZA 2YWMA 2FNOA 5G1LA 2RUFA 2HFDA 1YEWC 5ECKB 2WVZA 4KAEA 1V40A 4OFMA 3GSTA 3F4SA 4AKXB 2KHPA 3MWHA 5J4YA 4MPGA 3QAWA 1M2DA 1TDIA 1TXXA 3EC3A 2HRFA 3QDNA 1IYHA 3Q74A 2WZ9A 5AISA 1T8EB 4ULXA 1GNEA 1AQXA 1EZKA 2AB6A 4WBJA 2H76A 1FAAA 3KJYA 1LU4A 2V1MA 3HHVA 1EGOA 11GSA 1X0RA 3ZTLA 5IMVA 3TKSA 4KB3A 2YANA 5DAKB 3KM6A 5DCHA 1MTCA 4H86A 1G6WA 2L5OA 4JZQA 4IW9A 4KDXA 1EEJA 4NV5A 4EC0A 4AJ6A 3HVSA 2V32A 2L4QA 4V1Ag 2MYGA 3FW2A 1JFUA 1FG4A 1K0MA 5LNKe 4USSA 1PKZA 1F3BA 1B9XC 5HR2A 1SKSB 2GQLA 3IHGA 1GH2A 2DJ0A 1XFLA 1C72A 3E9JB 1Q98A 1R5AA 4IBPA 4CY8A 1PKWA 3EPTA 2N5FA 2LNSA 1K3YA 3WYWA 3TU3B 1PGTA 3LYKA 5JWQB 5JCWA 4HQZA 2PBJA 4IELA 2FA4A 2YZHA 2HRNA 5CRDA 5IPHA 3F6FA 3WT2A 3CTGA 1F6MC 3P2AA 1K3LA 2YWOA 3A2WA 1ABAA 4O7HA 5ECLB 5FWGA 1U3AA 4HQSA 3H79A 4AF2A 2KP2A 4OFNA 2JACA 1VF3A 4I8BA 1E6BA 2F3MA 5CREA 4TN8A 1UVZA 3VI5A 4Q5QA 2ES7A 4E8EA 2GT6A 3ZITA 1TTZA 4K2DA 2G2QA 1BG5A 4HU7A 2BMXA 5B8AA 3ZMLA 1SL0B 4MMMA 4MJAA 4WXTA 5CAXA 1JLWA 2F8AA 2PVOC 5ECMB 1SYRA 4BVXB 1J0FA 3FR6A 3D6IA 3VWWA 3GKNA 4Q5RA 2HSNA 4XHMA 3APQA 1X5CA 2DMMA 4LLRA 5AGYA 4QQ7A 1M99A 2K18A 4PURA 1X9SB 2I9HA 2QGVA 3QAVA 3CQFA 2HSNB 1A23A 2GVPA 2A4HA 4GQCA 1NHOA 4ICYA 4HEA2 4EDZA 2HRKA 2O89A 1GRXA 5B8BA 5HFGA 1A2JA 2YV7A 1XBSA 1TRSA 4QL7A 4GCIA 2YNXA 3RPPA 19GSA 1GSQA 4TR1B 6GSYA 1TI3A 1BJXA 2BJXA 4L0UA 1YQ1A 1M9BA 1GL8A 2HRKB 3EMXA 3TJKA 4BL7B 4CW9A 5IMZA 1PN9A 3QPMA 1FOHA 3WGXA 1QGVA 2HSHA 1CQHA 3QR6A 4PQHA 2VL9A 5IOWA 3D4TA 1EV4A 1YEXA 5A4UA 3ERWA 2H73A 2H1BA 4PGTA 4ZILA 10GSA 3KMOA 2H30A 2IMFA 3M9JA 4X0XA 1SKWB 5COHA 4ECJA 2B1LA 2VLTA 5L71A 4KNDA 5JWRB 3BCKA 3ZIVA 1WJKA 4AJ8A 3HJOA 1DE2A 1KTEA 4MNNA 4PXOA 4KSOA 3HJMA 4G10A 1TK0B 2UV8G 4MDCA 2CV4A 2IWTA 2CVDA 3D22A 3E3EA 4POKA 1GLQA 2YN1A 4IQAA 1TJDA 4GF0A 4AKHA 2VCWA 4OD7A 2DKHA 1OVNA 4NPBA 2M46A 1TXUA 2YCDA 3KGKA 4BIKA 4O5UA 2OJLA 5IO2A 3MIXA 3DKSA 3ISOA 4POBA 5EL8A 1B48A 5B6MA 2FWFA 4HZ2A 3OR5A 3UVHA 3IPZA 3MDKA 3GNJA 3DYRA 4XS6A 5H5RA 2VUPA 4V1Ap 3I6AA 3IC8A 5DQYA 3GURA 4MK3A 3TRPA 2XBIA 1GSSA 1F3AA 2TRXA 1THXA 1W89A 1R4WA 2FWGA 4MZCA 5EPFA 2H19A 1Q4JA 3EINA 1YZXA 4W66A 1RW1A 4K7IA 4PNFA 5F05A 3KMNA 5HFKA 4L0WA 1GULA 3MYDA 1T3BA 5G2ZA 6GSUA 1VGLA 4FH8A 3ZREA 4LL4B 4O92A 3ZFBA 2IJYA 3M3MA 4QMKA 2EFEA 1XWGA 1BX9A 1B9YC 2DBCA 4WBRD 3CSJA 3TCOA 3PH9A 2V6KA 2TRCP 1SENA 2CZ2A 1DSBA 5C00A 3F4RA 1SVLA 3EVIA 4PHZC 3IOSA 2H74A 4DSQA 5GSTA 5IMDA 3UBLA 4PUFC 3ERGA 4F9ZA 3ZVJA 1EGRA 1GUKA 2I4AA 1OC8A 4K2XA 2LV3A 1FHEA 1OE8A 1WRYA 3J7Yb 3Q18A 3IK9A 1U6TA 3ERFA 3GH6A 4KF9A 2WS2A 3WT1A 2CQ9A 1ZGNA 2VKZG 3Q6OA 5KOWA 4YQUA 3F9UA 5D93A 1J08A 1YDKA 1ML6A 2LJAA 1WPIA 5CO3A 4EL1A 4XS4B 2WGRA 1MD4A 4MABA 4TRXA 3D21A 5KEJA 4GLTA 2LRTA 5HQPA 1GTIA 4FXYP 5DCGA 4NHZA 3LORA 2H0IA 2MBTA 4GWRA 4YQVA 1FOVA 4TR4A 3FYGA 4HOJA 3KH7A 4NXIA 5F06A 2YJ7A 3EWLA 2B7KA 3DWVA 1S3CA 2LKUA 4MH2A 3LW9A 5EY6A 5FT3A 2FA8A 2H6ZA 1S3RA 2H1AA 5DALA 4PTSA 5ECRB 2C0EA 4Z2TA 3H1NA 3F3RA 3LXZA 5ECOB 2WCIA 3QD9A 4ZL9A 1TW9A 3UMAA 1K0NA 1TK5B 5B6NA 2WVYA 4EF0A 3RBTA 1M3JA 2GZYA 2HQTA 3CYNA 3CWGA 5G5EA 2DJJA 1ERTA 3TJBA 1O6JA 1FVJA 2RLIA 4JR6A 1PX7A 3EMPA 5DJLA 3MSZA 3DVWA 1LBKA 3VLNA 5ECHB 3H4KA 4V2MA 1T4YA 1EP8A 3D5JA 3DXBA 2L6DA 1A2MA 2CA8A 2I1UA 5J9CA 4K0NA 1K0DA 4EVMA 2CT6A 2HZEA 2OA7A 3KP8A 1ZYQB 4EO3A 3N9JA 1MDJA 2OE0A 2R37A 2LNTA 1Z9HA 3UOMA 1QUWA 4BA7A 3FK8A 5GSSA 3IAS2 1B8XA 3KEBA 4KW6A 3IHQA 1R26A 2GZPA 1T1VA 4POMA 4HJMA 4GXZA 1U87A 3N5OA 3IRAA 4YAPA 1VF4A 3LYPA 4N0ZA 3CRTA 2MBSA 3RDWA 3GFKA 2EC4A 5E59A 4OCFA 1S3DA 2J23A 2EFCA 1SVOA 3G7YA 4JRRA 1JHBA 2LS5A 1R7HA 2C8UA 3VWUA 3HVNA 1AQVA 1M3IA 1PQNA 2A2SA 1ZL9A 5HR0A 5EVOA 1S4BP 4DVCA 2H1GA 5BRTA 5F8BA 4MH3A 4IGJA 2C1YA 4POLA 5ELAA 1PX6A 2WDUA 2H71A 2AHEA 2HSMB 4K9ZA 1XVQA 5HR3A 1U3IA 2H1DA 5CRGA 2B3SA 1JZRA 3TKSE 3FHKA 1EP7A 1WWJA 1ZYPA 2JSYA 3VI7A 1V9WA 3FRCA 5DAKA 2AUVA 1G7EA 1XCCA 1SD8A 4XRAA 3L78A 4AI6A 1A8LA 1KEBA 2UZ8A 1TRUA 3GKKA 3VPQA 2RUEA 2NBSA 2DJ2A 1BQ7A 2O5VA 2X8CA 1NW2A 5ECQB 5LD0A 2C3QA 4RI6A 1O7UA 1U88A 2FWEA 3UIWA 3GL5A 3KP9A 2X64A 4MLYA 1I5GA 5KOXA 3C7MA 2DSAA 3APSA 2O85A 4WR5A 2K8SA 2R3XA 4L5OA 2LRNA 2PU9C 2PWJA 2QKEA 2VL2C 3F3QA 4YKGA 4J2FA 3IR4A 1THOA 4MZBA 2REMA 5A34B 1SJIA 2PUKC 2KP1A 4G0IA 4Z7XA 4G19A 2J9HA 2XPDA 4KDUA 3IK7A 2K8VA 5JCGA 4MF6A 2M72A 1GSDA 4I2UA 5JCUA 2LQOA 1SJZA 5B7CA 3GV1A 1XIYA 2N5AA 4BVXA 2K6VA 2VCXA 3UJ1A 1HD2A 9GSSA 5F07A 2WJUA 2DMLA 2FWHA 3C71A 1OAZA 3EYTA 2QC7A 1SKRB 2DIYA 5CRHA 3CMIA 2VM2A 4DSSB 1HNCA 2B1KA 1XOBA 4BWSA 4L5LA 2VLVA 2MMOA 1TU7A 1NSWA 1XW9A 4FIWA 3HCZA 3F4TA 2P0GA 3ZFLA 5CYYA 4RUVA 2IMDA 1GSEA 2WW0A 2VM1A 1K0CA 3GSSA 3ME7A 5IM9A 2ON5A 1GSYA 4IKHA 4G01A 5KN1A 3GX8A 3UVTA 1TU8A 5AIXA 1ZOFA 4JU5A 5J4VA 1GNWA 2DJKA 1SYXA 1ON4A 3TDGA 1AUCA 2M80A 4XCSA 4TR1A 5KN2A 5ECSA 1G7OA 3D4MA 2C0DA 5HFIA 3J7Yk 1BYEA 1GTUA 2C3TA 3HKRA 4MP4A 4BL7A 4JE1A 2ON7A 1PFOA 3KXOA 3WGDA 3W6GA 2C0FA 2VIMA 3FZ4A 2F51A 2KUCA 4IP6A 2A2PA 4YAVA 2HZFA 5CP1A 3RHBA 1VF1A 1O73A 1SD9A 3IBHA 4D73B 4J56E 2GZZA 2LJRA 2B6MA 4O5RA 3RPNA 5FHIA 1TRWA 5IIZA 1BF5A 2ZNMA 4YH2A 2JL4A 3RHCA 2JZSA 4KX4A 1PL2A 2VL2A 3VURA 1Z3EA 2L5LA 2B5XA 2OE1A 5GAND 3GH9A 1ZYEA 1OC9A 3EU4A 4NWYA 2YV9A 4GRFA 4RQRA 4TVEA 2YJHA 2EIQA 1EV9A 4TW5A 1UA5A 4GTUA 5A4VA 2LUSA 4JBBA 4V2NA 1TOFA 1HYUA 3GN3A 3BD2A 4LL1B 4MJBA 1TP9A 4GQFA 5DDLA 1OC9B 2NDOA 4TOPA 3L9UA 4ML1A 1X9MB 2IN3A 2GDRA 3TRXA 3SWLA 3HZ8A 3QMXA 2JZRA 2GTUA 2PPTA 2WW2A 3C1RA 4CHSA 2IMIA 5ELGA 4HUAA 2E2GA 3FZ9A 2EFHA 1MD3A 1SU9A 4LMWA 4IQ1A 1SL1B 2RIIA 2L6CA 2B7JA 3IC4A 2DJ3A 1SK1A 3A3TA 2IFQA 1S3AA 1VRSD 1NM3A 4XS1A 2WVXA 3KD0A 2C80A 2R0GA 1WIKA 5ABRA 1T00A 5A1NB 3A5IA 1V98A 2IFQB 2WW3A 2V6OA 4WEYA 1YKCA 1FO5A 2WVXB 2CVKA 1H75A 2DJ1A 3U5RE 3TKRA 3VPTA 2WW1A 2O3EA 1ZMAA 4WF4A 2R5GA 1UN2A 3MAKA 3HYPA 2LTKA 1PSQA 2MMAA 3TOUA 1A24A 2F9SA 4ZB6A 3LQ7A 1TKDB 2IMKA 4YQMA 1M0UA 3K8NA 1R5PA 2DLXA 4ZBAA 2FUG2 1IYIA 1X5EA 1Y25A 5H5SA 2OADA 3FMWA 1ILOA 3VWVA 1Z6NA 3TUEA 4MJEA 1GUHA 1XWBA 3NZNA 5INYA 5IPGA 1ERVA 1M2AA 3TJGA 4NMUA 5GZZB 3L9SA 2IIYA 2XBQA 4ECBA 3C8EA 2YZUA 4KDYA 4FYUA 1WOUA 3PINA 5HR1A 2H0HA 4N30A 3HVVA 2WFCA 1JLVA 4XS4A 3V1WA 1SL2B 3RGBC 2GGTA 3O6TA 1HNAA 3DMLA 2X4AA 3GIXA 2GQKA 1GTAA 3VFIA 1O8WA 4PI2C 5DQSA 2K9FA 3QFAC 1USBA 1N8JA 3ZIJA 2E7PA 4K1FA 3KTLA 4HDEA 2O7KA 2YWIA 1I9DA 4E8HA 4HZ4A 3ZL5A 3GYKA 1GWCA 2EFDA 2VO4A 4NV2A 2H01A 5D9XA 2F8FA 3BBYA 4NHWA 2OE3A 4A5PA 4CDOA 4K7NA 3DVXA 3BOAA 3VWXA 5J41A 17GSA 5E4WA 2OACA 2FGXA 4G2EA 5AN1A 2CX4A 3G7JA 4YKFA 1JZDA 2CAQA 3CHXC 4V2LA 2FHEA 1XWKA 2JU5A 1JZWA 4ID0A 5IO0A 3CBUA 3UEMA 3TB2A 5G30A 2HI7A 1FW1A 4KE3A 2TIRA 2VD0A 2L4CA 1BG1A 4WETA 14GSA 2LRCA 3LG6A 1QFNA 3CTFA 3QFBC 5J4UA 3LJRA 4EDYA 1PN0A 2VLUA 2V41A 1TI1A 2BTOT 1JZOA 2WRTA 3HA9A 3C73A 3S9FA 1QXHA 6GSTA 2GSTA 2H70A 2O8VB 1J9BA 3NOFA 2AYTA 3GRXA 2HNLA 3LEFA 3FZ5A 1A2LA 2LEGA 4F82A 3DRNA 1OE7A 4K5SA 3UBKA 3DIEA 2X8GA 3DEXA 3P90A 3FR9A 5A4WA 1AXDA 4AJ7A 2A4VA 4ZIJA 5A5HB 2GS3A 4FO5A 4WF5A 2PERA 4PX1A 1YKAA 2C4JA 4PNGA 2YP6A 2LJKA 4TKYA 4AKGA 2VD1A 2EIOA 1Z7PA 4IVFA 5LCZA 2XPEA 2CAIA 2IL3A 1PRXA 3GA4A 3ED3A 2HSMA 3FEUA 3G9BA 3H93A 3FZAA 2H72A 1A0FA 4IHUA 4BVYA 4ECIA 4ISDA 2HLSA 2D2ZA 2YPMA 1O85A 1Y6EA 3FY7A 4EXJA 2QA2A 1O81A 2WB9A 3TKPA 1GSFA 5D9WA 3EURA 2OBKA 4BVYB 1GTBA 3LSZA 2ZCTA 4MPFA 3FR3A 3I69A 2VCZA 3GX0A 4DSRA 2VL3A 3W8SA 3KZQA 4F2IA 2PGTA 3P7XA 5IMCA 3GTUB 4PUAA 4PQ1A
chains in the Genus database with same CATH topology
