4PQJA

Crystal structure of a phosphate binding protein
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
286
structure length
270
Chain Sequence
GVSGNLSSVGSDTLANLMTMWAEEYKRLYPNVNIQIQAAGSSTAPPALTEGTANLGPMSRKMKDVELQAFEQKYGYKPTAVPVAVDALAIFVHKDNPIKGLTMQQVDAIFSATRLCGSKQDVKTWGDLGLTGDWAKKPVQLFGRNSVSGTYGYFKEEALCKGDFRPNVNEQPGSASVVQSVSQSLNGIGYSGIGYKTASVKTVALAKGTYPLSRFLYVYVNKAPNKPLDPLEAQFLKLVLSKTGQQVVVKDGYIPLPAKVAEKAIKELGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a phosphate binding protein
rcsb
molecule keywords Phosphate binding protein
molecule tags Transport protein
source organism Pseudomonas aeruginosa
total genus 84
structure length 270
sequence length 286
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12849 PBP_like_2 PBP superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4pqjA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4pqjA01
2DS9A 2GHBA 1JNFA 4ELRA 4H67A 3QAXA 1O64A 3FJGA 4LUBA 5TU0A 3FXQA 1QKAA 2XXXA 1NH8A 5H8NB 2BJJX 1N3XA 4XKRA 4NWCA 4IO7A 3H6TA 1DPPA 2IEEA 1BP5A 4YZZA 4LQ2A 2R9JA 3BFUA 2XXTA 1OVTA 2F7BA 2O51A 2Y7WA 3HPIA 1XOCA 4Q0CA 2V84A 1B4HA 1YAEA 4YKJA 1I6QA 3VV5A 3K0VA 4XTCQ 2ZYNA 1JQFA 5BWJA 3L6GA 1LBCA 1NNPA 1OQGA 4NF6A 1JVXA 2F6GA 2UVGA 2XXHA 1M5CA 4E0XA 5EHSA 3OD7A 1FQDA 3O6HA 4U4XA 3S4UA 3MZBA 1A54A 3A3UA 5AA2B 1JEVA 3GXAA 3CG3A 1B6HA 1FTKA 2GH9A 3CSBA 5CMCA 2Z23A 4ZZEA 4ISUA 4TOZA 1IXIA 3PPRA 1A55A 1SDXA 2VOZA 3PMVA 2XXQA 2R71A 1TXFA 1B3FA 3S9MC 3TODA 3O66A 1H45A 2Q88A 4MLQA 4BDLA 2ALUA 1N7WA 4G68C 2DWAA 4WEPA 3QSLA 1B32A 3SERA 3SKPA 3L6HA 4ZEIA 4N13A 4JDFA 3K4UA 5KZTA 4GFRA 1ZIUA 3JV9A 3WAFA 3S2VA 4DXCA 3EQ1A 5AA2A 1LFGA 4JSDA 3B6WA 4FAJA 3TTKA 1B3EA 5J1DA 3MW0A 2D5WA 3SETA 1B2HA 3T9HB 5IAIA 3ZKKA 4JB7A 5L9MA 2GHAA 1MXUA 5AA3A 3PPOA 4YKKA 2RINA 3IOVA 2F97A 2H5YA 1NH7A 3O9PA 3RGYA 4TLMB 4R74A 2AL5A 1S9TA 1PB7A 4BDOA 1SYIA 5HPQA 5CBRA 3QK6A 3Q27A 4H0WA 2D21A 1I6AA 4MLVA 2RF1A 4QFLA 3H6VA 2O7IA 2NWJA 3IO4A 4OTEA 4F2QA 1XHYA 4HS7A 1MM7A 1VE4A 3PUWE 2ZMBA 3IOUA 3SESA 4RXLA 4OQOA 3MWBA 3SEWA 2DWHA 1UQWA 3OSRA 3KZGA 3TTMA 3ILUB 3BFTA 3KN3A 1VR5A 5M2VA 3KBRA 4F3PA 2FNCA 4WEDA 4OERA 3FV2A 4O3AA 4G8MA 1B3LA 3N5LA 4C1UA 4LP2B 3MPLA 4EQ7A 1UTHB 3ZS6A 1O7TA 2Q9TA 2HAVA 3TELA 2X7PA 2RKMA 1SBPA 3M3KA 1MDQA 1Y9UA 2UVIA 4EQ9A 2QSXA 3W15C 5DTBA 1NKXA 3LR1A 3KJ7A 1N84A 4KCCA 4OENA 1B3HA 3C9HA 2V3TA 3E4RA 1PEBA 4U21A 4XXUA 2HXWA 2VHAA 3GZGA 4DZ1A 2ZNUA 1LB8A 5I56B 3LSWA 1FQEA 3OXNA 4HW8A 3C31A 1N76A 3SDFA 2XXRA 3DP8A 4GXAA 4GQOA 4RNSA 2Y84A 4JBZA 1SW4A 3UGWA 2DOJA 4ZEKA 1B4ZA 4NWDA 4P11A 2RC7A 4I9DA 3OMBA 3TQWA 4G77A 1UTHA 2DQVA 3OSQA 5H8FB 4POWA 5I84A 2NXOA 5CI5A 3CFZA 3SEYA 3UN6A 5AA4B 4MFIA 1OVBA 3LUYA 3FJMA 1ZBMA 2Q89A 2Z8FA 4YKIA 1LLSA 2O69A 3U92A 3ECRA 1FQAA 3MP6A 4EXLA 3CFXA 4F3SA 4JWYA 1LAGE 2Y7KA 1A7LA 5I56A 3PUVE 3VLVA 1F9BA 1P1NA 2XX8A 3FVOA 3V83A 1N04A 4RK9A 2WKYA 3IJXB 3T9UA 1MM6A 3B6QA 4U23A 3O29A 5AA1A 2I58A 3F11A 3TMGA 4BDRA 1PBPA 4M4GA 1B52A 4HTGA 4LATA 2PT2A 3CSGA 3OENA 3VLWA 2O7UA 4RPNA 5H8FA 3VVDA 1JW4A 1S7YA 3VFJA 3MVZA 5FHMA 5DVFA 3MPKA 5AA4A 3FXUA 2P1SA 1SI1A 4R72A 1WODA 4OWDA 5DEXB 3H6UA 4GF8A 1B5HA 2THIA 4LQ5A 1FW0A 3KGCA 3PU5A 1B0HA 5K2YA 3TQLA 3IX1A 2F5XA 3K01A 3PD8A 2PX1A 4F1UA 4AB6A 3SEUA 4ZS9A 3N26A 4R9GA 5I57B 1RYOA 2M8CA 3JYRA 3PPNA 2OJTA 3HO7A 1I69A 1ZMGA 3I3VA 2I3VA 4DIGA 4FJPA 3TDJA 1US5A 4H65A 4PFYA 1PDAA 4KPTA 1NMUA 3Q28A 4EUOA 2PT1A 3O97A 4MBPA 4RYAA 3IK6B 5DEXA 4G4PA 1H76A 2XXUA 1Y20A 4ESWA 1DPEA 3KFMA 2O1LA 1BLFA 2I0BA 5I59B 1ZTYA 3MVXA 5CBSA 3LSFB 4OETA 3HCQA 3TTNA 4XKQA 2XXIA 5ISUA 2V25A 4RK2A 1ELJA 1USYH 1MPDA 4K3FA 1CE2A 4NEDA 2CZLA 3K6XA 2NVUB 2Q2CA 2OWTA 3CIJA 4F29A 5I57A 3G3GA 4ELPA 2UYEA 4N07A 1QUKA 4KQPA 5JK4A 3HHFA 1IZ1A 3OO7A 4E0WA 3MC2A 5TP9B 1TT1A 1R9QA 3VVEA 2F6PA 4LA9A 3G3HA 3JZJA 3PV0E 5DVIA 3U94A 1MY1A 1OIBA 4BDQA 1LAXA 2H98A 1A8FA 4BDMA 1XS5A 3OEKA 4QFNA 1JW1A 3PUXE 3PGFA 2Z8DA 3VE1B 4IO3A 5I59A 3RY3A 1DOTA 2B3BA 1B58A 2V3UA 4RA1A 4LZ8A 4RJZA 2I0CA 3VLUA 2Z22A 3O28A 2XXYA 1HSLA 2UVHA 4H5GA 2D3IA 3U72A 1SD3A 1FQCA 3VXCA 3RUMA 1MXYA 1JVYA 1AMFA 3T9VA 5TP9A 4OFOA 3RQTA 3IB0A 2REJA 4I62A 2O6AA 4KYDA 2ZXTA 1H43A 1MQDA 1QUJA 3K1MA 2QS1A 2O84X 3MUQA 1Q1KA 3TKDA 1B5JA 4THIA 5K2XA 3K6WA 4R73A 3Q26A 1PBQA 4KD5A 5L8DA 1MQIA 1B7HA 5AA2D 1BIYA 4NF4A 4MH5A 1MS7A 2W7YA 2CMOA 1QULA 3PMXA 1ZKBA 1N7XA 1CB6A 1MPCA 2H99A 1D3KA 1FTJA 1JEUA 1B7ZA 1OLCA 3I6VA 4YU0A 2KLFA 1D9VA 4GXSB 5TPAB 4YMAA 3RTFB 4PQJA 1TWYA 2E1SA 4DE8A 5CMKA 1IIWA 3TZAA 2IA4A 2XX7A 4F39A 3W9VA 2GRVA 3E13X 4Z0IA 1B1HA 4OFJA 1ANFA 1B40A 4X48A 3FVGA 4EDPA 4GL8A 1I6BA 3WAEA 4Z7EA 3QYTA 5F7VA 1TFDA 3EHTA 3PPQA 4F2OA 1PB9A 4P0GA 2F7CA 3H7MA 4ZECA 5DT6A 3C33A 1N0TA 4OFLA 4GRKA 3T93B 3RN8A 1GGGA 5TPAA 1P1UA 2OCUA 3KOSA 3MP8A 1XC1A 2ZNTA 3R6UA 3A3CA 3H03A 2P2AA 3TTRA 2AIXA 1UIUA 1US4A 5KDTB 1A99A 3EF7A 5FTIA 1B46A 1B9JA 4PFUA 2H25A 3SEXA 3KN7A 2E0SA 2DSFA 1FCKA 3DP6A 1URDA 2G29A 4GLIA 4YB6A 4Q8RA 1B51A 5B7DA 2YJPA 1YPNA 1EZOA 2QS2A 4DCYA 4QSEA 3MAMA 3KSXA 2XD3A 2FA7A 3G7WA 4I8CA 4FECA 4RY1A 2HZKA 2DWJA 3OO6A 1LB9A 4F1VA 2F8DA 4H5FA 2R6GE 4U2RA 4KI0E 3VDFA 1GVCA 3S9EA 5H8QB 3C35A 3PD9A 5KDTA 1ATGA 2F35A 4OZ9A 3K2DA 4ESXA 1JETA 4ZE9A 3PMWA 4NF5B 4LZ7A 3EN3A 3VVFA 5ELVA 4ELOA 3B6TA 3G3FA 3HN0A 4ND9A 3QUFA 3PPPA 3K1NA 1UTBB 1SQYA 1MXZA 2OZZA 1LCTA 2DE2A 4R6HA 4IY6A 4KYSA 1B1XA 2HZLA 2ZNSA 1IEJA 4IO4A 4IO2A 4PE5B 5EYFA 3AXFA 2OWSA 2XXPA 3ILTB 3TUSA 3FATA 3MP1A 3TCGA 2Q2AA 4WXJA 3ZKLA 2Y7IA 1AIVA 3N6TA 3EPEA 3M3FA 3IB1A 1SI0A 3KN8A 4PFWA 1XVXA 4YAHX 5H8QA 1GV8A 5ITOA 1MY3A 4G8NA 3EHUA 3KSJA 2I49A 1XVYA 1MQGA 4FORA 4GL0A 4DXUA 3LSLA 4FIMA 1NNTA 3FXRA 4NF5A 4YICA 3Q25A 1SW2A 4F3BA 2I48A 2ZYMA 4NMYA 5I2KA 1IITA 4EF1A 3ODBA 4G68B 2V93A 3K1PA 5JTYB 1VSOA 4IB2A 1UTBA 3BKIB 1OMPA 4C1TA 4R75A 3IAZA 2XD2A 1POTA 3E3KA 4R2FA 5FHNA 4C0RA 4BLAA 4XKNA 4KHZE 4IGRA 2UYFA 1DTGA 2Z8EA 1MH4A 2X26A 2DWIA 1SVXB 1M5BA 4H1XA 3R7XA 4M1VA 3THIA 1BTJA 3O6IA 1USYE 2QS3A 4LVQA 4F22A 4F1YA 3K6VA 4TLLB 3TEPA 3T22A 1II5A 3P7IA 2ZYOA 4GD5A 3H4ZA 3CVGA 1EZ9A 5CMMA 4G68A 1M5DA 4YB5A 3MQ9A 3M3LA 5JTYA 3FIRA 1AOVA 1L5TA 3N6UA 2OLBA 2HFBA 1Y3NA 2HEUA 