1DE1A 5G1KA 4LA1A 6GSXA 1SVMA 1V57A 5D96A 4ZL8A 1XXUA 1GSUA 4MA9A 3I9V2 1PMTA 1EOHA 3ZVJD 4K6XA 1KBNA 2H6XA 1URMA 5A34A 4OFTA 2PVQA 3KIJA 3HXSA 2RM5A 3P8WA 3KH9A 1CQGA 4ECCA 3IDVA 3F63A 4F0CA 4TR3A 5D73A 3L0HA 3VK9A 5A5KA 3TRQA 4X1UA 4LMVA 3HDCA 4IJ3A 2H1LA 1UC7A 2JSZA 4WR4A 2VAFA 1XWCA 4KH7A 4DSSA 2GSRA 3TKQA 4ZB8A 1TK8B 2L57A 2YOIA 2FCHA 1F37A 2Z9SA 1N2AA 3A2XA 4BWQA 4K8MA 22GSA 1RK4A 4N10A 20GSA 2PN8A 4ZBDA 4XRDA 4EUYA 2KOKA 3LGCA 4K5RA 3BJ5A 1Z6MA 4KUNA 2VCTA 4HI7A 1WP0A 3Q19A 2CX3A 4OMVA 1ZCPA 1DBYA 1M7TA 2R6KA 2X49A 3I43A 1KNGA 1ST9A 1X5DA 4IS0A 3U6VA 1XW6A 1MDIA 3EU3A 4X4JA 2VCVA 3O3TA 4MZWA 1WE0A 4FQUA 4J57E 3IAM2 4D73A 4KA0A 4ML6A 1A8YA 1QMVA 3A2VA 3F8UA 18GSA 2WULA 5ID2A 1GUMA 4TR0A 5DBQA 4TXVA 1RQMA 4EKZA 3ZMKA 2DIZA 12GSA 1Z7RA 5ECPB 2AAWA 4EIQA 2MZCA 4JR4A 4ZB9A 1SK0A 1XWAA 4FYCA 2QSIA 4IP1A 5ID2B 2CVBA 1Z5YE 1MEKA 2C0GA 2OKAA 2V2GA 3GKXA 4N11A 4RQXA 5DJMA 1EWXA 4L8EA 5J3RA 1EOGA 5CNWA 1N25A 3GHAA 1XVWA 2I81A 7GSSA 3CXGA 1BAYA 2GSQA 2OBIA 5ECNB 3CRUA 4GSTA 1VF2A 4MF5A 4I97A 3H8QA 3F6DA 2XC2A 1YEPA 2X99A 3CSIA 1EEMA 1V58A 3GL3A 4HJ2A 4MCUA 1AQWA 1OKDA 4OO5A 3DGQA 1K3OA 4GDFA 3IE3A 2I3YA 2P5RA 2X8HA 5ECIB 5G31A 1SJ6A 4P3YB 1PD21 4AGSA 3LWAA 3QCPA 1OYJA 4N0VA 4EE0A 1O8XA 2P5QA 2IPAA 2EIRA 3HJPA 3L9VA 1ERUA 1XW5A 2VOCA 2LSTA 4TXOA 3R3EA 3M1GA 3HMJG 4MF7A 3UARA 2H0GA 3M8NA 6GSSA 1YF1A 5A1NA 2NPBA 1HNBA 2GSSA 2GT5A 5KN0A 2RM6A 1YY7A 3QAGA 4TXOB 3BCIA 3C1SA 4BPYA 1AC1A 4GSSA 5AIVA 2XHFA 4KGIA 1M2BA 2AV4A 4HS1A 3ZZXA 5BMUA 1XOAA 1HQOA 1Y1UA 4ZB7A 4ZL7A 2R2JA 4N3ZA 2MMNA 1AIUA 2G0FA 4PQIA 1GLPA 3R2QA 3AY8A 3ME8A 2HE3A 4X43A 2A2RA 2FY6A 2DC5A 5BMUB 5DVBA 2JZTA 5GAPD 3LFLA 2CZ3A 2H6YA 2R4VA 1T4ZA 3WD6A 5J47A 1YVLA 1F2EA 1PA3A 3HD5A 1PL1A 4AKIA 5JWOB 1XPVA 4G0KA 1K0AA 2R0PA 4FYBA 1B4PA 4K0GA 3IXRA 4O32A 5H5QA 4ACSA 2B5YA 4F0BA 4IJIA 4JEDA 5J9BA 1FB0A 4Q5NA 1FB6A 5F0GA 1T7PB 5D8IA 4Z2UA 4ILFA 1G0TA 4KCEA 3US3A 2QA1A 3TJJA 1H4OA 4I2TA 1M9AA 2P31A 2ALBA 2HYXA 6GSWA 1QK8A 3KTBA 3G7IA 1OKTA 2GLRA 3M0FA 5IMAA 1LJRA 4E68A 4G0LA 5ENUA 3ZYWA 3NIVA 1ERWA 3A5WA 3MNGA 1AW9A 4IN0A 1E2YA 1GP1A 4ZXGA 3HVXA 3M9KA 3JCML 3ZLPA 3F0IA 1TRVA 3DD3A 2VCQA 2AJQB 1ZZYA 3ZRDA 6GSVA 5CRWA 1NHYA 3EE2A 1QQ2A 3UL3A 4RI7A 4KSMA 2KLXA 2N5BA 2NVLA 2E0QA 1WMJA 4Z2RA 4OWYA 2ZUPA 1BEDA 4KCAA 4QL9A 5G5FA 3SBCA 13GSA 3HZ4A 4K7OA 16GSA 5IOXA 5J5NA 3TOTA 1B4QA 4MJCA 2FLSA 1MDKA 3W8JA 5C04A 4G9HA 5KN3A 4EIPA 4O5QA 2DKIA 3UAPA 3CSHA 2O87A 1ACVA 2LQQA 5DALB 3TKSC 3D0ZA 3KCMA 1YJ6A 3WGEA 4ZBBA 3TGZA 4XTSA 1XZOA 4I5QA 3TJFA 5A5HA 4HU9A 2JADA 3PPUA 3GKMA 1K0OA 5J40A 1FVKA 2R0CA 2IMEA 5D9VA 4XIHA 3QOUA 1AAZA 2HXKA 4CY6A 3O76A 3GUSA 4F03A 1SK2A 3LXTA 2OT3A 2HT9A 1X9WB 2C3NA 3PR8A 2H8LA 2NTOA 2HZEB 3GMFA 1OC3A 4GSNA 3HY2A 4OO4A 4WKWA 4NAXA 1YF0A 4OCEA 1G6YA 2GQMA 1V2AA 3L4NA 3E0UA 1ZYNA 2E2MA 3IV4A 4I6XA 2HRAA 5IMFA 1K0BA 2H75A 2FD3A 1F9MA 2B5EA 8GSSA 5IQYA 2YWNA 4Q5FA 4DEJA 2HSYA 3IA1A 3GTUA 1DUGA 1W4VA 1A0RP 5D9TA 2L59A 2H66A 3FKFA 3APOA 3RAZA 3PGTA 2PMTA 2MMZA 2YWMA 2FNOA 5G1LA 2RUFA 2HFDA 5ECKB 4KAEA 1V40A 4OFMA 3GSTA 3F4SA 4AKXB 2KHPA 3MWHA 5J4YA 4MPGA 3QAWA 1M2DA 1TDIA 1TXXA 3EC3A 2HRFA 3QDNA 1IYHA 3Q74A 2WZ9A 5AISA 1T8EB 4ULXA 1GNEA 1AQXA 1EZKA 2AB6A 4WBJA 2H76A 1FAAA 3KJYA 1LU4A 2V1MA 3HHVA 1EGOA 11GSA 1X0RA 3ZTLA 5IMVA 3TKSA 4KB3A 2YANA 5DAKB 3KM6A 5DCHA 1MTCA 4H86A 1G6WA 2L5OA 4JZQA 4IW9A 4KDXA 1EEJA 4NV5A 4EC0A 4AJ6A 3HVSA 2V32A 2L4QA 4V1Ag 2MYGA 3FW2A 1JFUA 1FG4A 1K0MA 5LNKe 4USSA 1PKZA 1F3BA 1B9XC 5HR2A 1SKSB 2GQLA 3IHGA 1GH2A 2DJ0A 1XFLA 1C72A 3E9JB 1Q98A 1R5AA 4IBPA 4CY8A 1PKWA 3EPTA 2N5FA 2LNSA 1K3YA 3WYWA 3TU3B 1PGTA 3LYKA 5JWQB 5JCWA 4HQZA 2PBJA 4IELA 2FA4A 2YZHA 2HRNA 5CRDA 5IPHA 3F6FA 3WT2A 3CTGA 1F6MC 3P2AA 1K3LA 2YWOA 3A2WA 1ABAA 4O7HA 5ECLB 5FWGA 1U3AA 4HQSA 3H79A 4AF2A 2KP2A 4OFNA 2JACA 1VF3A 4I8BA 1E6BA 2F3MA 5CREA 4TN8A 1UVZA 3VI5A 4Q5QA 2ES7A 4E8EA 2GT6A 3ZITA 1TTZA 4K2DA 2G2QA 1BG5A 4HU7A 2BMXA 5B8AA 3ZMLA 1SL0B 4MMMA 4MJAA 4WXTA 5CAXA 1JLWA 2F8AA 2PVOC 5ECMB 1SYRA 4BVXB 1J0FA 3FR6A 3D6IA 3VWWA 3GKNA 4Q5RA 2HSNA 4XHMA 3APQA 1X5CA 2DMMA 4LLRA 5AGYA 4QQ7A 1M99A 2K18A 4PURA 1X9SB 2I9HA 2QGVA 3QAVA 2HSNB 1A23A 2GVPA 2A4HA 4GQCA 1NHOA 4ICYA 4HEA2 4EDZA 2HRKA 2O89A 1GRXA 5B8BA 5HFGA 1A2JA 2YV7A 1XBSA 1TRSA 4QL7A 4GCIA 2YNXA 3RPPA 19GSA 1GSQA 4TR1B 6GSYA 1TI3A 1BJXA 2BJXA 4L0UA 1YQ1A 1M9BA 1GL8A 2HRKB 3EMXA 3TJKA 4BL7B 4CW9A 5IMZA 1PN9A 3QPMA 1FOHA 3WGXA 1QGVA 2HSHA 1CQHA 3QR6A 4PQHA 2VL9A 5IOWA 3D4TA 1EV4A 1YEXA 5A4UA 3ERWA 2H73A 2H1BA 4PGTA 4ZILA 10GSA 3KMOA 2H30A 2IMFA 3M9JA 4X0XA 1SKWB 5COHA 4ECJA 2B1LA 2VLTA 5L71A 4KNDA 5JWRB 3BCKA 3ZIVA 1WJKA 4AJ8A 3HJOA 1DE2A 1KTEA 4MNNA 4PXOA 4KSOA 3HJMA 4G10A 1TK0B 2UV8G 4MDCA 2CV4A 2IWTA 2CVDA 3D22A 3E3EA 4POKA 1GLQA 2YN1A 4IQAA 1TJDA 4GF0A 4AKHA 2VCWA 4OD7A 2DKHA 1OVNA 4NPBA 2M46A 1TXUA 2YCDA 3KGKA 4O5UA 2OJLA 5IO2A 3MIXA 3DKSA 3ISOA 4POBA 5EL8A 1B48A 5B6MA 2FWFA 4HZ2A 3OR5A 3UVHA 3IPZA 3MDKA 3GNJA 3DYRA 4XS6A 5H5RA 2VUPA 4V1Ap 3I6AA 3IC8A 5DQYA 3GURA 4MK3A 3TRPA 2XBIA 1GSSA 1F3AA 2TRXA 1THXA 1W89A 1R4WA 2FWGA 4MZCA 5EPFA 2H19A 1Q4JA 3EINA 1YZXA 4W66A 1RW1A 4K7IA 4PNFA 5F05A 3KMNA 5HFKA 4L0WA 1GULA 3MYDA 1T3BA 5G2ZA 6GSUA 1VGLA 4FH8A 3ZREA 4LL4B 4O92A 3ZFBA 2IJYA 3M3MA 4QMKA 2EFEA 1XWGA 1BX9A 1B9YC 2DBCA 4WBRD 3CSJA 3TCOA 3PH9A 2V6KA 2TRCP 1SENA 2CZ2A 1DSBA 5C00A 3F4RA 1SVLA 3EVIA 3IOSA 2H74A 4DSQA 5GSTA 5IMDA 3UBLA 4PUFC 3ERGA 4F9ZA 3ZVJA 1EGRA 1GUKA 2I4AA 1OC8A 4K2XA 2LV3A 1FHEA 1OE8A 1WRYA 3J7Yb 3Q18A 3IK9A 1U6TA 3ERFA 3GH6A 4KF9A 2WS2A 3WT1A 2CQ9A 1ZGNA 2VKZG 3Q6OA 5KOWA 4YQUA 3F9UA 5D93A 1J08A 1YDKA 1ML6A 2LJAA 1WPIA 5CO3A 4EL1A 4XS4B 2WGRA 1MD4A 4MABA 4TRXA 3D21A 5KEJA 4GLTA 2LRTA 5HQPA 1GTIA 5DCGA 4NHZA 3LORA 2H0IA 2MBTA 4GWRA 4YQVA 1FOVA 4TR4A 3FYGA 4HOJA 3KH7A 4NXIA 5F06A 2YJ7A 3EWLA 2B7KA 3DWVA 1S3CA 2LKUA 4MH2A 3LW9A 5EY6A 5FT3A 2FA8A 2H6ZA 2H1AA 5DALA 4PTSA 5ECRB 2C0EA 4Z2TA 3H1NA 3F3RA 3LXZA 5ECOB 2WCIA 3QD9A 4ZL9A 1TW9A 3UMAA 1K0NA 1TK5B 5B6NA 4EF0A 3RBTA 2GZYA 2HQTA 3CYNA 3CWGA 5G5EA 2DJJA 1ERTA 3TJBA 1O6JA 1FVJA 2RLIA 4JR6A 1PX7A 3EMPA 5DJLA 3MSZA 3DVWA 1LBKA 3VLNA 5ECHB 3H4KA 4V2MA 1T4YA 1EP8A 3D5JA 3DXBA 2L6DA 1A2MA 2CA8A 2I1UA 5J9CA 4K0NA 1K0DA 4EVMA 2CT6A 2HZEA 2OA7A 3KP8A 1ZYQB 4EO3A 3N9JA 1MDJA 2OE0A 2R37A 2LNTA 1Z9HA 3UOMA 1QUWA 4BA7A 3FK8A 5GSSA 3IAS2 1B8XA 3KEBA 4KW6A 3IHQA 1R26A 2GZPA 1T1VA 4POMA 4HJMA 4GXZA 1U87A 3N5OA 3IRAA 4YAPA 1VF4A 3LYPA 4N0ZA 3CRTA 2MBSA 3RDWA 3GFKA 2EC4A 5E59A 4OCFA 1S3DA 2J23A 2EFCA 1SVOA 3G7YA 4JRRA 1JHBA 2LS5A 1R7HA 2C8UA 3VWUA 1AQVA 1PQNA 2A2SA 1ZL9A 5HR0A 5EVOA 4DVCA 2H1GA 5BRTA 5F8BA 4MH3A 4IGJA 2C1YA 4POLA 5ELAA 1PX6A 2WDUA 2H71A 2AHEA 2HSMB 4K9ZA 1XVQA 5HR3A 1U3IA 2H1DA 5CRGA 2B3SA 1JZRA 3TKSE 3FHKA 1EP7A 1WWJA 1ZYPA 2JSYA 3VI7A 1V9WA 3FRCA 5DAKA 2AUVA 1G7EA 1XCCA 1SD8A 4XRAA 3L78A 4AI6A 1A8LA 1KEBA 2UZ8A 1TRUA 3GKKA 3VPQA 2RUEA 2NBSA 2DJ2A 1BQ7A 2O5VA 2X8CA 1NW2A 5ECQB 5LD0A 2C3QA 4RI6A 1O7UA 1U88A 2FWEA 3UIWA 3GL5A 3KP9A 2X64A 4MLYA 1I5GA 5KOXA 3C7MA 2DSAA 3APSA 2O85A 4WR5A 2K8SA 2R3XA 4L5OA 2LRNA 2PU9C 2PWJA 2QKEA 2VL2C 3F3QA 4YKGA 4J2FA 3IR4A 1THOA 4MZBA 2REMA 5A34B 1SJIA 2PUKC 2KP1A 4G0IA 4Z7XA 4G19A 2J9HA 2XPDA 4KDUA 3IK7A 2K8VA 5JCGA 4MF6A 2M72A 1GSDA 4I2UA 5JCUA 2LQOA 1SJZA 5B7CA 3GV1A 1XIYA 2N5AA 4BVXA 2K6VA 2VCXA 3UJ1A 1HD2A 9GSSA 5F07A 2WJUA 2DMLA 2FWHA 3C71A 1OAZA 3EYTA 2QC7A 1SKRB 2DIYA 5CRHA 3CMIA 2VM2A 4DSSB 1HNCA 2B1KA 1XOBA 4BWSA 4L5LA 2VLVA 2MMOA 1TU7A 1NSWA 1XW9A 4FIWA 3HCZA 3F4TA 2P0GA 3ZFLA 5CYYA 4RUVA 2IMDA 1GSEA 2VM1A 1K0CA 3GSSA 3ME7A 5IM9A 2ON5A 1GSYA 4IKHA 4G01A 5KN1A 3GX8A 3UVTA 1TU8A 5AIXA 1ZOFA 4JU5A 5J4VA 1GNWA 2DJKA 1SYXA 1ON4A 3TDGA 1AUCA 2M80A 4XCSA 4TR1A 5KN2A 5ECSA 1G7OA 3D4MA 2C0DA 5HFIA 3J7Yk 1BYEA 1GTUA 2C3TA 3HKRA 4MP4A 4BL7A 4JE1A 2ON7A 3KXOA 3WGDA 3W6GA 2C0FA 2VIMA 3FZ4A 2F51A 2KUCA 4IP6A 2A2PA 4YAVA 2HZFA 5CP1A 3RHBA 1VF1A 1O73A 1SD9A 3IBHA 4D73B 4J56E 2GZZA 2LJRA 2B6MA 4O5RA 3RPNA 5FHIA 1TRWA 5IIZA 1BF5A 2ZNMA 4YH2A 2JL4A 3RHCA 2JZSA 4KX4A 1PL2A 2VL2A 3VURA 1Z3EA 2L5LA 2B5XA 2OE1A 5GAND 3GH9A 1ZYEA 1OC9A 3EU4A 4NWYA 2YV9A 4GRFA 4RQRA 4TVEA 2YJHA 2EIQA 1EV9A 4TW5A 1UA5A 4GTUA 5A4VA 2LUSA 4JBBA 4V2NA 1TOFA 1HYUA 3GN3A 3BD2A 4LL1B 4MJBA 1TP9A 4GQFA 5DDLA 1OC9B 2NDOA 4TOPA 3L9UA 4ML1A 1X9MB 2IN3A 2GDRA 3TRXA 3SWLA 3HZ8A 3QMXA 2JZRA 2GTUA 2PPTA 3C1RA 4CHSA 2IMIA 5ELGA 4HUAA 2E2GA 3FZ9A 2EFHA 1MD3A 1SU9A 4LMWA 4IQ1A 1SL1B 2RIIA 2L6CA 2B7JA 3IC4A 2DJ3A 1SK1A 3A3TA 2IFQA 1S3AA 1VRSD 1NM3A 4XS1A 3KD0A 2C80A 2R0GA 1WIKA 5ABRA 1T00A 5A1NB 3A5IA 1V98A 2IFQB 2V6OA 4WEYA 1YKCA 1FO5A 2CVKA 1H75A 2DJ1A 3U5RE 3TKRA 3VPTA 1ZMAA 4WF4A 2R5GA 1UN2A 3MAKA 3HYPA 2LTKA 1PSQA 2MMAA 3TOUA 1A24A 2F9SA 4ZB6A 3LQ7A 1TKDB 2IMKA 4YQMA 1M0UA 3K8NA 1R5PA 2DLXA 4ZBAA 2FUG2 1IYIA 1X5EA 1Y25A 5H5SA 2OADA 3FMWA 1ILOA 3VWVA 1Z6NA 3TUEA 4MJEA 1GUHA 1XWBA 3NZNA 5INYA 5IPGA 1ERVA 1M2AA 3TJGA 4NMUA 5GZZB 3L9SA 2IIYA 2XBQA 4ECBA 3C8EA 2YZUA 4KDYA 4FYUA 1WOUA 3PINA 5HR1A 2H0HA 4N30A 3HVVA 2WFCA 1JLVA 4XS4A 3V1WA 1SL2B 2GGTA 3O6TA 1HNAA 3DMLA 2X4AA 3GIXA 2GQKA 1GTAA 3VFIA 1O8WA 5DQSA 2K9FA 3QFAC 1USBA 1N8JA 3ZIJA 2E7PA 4K1FA 3KTLA 4HDEA 2O7KA 2YWIA 1I9DA 4E8HA 4HZ4A 3ZL5A 3GYKA 1GWCA 2EFDA 2VO4A 4NV2A 2H01A 5D9XA 2F8FA 3BBYA 4NHWA 2OE3A 4A5PA 4CDOA 4K7NA 3DVXA 3BOAA 3VWXA 5J41A 17GSA 5E4WA 2OACA 2FGXA 4G2EA 5AN1A 2CX4A 3G7JA 4YKFA 1JZDA 2CAQA 4V2LA 2FHEA 1XWKA 2JU5A 1JZWA 4ID0A 5IO0A 3CBUA 3UEMA 3TB2A 5G30A 2HI7A 1FW1A 4KE3A 2TIRA 2VD0A 2L4CA 1BG1A 4WETA 14GSA 2LRCA 3LG6A 1QFNA 3CTFA 3QFBC 5J4UA 3LJRA 4EDYA 1PN0A 2VLUA 2V41A 1TI1A 2BTOT 1JZOA 2WRTA 3HA9A 3C73A 3S9FA 1QXHA 6GSTA 2GSTA 2H70A 2O8VB 1J9BA 3NOFA 2AYTA 3GRXA 2HNLA 3LEFA 3FZ5A 1A2LA 2LEGA 4F82A 3DRNA 1OE7A 4K5SA 3UBKA 3DIEA 2X8GA 3DEXA 3P90A 3FR9A 5A4WA 1AXDA 4AJ7A 2A4VA 4ZIJA 5A5HB 2GS3A 4FO5A 4WF5A 2PERA 4PX1A 1YKAA 2C4JA 4PNGA 2YP6A 2LJKA 4TKYA 4AKGA 2VD1A 2EIOA 1Z7PA 4IVFA 5LCZA 2XPEA 2CAIA 2IL3A 1PRXA 3GA4A 3ED3A 2HSMA 3FEUA 3G9BA 3H93A 3FZAA 2H72A 1A0FA 4IHUA 4BVYA 4ECIA 4ISDA 2HLSA 2D2ZA 2YPMA 1O85A 1Y6EA 3FY7A 4EXJA 2QA2A 1O81A 2WB9A 3TKPA 1GSFA 5D9WA 3EURA 2OBKA 4BVYB 1GTBA 3LSZA 2ZCTA 4MPFA 3FR3A 3I69A 2VCZA 3GX0A 4DSRA 2VL3A 3W8SA 3KZQA 4F2IA 2PGTA 3P7XA 5IMCA 3GTUB 4PUAA 4PQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DE1 A;  5G1K A;  4LA1 A;  6GSX A;  1V57 A;  5D96 A;  4ZL8 A;  1XXU A;  1GSU A;  4MA9 A;  3I9V 2;  1PMT A;  1EOH A;  3ZVJ D;  4K6X A;  1KBN A;  2H6X A;  1URM A;  4OFT A;  2PVQ A;  3KIJ A;  3HXS A;  2RM5 A;  3P8W A;  3KH9 A;  1CQG A;  4ECC A;  3IDV A;  3F63 A;  4F0C A;  4TR3 A;  5D73 A;  3L0H A;  3VK9 A;  5A5K A;  3TRQ A;  4X1U A;  4LMV A;  3HDC A;  4IJ3 A;  1UC7 A;  2JSZ A;  4WR4 A;  2VAF A;  1XWC A;  4KH7 A;  4DSS A;  2GSR A;  3TKQ A;  4ZB8 A;  1TK8 B;  2L57 A;  2YOI A;  2FCH A;  1F37 A;  2Z9S A;  1N2A A;  3A2X A;  4BWQ A;  4K8M A;  22GS A;  1RK4 A;  4N10 A;  20GS A;  2PN8 A;  4ZBD A;  4XRD A;  4EUY A;  2KOK A;  3LGC A;  3BJ5 A;  1Z6M A;  4KUN A;  2VCT A;  4HI7 A;  1WP0 A;  3Q19 A;  2CX3 A;  4OMV A;  1ZCP A;  1DBY A;  1M7T A;  2R6K A;  3I43 A;  1KNG A;  1ST9 A;  1X5D A;  4IS0 A;  3U6V A;  1XW6 A;  1MDI A;  3EU3 A;  2VCV A;  3O3T A;  4MZW A;  1WE0 A;  4FQU A;  4J57 E;  3IAM 2;  4D73 A;  4KA0 A;  4ML6 A;  1A8Y A;  1QMV A;  3A2V A;  3F8U A;  18GS A;  2WUL A;  5ID2 A;  1GUM A;  4TR0 A;  5DBQ A;  4TXV A;  1RQM A;  4EKZ A;  3ZMK A;  2DIZ A;  12GS A;  1Z7R A;  5ECP B;  2AAW A;  2MZC A;  4JR4 A;  4ZB9 A;  1SK0 A;  1XWA A;  4FYC A;  2QSI A;  4IP1 A;  5ID2 B;  2CVB A;  1Z5Y E;  1MEK A;  2C0G A;  2OKA A;  2V2G A;  3GKX A;  4N11 A;  4RQX A;  5DJM A;  1EWX A;  4L8E A;  5J3R A;  1EOG A;  5CNW A;  3GHA A;  1XVW A;  2I81 A;  7GSS A;  3CXG A;  1BAY A;  2GSQ A;  2OBI A;  5ECN B;  3CRU A;  4GST A;  1VF2 A;  4MF5 A;  4I97 A;  3H8Q A;  3F6D A;  2XC2 A;  1YEP A;  2X99 A;  3CSI A;  1EEM A;  1V58 A;  3GL3 A;  4HJ2 A;  4MCU A;  1AQW A;  1OKD A;  4OO5 A;  3DGQ A;  1K3O A;  3IE3 A;  2I3Y A;  2P5R A;  2X8H A;  5ECI B;  5G31 A;  1SJ6 A;  4P3Y B;  1PD2 1;  4AGS A;  3LWA A;  3QCP A;  1OYJ A;  4N0V A;  4EE0 A;  1O8X A;  2P5Q A;  2IPA A;  2EIR A;  3HJP A;  3L9V A;  1ERU A;  1XW5 A;  2VOC A;  2LST A;  4TXO A;  3R3E A;  3M1G A;  4MF7 A;  3UAR A;  2H0G A;  3M8N A;  6GSS A;  1YF1 A;  2NPB A;  1HNB A;  2GSS A;  2GT5 A;  5KN0 A;  2RM6 A;  1YY7 A;  3QAG A;  4TXO B;  3BCI A;  3C1S A;  4BPY A;  1AC1 A;  4GSS A;  5AIV A;  2XHF A;  4KGI A;  1M2B A;  2AV4 A;  4HS1 A;  3ZZX A;  5BMU A;  1XOA A;  1HQO A;  4ZL7 A;  2R2J A;  2MMN A;  1AIU A;  2G0F A;  4PQI A;  1GLP A;  3R2Q A;  3AY8 A;  3ME8 A;  2HE3 A;  4X43 A;  2A2R A;  2FY6 A;  2DC5 A;  5DVB A;  2JZT A;  5GAP D;  3LFL A;  2CZ3 A;  2H6Y A;  2R4V A;  1T4Z A;  3WD6 A;  1F2E A;  1PA3 A;  3HD5 A;  1PL1 A;  5JWO B;  1XPV A;  4G0K A;  1K0A A;  4FYB A;  1B4P A;  4K0G A;  3IXR A;  4O32 A;  5H5Q A;  4ACS A;  2B5Y A;  4F0B A;  4IJI A;  4JED A;  5J9B A;  1FB0 A;  4Q5N A;  1FB6 A;  5F0G A;  1T7P B;  5D8I A;  4ILF A;  1G0T A;  4KCE A;  3US3 A;  3TJJ A;  1H4O A;  4I2T A;  1M9A A;  2P31 A;  2ALB A;  2HYX A;  6GSW A;  1QK8 A;  3KTB A;  3G7I A;  1OKT A;  2GLR A;  3M0F A;  5IMA A;  1LJR A;  4G0L A;  5ENU A;  3ZYW A;  3NIV A;  1ERW A;  3A5W A;  3MNG A;  1AW9 A;  4IN0 A;  1E2Y A;  1GP1 A;  4ZXG A;  3HVX A;  3M9K A;  3JCM L;  3ZLP A;  3F0I A;  1TRV A;  3DD3 A;  2VCQ A;  2AJQ B;  1ZZY A;  3ZRD A;  6GSV A;  5CRW A;  1NHY A;  3EE2 A;  1QQ2 A;  3UL3 A;  4RI7 A;  4KSM A;  2KLX A;  2N5B A;  2NVL A;  2E0Q A;  1WMJ A;  4OWY A;  2ZUP A;  1BED A;  4KCA A;  4QL9 A;  5G5F A;  3SBC A;  13GS A;  3HZ4 A;  4K7O A;  16GS A;  5IOX A;  5J5N A;  3TOT A;  1B4Q A;  4MJC A;  2FLS A;  1MDK A;  3W8J A;  5C04 A;  4G9H A;  5KN3 A;  3UAP A;  3CSH A;  2O87 A;  1ACV A;  2LQQ A;  5DAL B;  3TKS C;  3D0Z A;  3KCM A;  1YJ6 A;  3WGE A;  4ZBB A;  3TGZ A;  4XTS A;  1XZO A;  4I5Q A;  3TJF A;  4HU9 A;  2JAD A;  3PPU A;  3GKM A;  1K0O A;  1FVK A;  2IME A;  5D9V A;  4XIH A;  3QOU A;  1AAZ A;  2HXK A;  3O76 A;  3GUS A;  4F03 A;  1SK2 A;  3LXT A;  2HT9 A;  1X9W B;  2C3N A;  3PR8 A;  2H8L A;  2NTO A;  2HZE B;  3GMF A;  1OC3 A;  4GSN A;  3HY2 A;  4OO4 A;  4WKW A;  4NAX A;  1YF0 A;  4OCE A;  1G6Y A;  2GQM A;  1V2A A;  3L4N A;  3E0U A;  2E2M A;  3IV4 A;  4I6X A;  2HRA A;  5IMF A;  1K0B A;  2H75 A;  2FD3 A;  1F9M A;  2B5E A;  8GSS A;  5IQY A;  2YWN A;  4Q5F A;  4DEJ A;  2HSY A;  3IA1 A;  3GTU A;  1DUG A;  1W4V A;  1A0R P;  5D9T A;  2L59 A;  2H66 A;  3FKF A;  3APO A;  3RAZ A;  3PGT A;  2PMT A;  2MMZ A;  2YWM A;  2FNO A;  5G1L A;  2RUF A;  2HFD A;  5ECK B;  4KAE A;  1V40 A;  4OFM A;  3GST A;  3F4S A;  2KHP A;  3MWH A;  4MPG A;  3QAW A;  1M2D A;  1TDI A;  1TXX A;  3EC3 A;  2HRF A;  3QDN A;  1IYH A;  3Q74 A;  2WZ9 A;  5AIS A;  1T8E B;  4ULX A;  1GNE A;  1AQX A;  1EZK A;  2AB6 A;  4WBJ A;  2H76 A;  1FAA A;  3KJY A;  1LU4 A;  2V1M A;  3HHV A;  1EGO A;  11GS A;  1X0R A;  3ZTL A;  5IMV A;  3TKS A;  4KB3 A;  2YAN A;  5DAK B;  3KM6 A;  5DCH A;  4H86 A;  1MTC A;  1G6W A;  2L5O A;  4JZQ A;  4IW9 A;  4KDX A;  1EEJ A;  4NV5 A;  4EC0 A;  4AJ6 A;  3HVS A;  2V32 A;  2L4Q A;  4V1A g;  2MYG A;  3FW2 A;  1JFU A;  1FG4 A;  1K0M A;  5LNK e;  4USS A;  1PKZ A;  1F3B A;  1B9X C;  5HR2 A;  1SKS B;  2GQL A;  1GH2 A;  2DJ0 A;  1XFL A;  1C72 A;  3E9J B;  1Q98 A;  1R5A A;  4IBP A;  1PKW A;  2N5F A;  2LNS A;  1K3Y A;  3WYW A;  1PGT A;  3LYK A;  5JWQ B;  5JCW A;  4HQZ A;  2PBJ A;  4IEL A;  2FA4 A;  2YZH A;  2HRN A;  5CRD A;  5IPH A;  3F6F A;  3WT2 A;  3CTG A;  1F6M C;  3P2A A;  1K3L A;  2YWO A;  3A2W A;  1ABA A;  4O7H A;  5ECL B;  5FWG A;  1U3A A;  4HQS A;  3H79 A;  4AF2 A;  2KP2 A;  4OFN A;  2JAC A;  1VF3 A;  4I8B A;  1E6B A;  2F3M A;  5CRE A;  4TN8 A;  1UVZ A;  3VI5 A;  4Q5Q A;  2ES7 A;  4E8E A;  2GT6 A;  3ZIT A;  1TTZ A;  4K2D A;  2G2Q A;  1BG5 A;  4HU7 A;  2BMX A;  5B8A A;  3ZML A;  1SL0 B;  4MMM A;  4MJA A;  4WXT A;  5CAX A;  1JLW A;  2F8A A;  2PVO C;  5ECM B;  1SYR A;  4BVX B;  1J0F A;  3FR6 A;  3D6I A;  3VWW A;  3GKN A;  4Q5R A;  4XHM A;  3APQ A;  1X5C A;  2DMM A;  4LLR A;  5AGY A;  4QQ7 A;  1M99 A;  2K18 A;  4PUR A;  1X9S B;  2I9H A;  2QGV A;  3QAV A;  2HSN B;  1A23 A;  2GVP A;  4GQC A;  1NHO A;  4HEA 2;  4EDZ A;  2HRK A;  2O89 A;  1GRX A;  5B8B A;  5HFG A;  1A2J A;  2YV7 A;  1XBS A;  1TRS A;  4QL7 A;  4GCI A;  2YNX A;  3RPP A;  