3FASA 1LCFA 1P99A 4KCDA 4TQUQ 2REGA 2RCAA 3TCHA 3KEIA 4F3GA 1B3GA 3H06B 1P1WA 4XKPA 1LGBC 2YPNA 3V5AA 1R6ZA 1D4NA 4U1OA 4L17A 1B0LA 2YLNA 1LAHE 1H44A 1Y1MA 1FTLA 4PFTA 2ESNA 4BDNA 3E9XA 4QSDA 1QVSA 1EZPA 2ONKE 3D4CA 2DXYA 3T96B 1J1NA 1Y3QA 1DSNA 3VXBA 3V8XB 4FEDA 3MBPA 2DE3A 1WVJA 2F7AA 3S9NC 1A40A 3TTLA 2H4IA 3W9WA 4NF4B 4N6PA 3GBAA 5KCJB 3G3IA 1RYXA 4QFKA 1LFHA 3RTWB 4JWXA 3K02A 3FVKA 5AE4A 3I5OA 3IL1B 4X9TA 1HSEA 5A5XB 2VD2A 4U1ZA 3K6UA 1NL5A 3N94A 2PVUA 1Y1ZA 2ANJA 2DVCA 4FATA 1ZLQA 2QS4A 1IXGA 1R9LA 3CRBA 4FEBA 2HQ0A 1PB8A 4OXVA 4GVOA 1MXVA 2DXRA 5I2NB 3PUZE 2PYYA 3O6GA 1URSA 3IJOB 2O68A 4G8HA 4R6YA 3SEVA 1QKBA 5LOMA 4KR5A 4R2BA 5H8NA 3G3JA 2A5TB 1POY1 3UK4A 1LBBA 1GR2A 4QHQA 3Q29A 3T9XB 1KWHA 3KG2A 4UA8A 3MVYA 2VP1A 5KCJA 1M5FA 1MY2A 2PMSA 3D4GA 4NE4A 2UXAA 2O1MA 2QRYA 4X1BA 4OESA 5A5XA 2FYIA 1NNKA 2DP8A 3RT6B 5L9SA 2HCAA 1YTVA 3IB2A 3RT8A 4IY5A 3S9LC 3A09A 1IQ7A 4QRZA 3M8UA 1LFIA 4DCXA 3UA8A 1NNFA 3UORA 1B5IA 3GLBA 3FGSA 4DDDA 5I2NA 3RPWA 2F34A 4OYVA 1BKAA 3QUJA 5HBCA 1XT8A 4AQ4A 2LAOA 1RKMA 3B7DA 2A5TA 2QMXA 4YKPA 4OVJA 3MJNA 4U22A 4LZ5A 1MDP1 2I4CA 2UVJA 4PETA 3DELB 2OBGA 4ECFA 5HM4B 1FTMA 2B65A 1H3DA 1HSJA 1EU8A 3FVNA 5BUUA 2ABHA 2V3QA 3H3GA 3CFLA 1MXXA 1UIVA 1QUIA 4ZE8A 1R1NA 5IKBA 2QPQA 3HSTA 2ONSA 3ZSFA 1OQHA 4EF2A 4UACA 1Y4TA 4ZZAA 3V89B 2AL4A 2Y7RA 3IO6A 4JXIA 4OEUA 4GIZA 1FTOA 4EQBA 3FJ7A 1JW5A 3TYHA 3DLNA 1IXCA 3TPAA 3MZ9A 3KJTA 3TCFA 3FD3A 3C34A 2I3WA 4P0IA 3H6WA 1AL3A 4GOTA 3TFLA 3U1OA 5CM6A 5I58B 4X1DA 3CG1A 2XX9A 3LBSA 3UP9A 4O3BA 4H8IA 5L9OA 3BBRA 3MVWA 1ZU0A 3OELA 2ZYKA 4ELQA 3K00A 1Q35A 3EHSA 3PUYE 4ZEDA 1YCJA 2QJEA 5CC2A 3IOWA 2A5SA 1FQBA 1FQFA 1AH5A 1OLAA 4F31B 2XXWA 4ZEFA 5FTHA 1T0KA 4AB5A 1MXWA 1MQJA 4OHNA 4JWOA 5H8HB 4F19A 3HHGA 4POXA 3OO9A 1Z7ME 3U93A 3OEMA 4YB7A 2DVZA 2XXVA 4MF3A 3QXMA 5I2KB 5I58A 1O63A 4R9FA 3C36A 4H6DA 2G93A 3ONMA 2F36A 3IORA 2QL3A 4ONYA 1S50A 5CMBA 4EXKA 1DMBA 1SYHA 4QFPA 2NUVA 4ZEBA 1P1QA 3DM0A 1Y3PA 1MQHA 3MZ1A 3OO8A 1ZJLA 4IGTA 4OMBA 3TAJA 2H9BA 2Q8JA 2P0SA 1A8EA 4FE8A 4O3CA 1MPBA 5DVJA 4ZDMA 5B70A 3DP4A 1GTKA 3G3KA 5H8HA 1QJMA 1WDNA 2DE4A 5FHOA 4WKMA 2GFEA 4OEVA 5EHMA 3OOAA 2QMWA 4QSCA 2B3FA 1VFDA 3FUZA 1EH3A 4NF8B 1B7UA 1P1OA 5ICQA 4DXBA 2I4BA 1TFAA 3IR1A 3RLFE 1D9YA 1N3WA 4I1DA 4PP0A 5ITPA 2HAUA 2RC8A 4HCYA 4QF9A 2Y7PA 2I6EA 3C4MA 4LONB 1LSTA 4RPOA 3RNNA 1MY0A 3GBBA 4R6KA 4F18A 1MRPA 2XHDA 3U8QA 1Y4CA 4Q30B 3LC8A 3R26A 1NFTA 2AYSA 4XIGQ 3USDA 3C32A 3FZVA 1IUDA 3CR9A 4KYEA 3T66A 1QW0A 2RC9A 4DLDA 4HCWA 2VD3A 4H8JA 2X7QA 5JEIA 1MY4A 3LSXA 3FV1A 4NF8A 4YMBA 4NTLA 1MG1A 2F78A 4IO5A 5H8SA 5CRYA 1VFEA 3O2AA 4G2ZA 2RCBA 2PBWA 3KOTA 5F1QA 1MH3A 3QIMA 5ICTA 1PC3A 2ONRA 1Z7NE 1URGA 4IO6A 1SW1A 1SW5A 3IOTA 3HV1A 4KFQA 4NF6B 2OK2A 4U4SA 1DTZA 2DYXA 4GWOA 3CI8A 1IXHA 5DYHA 1LAFE 1B05A 3UIFA 1M5EA 2NOOA 4Q5TA 2VGQA 4JSOA 4QFOA
chains in the Genus database with same CATH superfamily
1FPEA 2DS9A 2GHBA 3T0JA 1JNFA 4ELRA 4H67A 1DK4A 3QAXA 1O64A 3FJGA 4LUBA 5TU0A 3FXQA 4GWZA 1QKAA 2XXXA 1NH8A 5DW8A 5H8NB 2BJJX 2XWOA 1N3XA 4XKRA 4NWCA 4IO7A 3H6TA 1DPPA 2IEEA 1BP5A 4YZZA 4LQ2A 2R9JA 3BFUA 2XXTA 4MNPA 1OVTA 2F7BA 2O51A 4XEQA 2KQZA 2Y7WA 2VPNA 3HPIA 1XOCA 4Q0CA 2V84A 1B4HA 1YAEA 4YKJA 1I6QA 3VV5A 3K0VA 4XTCQ 4I40A 5F24A 2ZYNA 1JQFA 5BWJA 2QVVA 3L6GA 1LBCA 1NNPA 1OQGA 4NF6A 1JVXA 2F6GA 2UVGA 2XXHA 1M5CA 4E0XA 2WX9A 3OD7A 5EHSA 1FQDA 3O6HA 4U4XA 3S4UA 3MZBA 4PE3A 1A54A 4PDDA 3A3UA 1IMDA 5AA2B 1JEVA 3GXAA 1SPIA 3CG3A 1B6HA 1FTKA 2GH9A 3CSBA 4MHFA 5CMCA 2Z23A 4ZZEA 4ISUA 4TOZA 1IXIA 3PPRA 1A55A 1SDXA 2VOZA 3PMVA 2XXQA 2R71A 1TXFA 1B3FA 3S9MC 1FPJA 3ISPA 3TODA 3O66A 3KC1A 1H45A 2Q88A 4MLQA 2DDKA 3KC0A 4X04A 4BDLA 2ALUA 1N7WA 1LBVA 4G68C 4MX6A 2DWAA 4WEPA 3QSLA 1B32A 3SERA 3SKPA 3L6HA 4ZEIA 4N13A 4JDFA 4MEVA 3K4UA 5KZTA 4GFRA 1ZIUA 3JV9A 3WAFA 3S2VA 4DXCA 3EQ1A 5AA2A 4HXVA 1LFGA 2PFYA 4JSDA 3B6WA 5ESYA 4DI4B 4FAJA 3TTKA 1B3EA 5J1DA 3MW0A 4P1LA 2PCRA 1IMCA 2D5WA 3SETA 1B2HA 3T9HB 5IAIA 4PAIA 3ZKKA 4JB7A 5L9MA 2GHAA 1MXUA 2ZZWA 5AA3A 3PPOA 4YKKA 2RINA 3IOVA 2F97A 2CEYA 2H5YA 1NH7A 3O9PA 1LBXA 3RGYA 4TLMB 4R74A 2AL5A 1S9TA 5EQAA 1PB7A 4BDOA 1SYIA 5HPQA 5CBRA 3QK6A 3Q27A 4LN5A 4H0WA 2P3NA 2D21A 1I6AA 4MLVA 2RF1A 4QFLA 3H6VA 2O7IA 2NWJA 3IO4A 4OTEA 1DBZA 4F2QA 1XHYA 4HS7A 5ET5A 1MM7A 1VE4A 3PUWE 4IR8A 3FXBA 2ZMBA 1FRPA 3IOUA 3SESA 4RXLA 4OQOA 1FTAA 4O7MA 3MWBA 3SEWA 1IMFA 1KA1A 2DWHA 1UQWA 3OSRA 3KZGA 3TTMA 1FSAA 3ILUB 3BFTA 3KN3A 1VR5A 5M2VA 3KBRA 4F3PA 2FNCA 4WEDA 4OERA 2R8TA 3FV2A 5I3SA 4O3AA 4G8MA 1B3LA 3N5LA 4C1UA 4LP2B 3MPLA 4EQ7A 4GBWA 1UTHB 4MCOA 3ZS6A 1O7TA 2Q9TA 3T1BA 2HAVA 4XF5A 3TELA 2X7PA 2RKMA 1SBPA 3M3KA 1MDQA 1Y9UA 2UVIA 1IMEA 4FBPA 4EQ9A 2QSXA 3W15C 5DTBA 1NKXA 3LR1A 3IFAA 3KJ7A 4GWXA 1N84A 4PAFA 1FPGA 4KCCA 3LUZA 4OENA 1B3HA 3C9HA 2V3TA 3E4RA 1PEBA 4U21A 4XXUA 2HXWA 2VHAA 3GZGA 4DZ1A 2ZNUA 1LB8A 5I56B 3LSWA 1FQEA 3OXNA 4HW8A 3C31A 2GQ1A 1N76A 5LDZA 1RDXA 2Y5LA 3SDFA 2XXRA 3DP8A 4GXAA 4NG7A 4GQOA 4RNSA 2Y84A 4JBZA 1SW4A 3UGWA 2DOJA 1EYJA 4ZEKA 1B4ZA 1FBGA 4PCDA 4NWDA 4P11A 4GX6A 2RC7A 4I9DA 3OMBA 4JVCA 3TQWA 4G77A 1UTHA 2DQVA 3OSQA 5H8FB 4POWA 5I84A 2NXOA 5CI5A 3CFZA 3SEYA 1FPLA 3UN6A 5AA4B 4MFIA 1OVBA 3LUYA 3FJMA 4O94A 1ZBMA 2Q89A 2Z8FA 4YKIA 1LLSA 1NV1A 2O69A 3U92A 3ECRA 1FQAA 1K9YA 3MP6A 3CHGA 4EXLA 3CFXA 4F3SA 4JWYA 1LAGE 2Y7KA 4GWYA 1A7LA 5I56A 3B8BA 3PUVE 3VLVA 1F9BA 1P1NA 2XX8A 3FVOA 2KR0A 3V83A 4OVQA 1N04A 4RK9A 2WKYA 3IJXB 3T9UA 5IM2A 1MM6A 3B6QA 4U23A 3O29A 5AA1A 2I58A 3F11A 3TMGA 4BDRA 1PBPA 4M4GA 1B52A 4HTGA 4LATA 2PT2A 3CSGA 3OENA 3VLWA 2O7UA 4RPNA 5H8FA 3VVDA 4OVTA 1JW4A 5IZ1A 1S7YA 3VFJA 3MVZA 5FHMA 5DVFA 3MPKA 5AA4A 3FXUA 2P1SA 4MMPA 1SI1A 4R72A 4PDHA 1WODA 4OWDA 5DEXB 3H6UA 4GF8A 1B5HA 2THIA 4MJOA 4LQ5A 1FW0A 3KGCA 3PU5A 1B0HA 5K2YA 1G0IA 3TQLA 5EQ8A 3IX1A 2F5XA 3K01A 1FPKA 4OA4A 3PD8A 2PX1A 4NHBA 4F1UA 4AB6A 3SEUA 1NUZA 4ZS9A 3N26A 4R9GA 5I57B 1RYOA 2M8CA 5J16A 3JYRA 5ET6A 3PPNA 4NX1A 4GBVA 2OJTA 3HO7A 1I69A 1ZMGA 3I3VA 2I3VA 4DIGA 2B4MA 4FJPA 3TDJA 1US5A 4H65A 4PFYA 1PDAA 4KPTA 1NMUA 5ET7A 1FPIA 3Q28A 4EUOA 2PT1A 3O97A 4MBPA 4RYAA 3IK6B 5DEXA 4G4PA 1H76A 2XXUA 4OVRA 1Y20A 