19GS A;  1GSQ A;  4TR1 B;  6GSY A;  1TI3 A;  1BJX A;  2BJX A;  4L0U A;  1YQ1 A;  1M9B A;  1GL8 A;  2HRK B;  3EMX A;  3TJK A;  4BL7 B;  4CW9 A;  5IMZ A;  1PN9 A;  3QPM A;  3WGX A;  1QGV A;  2HSH A;  1CQH A;  3QR6 A;  4PQH A;  2VL9 A;  5IOW A;  3D4T A;  1EV4 A;  1YEX A;  5A4U A;  3ERW A;  2H73 A;  2H1B A;  4PGT A;  4ZIL A;  10GS A;  3KMO A;  2H30 A;  2IMF A;  3M9J A;  4X0X A;  1SKW B;  5COH A;  4ECJ A;  2B1L A;  2VLT A;  5L71 A;  4KND A;  5JWR B;  3BCK A;  3ZIV A;  1WJK A;  4AJ8 A;  3HJO A;  1DE2 A;  1KTE A;  4PXO A;  4KSO A;  3HJM A;  4G10 A;  1TK0 B;  4MDC A;  2CV4 A;  2IWT A;  2CVD A;  3D22 A;  3E3E A;  4POK A;  1GLQ A;  2YN1 A;  4IQA A;  1TJD A;  4GF0 A;  2VCW A;  4OD7 A;  1OVN A;  4NPB A;  2M46 A;  2YCD A;  3KGK A;  2OJL A;  5IO2 A;  3DKS A;  3ISO A;  4POB A;  5EL8 A;  1B48 A;  5B6M A;  2FWF A;  4HZ2 A;  3OR5 A;  3UVH A;  3IPZ A;  3MDK A;  3GNJ A;  3DYR A;  4XS6 A;  5H5R A;  2VUP A;  4V1A p;  3I6A A;  3IC8 A;  5DQY A;  3GUR A;  4MK3 A;  3TRP A;  2XBI A;  1GSS A;  1F3A A;  2TRX A;  1THX A;  1W89 A;  1R4W A;  2FWG A;  4MZC A;  5EPF A;  2H19 A;  1Q4J A;  3EIN A;  1YZX A;  1RW1 A;  4K7I A;  4PNF A;  5F05 A;  3KMN A;  5HFK A;  4L0W A;  1GUL A;  1T3B A;  5G2Z A;  6GSU A;  1VGL A;  4FH8 A;  3ZRE A;  4LL4 B;  4O92 A;  3ZFB A;  2IJY A;  3M3M A;  1XWG A;  1BX9 A;  1B9Y C;  2DBC A;  4WBR D;  3CSJ A;  3TCO A;  3PH9 A;  2V6K A;  2TRC P;  1SEN A;  2CZ2 A;  1DSB A;  5C00 A;  3F4R A;  3EVI A;  3IOS A;  2H74 A;  4DSQ A;  5GST A;  5IMD A;  3UBL A;  4PUF C;  3ERG A;  4F9Z A;  3ZVJ A;  1EGR A;  1GUK A;  2I4A A;  1OC8 A;  2LV3 A;  1FHE A;  1OE8 A;  1WRY A;  3J7Y b;  3Q18 A;  3IK9 A;  1U6T A;  3ERF A;  3GH6 A;  4KF9 A;  2WS2 A;  3WT1 A;  2CQ9 A;  1ZGN A;  3Q6O A;  4YQU A;  3F9U A;  5D93 A;  1J08 A;  1YDK A;  1ML6 A;  2LJA A;  1WPI A;  5CO3 A;  4EL1 A;  4XS4 B;  2WGR A;  1MD4 A;  4MAB A;  4TRX A;  3D21 A;  5KEJ A;  4GLT A;  2LRT A;  5HQP A;  1GTI A;  5DCG A;  4NHZ A;  3LOR A;  2H0I A;  2MBT A;  4GWR A;  4YQV A;  1FOV A;  4TR4 A;  3FYG A;  4HOJ A;  3KH7 A;  4NXI A;  5F06 A;  2YJ7 A;  3EWL A;  2B7K A;  3DWV A;  1S3C A;  2LKU A;  4MH2 A;  5EY6 A;  5FT3 A;  2FA8 A;  2H6Z A;  2H1A A;  5DAL A;  4PTS A;  5ECR B;  2C0E A;  3H1N A;  3F3R A;  3LXZ A;  5ECO B;  2WCI A;  3QD9 A;  4ZL9 A;  1TW9 A;  3UMA A;  1K0N A;  1TK5 B;  5B6N A;  4EF0 A;  3RBT A;  2GZY A;  2HQT A;  3CYN A;  5G5E A;  2DJJ A;  1ERT A;  3TJB A;  1O6J A;  1FVJ A;  2RLI A;  4JR6 A;  1PX7 A;  3EMP A;  5DJL A;  3MSZ A;  3DVW A;  1LBK A;  3VLN A;  5ECH B;  3H4K A;  4V2M A;  1T4Y A;  1EP8 A;  3D5J A;  3DXB A;  2L6D A;  1A2M A;  2CA8 A;  2I1U A;  5J9C A;  4K0N A;  1K0D A;  4EVM A;  2CT6 A;  2HZE A;  2OA7 A;  3KP8 A;  1ZYQ B;  4EO3 A;  3N9J A;  1MDJ A;  2OE0 A;  2R37 A;  2LNT A;  1Z9H A;  3UOM A;  1QUW A;  4BA7 A;  3FK8 A;  5GSS A;  3IAS 2;  1B8X A;  3KEB A;  4KW6 A;  3IHQ A;  1R26 A;  2GZP A;  1T1V A;  4POM A;  4HJM A;  4GXZ A;  1U87 A;  3N5O A;  3IRA A;  4YAP A;  1VF4 A;  3LYP A;  4N0Z A;  3CRT A;  2MBS A;  3RDW A;  3GFK A;  2EC4 A;  5E59 A;  4OCF A;  1S3D A;  2J23 A;  1JHB A;  3G7Y A;  4JRR A;  2LS5 A;  1R7H A;  2C8U A;  3VWU A;  1AQV A;  1PQN A;  2A2S A;  1ZL9 A;  5HR0 A;  5EVO A;  4DVC A;  2H1G A;  5F8B A;  4MH3 A;  4IGJ A;  2C1Y A;  4POL A;  5ELA A;  1PX6 A;  2WDU A;  2H71 A;  2AHE A;  2HSM B;  4K9Z A;  1XVQ A;  5HR3 A;  1U3I A;  2H1D A;  5CRG A;  2B3S A;  1JZR A;  3TKS E;  3FHK A;  1EP7 A;  1WWJ A;  2JSY A;  3VI7 A;  1V9W A;  3FRC A;  5DAK A;  2AUV A;  1G7E A;  1XCC A;  1SD8 A;  4XRA A;  3L78 A;  1A8L A;  1KEB A;  2UZ8 A;  1TRU A;  3GKK A;  3VPQ A;  2RUE A;  2NBS A;  2DJ2 A;  1BQ7 A;  2X8C A;  1NW2 A;  5ECQ B;  5LD0 A;  2C3Q A;  4RI6 A;  1O7U A;  1U88 A;  2FWE A;  3UIW A;  3GL5 A;  3KP9 A;  2X64 A;  4MLY A;  1I5G A;  3C7M A;  2DSA A;  3APS A;  2O85 A;  4WR5 A;  2K8S A;  2R3X A;  4L5O A;  2LRN A;  2PU9 C;  2PWJ A;  2QKE A;  2VL2 C;  3F3Q A;  4J2F A;  3IR4 A;  1THO A;  4MZB A;  2REM A;  1SJI A;  2PUK C;  2KP1 A;  4G0I A;  4Z7X A;  4G19 A;  2J9H A;  2XPD A;  4KDU A;  3IK7 A;  2K8V A;  5JCG A;  4MF6 A;  2M72 A;  1GSD A;  4I2U A;  5JCU A;  2LQO A;  1SJZ A;  5B7C A;  3GV1 A;  1XIY A;  2N5A A;  4BVX A;  2K6V A;  2VCX A;  3UJ1 A;  1HD2 A;  9GSS A;  5F07 A;  2WJU A;  2DML A;  2FWH A;  3C71 A;  1OAZ A;  3EYT A;  2QC7 A;  1SKR B;  2DIY A;  5CRH A;  3CMI A;  2VM2 A;  4DSS B;  1HNC A;  2B1K A;  1XOB A;  4BWS A;  4L5L A;  2VLV A;  2MMO A;  1TU7 A;  1NSW A;  1XW9 A;  4FIW A;  3HCZ A;  3F4T A;  2P0G A;  3ZFL A;  5CYY A;  4RUV A;  2IMD A;  1GSE A;  2VM1 A;  1K0C A;  3GSS A;  3ME7 A;  5IM9 A;  2ON5 A;  1GSY A;  4IKH A;  5KN1 A;  3GX8 A;  3UVT A;  1TU8 A;  5AIX A;  1ZOF A;  4JU5 A;  1GNW A;  2DJK A;  1SYX A;  1ON4 A;  3TDG A;  1AUC A;  2M80 A;  4XCS A;  4TR1 A;  5KN2 A;  5ECS A;  1G7O A;  3D4M A;  2C0D A;  5HFI A;  3J7Y k;  1BYE A;  1GTU A;  2C3T A;  3HKR A;  4MP4 A;  4BL7 A;  4JE1 A;  2ON7 A;  3KXO A;  3WGD A;  3W6G A;  2C0F A;  2VIM A;  3FZ4 A;  2F51 A;  2KUC A;  4IP6 A;  4YAV A;  2HZF A;  5CP1 A;  3RHB A;  1VF1 A;  1O73 A;  1SD9 A;  3IBH A;  4D73 B;  4J56 E;  2GZZ A;  2LJR A;  2B6M A;  4O5R A;  3RPN A;  5FHI A;  1TRW A;  5IIZ A;  2ZNM A;  4YH2 A;  2JL4 A;  3RHC A;  2JZS A;  4KX4 A;  1PL2 A;  2VL2 A;  3VUR A;  1Z3E A;  2L5L A;  2B5X A;  2OE1 A;  5GAN D;  3GH9 A;  1ZYE A;  1OC9 A;  3EU4 A;  4NWY A;  2YV9 A;  4GRF A;  4RQR A;  4TVE A;  2YJH A;  2EIQ A;  1EV9 A;  4TW5 A;  1UA5 A;  4GTU A;  5A4V A;  2LUS A;  4JBB A;  4V2N A;  1TOF A;  1HYU A;  3GN3 A;  3BD2 A;  4LL1 B;  4MJB A;  1TP9 A;  4GQF A;  5DDL A;  1OC9 B;  2NDO A;  4TOP A;  3L9U A;  4ML1 A;  1X9M B;  2IN3 A;  2GDR A;  3TRX A;  3SWL A;  3HZ8 A;  3QMX A;  2JZR A;  2GTU A;  2PPT A;  3C1R A;  4CHS A;  2IMI A;  5ELG A;  4HUA A;  2E2G A;  3FZ9 A;  1MD3 A;  1SU9 A;  4LMW A;  4IQ1 A;  1SL1 B;  2RII A;  2L6C A;  2B7J A;  3IC4 A;  2DJ3 A;  1SK1 A;  3A3T A;  2IFQ A;  1S3A A;  1VRS D;  1NM3 A;  4XS1 A;  3KD0 A;  2C80 A;  1WIK A;  5ABR A;  1T00 A;  1V98 A;  2IFQ B;  2V6O A;  4WEY A;  1YKC A;  1FO5 A;  2CVK A;  1H75 A;  2DJ1 A;  3U5R E;  3TKR A;  3VPT A;  1ZMA A;  4WF4 A;  2R5G A;  1UN2 A;  3MAK A;  3HYP A;  2LTK A;  1PSQ A;  2MMA A;  3TOU A;  1A24 A;  2F9S A;  4ZB6 A;  3LQ7 A;  1TKD B;  2IMK A;  4YQM A;  1M0U A;  3K8N A;  1R5P A;  2DLX A;  4ZBA A;  2FUG 2;  1IYI A;  1X5E A;  1Y25 A;  5H5S A;  2OAD A;  1ILO A;  3VWV A;  1Z6N A;  3TUE A;  4MJE A;  1GUH A;  1XWB A;  3NZN A;  5INY A;  5IPG A;  1ERV A;  1M2A A;  3TJG A;  4NMU A;  5GZZ B;  3L9S A;  2IIY A;  2XBQ A;  4ECB A;  3C8E A;  2YZU A;  4KDY A;  4FYU A;  1WOU A;  3PIN A;  5HR1 A;  2H0H A;  4N30 A;  3HVV A;  2WFC A;  1JLV A;  4XS4 A;  3V1W A;  1SL2 B;  2GGT A;  3O6T A;  1HNA A;  3DML A;  3GIX A;  2GQK A;  1GTA A;  3VFI A;  1O8W A;  5DQS A;  2K9F A;  3QFA C;  1USB A;  1N8J A;  3ZIJ A;  2E7P A;  4K1F A;  3KTL A;  4HDE A;  2O7K A;  2YWI A;  1I9D A;  4E8H A;  4HZ4 A;  3ZL5 A;  3GYK A;  1GWC A;  2VO4 A;  4NV2 A;  2H01 A;  5D9X A;  2F8F A;  3BBY A;  4NHW A;  2OE3 A;  4CDO A;  4K7N A;  3DVX A;  3BOA A;  3VWX A;  5J41 A;  17GS A;  5E4W A;  2OAC A;  2FGX A;  4G2E A;  5AN1 A;  2CX4 A;  3G7J A;  1JZD A;  2CAQ A;  4V2L A;  2FHE A;  1XWK A;  2JU5 A;  1JZW A;  4ID0 A;  5IO0 A;  3CBU A;  3UEM A;  3TB2 A;  5G30 A;  2HI7 A;  1FW1 A;  4KE3 A;  2TIR A;  2VD0 A;  2L4C A;  4WET A;  14GS A;  2LRC A;  3LG6 A;  1QFN A;  3CTF A;  3QFB C;  5J4U A;  3LJR A;  4EDY A;  2VLU A;  2V41 A;  1TI1 A;  2BTO T;  1JZO A;  2WRT A;  3HA9 A;  3C73 A;  3S9F A;  1QXH A;  6GST A;  2GST A;  2H70 A;  2O8V B;  1J9B A;  3NOF A;  2AYT A;  3GRX A;  2HNL A;  3LEF A;  3FZ5 A;  1A2L A;  2LEG A;  4F82 A;  3DRN A;  1OE7 A;  3UBK A;  3DIE A;  2X8G A;  3DEX A;  3P90 A;  3FR9 A;  5A4W A;  1AXD A;  4AJ7 A;  2A4V A;  4ZIJ A;  2GS3 A;  4FO5 A;  4WF5 A;  2PER A;  4PX1 A;  1YKA A;  2C4J A;  4PNG A;  2YP6 A;  2LJK A;  4TKY A;  2VD1 A;  2EIO A;  1Z7P A;  4IVF A;  5LCZ A;  2XPE A;  2CAI A;  2IL3 A;  1PRX A;  3GA4 A;  3ED3 A;  2HSM A;  3FEU A;  3G9B A;  3H93 A;  3FZA A;  2H72 A;  1A0F A;  4IHU A;  4BVY A;  4ECI A;  4ISD A;  2HLS A;  2D2Z A;  2YPM A;  1O85 A;  1Y6E A;  3FY7 A;  4EXJ A;  1O81 A;  2WB9 A;  3TKP A;  1GSF A;  5D9W A;  3EUR A;  2OBK A;  4BVY B;  1GTB A;  3LSZ A;  2ZCT A;  4MPF A;  3FR3 A;  3I69 A;  2VCZ A;  3GX0 A;  4DSR A;  2VL3 A;  3W8S A;  3KZQ A;  4F2I A;  2PGT A;  3P7X A;  5IMC A;  3GTU B;  4PUA A;  4PQ1 A; 