4ESWA 1DPEA 3KFMA 4I3EA 2O1LA 1BLFA 2I0BA 5I59B 1ZTYA 2Q8MA 3MVXA 5CBSA 3LSFB 5IGAA 2HXRA 4OETA 3HCQA 3TTNA 4XKQA 2XXIA 5ISUA 3ROJA 2V25A 4RK2A 1ELJA 1USYH 1MPDA 4K3FA 1CE2A 1VDWA 4NEDA 2CZLA 3K6XA 2NVUB 2Q2CA 2OWTA 3CIJA 4F29A 5I57A 3G3GA 4ELPA 2UYEA 4N07A 1QUKA 4KQPA 5JK4A 3HHFA 1IZ1A 3OO7A 4E0WA 3MC2A 5TP9B 5EYHA 1TT1A 1R9QA 3VVEA 2F6PA 2ZZXA 4LA9A 3G3HA 3JZJA 3PV0E 5DVIA 3U94A 3E79A 1MY1A 4P47A 1OIBA 4BDQA 1LAXA 2H98A 1A8FA 4BDMA 1XS5A 3OEKA 4QFNA 1JW1A 3PUXE 3PGFA 2Z8DA 3VE1B 4IO3A 5I59A 3RY3A 4GWWA 3KBZA 1DOTA 2B3BA 4N91A 1B58A 2V3UA 4RA1A 4PFIA 4MNIA 4LZ8A 4RJZA 2I0CA 3VLUA 2Z22A 2XWVA 3O28A 2XXYA 1HSLA 2UVHA 4H5GA 2D3IA 2HPGA 3U72A 1K9ZA 1SD3A 1FQCA 3VXCA 3RUMA 1EYKA 1MXYA 1JVYA 5ET8A 2WBBA 1AMFA 3T9VA 5TP9A 4OFOA 3RQTA 3IB0A 2REJA 1NUXA 4HE0A 4I62A 4KYDA 2O6AA 2ZXTA 1H43A 1MQDA 1QUJA 3K1MA 2QS1A 2O84X 3MUQA 4QBAA 1Q1KA 3TKDA 1B5JA 4THIA 5K2XA 3K6WA 4R73A 3Q26A 1PBQA 4P3LA 4KD5A 5L8DA 1MQIA 1B7HA 5AA2D 2MKZA 1BIYA 4NF4A 4MH5A 1MS7A 2W7YA 1FBCA 2CMOA 1QULA 3PMXA 1ZKBA 1N7XA 1EYIA 1CB6A 1MPCA 2H99A 1D3KA 1FTJA 1JEUA 1B7ZA 1OLCA 3I6VA 4YU0A 2KLFA 1D9VA 4GXSB 5TPAB 4YMAA 4GX3A 3RTFB 4PQJA 1TWYA 2V4CA 2E1SA 5IZ3B 4DE8A 5CMKA 1IIWA 2QFLA 3TZAA 2IA4A 2XX7A 1FBEA 2VPOA 4F39A 4AS4A 3W9VA 1FPBA 2GRVA 3E13X 4Z0IA 1B1HA 4OFJA 4HE2A 1ANFA 1B40A 4X48A 3FVGA 4EDPA 4GL8A 5EQ9A 1I6BA 3WAEA 2HHMA 4Z7EA 1G0HA 3QYTA 1NUWA 5F7VA 1NV5A 1TFDA 3EHTA 3PPQA 4F2OA 4N6KA 1PB9A 4P0GA 4P56A 2F7CA 2WYKA 3H7MA 4ZECA 5DT6A 1FBHA 3C33A 1N0TA 4OFLA 4P1EA 4GRKA 3T93B 3RN8A 1GGGA 5TPAA 1P1UA 2OCUA 3KOSA 3MP8A 1XC1A 2XA5A 5IZ3A 2ZNTA 3R6UA 3SZPA 3A3CA 3H03A 2P2AA 5LTCA 3TTRA 2AIXA 1UIUA 1US4A 1BK4A 5KDTB 1A99A 3EF7A 4DI3D 1KZ8A 5FTIA 2XWKA 1B46A 4NGUA 1B9JA 4PFUA 2H25A 3SEXA 3KN7A 2E0SA 2DSFA 1FPDA 3U65A 1FCKA 3DP6A 1NV3A 1URDA 2G29A 4GLIA 4YB6A 4Q8RA 1B51A 5B7DA 2YJPA 1YPNA 1EZOA 2QS2A 1AWBA 4DCYA 4QSEA 3MAMA 3KSXA 2XD3A 2FA7A 2QVRA 3G7WA 4I8CA 4FECA 4RY1A 1RDZA 1LBWA 3D1RA 2HZKA 2DWJA 3OO6A 1LB9A 4F1VA 2F8DA 4H5FA 2R6GE 4U2RA 4KI0E 4QXDA 3VDFA 1GVCA 3S9EA 5H8QB 3C35A 3PD9A 5KDTA 1ATGA 2F35A 4OZ9A 3K2DA 4ESXA 1JETA 4ZE9A 3PMWA 4NF5B 4LZ7A 3EN3A 3VVFA 5ELVA 4ELOA 4NAPA 3B6TA 3G3FA 3BIGA 3HN0A 4ND9A 3QUFA 3MSTA 3PPPA 3K1NA 1KA0A 1UTBB 1SQYA 1MXZA 2CZIA 2OZZA 1LCTA 2DE2A 4R6HA 4IY6A 4KYSA 1B1XA 2HZLA 2ZNSA 3QMFA 1IEJA 4IO4A 4IO2A 4PE5B 5EYFA 3AXFA 2OWSA 2XXPA 3ILTB 4MAGA 3TUSA 3FATA 3MP1A 3TCGA 2Q2AA 4WXJA 3ZKLA 3B50A 2Y7IA 1AIVA 3N6TA 3EPEA 3M3FA 3IB1A 4KXPA 1SI0A 3KN8A 4PFWA 1XVXA 4YAHX 5H8QA 1GV8A 5ITOA 1MY3A 4PAKA 4G8NA 3EHUA 4PTKA 3KSJA 2I49A 1XVYA 1MQGA 4FORA 4GL0A 4DXUA 3LSLA 4FIMA 1NNTA 3FXRA 4NF5A 4YICA 3Q25A 1SW2A 2VT5A 4F3BA 2I48A 2ZYMA 4NMYA 5I2KA 1IITA 4EF1A 3ODBA 4G68B 2V93A 3K1PA 2XWIA 5JTYB 1VSOA 4IB2A 1UTBA 3BKIB 1XI6A 1OMPA 1QGXA 3RYDA 5EQ7A 4C1TA 4R75A 3IAZA 2FHYA 1IMAA 2XD2A 1POTA 3E3KA 1YZ0A 4R2FA 5FHNA 4C0RA 4BLAA 4XKNA 4KHZE 4IGRA 2UYFA 1DTGA 2Z8EA 1MH4A 2X26A 2DWIA 4PF8A 1SVXB 5IZZA 1M5BA 4H45A 4H1XA 3R7XA 4M1VA 3THIA 1BTJA 3O6IA 1USYE 2QS3A 4LVQA 4F22A 4F1YA 3K6VA 4TLLB 3TEPA 3T22A 1II5A 2BJIA 2ZYOA 3P7IA 4GD5A 3H4ZA 3CVGA 1EZ9A 5CMMA 4G68A 4NN3A 1M5DA 4YB5A 3MQ9A 3M3LA 5JTYA 3FIRA 1AOVA 1L5TA 3N6UA 2OLBA 2HFBA 1Y3NA 2HEUA 3FASA 4P8BA 1LCFA 1P99A 4KCDA 4TQUQ 2REGA 2RCAA 3TCHA 3KEIA 4F3GA 1B3GA 3H06B 1INPA 1P1WA 4XKPA 2JJKA 1LGBC 2YPNA 3V5AA 1R6ZA 1D4NA 4U1OA 4L17A 2P3VA 1B0LA 2YLNA 1LAHE 1H44A 1Y1MA 2WBDA 1FTLA 4MNCA 4PFTA 4O7IA 2ESNA 4BDNA 3E9XA 4PGPA 4QSDA 1QVSA 1EZPA 2ONKE 3D4CA 1LBYA 2DXYA 3T96B 1J1NA 1Y3QA 1DSNA 3VXBA 3V8XB 4FEDA 2F3DA 3MBPA 2DE3A 1WVJA 2F7AA 3E78A 3S9NC 1A40A 3TTLA 2H4IA 3W9WA 1CNQA 4NF4B 4N6PA 3GBAA 5KCJB 3G3IA 1RYXA 4QFKA 1LFHA 3RTWB 4JWXA 3K02A 3FVKA 1JP4A 5AE4A 1D9QA 3I5OA 3IL1B 4X9TA 1HSEA 5A5XB 2VD2A 3IFCA 4U1ZA 3K6UA 1NL5A 3N94A 2PVUA 4GWUA 4N4UA 2FVZA 4N6DA 1Y1ZA 5T3JA 5FBPA 2ANJA 2DVCA 4FATA 1ZLQA 3GYYA 2QS4A 1IXGA 1R9LA 3CRBA 4FEBA 2QVUA 4P9KA 4N8YA 2HQ0A 1PB8A 4OXVA 4GVOA 1MXVA 2DXRA 5I2NB 3PUZE 2PYYA 3O6GA 2OWZA 1URSA 3IJOB 2O68A 4G8HA 4R6YA 3SEVA 1QKBA 5LOMA 4KR5A 4R2BA 5H8NA 4N8GA 3G3JA 2A5TB 1FBFA 1POY1 3UK4A 2PFZA 4PGNA 1FJ6A 1LBBA 1GR2A 4QHQA 3Q29A 3T9XB 1KWHA 3KG2A 4UA8A 3MVYA 2VP1A 5KCJA 1M5FA 1MY2A 4G61A 2PMSA 3D4GA 4NE4A 1Q9DA 2UXAA 2O1MA 2QRYA 4X1BA 2L5VA 4OESA 5A5XA 2FYIA 1NNKA 2DP8A 3RT6B 5L9SA 2HCAA 1YTVA 3IB2A 3RT8A 4IY5A 3S9LC 3A09A 1IQ7A 4NQ8A 4QRZA 3M8UA 1LFIA 4DCXA 3UA8A 4GWSA 1NNFA 2Q74A 1B5IA 3GLBA 3FGSA 3UORA 4DDDA 5I2NA 3RPWA 2F34A 4OYVA 1BKAA 4O8MA 3QUJA 2OX3A 5HBCA 1XT8A 4AQ4A 2LAOA 1RKMA 3B7DA 2A5TA 2QMXA 4YKPA 4OVJA 3MJNA 4U22A 4LZ5A 3LV0A 1MDP1 2I4CA 2UVJA 4PETA 3DELB 2OBGA 4ECFA 5HM4B 1FTMA 2B65A 1H3DA 1HSJA 1EU8A 3FVNA 5BUUA 2ABHA 2V3QA 3H3GA 3CFLA 2CZKA 4PF6A 1MXXA 1UIVA 1QUIA 4ZE8A 1R1NA 5IKBA 1NV2A 2QPQA 3HSTA 3BIHA 2ONSA 3ZSFA 1OQHA 3MYUA 2F3BA 4EF2A 4UACA 1Y4TA 1FBDA 4ZZAA 3V89B 2AL4A 2Y7RA 3IO6A 4JXIA 4OEUA 4GIZA 1FTOA 4N17A 3FJ7A 4EQBA 1JW5A 3TYHA 3DLNA 1IXCA 3TPAA 3MZ9A 3KJTA 3TCFA 3FD3A 1FJ9A 3C34A 2I3WA 4HE1A 4P0IA 3H6WA 1AL3A 4GOTA 3TFLA 2WYPA 1FPFA 3U1OA 4H46A 1YYZA 5CM6A 5I58B 4X1DA 3CG1A 2XX9A 3LBSA 3FBPA 3UP9A 4O3BA 4H8IA 4JVDA 5L9OA 3BBRA 3MVWA 1NUYA 1ZU0A 3OELA 2ZYKA 4ELQA 3K00A 1Q35A 3EHSA 4PBHA 3PUYE 4ZEDA 1YCJA 2QJEA 5CC2A 3IOWA 2A5SA 1FQBA 1FQFA 1AH5A 1OLAA 4F31B 2XXWA 4ZEFA 5FTHA 1T0KA 4N15A 4AB5A 4AS5A 1MXWA 1MQJA 4OHNA 4JWOA 4JVIA 4OVPA 5H8HB 1LEVA 3HHGA 4POXA 4F19A 3OO9A 1Z7ME 3U93A 3PTYA 3OEMA 4YB7A 2DVZA 2XXVA 4MF3A 3QXMA 2FIEA 5I2KB 5I58A 1O63A 2XXKA 4R9FA 3C36A 4H6DA 2G93A 3NOHA 3ONMA 2F36A 3IORA 2QL3A 4PBQA 4ONYA 1S50A 5CMBA 4EXKA 5A5LA 4PFRA 1DMBA 1SYHA 4QFPA 2NUVA 4ZEBA 1P1QA 3DM0A 1Y3PA 1MQHA 3MZ1A 3OO8A 1ZJLA 4IGTA 4OMBA 2ZZVA 3TAJA 2CEXA 2H9BA 5EYGA 2P0SA 2Q8JA 1A8EA 4FE8A 4O3CA 1MPBA 5DVJA 4ZDMA 5B70A 1NV6A 3DP4A 1GTKA 3G3KA 5H8HA 1QJMA 1WDNA 4NF0A 2DE4A 5FHOA 3RPLB 4WKMA 2GFEA 3EKIA 4OEVA 5EHMA 3OOAA 2QMWA 4QSCA 2B3FA 1DCUA 2CZHA 1VFDA 2FBPA 3FUZA 1EH3A 4NF8B 4OVSA 1B7UA 4MIJA 3A29A 2WEFA 1P1OA 1IMBA 5ICQA 4DXBA 2I4BA 4I3YA 1TFAA 3IR1A 3RLFE 1D9YA 5I5PA 1N3WA 4I1DA 4PP0A 4X8RA 5ITPA 2HAUA 2RC8A 4HCYA 4QF9A 2Y7PA 2I6EA 3C4MA 4LONB 1LSTA 4RPOA 3RNNA 1MY0A 4PC9A 3GBBA 4R6KA 4F18A 1MRPA 2XHDA 3U8QA 1Y4CA 4Q30B 3LC8A 3R26A 1NFTA 2AYSA 4UABA 4XIGQ 3USDA 3C32A 3FZVA 1IUDA 3CR9A 4KYEA 3T66A 1QW0A 2RC9A 3RPLA 4DLDA 4HCWA 2VD3A 4H8JA 1RDYA 2X7QA 5JEIA 1MY4A 3HFUA 1NV7A 3LSXA 3FV1A 4NF8A 4YMBA 4NTLA 4PFBA 1NV0A 1MG1A 2F78A 2B4LA 2FIXA 4IO5A 5H8SA 5CRYA 1VFEA 3O2AA 4G2ZA 2RCBA 4XFEA 2PBWA 3KOTA 5F1QA 2Y5KA 1MH3A 3QIMA 1LBZA 5ICTA 1PC3A 2ONRA 1Z7NE 5I7IA 1URGA 4IO6A 4GX4A 1SW1A 1SW5A 3IOTA 4N81A 3HV1A 4KFQA 4NF6B 2OK2A 4U4SA 1DTZA 2DYXA 4GWOA 1FBPA 3CI8A 1IXHA 5DYHA 1LAFE 1NI9A 1B05A 4OANA 3UIFA 1M5EA 2NOOA 1YXIA 4Q5TA 1NV4A 2VGQA 4JSOA 4QFOA