#chains in the Genus database with same CATH topology
 1DE1 A;  5G1K A;  4LA1 A;  6GSX A;  1SVM A;  1V57 A;  4HSC X;  5D96 A;  4ZL8 A;  1XXU A;  1GSU A;  4MA9 A;  3I9V 2;  1PMT A;  1EOH A;  3ZVJ D;  4K6X A;  1KBN A;  2H6X A;  1URM A;  5A34 A;  4OFT A;  2PVQ A;  3KIJ A;  3HXS A;  2RM5 A;  3P8W A;  3KH9 A;  1CQG A;  4ECC A;  3IDV A;  3F63 A;  4F0C A;  4TR3 A;  5D73 A;  3L0H A;  3VK9 A;  5A5K A;  3TRQ A;  4X1U A;  4LMV A;  3HDC A;  4IJ3 A;  2H1L A;  1UC7 A;  2JSZ A;  4WR4 A;  2VAF A;  1XWC A;  4KH7 A;  4DSS A;  2GSR A;  3TKQ A;  4ZB8 A;  1TK8 B;  2L57 A;  2YOI A;  2FCH A;  1F37 A;  2Z9S A;  1N2A A;  3A2X A;  4BWQ A;  4K8M A;  22GS A;  1RK4 A;  4N10 A;  20GS A;  2PN8 A;  4ZBD A;  4XRD A;  4EUY A;  2KOK A;  3LGC A;  4K5R A;  3BJ5 A;  1Z6M A;  4KUN A;  2VCT A;  4HI7 A;  1WP0 A;  3Q19 A;  2CX3 A;  4OMV A;  1ZCP A;  1DBY A;  1M7T A;  2R6K A;  2X49 A;  3I43 A;  1KNG A;  1ST9 A;  1X5D A;  4IS0 A;  3U6V A;  1XW6 A;  1MDI A;  3EU3 A;  4X4J A;  2VCV A;  3O3T A;  4MZW A;  1WE0 A;  4FQU A;  4J57 E;  3IAM 2;  4D73 A;  4KA0 A;  4ML6 A;  1A8Y A;  1QMV A;  3A2V A;  3F8U A;  18GS A;  2WUL A;  5ID2 A;  1GUM A;  4TR0 A;  5DBQ A;  4TXV A;  1RQM A;  4EKZ A;  3ZMK A;  2DIZ A;  12GS A;  1Z7R A;  5ECP B;  2AAW A;  4EIQ A;  2MZC A;  4JR4 A;  4ZB9 A;  1SK0 A;  1XWA A;  4FYC A;  2QSI A;  4IP1 A;  5ID2 B;  2CVB A;  1Z5Y E;  1MEK A;  2C0G A;  2OKA A;  2V2G A;  3GKX A;  4N11 A;  4RQX A;  5DJM A;  1EWX A;  4L8E A;  5J3R A;  1EOG A;  5CNW A;  1N25 A;  3GHA A;  1XVW A;  2I81 A;  7GSS A;  3CXG A;  1BAY A;  2GSQ A;  2OBI A;  5ECN B;  3CRU A;  4GST A;  1VF2 A;  4MF5 A;  4I97 A;  3H8Q A;  3F6D A;  2XC2 A;  1YEP A;  3RFR C;  2X99 A;  3CSI A;  1EEM A;  1V58 A;  3GL3 A;  4HJ2 A;  4MCU A;  1AQW A;  1OKD A;  4OO5 A;  3DGQ A;  1K3O A;  4GDF A;  3IE3 A;  2I3Y A;  2P5R A;  2X8H A;  5ECI B;  5G31 A;  1SJ6 A;  4P3Y B;  1PD2 1;  4AGS A;  3LWA A;  3QCP A;  1OYJ A;  4N0V A;  4EE0 A;  1O8X A;  2P5Q A;  2IPA A;  2EIR A;  3HJP A;  3L9V A;  1ERU A;  1XW5 A;  2VOC A;  2LST A;  4TXO A;  3R3E A;  3M1G A;  3HMJ G;  4MF7 A;  3UAR A;  2H0G A;  3M8N A;  6GSS A;  1YF1 A;  5A1N A;  2NPB A;  1HNB A;  2GSS A;  2GT5 A;  5KN0 A;  2RM6 A;  1YY7 A;  3QAG A;  4TXO B;  3BCI A;  3C1S A;  4BPY A;  1AC1 A;  4GSS A;  5AIV A;  2XHF A;  4KGI A;  1M2B A;  2AV4 A;  4HS1 A;  3ZZX A;  5BMU A;  1XOA A;  1HQO A;  1Y1U A;  4ZB7 A;  4ZL7 A;  2R2J A;  4N3Z A;  2MMN A;  1AIU A;  2O36 A;  2G0F A;  4PQI A;  1GLP A;  3R2Q A;  3AY8 A;  3ME8 A;  2HE3 A;  4X43 A;  2A2R A;  2FY6 A;  2DC5 A;  5BMU B;  5DVB A;  2JZT A;  5GAP D;  3LFL A;  2CZ3 A;  2H6Y A;  2R4V A;  1T4Z A;  3WD6 A;  5J47 A;  1YVL A;  1F2E A;  1PA3 A;  3HD5 A;  1PL1 A;  4AKI A;  5JWO B;  1XPV A;  4G0K A;  1K0A A;  2R0P A;  4FYB A;  1B4P A;  4K0G A;  3IXR A;  4O32 A;  5H5Q A;  4ACS A;  2B5Y A;  4F0B A;  4IJI A;  4JED A;  5J9B A;  1FB0 A;  4Q5N A;  1FB6 A;  5F0G A;  1XG8 A;  1T7P B;  5D8I A;  4Z2U A;  4ILF A;  1G0T A;  4KCE A;  3US3 A;  2QA1 A;  3TJJ A;  1H4O A;  4I2T A;  1M9A A;  2P31 A;  2ALB A;  2HYX A;  6GSW A;  1QK8 A;  3KTB A;  3G7I A;  1OKT A;  2GLR A;  3M0F A;  5IMA A;  1LJR A;  4E68 A;  4G0L A;  5ENU A;  3ZYW A;  3NIV A;  1ERW A;  3A5W A;  3MNG A;  1AW9 A;  4IN0 A;  1I1I P;  1E2Y A;  1GP1 A;  4ZXG A;  3HVX A;  3M9K A;  3JCM L;  3ZLP A;  3F0I A;  1TRV A;  4PI0 C;  3DD3 A;  2VCQ A;  2AJQ B;  1ZZY A;  3ZRD A;  6GSV A;  5CRW A;  1NHY A;  3EE2 A;  1QQ2 A;  3UL3 A;  4RI7 A;  4KSM A;  2KLX A;  2N5B A;  2NVL A;  2E0Q A;  1WMJ A;  4Z2R A;  4OWY A;  2ZUP A;  1BED A;  4KCA A;  4QL9 A;  5G5F A;  3SBC A;  13GS A;  3HZ4 A;  4K7O A;  16GS A;  5IOX A;  5J5N A;  3TOT A;  1B4Q A;  4MJC A;  2FLS A;  1MDK A;  3W8J A;  5C04 A;  4G9H A;  5KN3 A;  4EIP A;  4O5Q A;  2DKI A;  3UAP A;  3CSH A;  2O87 A;  1ACV A;  2LQQ A;  5DAL B;  3TKS C;  3D0Z A;  3KCM A;  1YJ6 A;  3WGE A;  4ZBB A;  3TGZ A;  4XTS A;  1XZO A;  4I5Q A;  3TJF A;  5A5H A;  4HU9 A;  2JAD A;  3PPU A;  3GKM A;  1K0O A;  5J40 A;  1FVK A;  2R0C A;  2IME A;  5D9V A;  4XIH A;  3QOU A;  1AAZ A;  2HXK A;  4CY6 A;  3O76 A;  3GUS A;  4F03 A;  1SK2 A;  3LXT A;  2OT3 A;  2HT9 A;  1X9W B;  2C3N A;  3PR8 A;  2H8L A;  2NTO A;  2HZE B;  3GMF A;  1OC3 A;  4GSN A;  3HY2 A;  4OO4 A;  4WKW A;  4NAX A;  1YF0 A;  4OCE A;  1G6Y A;  2GQM A;  1V2A A;  3L4N A;  2WZS A;  3E0U A;  1ZYN A;  2E2M A;  3IV4 A;  4I6X A;  2HRA A;  5IMF A;  1K0B A;  2H75 A;  2FD3 A;  1F9M A;  2B5E A;  8GSS A;  5IQY A;  2YWN A;  4Q5F A;  4DEJ A;  2HSY A;  3IA1 A;  3GTU A;  1DUG A;  1W4V A;  1A0R P;  5D9T A;  2L59 A;  2H66 A;  3FKF A;  3APO A;  3RAZ A;  3PGT A;  2PMT A;  2MMZ A;  2YWM A;  2FNO A;  5G1L A;  2RUF A;  2HFD A;  1YEW C;  5ECK B;  2WVZ A;  4KAE A;  1V40 A;  4OFM A;  3GST A;  3F4S A;  4AKX B;  2KHP A;  3MWH A;  5J4Y A;  4MPG A;  3QAW A;  1M2D A;  1TDI A;  1TXX A;  3EC3 A;  2HRF A;  3QDN A;  1IYH A;  3Q74 A;  2WZ9 A;  5AIS A;  1T8E B;  4ULX A;  1GNE A;  1AQX A;  1EZK A;  2AB6 A;  4WBJ A;  2H76 A;  1FAA A;  3KJY A;  1LU4 A;  2V1M A;  3HHV A;  1EGO A;  11GS A;  1X0R A;  3ZTL A;  5IMV A;  3TKS A;  4KB3 A;  2YAN A;  5DAK B;  3KM6 A;  5DCH A;  1MTC A;  4H86 A;  1G6W A;  2L5O A;  4JZQ A;  4IW9 A;  4KDX A;  1EEJ A;  4NV5 A;  4EC0 A;  4AJ6 A;  3HVS A;  2V32 A;  2L4Q A;  4V1A g;  2MYG A;  3FW2 A;  1JFU A;  1FG4 A;  1K0M A;  5LNK e;  4USS A;  1PKZ A;  1F3B A;  1B9X C;  5HR2 A;  1SKS B;  2GQL A;  3IHG A;  1GH2 A;  2DJ0 A;  1XFL A;  1C72 A;  3E9J B;  1Q98 A;  1R5A A;  4IBP A;  4CY8 A;  1PKW A;  3EPT A;  2N5F A;  2LNS A;  1K3Y A;  3WYW A;  3TU3 B;  1PGT A;  3LYK A;  5JWQ B;  5JCW A;  4HQZ A;  2PBJ A;  4IEL A;  2FA4 A;  2YZH A;  2HRN A;  5CRD A;  5IPH A;  3F6F A;  3WT2 A;  3CTG A;  1F6M C;  3P2A A;  1K3L A;  2YWO A;  3A2W A;  1ABA A;  4O7H A;  5ECL B;  5FWG A;  1U3A A;  4HQS A;  3H79 A;  4AF2 A;  2KP2 A;  4OFN A;  2JAC A;  1VF3 A;  4I8B A;  1E6B A;  2F3M A;  5CRE A;  4TN8 A;  1UVZ A;  3VI5 A;  4Q5Q A;  2ES7 A;  4E8E A;  2GT6 A;  3ZIT A;  1TTZ A;  4K2D A;  2G2Q A;  1BG5 A;  4HU7 A;  2BMX A;  5B8A A;  3ZML A;  1SL0 B;  4MMM A;  4MJA A;  4WXT A;  5CAX A;  1JLW A;  2F8A A;  2PVO C;  5ECM B;  1SYR A;  4BVX B;  1J0F A;  3FR6 A;  3D6I A;  3VWW A;  3GKN A;  4Q5R A;  2HSN A;  4XHM A;  3APQ A;  1X5C A;  2DMM A;  4LLR A;  5AGY A;  4QQ7 A;  1M99 A;  2K18 A;  4PUR A;  1X9S B;  2I9H A;  2QGV A;  3QAV A;  3CQF A;  2HSN B;  1A23 A;  2GVP A;  2A4H A;  4GQC A;  1NHO A;  4ICY A;  4HEA 2;  4EDZ A;  2HRK A;  2O89 A;  1GRX A;  5B8B A;  5HFG A;  1A2J A;  2YV7 A;  1XBS A;  1TRS A;  4QL7 A;  4GCI A;  2YNX A;  3RPP A;  19GS A;  1GSQ A;  4TR1 B;  6GSY A;  1TI3 A;  1BJX A;  2BJX A;  4L0U A;  1YQ1 A;  1M9B A;  1GL8 A;  2HRK B;  3EMX A;  3TJK A;  4BL7 B;  4CW9 A;  5IMZ A;  1PN9 A;  3QPM A;  1FOH A;  3WGX A;  1QGV A;  2HSH A;  1CQH A;  3QR6 A;  4PQH A;  2VL9 A;  5IOW A;  3D4T A;  1EV4 A;  1YEX A;  5A4U A;  3ERW A;  2H73 A;  2H1B A;  4PGT A;  4ZIL A;  10GS A;  3KMO A;  2H30 A;  2IMF A;  3M9J A;  4X0X A;  1SKW B;  5COH A;  4ECJ A;  2B1L A;  2VLT A;  5L71 A;  4KND A;  5JWR B;  3BCK A;  3ZIV A;  1WJK A;  4AJ8 A;  3HJO A;  1DE2 A;  1KTE A;  4MNN A;  4PXO A;  4KSO A;  3HJM A;  4G10 A;  1TK0 B;  2UV8 G;  4MDC A;  2CV4 A;  2IWT A;  2CVD A;  3D22 A;  3E3E A;  4POK A;  1GLQ A;  2YN1 A;  4IQA A;  1TJD A;  4GF0 A;  4AKH A;  2VCW A;  4OD7 A;  2DKH A;  1OVN A;  4NPB A;  