chains in the Genus database with same CATH topology
2DS9A 2GHBA 1JNFA 4ELRA 4H67A 3QAXA 1O64A 3FJGA 4LUBA 5TU0A 3FXQA 1QKAA 2XXXA 1NH8A 5H8NB 2BJJX 1N3XA 4XKRA 4NWCA 4IO7A 3H6TA 1DPPA 2IEEA 1BP5A 4YZZA 4LQ2A 2R9JA 3BFUA 2XXTA 1OVTA 2F7BA 2O51A 2Y7WA 3HPIA 1XOCA 4Q0CA 2V84A 1B4HA 1YAEA 4YKJA 1I6QA 3VV5A 3K0VA 4XTCQ 2ZYNA 1JQFA 5BWJA 3L6GA 1LBCA 1NNPA 1OQGA 4NF6A 1JVXA 2F6GA 2UVGA 2XXHA 1M5CA 4E0XA 5EHSA 3OD7A 1FQDA 3O6HA 4U4XA 3S4UA 3MZBA 1A54A 3A3UA 5AA2B 1JEVA 3GXAA 3CG3A 1B6HA 1FTKA 2GH9A 3CSBA 5CMCA 2Z23A 4ZZEA 4ISUA 4TOZA 1IXIA 3PPRA 1A55A 1SDXA 2VOZA 3PMVA 2XXQA 2R71A 1TXFA 1B3FA 3S9MC 3TODA 3O66A 1H45A 2Q88A 4MLQA 4BDLA 2ALUA 1N7WA 4G68C 2DWAA 4WEPA 3QSLA 1B32A 3SERA 3SKPA 3L6HA 4ZEIA 4N13A 4JDFA 3K4UA 5KZTA 4GFRA 1ZIUA 3JV9A 3WAFA 3S2VA 4DXCA 3EQ1A 5AA2A 1LFGA 4JSDA 3B6WA 4FAJA 3TTKA 1B3EA 5J1DA 3MW0A 2D5WA 3SETA 1B2HA 3T9HB 5IAIA 3ZKKA 4JB7A 5L9MA 2GHAA 1MXUA 5AA3A 3PPOA 4YKKA 2RINA 3IOVA 2F97A 2H5YA 1NH7A 3O9PA 3RGYA 4TLMB 4R74A 2AL5A 1S9TA 1PB7A 4BDOA 1SYIA 5HPQA 5CBRA 3QK6A 3Q27A 4H0WA 2D21A 1I6AA 4MLVA 2RF1A 4QFLA 3H6VA 2O7IA 2NWJA 3IO4A 4OTEA 4F2QA 1XHYA 4HS7A 1MM7A 1VE4A 3PUWE 2ZMBA 3IOUA 3SESA 4RXLA 4OQOA 3MWBA 3SEWA 2DWHA 1UQWA 3OSRA 3KZGA 3TTMA 3ILUB 3BFTA 3KN3A 1VR5A 5M2VA 3KBRA 4F3PA 2FNCA 4WEDA 4OERA 3FV2A 4O3AA 4G8MA 1B3LA 3N5LA 4C1UA 4LP2B 3MPLA 4EQ7A 1UTHB 3ZS6A 1O7TA 2Q9TA 2HAVA 3TELA 2X7PA 2RKMA 1SBPA 3M3KA 1MDQA 1Y9UA 2UVIA 4EQ9A 2QSXA 3W15C 5DTBA 1NKXA 3LR1A 3KJ7A 1N84A 4KCCA 4OENA 1B3HA 3C9HA 2V3TA 3E4RA 1PEBA 4U21A 4XXUA 2HXWA 2VHAA 3GZGA 4DZ1A 2ZNUA 1LB8A 5I56B 3LSWA 1FQEA 3OXNA 4HW8A 3C31A 1N76A 3SDFA 2XXRA 3DP8A 4GXAA 4GQOA 4RNSA 2Y84A 4JBZA 1SW4A 3UGWA 2DOJA 4ZEKA 1B4ZA 4NWDA 4P11A 2RC7A 4I9DA 3OMBA 3TQWA 4G77A 1UTHA 2DQVA 3OSQA 5H8FB 4POWA 5I84A 2NXOA 5CI5A 3CFZA 3SEYA 3UN6A 5AA4B 4MFIA 1OVBA 3LUYA 3FJMA 1ZBMA 2Q89A 2Z8FA 4YKIA 1LLSA 2O69A 3U92A 3ECRA 1FQAA 3MP6A 4EXLA 3CFXA 4F3SA 4JWYA 1LAGE 2Y7KA 1A7LA 5I56A 3PUVE 3VLVA 1F9BA 1P1NA 2XX8A 3FVOA 3V83A 1N04A 4RK9A 2WKYA 3IJXB 3T9UA 1MM6A 3B6QA 4U23A 3O29A 5AA1A 2I58A 3F11A 3TMGA 4BDRA 1PBPA 4M4GA 1B52A 4HTGA 4LATA 2PT2A 3CSGA 3OENA 3VLWA 2O7UA 4RPNA 5H8FA 3VVDA 1JW4A 1S7YA 3VFJA 3MVZA 5FHMA 5DVFA 3MPKA 5AA4A 3FXUA 2P1SA 1SI1A 4R72A 1WODA 4OWDA 5DEXB 3H6UA 4GF8A 1B5HA 2THIA 4LQ5A 1FW0A 3KGCA 3PU5A 1B0HA 5K2YA 3TQLA 3IX1A 2F5XA 3K01A 3PD8A 2PX1A 4F1UA 4AB6A 3SEUA 4ZS9A 3N26A 4R9GA 5I57B 1RYOA 2M8CA 3JYRA 3PPNA 2OJTA 3HO7A 1I69A 1ZMGA 3I3VA 2I3VA 4DIGA 4FJPA 3TDJA 1US5A 4H65A 4PFYA 1PDAA 4KPTA 1NMUA 3Q28A 4EUOA 2PT1A 3O97A 4MBPA 4RYAA 3IK6B 5DEXA 4G4PA 1H76A 2XXUA 1Y20A 4ESWA 1DPEA 3KFMA 2O1LA 1BLFA 2I0BA 5I59B 1ZTYA 3MVXA 5CBSA 3LSFB 4OETA 3HCQA 3TTNA 4XKQA 2XXIA 5ISUA 2V25A 4RK2A 1ELJA 1USYH 1MPDA 4K3FA 1CE2A 4NEDA 2CZLA 3K6XA 2NVUB 2Q2CA 2OWTA 3CIJA 4F29A 5I57A 3G3GA 4ELPA 2UYEA 4N07A 1QUKA 4KQPA 5JK4A 3HHFA 1IZ1A 3OO7A 4E0WA 3MC2A 5TP9B 1TT1A 1R9QA 3VVEA 2F6PA 4LA9A 3G3HA 3JZJA 3PV0E 5DVIA 3U94A 1MY1A 1OIBA 4BDQA 1LAXA 2H98A 1A8FA 4BDMA 1XS5A 3OEKA 4QFNA 1JW1A 3PUXE 3PGFA 2Z8DA 3VE1B 4IO3A 5I59A 3RY3A 1DOTA 2B3BA 1B58A 2V3UA 4RA1A 4LZ8A 4RJZA 2I0CA 3VLUA 2Z22A 3O28A 2XXYA 1HSLA 2UVHA 4H5GA 2D3IA 3U72A 1SD3A 1FQCA 3VXCA 3RUMA 1MXYA 1JVYA 1AMFA 3T9VA 5TP9A 4OFOA 3RQTA 3IB0A 2REJA 4I62A 2O6AA 4KYDA 2ZXTA 1H43A 1MQDA 1QUJA 3K1MA 2QS1A 2O84X 3MUQA 1Q1KA 3TKDA 1B5JA 4THIA 5K2XA 3K6WA 4R73A 3Q26A 1PBQA 4KD5A 5L8DA 1MQIA 1B7HA 5AA2D 1BIYA 4NF4A 4MH5A 1MS7A 2W7YA 2CMOA 1QULA 3PMXA 1ZKBA 1N7XA 1CB6A 1MPCA 2H99A 1D3KA 1FTJA 1JEUA 1B7ZA 1OLCA 3I6VA 4YU0A 2KLFA 1D9VA 4GXSB 5TPAB 4YMAA 3RTFB 4PQJA 1TWYA 2E1SA 4DE8A 5CMKA 1IIWA 3TZAA 2IA4A 2XX7A 4F39A 3W9VA 2GRVA 3E13X 4Z0IA 1B1HA 4OFJA 1ANFA 1B40A 4X48A 3FVGA 4EDPA 4GL8A 1I6BA 3WAEA 4Z7EA 3QYTA 5F7VA 1TFDA 3EHTA 3PPQA 4F2OA 1PB9A 4P0GA 2F7CA 3H7MA 4ZECA 5DT6A 3C33A 1N0TA 4OFLA 4GRKA 3T93B 3RN8A 1GGGA 5TPAA 1P1UA 2OCUA 3KOSA 3MP8A 1XC1A 2ZNTA 3R6UA 3A3CA 3H03A 2P2AA 3TTRA 2AIXA 1UIUA 1US4A 5KDTB 1A99A 3EF7A 5FTIA 1B46A 1B9JA 4PFUA 2H25A 3SEXA 3KN7A 2E0SA 2DSFA 1FCKA 3DP6A 1URDA 2G29A 4GLIA 4YB6A 4Q8RA 1B51A 5B7DA 2YJPA 1YPNA 1EZOA 2QS2A 4DCYA 4QSEA 3MAMA 3KSXA 2XD3A 2FA7A 3G7WA 4I8CA 4FECA 4RY1A 2HZKA 2DWJA 3OO6A 1LB9A 4F1VA 2F8DA 4H5FA 2R6GE 4U2RA 4KI0E 3VDFA 1GVCA 3S9EA 5H8QB 3C35A 3PD9A 5KDTA 1ATGA 2F35A 4OZ9A 3K2DA 4ESXA 1JETA 4ZE9A 3PMWA 4NF5B 4LZ7A 3EN3A 3VVFA 5ELVA 4ELOA 3B6TA 3G3FA 3HN0A 4ND9A 3QUFA 3PPPA 3K1NA 1UTBB 1SQYA 1MXZA 2OZZA 1LCTA 2DE2A 4R6HA 4IY6A 4KYSA 1B1XA 2HZLA 2ZNSA 1IEJA 4IO4A 4IO2A 4PE5B 5EYFA 3AXFA 2OWSA 2XXPA 3ILTB 3TUSA 3FATA 3MP1A 3TCGA 2Q2AA 4WXJA 3ZKLA 2Y7IA 1AIVA 3N6TA 3EPEA 3M3FA 3IB1A 1SI0A 3KN8A 4PFWA 1XVXA 4YAHX 5H8QA 1GV8A 5ITOA 1MY3A 4G8NA 3EHUA 3KSJA 2I49A 1XVYA 1MQGA 4FORA 4GL0A 4DXUA 3LSLA 4FIMA 1NNTA 3FXRA 4NF5A 4YICA 3Q25A 1SW2A 4F3BA 2I48A 2ZYMA 4NMYA 5I2KA 1IITA 4EF1A 3ODBA 4G68B 2V93A 3K1PA 5JTYB 1VSOA 4IB2A 1UTBA 3BKIB 1OMPA 4C1TA 4R75A 3IAZA 2XD2A 1POTA 3E3KA 4R2FA 5FHNA 4C0RA 4BLAA 4XKNA 4KHZE 4IGRA 2UYFA 1DTGA 2Z8EA 1MH4A 2X26A 2DWIA 1SVXB 1M5BA 4H1XA 3R7XA 4M1VA 3THIA 1BTJA 3O6IA 1USYE 2QS3A 4LVQA 4F22A 4F1YA 3K6VA 4TLLB 3TEPA 3T22A 1II5A 3P7IA 2ZYOA 4GD5A 3H4ZA 3CVGA 1EZ9A 5CMMA 4G68A 1M5DA 4YB5A 3MQ9A 3M3LA 5JTYA 3FIRA 1AOVA 1L5TA 3N6UA 2OLBA 2HFBA 1Y3NA 2HEUA 3FASA 1LCFA 1P99A 4KCDA 4TQUQ 2REGA 2RCAA 3TCHA 3KEIA 4F3GA 1B3GA 3H06B 1P1WA 4XKPA 1LGBC 2YPNA 3V5AA 1R6ZA 1D4NA 4U1OA 4L17A 1B0LA 2YLNA 1LAHE 1H44A 1Y1MA 1FTLA 4PFTA 2ESNA 4BDNA 3E9XA 4QSDA 1QVSA 1EZPA 2ONKE 3D4CA 2DXYA 