2M46 A;  1TXU A;  2YCD A;  3KGK A;  4BIK A;  4O5U A;  2OJL A;  5IO2 A;  3MIX A;  3DKS A;  3ISO A;  4POB A;  5EL8 A;  1B48 A;  5B6M A;  2FWF A;  4HZ2 A;  3OR5 A;  3UVH A;  3IPZ A;  3MDK A;  3GNJ A;  3DYR A;  4XS6 A;  5H5R A;  2VUP A;  4V1A p;  3I6A A;  3IC8 A;  5DQY A;  3GUR A;  4MK3 A;  3TRP A;  2XBI A;  1GSS A;  1F3A A;  2TRX A;  1THX A;  1W89 A;  1R4W A;  2FWG A;  4MZC A;  5EPF A;  2H19 A;  1Q4J A;  3EIN A;  1YZX A;  4W66 A;  1RW1 A;  4K7I A;  4PNF A;  5F05 A;  3KMN A;  5HFK A;  4L0W A;  1GUL A;  3MYD A;  1T3B A;  5G2Z A;  6GSU A;  1VGL A;  4FH8 A;  3ZRE A;  4LL4 B;  4O92 A;  3ZFB A;  2IJY A;  3M3M A;  4QMK A;  2EFE A;  1XWG A;  1BX9 A;  1B9Y C;  2DBC A;  4WBR D;  3CSJ A;  3TCO A;  3PH9 A;  2V6K A;  2TRC P;  1SEN A;  2CZ2 A;  1DSB A;  5C00 A;  3F4R A;  1SVL A;  3EVI A;  4PHZ C;  3IOS A;  2H74 A;  4DSQ A;  5GST A;  5IMD A;  3UBL A;  4PUF C;  3ERG A;  4F9Z A;  3ZVJ A;  1EGR A;  1GUK A;  2I4A A;  1OC8 A;  4K2X A;  2LV3 A;  1FHE A;  1OE8 A;  1WRY A;  3J7Y b;  3Q18 A;  3IK9 A;  1U6T A;  3ERF A;  3GH6 A;  4KF9 A;  2WS2 A;  3WT1 A;  2CQ9 A;  1ZGN A;  2VKZ G;  3Q6O A;  5KOW A;  4YQU A;  3F9U A;  5D93 A;  1J08 A;  1YDK A;  1ML6 A;  2LJA A;  1WPI A;  5CO3 A;  4EL1 A;  4XS4 B;  2WGR A;  1MD4 A;  4MAB A;  4TRX A;  3D21 A;  5KEJ A;  4GLT A;  2LRT A;  5HQP A;  1GTI A;  4FXY P;  5DCG A;  4NHZ A;  3LOR A;  2H0I A;  2MBT A;  4GWR A;  4YQV A;  1FOV A;  4TR4 A;  3FYG A;  4HOJ A;  3KH7 A;  4NXI A;  5F06 A;  2YJ7 A;  3EWL A;  2B7K A;  3DWV A;  1S3C A;  2LKU A;  4MH2 A;  3LW9 A;  5EY6 A;  5FT3 A;  2FA8 A;  2H6Z A;  1S3R A;  2H1A A;  5DAL A;  4PTS A;  5ECR B;  2C0E A;  4Z2T A;  3H1N A;  3F3R A;  3LXZ A;  5ECO B;  2WCI A;  3QD9 A;  4ZL9 A;  1TW9 A;  3UMA A;  1K0N A;  1TK5 B;  5B6N A;  2WVY A;  4EF0 A;  3RBT A;  1M3J A;  2GZY A;  2HQT A;  3CYN A;  3CWG A;  5G5E A;  2DJJ A;  1ERT A;  3TJB A;  1O6J A;  1FVJ A;  2RLI A;  4JR6 A;  1PX7 A;  3EMP A;  5DJL A;  3MSZ A;  3DVW A;  1LBK A;  3VLN A;  5ECH B;  3H4K A;  4V2M A;  1T4Y A;  1EP8 A;  3D5J A;  3DXB A;  2L6D A;  1A2M A;  2CA8 A;  2I1U A;  5J9C A;  4K0N A;  1K0D A;  4EVM A;  2CT6 A;  2HZE A;  2OA7 A;  3KP8 A;  1ZYQ B;  4EO3 A;  3N9J A;  1MDJ A;  2OE0 A;  2R37 A;  2LNT A;  1Z9H A;  3UOM A;  1QUW A;  4BA7 A;  3FK8 A;  5GSS A;  3IAS 2;  1B8X A;  3KEB A;  4KW6 A;  3IHQ A;  1R26 A;  2GZP A;  1T1V A;  4POM A;  4HJM A;  4GXZ A;  1U87 A;  3N5O A;  3IRA A;  4YAP A;  1VF4 A;  3LYP A;  4N0Z A;  3CRT A;  2MBS A;  3RDW A;  3GFK A;  2EC4 A;  5E59 A;  4OCF A;  1S3D A;  2J23 A;  2EFC A;  1SVO A;  3G7Y A;  4JRR A;  1JHB A;  2LS5 A;  1R7H A;  2C8U A;  3VWU A;  3HVN A;  1AQV A;  1M3I A;  1PQN A;  2A2S A;  1ZL9 A;  5HR0 A;  5EVO A;  1S4B P;  4DVC A;  2H1G A;  5BRT A;  5F8B A;  4MH3 A;  4IGJ A;  2C1Y A;  4POL A;  5ELA A;  1PX6 A;  2WDU A;  2H71 A;  2AHE A;  2HSM B;  4K9Z A;  1XVQ A;  5HR3 A;  1U3I A;  2H1D A;  5CRG A;  2B3S A;  1JZR A;  3TKS E;  3FHK A;  1EP7 A;  1WWJ A;  1ZYP A;  2JSY A;  3VI7 A;  1V9W A;  3FRC A;  5DAK A;  2AUV A;  1G7E A;  1XCC A;  1SD8 A;  4XRA A;  3L78 A;  4AI6 A;  1A8L A;  1KEB A;  2UZ8 A;  1TRU A;  3GKK A;  3VPQ A;  2RUE A;  2NBS A;  2DJ2 A;  1BQ7 A;  2O5V A;  2X8C A;  1NW2 A;  5ECQ B;  5LD0 A;  2C3Q A;  4RI6 A;  1O7U A;  1U88 A;  2FWE A;  3UIW A;  3GL5 A;  3KP9 A;  2X64 A;  4MLY A;  1I5G A;  5KOX A;  3C7M A;  2DSA A;  3APS A;  2O85 A;  4WR5 A;  2K8S A;  2R3X A;  4L5O A;  2LRN A;  2PU9 C;  2PWJ A;  2QKE A;  2VL2 C;  3F3Q A;  4YKG A;  4J2F A;  3IR4 A;  1THO A;  4MZB A;  2REM A;  5A34 B;  1SJI A;  2PUK C;  2KP1 A;  4G0I A;  4Z7X A;  4G19 A;  2J9H A;  2XPD A;  4KDU A;  3IK7 A;  2K8V A;  5JCG A;  4MF6 A;  2M72 A;  1GSD A;  4I2U A;  5JCU A;  2LQO A;  1SJZ A;  5B7C A;  3GV1 A;  1XIY A;  2N5A A;  4BVX A;  2K6V A;  2VCX A;  3UJ1 A;  1HD2 A;  9GSS A;  5F07 A;  2WJU A;  2DML A;  2FWH A;  3C71 A;  1OAZ A;  3EYT A;  2QC7 A;  1SKR B;  2DIY A;  5CRH A;  3CMI A;  2VM2 A;  4DSS B;  1HNC A;  2B1K A;  1XOB A;  4BWS A;  4L5L A;  2VLV A;  2MMO A;  1TU7 A;  1NSW A;  1XW9 A;  4FIW A;  3HCZ A;  3F4T A;  2P0G A;  3ZFL A;  5CYY A;  4RUV A;  2IMD A;  1GSE A;  2WW0 A;  2VM1 A;  1K0C A;  3GSS A;  3ME7 A;  5IM9 A;  2ON5 A;  1GSY A;  4IKH A;  4G01 A;  5KN1 A;  3GX8 A;  3UVT A;  1TU8 A;  5AIX A;  1ZOF A;  4JU5 A;  5J4V A;  1GNW A;  2DJK A;  1SYX A;  1ON4 A;  3TDG A;  1AUC A;  2M80 A;  4XCS A;  4TR1 A;  5KN2 A;  5ECS A;  1G7O A;  3D4M A;  2C0D A;  5HFI A;  3J7Y k;  1BYE A;  1GTU A;  2C3T A;  3HKR A;  4MP4 A;  4BL7 A;  4JE1 A;  2ON7 A;  1PFO A;  3KXO A;  3WGD A;  3W6G A;  2C0F A;  2VIM A;  3FZ4 A;  2F51 A;  2KUC A;  4IP6 A;  2A2P A;  4YAV A;  2HZF A;  5CP1 A;  3RHB A;  1VF1 A;  1O73 A;  1SD9 A;  3IBH A;  4D73 B;  4J56 E;  2GZZ A;  2LJR A;  2B6M A;  4O5R A;  3RPN A;  5FHI A;  1TRW A;  5IIZ A;  1BF5 A;  2ZNM A;  4YH2 A;  2JL4 A;  3RHC A;  2JZS A;  4KX4 A;  1PL2 A;  2VL2 A;  3VUR A;  1Z3E A;  2L5L A;  2B5X A;  2OE1 A;  5GAN D;  3GH9 A;  1ZYE A;  1OC9 A;  3EU4 A;  4NWY A;  2YV9 A;  4GRF A;  4RQR A;  4TVE A;  2YJH A;  2EIQ A;  1EV9 A;  4TW5 A;  1UA5 A;  4GTU A;  5A4V A;  2LUS A;  4JBB A;  4V2N A;  1TOF A;  1HYU A;  3GN3 A;  3BD2 A;  4LL1 B;  4MJB A;  1TP9 A;  4GQF A;  5DDL A;  1OC9 B;  2NDO A;  4TOP A;  3L9U A;  4ML1 A;  1X9M B;  2IN3 A;  2GDR A;  3TRX A;  3SWL A;  3HZ8 A;  3QMX A;  2JZR A;  2GTU A;  2PPT A;  2WW2 A;  3C1R A;  4CHS A;  2IMI A;  5ELG A;  4HUA A;  2E2G A;  3FZ9 A;  2EFH A;  1MD3 A;  1SU9 A;  4LMW A;  4IQ1 A;  1SL1 B;  2RII A;  2L6C A;  2B7J A;  3IC4 A;  2DJ3 A;  1SK1 A;  3A3T A;  2IFQ A;  1S3A A;  1VRS D;  1NM3 A;  4XS1 A;  2WVX A;  3KD0 A;  2C80 A;  2R0G A;  1WIK A;  5ABR A;  1T00 A;  5A1N B;  3A5I A;  1V98 A;  2IFQ B;  2WW3 A;  2V6O A;  4WEY A;  1YKC A;  1FO5 A;  2WVX B;  2CVK A;  1H75 A;  2DJ1 A;  3U5R E;  3TKR A;  3VPT A;  2WW1 A;  2O3E A;  1ZMA A;  4WF4 A;  2R5G A;  1UN2 A;  3MAK A;  3HYP A;  2LTK A;  1PSQ A;  2MMA A;  3TOU A;  1A24 A;  2F9S A;  4ZB6 A;  3LQ7 A;  1TKD B;  2IMK A;  4YQM A;  1M0U A;  3K8N A;  1R5P A;  2DLX A;  4ZBA A;  2FUG 2;  1IYI A;  1X5E A;  1Y25 A;  5H5S A;  2OAD A;  3FMW A;  1ILO A;  3VWV A;  1Z6N A;  3TUE A;  4MJE A;  1GUH A;  1XWB A;  3NZN A;  5INY A;  5IPG A;  1ERV A;  1M2A A;  3TJG A;  4NMU A;  5GZZ B;  3L9S A;  2IIY A;  2XBQ A;  4ECB A;  3C8E A;  2YZU A;  4KDY A;  4FYU A;  1WOU A;  3PIN A;  5HR1 A;  2H0H A;  4N30 A;  3HVV A;  2WFC A;  1JLV A;  4XS4 A;  3V1W A;  1SL2 B;  3RGB C;  2GGT A;  3O6T A;  1HNA A;  3DML A;  2X4A A;  3GIX A;  2GQK A;  1GTA A;  3VFI A;  1O8W A;  4PI2 C;  5DQS A;  2K9F A;  3QFA C;  1USB A;  1N8J A;  3ZIJ A;  2E7P A;  4K1F A;  3KTL A;  4HDE A;  2O7K A;  2YWI A;  1I9D A;  4E8H A;  4HZ4 A;  3ZL5 A;  3GYK A;  1GWC A;  2EFD A;  2VO4 A;  4NV2 A;  2H01 A;  5D9X A;  2F8F A;  3BBY A;  4NHW A;  2OE3 A;  4A5P A;  4CDO A;  4K7N A;  3DVX A;  3BOA A;  3VWX A;  5J41 A;  17GS A;  5E4W A;  2OAC A;  2FGX A;  4G2E A;  5AN1 A;  2CX4 A;  3G7J A;  4YKF A;  1JZD A;  2CAQ A;  3CHX C;  4V2L A;  2FHE A;  1XWK A;  2JU5 A;  1JZW A;  4ID0 A;  5IO0 A;  3CBU A;  3UEM A;  3TB2 A;  5G30 A;  2HI7 A;  1FW1 A;  4KE3 A;  2TIR A;  2VD0 A;  2L4C A;  1BG1 A;  4WET A;  14GS A;  2LRC A;  3LG6 A;  1QFN A;  3CTF A;  3QFB C;  5J4U A;  3LJR A;  4EDY A;  1PN0 A;  2VLU A;  2V41 A;  1TI1 A;  2BTO T;  1JZO A;  2WRT A;  3HA9 A;  3C73 A;  3S9F A;  1QXH A;  6GST A;  2GST A;  2H70 A;  2O8V B;  1J9B A;  3NOF A;  2AYT A;  3GRX A;  2HNL A;  3LEF A;  3FZ5 A;  1A2L A;  2LEG A;  4F82 A;  3DRN A;  1OE7 A;  4K5S A;  3UBK A;  3DIE A;  2X8G A;  3DEX A;  3P90 A;  3FR9 A;  5A4W A;  1AXD A;  4AJ7 A;  2A4V A;  4ZIJ A;  5A5H B;  2GS3 A;  4FO5 A;  4WF5 A;  2PER A;  4PX1 A;  1YKA A;  2C4J A;  4PNG A;  2YP6 A;  2LJK A;  4TKY A;  4AKG A;  2VD1 A;  2EIO A;  1Z7P A;  4IVF A;  5LCZ A;  2XPE A;  2CAI A;  2IL3 A;  1PRX A;  3GA4 A;  3ED3 A;  2HSM A;  3FEU A;  3G9B A;  3H93 A;  3FZA A;  2H72 A;  1A0F A;  4IHU A;  4BVY A;  4ECI A;  4ISD A;  2HLS A;  2D2Z A;  2YPM A;  1O85 A;  1Y6E A;  3FY7 A;  4EXJ A;  2QA2 A;  1O81 A;  2WB9 A;  3TKP A;  1GSF A;  5D9W A;  3EUR A;  2OBK A;  4BVY B;  1GTB A;  3LSZ A;  2ZCT A;  4MPF A;  3FR3 A;  3I69 A;  2VCZ A;  3GX0 A;  4DSR A;  2VL3 A;  3W8S A;  3KZQ A;  4F2I A;  2PGT A;  3P7X A;  5IMC A;  3GTU B;  4PUA A;  4PQ1 A; 
#chains in the Genus database with same CATH homology
 1DE1 A;  5G1K A;  4LA1 A;  6GSX A;  1SVM A;  1V57 A;  5D96 A;  4ZL8 A;  1XXU A;  1GSU A;  4MA9 A;  3I9V 2;  1PMT A;  1EOH A;  3ZVJ D;  4K6X A;  1KBN A;  2H6X A;  1URM A;  5A34 A;  4OFT A;  2PVQ A;  3KIJ A;  3HXS A;  2RM5 A;  3P8W A;  3KH9 A;  1CQG A;  4ECC A;  3IDV A;  3F63 A;  4F0C A;  4TR3 A;  5D73 A;  3L0H A;  3VK9 A;  5A5K A;  3TRQ A;  4X1U A;  4LMV A;  3HDC A;  4IJ3 A;  2H1L A;  1UC7 A;  2JSZ A;  4WR4 A;  2VAF A;  1XWC A;  4KH7 A;  4DSS A;  2GSR A;  3TKQ A;  4ZB8 A;  1TK8 B;  2L57 A;  2YOI A;  2FCH A;  1F37 A;  2Z9S A;  1N2A A;  3A2X A;  4BWQ A;  4K8M A;  22GS A;  1RK4 A;  4N10 A;  20GS A;  2PN8 A;  4ZBD A;  4XRD A;  4EUY A;  2KOK A;  3LGC A;  4K5R A;  3BJ5 A;  1Z6M A;  4KUN A;  2VCT A;  4HI7 A;  1WP0 A;  3Q19 A;  2CX3 A;  4OMV A;  1ZCP A;  1DBY A;  1M7T A;  2R6K A;  2X49 A;  3I43 A;  1KNG A;  1ST9 A;  1X5D A;  4IS0 A;  3U6V A;  1XW6 A;  1MDI A;  3EU3 A;  4X4J A;  2VCV A;  3O3T A;  4MZW A;  1WE0 A;  4FQU A;  4J57 E;  3IAM 2;  4D73 A;  4KA0 A;  4ML6 A;  1A8Y A;  1QMV A;  3A2V A;  3F8U A;  18GS A;  2WUL A;  5ID2 A;  1GUM A;  4TR0 A;  5DBQ A;  4TXV A;  1RQM A;  4EKZ A;  3ZMK A;  2DIZ A;  12GS A;  1Z7R A;  5ECP B;  2AAW A;  4EIQ A;  2MZC A;  4JR4 A;  4ZB9 A;  1SK0 A;  1XWA A;  4FYC A;  2QSI A;  4IP1 A;  5ID2 B;  2CVB A;  1Z5Y E;  1MEK A;  2C0G A;  2OKA A;  2V2G A;  3GKX A;  4N11 A;  4RQX A;  5DJM A;  1EWX A;  4L8E A;  5J3R A;  1EOG A;  5CNW A;  1N25 A;  3GHA A;  1XVW A;  2I81 A;  7GSS A;  3CXG A;  1BAY A;  2GSQ A;  2OBI A;  5ECN B;  3CRU A;  4GST A;  1VF2 A;  4MF5 A;  4I97 A;  3H8Q A;  3F6D A;  2XC2 A;  1YEP A;  2X99 A;  3CSI A;  1EEM A;  1V58 A;  3GL3 A;  4HJ2 A;  4MCU A;  1AQW A;  1OKD A;  4OO5 A;  3DGQ A;  1K3O A;  4GDF A;  3IE3 A;  2I3Y A;  2P5R A;  2X8H A;  5ECI B;  5G31 A;  1SJ6 A;  4P3Y B;  1PD2 1;  4AGS A;  3LWA A;  3QCP A;  1OYJ A;  4N0V A;  4EE0 A;  1O8X A;  2P5Q A;  2IPA A;  2EIR A;  3HJP A;  3L9V A;  1ERU A;  1XW5 A;  2VOC A;  2LST A;  4TXO A;  3R3E A;  3M1G A;  3HMJ G;  4MF7 A;  3UAR A;  2H0G A;  3M8N A;  6GSS A;  1YF1 A;  5A1N A;  2NPB A;  1HNB A;  2GSS A;  2GT5 A;  5KN0 A;  2RM6 A;  1YY7 A;  3QAG A;  4TXO B;  3BCI A;  3C1S A;  4BPY A;  1AC1 A;  4GSS A;  5AIV A;  2XHF A;  4KGI A;  1M2B A;  2AV4 A;  4HS1 A;  3ZZX A;  5BMU A;  1XOA A;  1HQO A;  1Y1U A;  4ZB7 A;  4ZL7 A;  2R2J A;  4N3Z A;  2MMN A;  1AIU A;  2G0F A;  4PQI A;  1GLP A;  3R2Q A;  3AY8 A;  3ME8 A;  2HE3 A;  4X43 A;  2A2R A;  2FY6 A;  2DC5 A;  5BMU B;  5DVB A;  2JZT A;  5GAP D;  3LFL A;  2CZ3 A;  2H6Y A;  2R4V A;  1T4Z A;  3WD6 A;  5J47 A;  1YVL A;  1F2E A;  1PA3 A;  3HD5 A;  1PL1 A;  4AKI A;  5JWO B;  1XPV A;  4G0K A;  1K0A A;  2R0P A;  4FYB A;  1B4P A;  4K0G A;  3IXR A;  4O32 A;  5H5Q A;  4ACS A;  2B5Y A;  4F0B A;  4IJI A;  4JED A;  5J9B A;  1FB0 A;  4Q5N A;  1FB6 A;  5F0G A;  1T7P B;  5D8I A;  4Z2U A;  4ILF A;  1G0T A;  4KCE A;  3US3 A;  2QA1 A;  3TJJ A;  1H4O A;  4I2T A;  1M9A A;  2P31 A;  2ALB A;  2HYX A;  6GSW A;  1QK8 A;  3KTB A;  3G7I A;  1OKT A;  2GLR A;  3M0F A;  5IMA A;  1LJR A;  4E68 A;  4G0L A;  5ENU A;  3ZYW A;  3NIV A;  1ERW A;  3A5W A;  3MNG A;  1AW9 A;  4IN0 A;  1E2Y A;  1GP1 A;  4ZXG A;  3HVX A;  3M9K A;  3JCM L;  3ZLP A;  3F0I A;  1TRV A;  3DD3 A;  2VCQ A;  2AJQ B;  1ZZY A;  3ZRD A;  6GSV A;  5CRW A;  1NHY A;  3EE2 A;  1QQ2 A;  3UL3 A;  4RI7 A;  4KSM A;  2KLX A;  2N5B A;  2NVL A;  2E0Q A;  1WMJ A;  4Z2R A;  4OWY A;  2ZUP A;  1BED A;  4KCA A;  4QL9 A;  5G5F A;  3SBC A;  13GS A;  3HZ4 A;  4K7O A;  16GS A;  5IOX A;  5J5N A;  3TOT A;  1B4Q A;  4MJC A;  2FLS A;  1MDK A;  3W8J A;  5C04 A;  4G9H A;  5KN3 A;  4EIP A;  4O5Q A;  2DKI A;  3UAP A;  3CSH A;  2O87 A;  1ACV A;  2LQQ A;  5DAL B;  3TKS C;  3D0Z A;  3KCM A;  1YJ6 A;  3WGE A;  4ZBB A;  3TGZ A;  4XTS A;  1XZO A;  4I5Q A;  3TJF A;  5A5H A;  4HU9 A;  2JAD A;  3PPU A;  3GKM A;  1K0O A;  5J40 A;  1FVK A;  2R0C A;  2IME A;  5D9V A;  4XIH A;  3QOU A;  1AAZ A;  2HXK A;  4CY6 A;  3O76 A;  3GUS A;  4F03 A;  1SK2 A;  3LXT A;  2OT3 A;  2HT9 A;  1X9W B;  2C3N A;  3PR8 A;  2H8L A;  2NTO A;  2HZE B;  3GMF A;  1OC3 A;  4GSN A;  3HY2 A;  4OO4 A;  4WKW A;  4NAX A;  1YF0 A;  4OCE A;  1G6Y A;  2GQM A;  1V2A A;  3L4N A;  3E0U A;  1ZYN A;  2E2M A;  3IV4 A;  4I6X A;  2HRA A;  5IMF A;  1K0B A;  2H75 A;  2FD3 A;  1F9M A;  2B5E A;  8GSS A;  5IQY A;  2YWN A;  4Q5F A;  4DEJ A;  2HSY A;  3IA1 A;  3GTU A;  1DUG A;  1W4V A;  1A0R P;  5D9T A;  2L59 A;  2H66 A;  3FKF A;  3APO A;  3RAZ A;  3PGT A;  2PMT A;  2MMZ A;  2YWM A;  2FNO A;  5G1L A;  2RUF A;  2HFD A;  5ECK B;  4KAE A;  1V40 A;  4OFM A;  3GST A;  3F4S A;  4AKX B;  2KHP A;  3MWH A;  5J4Y A;  4MPG A;  3QAW A;  1M2D A;  1TDI A;  1TXX A;  3EC3 A;  2HRF A;  3QDN A;  1IYH A;  3Q74 A;  2WZ9 A;  5AIS A;  1T8E B;  4ULX A;  1GNE A;  1AQX A;  1EZK A;  2AB6 A;  4WBJ A;  2H76 A;  1FAA A;  3KJY A;  1LU4 A;  2V1M A;  3HHV A;  1EGO A;  11GS A;  1X0R A;  3ZTL A;  5IMV A;  3TKS A;  4KB3 A;  2YAN A;  5DAK B;  3KM6 A;  5DCH A;  1MTC A;  4H86 A;  1G6W A;  2L5O A;  4JZQ A;  4IW9 A;  4KDX A;  1EEJ A;  4NV5 A;  4EC0 A;  4AJ6 A;  3HVS A;  2V32 A;  2L4Q A;  4V1A g;  2MYG A;  3FW2 A;  1JFU A;  1FG4 A;  1K0M A;  5LNK e;  4USS A;  1PKZ A;  1F3B A;  1B9X C;  5HR2 A;  1SKS B;  2GQL A;  3IHG A;  1GH2 A;  2DJ0 A;  1XFL A;  1C72 A;  3E9J B;  1Q98 A;  1R5A A;  4IBP A;  4CY8 A;  1PKW A;  3EPT A;  2N5F A;  2LNS A;  1K3Y A;  3WYW A;  3TU3 B;  1PGT A;  3LYK A;  5JWQ B;  5JCW A;  4HQZ A;  2PBJ A;  4IEL A;  2FA4 A;  2YZH A;  2HRN A;  5CRD A;  5IPH A;  3F6F A;  3WT2 A;  3CTG A;  1F6M C;  3P2A A;  1K3L A;  2YWO A;  3A2W A;  1ABA A;  4O7H A;  5ECL B;  5FWG A;  1U3A A;  4HQS A;  3H79 A;  4AF2 A;  2KP2 A;  4OFN A;  2JAC A;  1VF3 A;  4I8B A;  1E6B A;  2F3M A;  5CRE A;  4TN8 A;  1UVZ A;  3VI5 A;  4Q5Q A;  2ES7 A;  4E8E A;  2GT6 A;  3ZIT A;  1TTZ A;  4K2D A;  2G2Q A;  1BG5 A;  4HU7 A;  2BMX A;  5B8A A;  3ZML A;  1SL0 B;  4MMM A;  4MJA A;  4WXT A;  5CAX A;  1JLW A;  2F8A A;  2PVO C;  5ECM B;  1SYR A;  4BVX B;  1J0F A;  3FR6 A;  3D6I A;  3VWW A;  3GKN A;  4Q5R A;  2HSN A;  4XHM A;  3APQ A;  1X5C A;  2DMM A;  4LLR A;  5AGY A;  4QQ7 A;  1M99 A;  2K18 A;  4PUR A;  1X9S B;  2I9H A;  2QGV A;  3QAV A;  2HSN B;  1A23 A;  2GVP A;  2A4H A;  4GQC A;  1NHO A;  4ICY A;  4HEA 2;  4EDZ A;  2HRK A;  2O89 A;  1GRX A;  5B8B A;  5HFG A;  1A2J A;  2YV7 A;  1XBS A;  1TRS A;  4QL7 A;  4GCI A;  2YNX A;  3RPP A;  19GS A;  1GSQ A;  4TR1 B;  6GSY A;  1TI3 A;  1BJX A;  2BJX A;  4L0U A;  1YQ1 A;  1M9B A;  1GL8 A;  2HRK B;  3EMX A;  3TJK A;  4BL7 B;  4CW9 A;  5IMZ A;  1PN9 A;  3QPM A;  1FOH A;  3WGX A;  1QGV A;  2HSH A;  1CQH A;  3QR6 A;  4PQH A;  2VL9 A;  5IOW A;  3D4T A;  1EV4 A;  1YEX A;  5A4U A;  3ERW A;  2H73 A;  2H1B A;  4PGT A;  4ZIL A;  10GS A;  3KMO A;  2H30 A;  2IMF A;  3M9J A;  4X0X A;  1SKW B;  5COH A;  4ECJ A;  2B1L A;  2VLT A;  5L71 A;  4KND A;  5JWR B;  3BCK A;  3ZIV A;  1WJK A;  4AJ8 A;  3HJO A;  1DE2 A;  1KTE A;  4MNN A;  4PXO A;  4KSO A;  3HJM A;  4G10 A;  1TK0 B;  2UV8 G;  4MDC A;  2CV4 A;  2IWT A;  2CVD A;  3D22 A;  3E3E A;  4POK A;  1GLQ A;  2YN1 A;  4IQA A;  1TJD A;  4GF0 A;  4AKH A;  2VCW A;  4OD7 A;  2DKH A;  1OVN A;  4NPB A;  2M46 A;  1TXU A;  2YCD A;  3KGK A;  4O5U A;  2OJL A;  5IO2 A;  3MIX A;  3DKS A;  3ISO A;  4POB A;  5EL8 A;  1B48 A;  5B6M A;  2FWF A;  4HZ2 A;  3OR5 A;  3UVH A;  3IPZ A;  3MDK A;  3GNJ A;  3DYR A;  4XS6 A;  5H5R A;  2VUP A;  4V1A