3T96B 1J1NA 1Y3QA 1DSNA 3VXBA 3V8XB 4FEDA 3MBPA 2DE3A 1WVJA 2F7AA 3S9NC 1A40A 3TTLA 2H4IA 3W9WA 4NF4B 4N6PA 3GBAA 5KCJB 3G3IA 1RYXA 4QFKA 1LFHA 3RTWB 4JWXA 3K02A 3FVKA 5AE4A 3I5OA 3IL1B 4X9TA 1HSEA 5A5XB 2VD2A 4U1ZA 3K6UA 1NL5A 3N94A 2PVUA 1Y1ZA 2ANJA 2DVCA 4FATA 1ZLQA 2QS4A 1IXGA 1R9LA 3CRBA 4FEBA 2HQ0A 1PB8A 4OXVA 4GVOA 1MXVA 2DXRA 5I2NB 3PUZE 2PYYA 3O6GA 1URSA 3IJOB 2O68A 4G8HA 4R6YA 3SEVA 1QKBA 5LOMA 4KR5A 4R2BA 5H8NA 3G3JA 2A5TB 1POY1 3UK4A 1LBBA 1GR2A 4QHQA 3Q29A 3T9XB 1KWHA 3KG2A 4UA8A 3MVYA 2VP1A 5KCJA 1M5FA 1MY2A 2PMSA 3D4GA 4NE4A 2UXAA 2O1MA 2QRYA 4X1BA 4OESA 5A5XA 2FYIA 1NNKA 2DP8A 3RT6B 5L9SA 2HCAA 1YTVA 3IB2A 3RT8A 4IY5A 3S9LC 3A09A 1IQ7A 4QRZA 3M8UA 1LFIA 4DCXA 3UA8A 1NNFA 3UORA 1B5IA 3GLBA 3FGSA 4DDDA 5I2NA 3RPWA 2F34A 4OYVA 1BKAA 3QUJA 5HBCA 1XT8A 4AQ4A 2LAOA 1RKMA 3B7DA 2A5TA 2QMXA 4YKPA 4OVJA 3MJNA 4U22A 4LZ5A 1MDP1 2I4CA 2UVJA 4PETA 3DELB 2OBGA 4ECFA 5HM4B 1FTMA 2B65A 1H3DA 1HSJA 1EU8A 3FVNA 5BUUA 2ABHA 2V3QA 3H3GA 3CFLA 1MXXA 1UIVA 1QUIA 4ZE8A 1R1NA 5IKBA 2QPQA 3HSTA 2ONSA 3ZSFA 1OQHA 4EF2A 4UACA 1Y4TA 4ZZAA 3V89B 2AL4A 2Y7RA 3IO6A 4JXIA 4OEUA 4GIZA 1FTOA 4EQBA 3FJ7A 1JW5A 3TYHA 3DLNA 1IXCA 3TPAA 3MZ9A 3KJTA 3TCFA 3FD3A 3C34A 2I3WA 4P0IA 3H6WA 1AL3A 4GOTA 3TFLA 3U1OA 5CM6A 5I58B 4X1DA 3CG1A 2XX9A 3LBSA 3UP9A 4O3BA 4H8IA 5L9OA 3BBRA 3MVWA 1ZU0A 3OELA 2ZYKA 4ELQA 3K00A 1Q35A 3EHSA 3PUYE 4ZEDA 1YCJA 2QJEA 5CC2A 3IOWA 2A5SA 1FQBA 1FQFA 1AH5A 1OLAA 4F31B 2XXWA 4ZEFA 5FTHA 1T0KA 4AB5A 1MXWA 1MQJA 4OHNA 4JWOA 5H8HB 4F19A 3HHGA 4POXA 3OO9A 1Z7ME 3U93A 3OEMA 4YB7A 2DVZA 2XXVA 4MF3A 3QXMA 5I2KB 5I58A 1O63A 4R9FA 3C36A 4H6DA 2G93A 3ONMA 2F36A 3IORA 2QL3A 4ONYA 1S50A 5CMBA 4EXKA 1DMBA 1SYHA 4QFPA 2NUVA 4ZEBA 1P1QA 3DM0A 1Y3PA 1MQHA 3MZ1A 3OO8A 1ZJLA 4IGTA 4OMBA 3TAJA 2H9BA 2Q8JA 2P0SA 1A8EA 4FE8A 4O3CA 1MPBA 5DVJA 4ZDMA 5B70A 3DP4A 1GTKA 3G3KA 5H8HA 1QJMA 1WDNA 2DE4A 5FHOA 4WKMA 2GFEA 4OEVA 5EHMA 3OOAA 2QMWA 4QSCA 2B3FA 1VFDA 3FUZA 1EH3A 4NF8B 1B7UA 1P1OA 5ICQA 4DXBA 2I4BA 1TFAA 3IR1A 3RLFE 1D9YA 1N3WA 4I1DA 4PP0A 5ITPA 2HAUA 2RC8A 4HCYA 4QF9A 2Y7PA 2I6EA 3C4MA 4LONB 1LSTA 4RPOA 3RNNA 1MY0A 3GBBA 4R6KA 4F18A 1MRPA 2XHDA 3U8QA 1Y4CA 4Q30B 3LC8A 3R26A 1NFTA 2AYSA 4XIGQ 3USDA 3C32A 3FZVA 1IUDA 3CR9A 4KYEA 3T66A 1QW0A 2RC9A 4DLDA 4HCWA 2VD3A 4H8JA 2X7QA 5JEIA 1MY4A 3LSXA 3FV1A 4NF8A 4YMBA 4NTLA 1MG1A 2F78A 4IO5A 5H8SA 5CRYA 1VFEA 3O2AA 4G2ZA 2RCBA 2PBWA 3KOTA 5F1QA 1MH3A 3QIMA 5ICTA 1PC3A 2ONRA 1Z7NE 1URGA 4IO6A 1SW1A 1SW5A 3IOTA 3HV1A 4KFQA 4NF6B 2OK2A 4U4SA 1DTZA 2DYXA 4GWOA 3CI8A 1IXHA 5DYHA 1LAFE 1B05A 3UIFA 1M5EA 2NOOA 4Q5TA 2VGQA 4JSOA 4QFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DS9 A;  2GHB A;  1JNF A;  4ELR A;  4H67 A;  3QAX A;  1O64 A;  3FJG A;  4LUB A;  5TU0 A;  3FXQ A;  1QKA A;  2XXX A;  1NH8 A;  5H8N B;  2BJJ X;  1N3X A;  4XKR A;  4NWC A;  4IO7 A;  3H6T A;  1DPP A;  2IEE A;  1BP5 A;  4YZZ A;  4LQ2 A;  2R9J A;  3BFU A;  2XXT A;  1OVT A;  2F7B A;  2O51 A;  2Y7W A;  3HPI A;  1XOC A;  4Q0C A;  2V84 A;  1B4H A;  1YAE A;  4YKJ A;  1I6Q A;  3VV5 A;  3K0V A;  4XTC Q;  2ZYN A;  1JQF A;  5BWJ A;  3L6G A;  1LBC A;  1NNP A;  1OQG A;  4NF6 A;  1JVX A;  2F6G A;  2UVG A;  2XXH A;  1M5C A;  4E0X A;  5EHS A;  3OD7 A;  1FQD A;  3O6H A;  4U4X A;  3S4U A;  3MZB A;  1A54 A;  3A3U A;  5AA2 B;  1JEV A;  3GXA A;  3CG3 A;  1B6H A;  1FTK A;  2GH9 A;  3CSB A;  5CMC A;  2Z23 A;  4ZZE A;  4ISU A;  4TOZ A;  1IXI A;  3PPR A;  1A55 A;  1SDX A;  2VOZ A;  3PMV A;  2XXQ A;  2R71 A;  1TXF A;  1B3F A;  3S9M C;  3TOD A;  3O66 A;  1H45 A;  2Q88 A;  4MLQ A;  4BDL A;  2ALU A;  1N7W A;  4G68 C;  2DWA A;  4WEP A;  3QSL A;  1B32 A;  3SER A;  3SKP A;  3L6H A;  4ZEI A;  4N13 A;  4JDF A;  3K4U A;  5KZT A;  4GFR A;  1ZIU A;  3JV9 A;  3WAF A;  3S2V A;  4DXC A;  3EQ1 A;  5AA2 A;  1LFG A;  4JSD A;  3B6W A;  4FAJ A;  3TTK A;  1B3E A;  5J1D A;  3MW0 A;  2D5W A;  3SET A;  1B2H A;  3T9H B;  5IAI A;  3ZKK A;  4JB7 A;  5L9M A;  2GHA A;  1MXU A;  5AA3 A;  3PPO A;  4YKK A;  2RIN A;  3IOV A;  2F97 A;  2H5Y A;  1NH7 A;  3O9P A;  3RGY A;  4TLM B;  4R74 A;  2AL5 A;  1S9T A;  1PB7 A;  4BDO A;  1SYI A;  5HPQ A;  5CBR A;  3QK6 A;  3Q27 A;  4H0W A;  2D21 A;  1I6A A;  4MLV A;  2RF1 A;  4QFL A;  3H6V A;  2O7I A;  2NWJ A;  3IO4 A;  4OTE A;  4F2Q A;  1XHY A;  4HS7 A;  1MM7 A;  1VE4 A;  3PUW E;  2ZMB A;  3IOU A;  3SES A;  4RXL A;  4OQO A;  3MWB A;  3SEW A;  2DWH A;  1UQW A;  3OSR A;  3KZG A;  3TTM A;  3ILU B;  3BFT A;  3KN3 A;  1VR5 A;  5M2V A;  3KBR A;  4F3P A;  2FNC A;  4WED A;  4OER A;  3FV2 A;  4O3A A;  4G8M A;  1B3L A;  3N5L A;  4C1U A;  4LP2 B;  3MPL A;  4EQ7 A;  1UTH B;  3ZS6 A;  1O7T A;  2Q9T A;  2HAV A;  3TEL A;  2X7P A;  2RKM A;  1SBP A;  3M3K A;  1MDQ A;  1Y9U A;  2UVI A;  4EQ9 A;  2QSX A;  3W15 C;  5DTB A;  1NKX A;  3LR1 A;  3KJ7 A;  1N84 A;  4KCC A;  4OEN A;  1B3H A;  3C9H A;  2V3T A;  3E4R A;  1PEB A;  4U21 A;  4XXU A;  2HXW A;  2VHA A;  3GZG A;  4DZ1 A;  2ZNU A;  1LB8 A;  5I56 B;  3LSW A;  1FQE A;  3OXN A;  4HW8 A;  3C31 A;  1N76 A;  3SDF A;  2XXR A;  3DP8 A;  4GXA A;  4GQO A;  4RNS A;  2Y84 A;  4JBZ A;  1SW4 A;  3UGW A;  2DOJ A;  4ZEK A;  1B4Z A;  4NWD A;  4P11 A;  2RC7 A;  4I9D A;  3OMB A;  3TQW A;  4G77 A;  1UTH A;  2DQV A;  3OSQ A;  5H8F B;  4POW A;  5I84 A;  2NXO A;  5CI5 A;  3CFZ A;  3SEY A;  3UN6 A;  5AA4 B;  4MFI A;  1OVB A;  3LUY A;  3FJM A;  1ZBM A;  2Q89 A;  2Z8F A;  4YKI A;  1LLS A;  2O69 A;  3U92 A;  3ECR A;  1FQA A;  3MP6 A;  4EXL A;  3CFX A;  4F3S A;  4JWY A;  1LAG E;  2Y7K A;  1A7L A;  5I56 A;  3PUV E;  3VLV A;  1F9B A;  1P1N A;  2XX8 A;  3FVO A;  3V83 A;  1N04 A;  4RK9 A;  2WKY A;  3IJX B;  3T9U A;  1MM6 A;  3B6Q A;  4U23 A;  3O29 A;  5AA1 A;  2I58 A;  3F11 A;  3TMG A;  4BDR A;  1PBP A;  4M4G A;  1B52 A;  4HTG A;  4LAT A;  2PT2 A;  3CSG A;  3OEN A;  3VLW A;  2O7U A;  4RPN A;  5H8F A;  3VVD A;  1JW4 A;  1S7Y A;  3VFJ A;  3MVZ A;  5FHM A;  5DVF A;  3MPK A;  5AA4 A;  3FXU A;  2P1S A;  1SI1 A;  4R72 A;  1WOD A;  4OWD A;  5DEX B;  3H6U A;  4GF8 A;  1B5H A;  2THI A;  4LQ5 A;  1FW0 A;  3KGC A;  3PU5 A;  1B0H A;  5K2Y A;  3TQL A;  3IX1 A;  2F5X A;  3K01 A;  3PD8 A;  2PX1 A;  4F1U A;  4AB6 A;  3SEU A;  4ZS9 A;  3N26 A;  4R9G A;  5I57 B;  1RYO A;  2M8C A;  3JYR A;  3PPN A;  2OJT A;  3HO7 A;  1I69 A;  1ZMG A;  3I3V A;  2I3V A;  4DIG A;  4FJP A;  3TDJ A;  1US5 A;  4H65 A;  4PFY A;  1PDA A;  4KPT A;  1NMU A;  3Q28 A;  4EUO A;  2PT1 A;  3O97 A;  4MBP A;  4RYA A;  3IK6 B;  5DEX A;  4G4P A;  1H76 A;  2XXU A;  1Y20 A;  4ESW A;  1DPE A;  3KFM A;  2O1L A;  1BLF A;  2I0B A;  5I59 B;  1ZTY A;  3MVX A;  5CBS A;  3LSF B;  4OET A;  3HCQ A;  3TTN A;  4XKQ A;  2XXI A;  5ISU A;  2V25 A;  4RK2 A;  1ELJ A;  1USY H;  1MPD A;  4K3F A;  1CE2 A;  4NED A;  2CZL A;  3K6X A;  2NVU B;  2Q2C A;  2OWT A;  3CIJ A;  4F29 A;  5I57 A;  3G3G A;  4ELP A;  2UYE A;  4N07 A;  1QUK A;  4KQP A;  5JK4 A;  3HHF A;  1IZ1 A;  3OO7 A;  4E0W A;  3MC2 A;  5TP9 B;  1TT1 A;  1R9Q A;  3VVE A;  2F6P A;  4LA9 A;  3G3H A;  3JZJ A;  3PV0 E;  5DVI A;  3U94 A;  1MY1 A;  1OIB A;  4BDQ A;  1LAX A;  2H98 A;  1A8F A;  4BDM A;  1XS5 A;  3OEK A;  4QFN A;  1JW1 A;  3PUX E;  3PGF A;  2Z8D A;  3VE1 B;  4IO3 A;  5I59 A;  3RY3 A;  1DOT A;  2B3B A;  1B58 A;  2V3U A;  4RA1 A;  4LZ8 A;  4RJZ A;  2I0C A;  3VLU A;  2Z22 A;  3O28 A;  2XXY A;  1HSL A;  2UVH A;  4H5G A;  2D3I A;  3U72 A;  1SD3 A;  1FQC A;  3VXC A;  3RUM A;  1MXY A;  1JVY A;  1AMF A;  3T9V A;  5TP9 A;  4OFO A;  3RQT A;  3IB0 A;  2REJ A;  4I62 A;  2O6A A;  4KYD A;  2ZXT A;  1H43 A;  1MQD A;  1QUJ A;  3K1M A;  2QS1 A;  2O84 X;  3MUQ A;  1Q1K A;  3TKD A;  1B5J A;  4THI A;  5K2X A;  3K6W A;  4R73 A;  3Q26 A;  1PBQ A;  4KD5 A;  5L8D A;  1MQI A;  1B7H A;  5AA2 D;  1BIY A;  4NF4 A;  4MH5 A;  1MS7 A;  2W7Y A;  2CMO A;  1QUL A;  3PMX A;  1ZKB A;  1N7X A;  1CB6 A;  1MPC A;  2H99 A;  1D3K A;  1FTJ A;  1JEU A;  1B7Z A;  1OLC A;  3I6V A;  4YU0 A;  2KLF A;  1D9V A;  4GXS B;  5TPA B;  4YMA A;  3RTF B;  4PQJ A;  1TWY A;  2E1S A;  4DE8 A;  5CMK A;  1IIW A;  3TZA A;  2IA4 A;  2XX7 A;  4F39 A;  3W9V A;  2GRV A;  3E13 X;  4Z0I A;  1B1H A;  4OFJ A;  1ANF A;  1B40 A;  4X48 A;  3FVG A;  4EDP A;  4GL8 A;  1I6B A;  3WAE A;  4Z7E A;  3QYT A;  5F7V A;  1TFD A;  3EHT A;  3PPQ A;  4F2O A;  1PB9 A;  4P0G A;  2F7C A;  3H7M A;  4ZEC A;  5DT6 A;  3C33 A;  1N0T A;  4OFL A;  4GRK A;  3T93 B;  3RN8 A;  1GGG A;  5TPA A;  1P1U A;  2OCU A;  3KOS A;  3MP8 A;  1XC1 A;  2ZNT A;  3R6U A;  3A3C A;  3H03 A;  2P2A A;  3TTR A;  2AIX A;  1UIU A;  1US4 A;  5KDT B;  1A99 A;  3EF7 A;  5FTI A;  1B46 A;  1B9J A;  4PFU A;  2H25 A;  3SEX A;  3KN7 A;  2E0S A;  2DSF A;  1FCK A;  3DP6 A;  1URD A;  2G29 A;  4GLI A;  4YB6 A;  4Q8R A;  1B51 A;  5B7D A;  2YJP A;  1YPN A;  1EZO A;  2QS2 A;  4DCY A;  4QSE A;  3MAM A;  3KSX A;  2XD3 A;  2FA7 A;  3G7W A;  4I8C A;  4FEC A;  4RY1 A;  2HZK A;  2DWJ A;  3OO6 A;  1LB9 A;  4F1V A;  2F8D A;  4H5F A;  2R6G E;  4U2R A;  4KI0 E;  3VDF A;  1GVC A;  3S9E A;  5H8Q B;  3C35 A;  3PD9 A;  5KDT A;  1ATG A;  2F35 A;  4OZ9 A;  3K2D A;  4ESX A;  1JET A;  4ZE9 A;  3PMW A;  4NF5 B;  4LZ7 A;  3EN3 A;  3VVF A;  5ELV A;  4ELO A;  3B6T A;  3G3F A;  3HN0 A;  4ND9 A;  3QUF A;  3PPP A;  3K1N A;  1UTB B;  1SQY A;  1MXZ A;  2OZZ A;  1LCT A;  2DE2 A;  4R6H A;  4IY6 A;  4KYS A;  1B1X A;  2HZL A;  2ZNS A;  1IEJ A;  4IO4 A;  4IO2 A;  4PE5 B;  5EYF A;  3AXF A;  2OWS A;  2XXP A;  3ILT B;  3TUS A;  3FAT A;  3MP1 A;  3TCG A;  2Q2A A;  4WXJ A;  3ZKL A;  2Y7I A;  1AIV A;  3N6T A;  3EPE A;  3M3F A;  3IB1 A;  1SI0 A;  3KN8 A;  4PFW A;  1XVX A;  4YAH X;  5H8Q A;  1GV8 A;  5ITO A;  1MY3 A;  4G8N A;  3EHU A;  3KSJ A;  2I49 A;  1XVY A;  1MQG A;  4FOR A;  4GL0 A;  4DXU A;  3LSL A;  4FIM A;  1NNT A;  3FXR A;  4NF5 A;  4YIC A;  3Q25 A;  1SW2 A;  4F3B A;  2I48 A;  2ZYM A;  4NMY A;  5I2K A;  1IIT A;  4EF1 A;  3ODB A;  4G68 B;  2V93 A;  3K1P A;  5JTY B;  1VSO A;  4IB2 A;  1UTB A;  3BKI B;  1OMP A;  4C1T A;  4R75 A;  3IAZ A;  2XD2 A;  1POT A;  3E3K A;  4R2F A;  5FHN A;  4C0R A;  4BLA A;  4XKN A;  4KHZ E;  4IGR A;  2UYF A;  1DTG A;  2Z8E A;  1MH4 A;  2X26 A;  2DWI A;  1SVX B;  1M5B A;  4H1X A;  3R7X A;  4M1V A;  3THI A;  1BTJ A;  3O6I A;  1USY E;  2QS3 A;  4LVQ A;  4F22 A;  4F1Y A;  3K6V A;  4TLL B;  3TEP A;  3T22 A;  1II5 A;  3P7I A;  2ZYO A;  4GD5 A;  3H4Z A;  3CVG A;  1EZ9 A;  5CMM A;  4G68 A;  1M5D A;  4YB5 A;  3MQ9 A;  3M3L A;  5JTY A;  3FIR A;  1AOV A;  1L5T A;  3N6U A;  2OLB A;  2HFB A;  1Y3N A;  2HEU A;  3FAS A;  1LCF A;  1P99 A;  4KCD A;  4TQU Q;  2REG A;  2RCA A;  3TCH A;  3KEI A;  4F3G A;  1B3G A;  3H06 B;  1P1W A;  4XKP A;  1LGB C;  2YPN A;  3V5A A;  1R6Z A;  1D4N A;  4U1O A;  4L17 A;  1B0L A;  2YLN A;  1LAH E;  1H44 A;  1Y1M A;  1FTL A;  4PFT A;  2ESN A;  4BDN A;  3E9X A;  4QSD A;  1QVS A;  1EZP A;  2ONK E;  3D4C A;  2DXY A;  3T96 B;  1J1N A;  1Y3Q A;  1DSN A;  3VXB A;  3V8X B;  4FED A;  3MBP A;  2DE3 A;  1WVJ A;  2F7A A;  3S9N C;  1A40 A;  3TTL A;  2H4I A;  3W9W A;  4NF4 B;  4N6P A;  3GBA A;  5KCJ B;  3G3I A;  1RYX A;  4QFK A;  1LFH A;  3RTW B;  4JWX A;  3K02 A;  3FVK A;  5AE4 A;  3I5O A;  3IL1 B;  4X9T A;  1HSE A;  5A5X B;  2VD2 A;  4U1Z A;  3K6U A;  1NL5 A;  3N94 A;  2PVU A;  1Y1Z A;  2ANJ A;  2DVC A;  4FAT A;  1ZLQ A;  2QS4 A;  1IXG A;  1R9L A;  3CRB A;  4FEB A;  2HQ0 A;  1PB8 A;  4OXV A;  4GVO A;  1MXV A;  2DXR A;  5I2N B;  3PUZ E;  2PYY A;  3O6G A;  1URS A;  3IJO B;  2O68 A;  4G8H A;  4R6Y A;  3SEV A;  1QKB A;  5LOM A;  4KR5 A;  4R2B A;  5H8N A;  3G3J A;  2A5T B;  1POY 1;  3UK4 A;  1LBB A;  1GR2 A;  4QHQ A;  3Q29 A;  3T9X B;  1KWH A;  3KG2 A;  4UA8 A;  3MVY A;  2VP1 A;  5KCJ A;  1M5F A;  1MY2 A;  2PMS A;  3D4G A;  4NE4 A;  2UXA A;  2O1M A;  2QRY A;  4X1B A;  4OES A;  5A5X A;  2FYI A;  1NNK A;  2DP8 A;  3RT6 B;  5L9S A;  2HCA A;  1YTV A;  3IB2 A;  3RT8 A;  4IY5 A;  3S9L C;  3A09 A;  1IQ7 A;  4QRZ A;  3M8U A;  1LFI A;  4DCX A;  3UA8 A;  1NNF A;  3UOR A;  1B5I A;  3GLB A;  3FGS A;  4DDD A;  5I2N A;  3RPW A;  2F34 A;  4OYV A;  1BKA A;  3QUJ A;  5HBC A;  1XT8 A;  4AQ4 A;  2LAO A;  1RKM A;  3B7D A;  2A5T A;  2QMX A;  4YKP A;  4OVJ A;  3MJN A;  4U22 A;  4LZ5 A;  1MDP 1;  2I4C A;  2UVJ A;  4PET A;  3DEL B;  2OBG A;  4ECF A;  5HM4 B;  1FTM A;  2B65 A;  