p;  3I6A A;  3IC8 A;  5DQY A;  3GUR A;  4MK3 A;  3TRP A;  2XBI A;  1GSS A;  1F3A A;  2TRX A;  1THX A;  1W89 A;  1R4W A;  2FWG A;  4MZC A;  5EPF A;  2H19 A;  1Q4J A;  3EIN A;  1YZX A;  4W66 A;  1RW1 A;  4K7I A;  4PNF A;  5F05 A;  3KMN A;  5HFK A;  4L0W A;  1GUL A;  3MYD A;  1T3B A;  5G2Z A;  6GSU A;  1VGL A;  4FH8 A;  3ZRE A;  4LL4 B;  4O92 A;  3ZFB A;  2IJY A;  3M3M A;  4QMK A;  2EFE A;  1XWG A;  1BX9 A;  1B9Y C;  2DBC A;  4WBR D;  3CSJ A;  3TCO A;  3PH9 A;  2V6K A;  2TRC P;  1SEN A;  2CZ2 A;  1DSB A;  5C00 A;  3F4R A;  1SVL A;  3EVI A;  3IOS A;  2H74 A;  4DSQ A;  5GST A;  5IMD A;  3UBL A;  4PUF C;  3ERG A;  4F9Z A;  3ZVJ A;  1EGR A;  1GUK A;  2I4A A;  1OC8 A;  4K2X A;  2LV3 A;  1FHE A;  1OE8 A;  1WRY A;  3J7Y b;  3Q18 A;  3IK9 A;  1U6T A;  3ERF A;  3GH6 A;  4KF9 A;  2WS2 A;  3WT1 A;  2CQ9 A;  1ZGN A;  2VKZ G;  3Q6O A;  5KOW A;  4YQU A;  3F9U A;  5D93 A;  1J08 A;  1YDK A;  1ML6 A;  2LJA A;  1WPI A;  5CO3 A;  4EL1 A;  4XS4 B;  2WGR A;  1MD4 A;  4MAB A;  4TRX A;  3D21 A;  5KEJ A;  4GLT A;  2LRT A;  5HQP A;  1GTI A;  5DCG A;  4NHZ A;  3LOR A;  2H0I A;  2MBT A;  4GWR A;  4YQV A;  1FOV A;  4TR4 A;  3FYG A;  4HOJ A;  3KH7 A;  4NXI A;  5F06 A;  2YJ7 A;  3EWL A;  2B7K A;  3DWV A;  1S3C A;  2LKU A;  4MH2 A;  3LW9 A;  5EY6 A;  5FT3 A;  2FA8 A;  2H6Z A;  2H1A A;  5DAL A;  4PTS A;  5ECR B;  2C0E A;  4Z2T A;  3H1N A;  3F3R A;  3LXZ A;  5ECO B;  2WCI A;  3QD9 A;  4ZL9 A;  1TW9 A;  3UMA A;  1K0N A;  1TK5 B;  5B6N A;  4EF0 A;  3RBT A;  2GZY A;  2HQT A;  3CYN A;  3CWG A;  5G5E A;  2DJJ A;  1ERT A;  3TJB A;  1O6J A;  1FVJ A;  2RLI A;  4JR6 A;  1PX7 A;  3EMP A;  5DJL A;  3MSZ A;  3DVW A;  1LBK A;  3VLN A;  5ECH B;  3H4K A;  4V2M A;  1T4Y A;  1EP8 A;  3D5J A;  3DXB A;  2L6D A;  1A2M A;  2CA8 A;  2I1U A;  5J9C A;  4K0N A;  1K0D A;  4EVM A;  2CT6 A;  2HZE A;  2OA7 A;  3KP8 A;  1ZYQ B;  4EO3 A;  3N9J A;  1MDJ A;  2OE0 A;  2R37 A;  2LNT A;  1Z9H A;  3UOM A;  1QUW A;  4BA7 A;  3FK8 A;  5GSS A;  3IAS 2;  1B8X A;  3KEB A;  4KW6 A;  3IHQ A;  1R26 A;  2GZP A;  1T1V A;  4POM A;  4HJM A;  4GXZ A;  1U87 A;  3N5O A;  3IRA A;  4YAP A;  1VF4 A;  3LYP A;  4N0Z A;  3CRT A;  2MBS A;  3RDW A;  3GFK A;  2EC4 A;  5E59 A;  4OCF A;  1S3D A;  2J23 A;  2EFC A;  1SVO A;  3G7Y A;  4JRR A;  1JHB A;  2LS5 A;  1R7H A;  2C8U A;  3VWU A;  1AQV A;  1PQN A;  2A2S A;  1ZL9 A;  5HR0 A;  5EVO A;  4DVC A;  2H1G A;  5BRT A;  5F8B A;  4MH3 A;  4IGJ A;  2C1Y A;  4POL A;  5ELA A;  1PX6 A;  2WDU A;  2H71 A;  2AHE A;  2HSM B;  4K9Z A;  1XVQ A;  5HR3 A;  1U3I A;  2H1D A;  5CRG A;  2B3S A;  1JZR A;  3TKS E;  3FHK A;  1EP7 A;  1WWJ A;  1ZYP A;  2JSY A;  3VI7 A;  1V9W A;  3FRC A;  5DAK A;  2AUV A;  1G7E A;  1XCC A;  1SD8 A;  4XRA A;  3L78 A;  4AI6 A;  1A8L A;  1KEB A;  2UZ8 A;  1TRU A;  3GKK A;  3VPQ A;  2RUE A;  2NBS A;  2DJ2 A;  1BQ7 A;  2O5V A;  2X8C A;  1NW2 A;  5ECQ B;  5LD0 A;  2C3Q A;  4RI6 A;  1O7U A;  1U88 A;  2FWE A;  3UIW A;  3GL5 A;  3KP9 A;  2X64 A;  4MLY A;  1I5G A;  5KOX A;  3C7M A;  2DSA A;  3APS A;  2O85 A;  4WR5 A;  2K8S A;  2R3X A;  4L5O A;  2LRN A;  2PU9 C;  2PWJ A;  2QKE A;  2VL2 C;  3F3Q A;  4YKG A;  4J2F A;  3IR4 A;  1THO A;  4MZB A;  2REM A;  5A34 B;  1SJI A;  2PUK C;  2KP1 A;  4G0I A;  4Z7X A;  4G19 A;  2J9H A;  2XPD A;  4KDU A;  3IK7 A;  2K8V A;  5JCG A;  4MF6 A;  2M72 A;  1GSD A;  4I2U A;  5JCU A;  2LQO A;  1SJZ A;  5B7C A;  3GV1 A;  1XIY A;  2N5A A;  4BVX A;  2K6V A;  2VCX A;  3UJ1 A;  1HD2 A;  9GSS A;  5F07 A;  2WJU A;  2DML A;  2FWH A;  3C71 A;  1OAZ A;  3EYT A;  2QC7 A;  1SKR B;  2DIY A;  5CRH A;  3CMI A;  2VM2 A;  4DSS B;  1HNC A;  2B1K A;  1XOB A;  4BWS A;  4L5L A;  2VLV A;  2MMO A;  1TU7 A;  1NSW A;  1XW9 A;  4FIW A;  3HCZ A;  3F4T A;  2P0G A;  3ZFL A;  5CYY A;  4RUV A;  2IMD A;  1GSE A;  2VM1 A;  1K0C A;  3GSS A;  3ME7 A;  5IM9 A;  2ON5 A;  1GSY A;  4IKH A;  4G01 A;  5KN1 A;  3GX8 A;  3UVT A;  1TU8 A;  5AIX A;  1ZOF A;  4JU5 A;  5J4V A;  1GNW A;  2DJK A;  1SYX A;  1ON4 A;  3TDG A;  1AUC A;  2M80 A;  4XCS A;  4TR1 A;  5KN2 A;  5ECS A;  1G7O A;  3D4M A;  2C0D A;  5HFI A;  3J7Y k;  1BYE A;  1GTU A;  2C3T A;  3HKR A;  4MP4 A;  4BL7 A;  4JE1 A;  2ON7 A;  3KXO A;  3WGD A;  3W6G A;  2C0F A;  2VIM A;  3FZ4 A;  2F51 A;  2KUC A;  4IP6 A;  2A2P A;  4YAV A;  2HZF A;  5CP1 A;  3RHB A;  1VF1 A;  1O73 A;  1SD9 A;  3IBH A;  4D73 B;  4J56 E;  2GZZ A;  2LJR A;  2B6M A;  4O5R A;  3RPN A;  5FHI A;  1TRW A;  5IIZ A;  1BF5 A;  2ZNM A;  4YH2 A;  2JL4 A;  3RHC A;  2JZS A;  4KX4 A;  1PL2 A;  2VL2 A;  3VUR A;  1Z3E A;  2L5L A;  2B5X A;  2OE1 A;  5GAN D;  3GH9 A;  1ZYE A;  1OC9 A;  3EU4 A;  4NWY A;  2YV9 A;  4GRF A;  4RQR A;  4TVE A;  2YJH A;  2EIQ A;  1EV9 A;  4TW5 A;  1UA5 A;  4GTU A;  5A4V A;  2LUS A;  4JBB A;  4V2N A;  1TOF A;  1HYU A;  3GN3 A;  3BD2 A;  4LL1 B;  4MJB A;  1TP9 A;  4GQF A;  5DDL A;  1OC9 B;  2NDO A;  4TOP A;  3L9U A;  4ML1 A;  1X9M B;  2IN3 A;  2GDR A;  3TRX A;  3SWL A;  3HZ8 A;  3QMX A;  2JZR A;  2GTU A;  2PPT A;  3C1R A;  4CHS A;  2IMI A;  5ELG A;  4HUA A;  2E2G A;  3FZ9 A;  2EFH A;  1MD3 A;  1SU9 A;  4LMW A;  4IQ1 A;  1SL1 B;  2RII A;  2L6C A;  2B7J A;  3IC4 A;  2DJ3 A;  1SK1 A;  3A3T A;  2IFQ A;  1S3A A;  1VRS D;  1NM3 A;  4XS1 A;  3KD0 A;  2C80 A;  2R0G A;  1WIK A;  5ABR A;  1T00 A;  5A1N B;  3A5I A;  1V98 A;  2IFQ B;  2V6O A;  4WEY A;  1YKC A;  1FO5 A;  2CVK A;  1H75 A;  2DJ1 A;  3U5R E;  3TKR A;  3VPT A;  1ZMA A;  4WF4 A;  2R5G A;  1UN2 A;  3MAK A;  3HYP A;  2LTK A;  1PSQ A;  2MMA A;  3TOU A;  1A24 A;  2F9S A;  4ZB6 A;  3LQ7 A;  1TKD B;  2IMK A;  4YQM A;  1M0U A;  3K8N A;  1R5P A;  2DLX A;  4ZBA A;  2FUG 2;  1IYI A;  1X5E A;  1Y25 A;  5H5S A;  2OAD A;  3FMW A;  1ILO A;  3VWV A;  1Z6N A;  3TUE A;  4MJE A;  1GUH A;  1XWB A;  3NZN A;  5INY A;  5IPG A;  1ERV A;  1M2A A;  3TJG A;  4NMU A;  5GZZ B;  3L9S A;  2IIY A;  2XBQ A;  4ECB A;  3C8E A;  2YZU A;  4KDY A;  4FYU A;  1WOU A;  3PIN A;  5HR1 A;  2H0H A;  4N30 A;  3HVV A;  2WFC A;  1JLV A;  4XS4 A;  3V1W A;  1SL2 B;  2GGT A;  3O6T A;  1HNA A;  3DML A;  2X4A A;  3GIX A;  2GQK A;  1GTA A;  3VFI A;  1O8W A;  5DQS A;  2K9F A;  3QFA C;  1USB A;  1N8J A;  3ZIJ A;  2E7P A;  4K1F A;  3KTL A;  4HDE A;  2O7K A;  2YWI A;  1I9D A;  4E8H A;  4HZ4 A;  3ZL5 A;  3GYK A;  1GWC A;  2EFD A;  2VO4 A;  4NV2 A;  2H01 A;  5D9X A;  2F8F A;  3BBY A;  4NHW A;  2OE3 A;  4A5P A;  4CDO A;  4K7N A;  3DVX A;  3BOA A;  3VWX A;  5J41 A;  17GS A;  5E4W A;  2OAC A;  2FGX A;  4G2E A;  5AN1 A;  2CX4 A;  3G7J A;  4YKF A;  1JZD A;  2CAQ A;  4V2L A;  2FHE A;  1XWK A;  2JU5 A;  1JZW A;  4ID0 A;  5IO0 A;  3CBU A;  3UEM A;  3TB2 A;  5G30 A;  2HI7 A;  1FW1 A;  4KE3 A;  2TIR A;  2VD0 A;  2L4C A;  1BG1 A;  4WET A;  14GS A;  2LRC A;  3LG6 A;  1QFN A;  3CTF A;  3QFB C;  5J4U A;  3LJR A;  4EDY A;  1PN0 A;  2VLU A;  2V41 A;  1TI1 A;  2BTO T;  1JZO A;  2WRT A;  3HA9 A;  3C73 A;  3S9F A;  1QXH A;  6GST A;  2GST A;  2H70 A;  2O8V B;  1J9B A;  3NOF A;  2AYT A;  3GRX A;  2HNL A;  3LEF A;  3FZ5 A;  1A2L A;  2LEG A;  4F82 A;  3DRN A;  1OE7 A;  4K5S A;  3UBK A;  3DIE A;  2X8G A;  3DEX A;  3P90 A;  3FR9 A;  5A4W A;  1AXD A;  4AJ7 A;  2A4V A;  4ZIJ A;  5A5H B;  2GS3 A;  4FO5 A;  4WF5 A;  2PER A;  4PX1 A;  1YKA A;  2C4J A;  4PNG A;  2YP6 A;  2LJK A;  4TKY A;  4AKG A;  2VD1 A;  2EIO A;  1Z7P A;  4IVF A;  5LCZ A;  2XPE A;  2CAI A;  2IL3 A;  1PRX A;  3GA4 A;  3ED3 A;  2HSM A;  3FEU A;  3G9B A;  3H93 A;  3FZA A;  2H72 A;  1A0F A;  4IHU A;  4BVY A;  4ECI A;  4ISD A;  2HLS A;  2D2Z A;  2YPM A;  1O85 A;  1Y6E A;  3FY7 A;  4EXJ A;  2QA2 A;  1O81 A;  2WB9 A;  3TKP A;  1GSF A;  5D9W A;  3EUR A;  2OBK A;  4BVY B;  1GTB A;  3LSZ A;  2ZCT A;  4MPF A;  3FR3 A;  3I69 A;  2VCZ A;  3GX0 A;  4DSR A;  2VL3 A;  3W8S A;  3KZQ A;  4F2I A;  2PGT A;  3P7X A;  5IMC A;  3GTU B;  4PUA A;  4PQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...