1H3D A;  1HSJ A;  1EU8 A;  3FVN A;  5BUU A;  2ABH A;  2V3Q A;  3H3G A;  3CFL A;  1MXX A;  1UIV A;  1QUI A;  4ZE8 A;  1R1N A;  5IKB A;  2QPQ A;  3HST A;  2ONS A;  3ZSF A;  1OQH A;  4EF2 A;  4UAC A;  1Y4T A;  4ZZA A;  3V89 B;  2AL4 A;  2Y7R A;  3IO6 A;  4JXI A;  4OEU A;  4GIZ A;  1FTO A;  4EQB A;  3FJ7 A;  1JW5 A;  3TYH A;  3DLN A;  1IXC A;  3TPA A;  3MZ9 A;  3KJT A;  3TCF A;  3FD3 A;  3C34 A;  2I3W A;  4P0I A;  3H6W A;  1AL3 A;  4GOT A;  3TFL A;  3U1O A;  5CM6 A;  5I58 B;  4X1D A;  3CG1 A;  2XX9 A;  3LBS A;  3UP9 A;  4O3B A;  4H8I A;  5L9O A;  3BBR A;  3MVW A;  1ZU0 A;  3OEL A;  2ZYK A;  4ELQ A;  3K00 A;  1Q35 A;  3EHS A;  3PUY E;  4ZED A;  1YCJ A;  2QJE A;  5CC2 A;  3IOW A;  2A5S A;  1FQB A;  1FQF A;  1AH5 A;  1OLA A;  4F31 B;  2XXW A;  4ZEF A;  5FTH A;  1T0K A;  4AB5 A;  1MXW A;  1MQJ A;  4OHN A;  4JWO A;  5H8H B;  4F19 A;  3HHG A;  4POX A;  3OO9 A;  1Z7M E;  3U93 A;  3OEM A;  4YB7 A;  2DVZ A;  2XXV A;  4MF3 A;  3QXM A;  5I2K B;  5I58 A;  1O63 A;  4R9F A;  3C36 A;  4H6D A;  2G93 A;  3ONM A;  2F36 A;  3IOR A;  2QL3 A;  4ONY A;  1S50 A;  5CMB A;  4EXK A;  1DMB A;  1SYH A;  4QFP A;  2NUV A;  4ZEB A;  1P1Q A;  3DM0 A;  1Y3P A;  1MQH A;  3MZ1 A;  3OO8 A;  1ZJL A;  4IGT A;  4OMB A;  3TAJ A;  2H9B A;  2Q8J A;  2P0S A;  1A8E A;  4FE8 A;  4O3C A;  1MPB A;  5DVJ A;  4ZDM A;  5B70 A;  3DP4 A;  1GTK A;  3G3K A;  5H8H A;  1QJM A;  1WDN A;  2DE4 A;  5FHO A;  4WKM A;  2GFE A;  4OEV A;  5EHM A;  3OOA A;  2QMW A;  4QSC A;  2B3F A;  1VFD A;  3FUZ A;  1EH3 A;  4NF8 B;  1B7U A;  1P1O A;  5ICQ A;  4DXB A;  2I4B A;  1TFA A;  3IR1 A;  3RLF E;  1D9Y A;  1N3W A;  4I1D A;  4PP0 A;  5ITP A;  2HAU A;  2RC8 A;  4HCY A;  4QF9 A;  2Y7P A;  2I6E A;  3C4M A;  4LON B;  1LST A;  4RPO A;  3RNN A;  1MY0 A;  3GBB A;  4R6K A;  4F18 A;  1MRP A;  2XHD A;  3U8Q A;  1Y4C A;  4Q30 B;  3LC8 A;  3R26 A;  1NFT A;  2AYS A;  4XIG Q;  3USD A;  3C32 A;  3FZV A;  1IUD A;  3CR9 A;  4KYE A;  3T66 A;  1QW0 A;  2RC9 A;  4DLD A;  4HCW A;  2VD3 A;  4H8J A;  2X7Q A;  5JEI A;  1MY4 A;  3LSX A;  3FV1 A;  4NF8 A;  4YMB A;  4NTL A;  1MG1 A;  2F78 A;  4IO5 A;  5H8S A;  5CRY A;  1VFE A;  3O2A A;  4G2Z A;  2RCB A;  2PBW A;  3KOT A;  5F1Q A;  1MH3 A;  3QIM A;  5ICT A;  1PC3 A;  2ONR A;  1Z7N E;  1URG A;  4IO6 A;  1SW1 A;  1SW5 A;  3IOT A;  3HV1 A;  4KFQ A;  4NF6 B;  2OK2 A;  4U4S A;  1DTZ A;  2DYX A;  4GWO A;  3CI8 A;  1IXH A;  5DYH A;  1LAF E;  1B05 A;  3UIF A;  1M5E A;  2NOO A;  4Q5T A;  2VGQ A;  4JSO A;  4QFO A; 
#chains in the Genus database with same CATH topology
 1FPE A;  2DS9 A;  2GHB A;  3T0J A;  1JNF A;  4ELR A;  4H67 A;  1DK4 A;  3QAX A;  1O64 A;  3FJG A;  4LUB A;  5TU0 A;  3FXQ A;  4GWZ A;  1QKA A;  2XXX A;  1NH8 A;  5DW8 A;  5H8N B;  2BJJ X;  2XWO A;  1N3X A;  4XKR A;  4NWC A;  4IO7 A;  3H6T A;  1DPP A;  2IEE A;  1BP5 A;  4YZZ A;  4LQ2 A;  2R9J A;  3BFU A;  2XXT A;  4MNP A;  1OVT A;  2F7B A;  2O51 A;  4XEQ A;  2KQZ A;  2Y7W A;  2VPN A;  3HPI A;  1XOC A;  4Q0C A;  2V84 A;  1B4H A;  1YAE A;  4YKJ A;  1I6Q A;  3VV5 A;  3K0V A;  4XTC Q;  4I40 A;  5F24 A;  2ZYN A;  1JQF A;  5BWJ A;  2QVV A;  3L6G A;  1LBC A;  1NNP A;  1OQG A;  4NF6 A;  1JVX A;  2F6G A;  2UVG A;  2XXH A;  1M5C A;  4E0X A;  2WX9 A;  3OD7 A;  5EHS A;  1FQD A;  3O6H A;  4U4X A;  3S4U A;  3MZB A;  4PE3 A;  1A54 A;  4PDD A;  3A3U A;  1IMD A;  5AA2 B;  1JEV A;  3GXA A;  1SPI A;  3CG3 A;  1B6H A;  1FTK A;  2GH9 A;  3CSB A;  4MHF A;  5CMC A;  2Z23 A;  4ZZE A;  4ISU A;  4TOZ A;  1IXI A;  3PPR A;  1A55 A;  1SDX A;  2VOZ A;  3PMV A;  2XXQ A;  2R71 A;  1TXF A;  1B3F A;  3S9M C;  1FPJ A;  3ISP A;  3TOD A;  3O66 A;  3KC1 A;  1H45 A;  2Q88 A;  4MLQ A;  2DDK A;  3KC0 A;  4X04 A;  4BDL A;  2ALU A;  1N7W A;  1LBV A;  4G68 C;  4MX6 A;  2DWA A;  4WEP A;  3QSL A;  1B32 A;  3SER A;  3SKP A;  3L6H A;  4ZEI A;  4N13 A;  4JDF A;  4MEV A;  3K4U A;  5KZT A;  4GFR A;  1ZIU A;  3JV9 A;  3WAF A;  3S2V A;  4DXC A;  3EQ1 A;  5AA2 A;  4HXV A;  1LFG A;  2PFY A;  4JSD A;  3B6W A;  5ESY A;  4DI4 B;  4FAJ A;  3TTK A;  1B3E A;  5J1D A;  3MW0 A;  4P1L A;  2PCR A;  1IMC A;  2D5W A;  3SET A;  1B2H A;  3T9H B;  5IAI A;  4PAI A;  3ZKK A;  4JB7 A;  5L9M A;  2GHA A;  1MXU A;  2ZZW A;  5AA3 A;  3PPO A;  4YKK A;  2RIN A;  3IOV A;  2F97 A;  2CEY A;  2H5Y A;  1NH7 A;  3O9P A;  1LBX A;  3RGY A;  4TLM B;  4R74 A;  2AL5 A;  1S9T A;  5EQA A;  1PB7 A;  4BDO A;  1SYI A;  5HPQ A;  5CBR A;  3QK6 A;  3Q27 A;  4LN5 A;  4H0W A;  2P3N A;  2D21 A;  1I6A A;  4MLV A;  2RF1 A;  4QFL A;  3H6V A;  2O7I A;  2NWJ A;  3IO4 A;  4OTE A;  1DBZ A;  4F2Q A;  1XHY A;  4HS7 A;  5ET5 A;  1MM7 A;  1VE4 A;  3PUW E;  4IR8 A;  3FXB A;  2ZMB A;  1FRP A;  3IOU A;  3SES A;  4RXL A;  4OQO A;  1FTA A;  4O7M A;  3MWB A;  3SEW A;  1IMF A;  1KA1 A;  2DWH A;  1UQW A;  3OSR A;  3KZG A;  3TTM A;  1FSA A;  3ILU B;  3BFT A;  3KN3 A;  1VR5 A;  5M2V A;  3KBR A;  4F3P A;  2FNC A;  4WED A;  4OER A;  2R8T A;  3FV2 A;  5I3S A;  4O3A A;  4G8M A;  1B3L A;  3N5L A;  4C1U A;  4LP2 B;  3MPL A;  4EQ7 A;  4GBW A;  1UTH B;  4MCO A;  3ZS6 A;  1O7T A;  2Q9T A;  3T1B A;  2HAV A;  4XF5 A;  3TEL A;  2X7P A;  2RKM A;  1SBP A;  3M3K A;  1MDQ A;  1Y9U A;  2UVI A;  1IME A;  4FBP A;  4EQ9 A;  2QSX A;  3W15 C;  5DTB A;  1NKX A;  3LR1 A;  3IFA A;  3KJ7 A;  4GWX A;  1N84 A;  4PAF A;  1FPG A;  4KCC A;  3LUZ A;  4OEN A;  1B3H A;  3C9H A;  2V3T A;  3E4R A;  1PEB A;  4U21 A;  4XXU A;  2HXW A;  2VHA A;  3GZG A;  4DZ1 A;  2ZNU A;  1LB8 A;  5I56 B;  3LSW A;  1FQE A;  3OXN A;  4HW8 A;  3C31 A;  2GQ1 A;  1N76 A;  5LDZ A;  1RDX A;  2Y5L A;  3SDF A;  2XXR A;  3DP8 A;  4GXA A;  4NG7 A;  4GQO A;  4RNS A;  2Y84 A;  4JBZ A;  1SW4 A;  3UGW A;  2DOJ A;  1EYJ A;  4ZEK A;  1B4Z A;  1FBG A;  4PCD A;  4NWD A;  4P11 A;  4GX6 A;  2RC7 A;  4I9D A;  3OMB A;  4JVC A;  3TQW A;  4G77 A;  1UTH A;  2DQV A;  3OSQ A;  5H8F B;  4POW A;  5I84 A;  2NXO A;  5CI5 A;  3CFZ A;  3SEY A;  1FPL A;  3UN6 A;  5AA4 B;  4MFI A;  1OVB A;  3LUY A;  3FJM A;  4O94 A;  1ZBM A;  2Q89 A;  2Z8F A;  4YKI A;  1LLS A;  1NV1 A;  2O69 A;  3U92 A;  3ECR A;  1FQA A;  1K9Y A;  3MP6 A;  3CHG A;  4EXL A;  3CFX A;  4F3S A;  4JWY A;  1LAG E;  2Y7K A;  4GWY A;  1A7L A;  5I56 A;  3B8B A;  3PUV E;  3VLV A;  1F9B A;  1P1N A;  2XX8 A;  3FVO A;  2KR0 A;  3V83 A;  4OVQ A;  1N04 A;  4RK9 A;  2WKY A;  3IJX B;  3T9U A;  5IM2 A;  1MM6 A;  3B6Q A;  4U23 A;  3O29 A;  5AA1 A;  2I58 A;  3F11 A;  3TMG A;  4BDR A;  1PBP A;  4M4G A;  1B52 A;  4HTG A;  4LAT A;  2PT2 A;  3CSG A;  3OEN A;  3VLW A;  2O7U A;  4RPN A;  5H8F A;  3VVD A;  4OVT A;  1JW4 A;  5IZ1 A;  1S7Y A;  3VFJ A;  3MVZ A;  5FHM A;  5DVF A;  3MPK A;  5AA4 A;  3FXU A;  2P1S A;  4MMP A;  1SI1 A;  4R72 A;  4PDH A;  1WOD A;  4OWD A;  5DEX B;  3H6U A;  4GF8 A;  1B5H A;  2THI A;  4MJO A;  4LQ5 A;  1FW0 A;  3KGC A;  3PU5 A;  1B0H A;  5K2Y A;  1G0I A;  3TQL A;  5EQ8 A;  3IX1 A;  2F5X A;  3K01 A;  1FPK A;  4OA4 A;  3PD8 A;  2PX1 A;  4NHB A;  4F1U A;  4AB6 A;  3SEU A;  1NUZ A;  4ZS9 A;  3N26 A;  4R9G A;  5I57 B;  1RYO A;  2M8C A;  5J16 A;  3JYR A;  5ET6 A;  3PPN A;  4NX1 A;  4GBV A;  2OJT A;  3HO7 A;  1I69 A;  1ZMG A;  3I3V A;  2I3V A;  4DIG A;  2B4M A;  4FJP A;  3TDJ A;  1US5 A;  4H65 A;  4PFY A;  1PDA A;  4KPT A;  1NMU A;  5ET7 A;  1FPI A;  3Q28 A;  4EUO A;  2PT1 A;  3O97 A;  4MBP A;  4RYA A;  3IK6 B;  5DEX A;  4G4P A;  1H76 A;  2XXU A;  4OVR A;  1Y20 A;  4ESW A;  1DPE A;  3KFM A;  4I3E A;  2O1L A;  1BLF A;  2I0B A;  5I59 B;  1ZTY A;  2Q8M A;  3MVX A;  5CBS A;  3LSF B;  5IGA A;  2HXR A;  4OET A;  3HCQ A;  3TTN A;  4XKQ A;  2XXI A;  5ISU A;  3ROJ A;  2V25 A;  4RK2 A;  1ELJ A;  1USY H;  1MPD A;  4K3F A;  1CE2 A;  1VDW A;  4NED A;  2CZL A;  3K6X A;  2NVU B;  2Q2C A;  2OWT A;  3CIJ A;  4F29 A;  5I57 A;  3G3G A;  4ELP A;  2UYE A;  4N07 A;  1QUK A;  4KQP A;  5JK4 A;  3HHF A;  1IZ1 A;  3OO7 A;  4E0W A;  3MC2 A;  5TP9 B;  5EYH A;  1TT1 A;  1R9Q A;  3VVE A;  2F6P A;  2ZZX A;  4LA9 A;  3G3H A;  3JZJ A;  3PV0 E;  5DVI A;  3U94 A;  3E79 A;  1MY1 A;  4P47 A;  1OIB A;  4BDQ A;  1LAX A;  2H98 A;  1A8F A;  4BDM A;  1XS5 A;  3OEK A;  4QFN A;  1JW1 A;  3PUX E;  3PGF A;  2Z8D A;  3VE1 B;  4IO3 A;  5I59 A;  3RY3 A;  4GWW A;  3KBZ A;  1DOT A;  2B3B A;  4N91 A;  1B58 A;  2V3U A;  4RA1 A;  4PFI A;  4MNI A;  4LZ8 A;  4RJZ A;  2I0C A;  3VLU A;  2Z22 A;  2XWV A;  3O28 A;  2XXY A;  1HSL A;  2UVH A;  4H5G A;  2D3I A;  2HPG A;  3U72 A;  1K9Z A;  1SD3 A;  1FQC A;  3VXC A;  3RUM A;  1EYK A;  1MXY A;  1JVY A;  5ET8 A;  2WBB A;  1AMF A;  3T9V A;  5TP9 A;  4OFO A;  3RQT A;  3IB0 A;  2REJ A;  1NUX A;  4HE0 A;  4I62 A;  4KYD A;  2O6A A;  2ZXT A;  1H43 A;  1MQD A;  1QUJ A;  3K1M A;  2QS1 A;  2O84 X;  3MUQ A;  4QBA A;  1Q1K A;  3TKD A;  1B5J A;  4THI A;  5K2X A;  3K6W A;  4R73 A;  3Q26 A;  1PBQ A;  4P3L A;  4KD5 A;  5L8D A;  1MQI A;  1B7H A;  5AA2 D;  2MKZ A;  1BIY A;  4NF4 A;  4MH5 A;  1MS7 A;  2W7Y A;  1FBC A;  2CMO A;  1QUL A;  3PMX A;  1ZKB A;  1N7X A;  1EYI A;  1CB6 A;  1MPC A;  2H99 A;  1D3K A;  1FTJ A;  1JEU A;  1B7Z A;  1OLC A;  3I6V A;  4YU0 A;  2KLF A;  1D9V A;  4GXS B;  5TPA B;  4YMA A;  4GX3 A;  3RTF B;  4PQJ A;  1TWY A;  2V4C A;  2E1S A;  5IZ3 B;  4DE8 A;  5CMK A;  1IIW A;  2QFL A;  3TZA A;  2IA4 A;  2XX7 A;  1FBE A;  2VPO A;  4F39 A;  4AS4 A;  3W9V A;  1FPB A;  2GRV A;  3E13 X;  4Z0I A;  1B1H A;  4OFJ A;  4HE2 A;  1ANF A;  1B40 A;  4X48 A;  3FVG A;  4EDP A;  4GL8 A;  5EQ9 A;  1I6B A;  3WAE A;  2HHM A;  4Z7E A;  1G0H A;  3QYT A;  1NUW A;  5F7V A;  1NV5 A;  1TFD A;  3EHT A;  3PPQ A;  4F2O A;  4N6K A;  1PB9 A;  4P0G A;  4P56 A;  2F7C A;  2WYK A;  3H7M A;  4ZEC A;  5DT6 A;  1FBH A;  3C33 A;  1N0T A;  4OFL A;  4P1E A;  4GRK A;  3T93 B;  3RN8 A;  1GGG A;  5TPA A;  1P1U A;  2OCU A;  3KOS A;  3MP8 A;  1XC1 A;  2XA5 A;  5IZ3 A;  2ZNT A;  3R6U A;  3SZP A;  3A3C A;  3H03 A;  2P2A A;  5LTC A;  3TTR A;  2AIX A;  1UIU A;  1US4 A;  1BK4 A;  5KDT B;  1A99 A;  3EF7 A;  4DI3 D;  1KZ8 A;  5FTI A;  2XWK A;  1B46 A;  4NGU A;  1B9J A;  4PFU A;  2H25 A;  3SEX A;  3KN7 A;  2E0S A;  2DSF A;  1FPD A;  3U65 A;  1FCK A;  3DP6 A;  1NV3 A;  1URD A;  2G29 A;  4GLI A;  4YB6 A;  4Q8R A;  1B51 A;  5B7D A;  2YJP A;  1YPN A;  1EZO A;  2QS2 A;  1AWB A;  4DCY A;  4QSE A;  3MAM A;  3KSX A;  2XD3 A;  2FA7 A;  2QVR A;  3G7W A;  4I8C A;  4FEC A;  4RY1 A;  1RDZ A;  1LBW A;  3D1R A;  2HZK A;  2DWJ A;  3OO6 A;  1LB9 A;  4F1V A;  2F8D A;  4H5F A;  2R6G E;  4U2R A;  4KI0 E;  4QXD A;  3VDF A;  1GVC A;  3S9E A;  5H8Q B;  3C35 A;  3PD9 A;  5KDT A;  1ATG A;  2F35 A;  4OZ9 A;  3K2D A;  4ESX A;  1JET A;  4ZE9 A;  3PMW A;  4NF5 B;  4LZ7 A;  3EN3 A;  3VVF A;  5ELV A;  4ELO A;  4NAP A;  3B6T A;  3G3F A;  3BIG A;  3HN0 A;  4ND9 A;  3QUF A;  3MST A;  3PPP A;  3K1N A;  1KA0 A;  1UTB B;  1SQY A;  1MXZ A;  2CZI A;  2OZZ A;  1LCT A;  2DE2 A;  4R6H A;  4IY6 A;  4KYS A;  1B1X A;  2HZL A;  2ZNS A;  3QMF A;  1IEJ A;  4IO4 A;  4IO2 A;  4PE5 B;  5EYF A;  3AXF A;  2OWS A;  2XXP A;  3ILT B;  4MAG A;  3TUS A;  3FAT A;  3MP1 A;  3TCG A;  2Q2A A;  4WXJ A;  3ZKL A;  3B50 A;  2Y7I A;  1AIV A;  3N6T A;  3EPE A;  3M3F A;  3IB1 A;  4KXP A;  1SI0 A;  3KN8 A;  4PFW A;  1XVX A;  4YAH X;  5H8Q A;  1GV8 A;  5ITO A;  1MY3 A;  4PAK A;  4G8N A;  3EHU A;  4PTK A;  3KSJ A;  2I49 A;  1XVY A;  1MQG A;  4FOR A;  4GL0 A;  4DXU A;  3LSL A;  4FIM A;  1NNT A;  3FXR A;  4NF5 A;  4YIC A;  3Q25 A;  1SW2 A;  2VT5 A;  4F3B A;  2I48 A;  2ZYM A;  4NMY A;  5I2K A;  1IIT A;  4EF1 A;  3ODB A;  4G68 B;  2V93 A;  3K1P A;  2XWI A;  5JTY B;  1VSO A;  4IB2 A;  1UTB A;  3BKI B;  1XI6 A;  1OMP A;  1QGX A;  3RYD A;  5EQ7 A;  4C1T A;  4R75 A;  3IAZ A;  2FHY A;  1IMA A;  2XD2 A;  1POT A;  3E3K A;  1YZ0 A;  4R2F A;  5FHN A;  4C0R A;  4BLA A;  4XKN A;  4KHZ E;  4IGR A;  2UYF A;  1DTG A;  2Z8E A;  1MH4 A;  2X26 A;  2DWI A;  4PF8 A;  1SVX B;  5IZZ A;  1M5B A;  4H45 A;  4H1X A;  3R7X A;  4M1V A;  3THI A;  1BTJ A;  3O6I A;  1USY E;  2QS3 A;  4LVQ A;  4F22 A;  4F1Y A;  3K6V A;  4TLL B;  3TEP A;  3T22 A;  1II5 A;  2BJI A;  2ZYO A;  3P7I A;  4GD5 A;  3H4Z A;  3CVG A;  1EZ9 A;  5CMM A;  4G68 A;  4NN3 A;  1M5D A;  4YB5 A;  3MQ9 A;  3M3L A;  5JTY A;  3FIR A;  1AOV A;  1L5T A;  3N6U A;  2OLB A;  2HFB A;  1Y3N A;  2HEU A;  3FAS A;  4P8B A;  1LCF A;  1P99 A;  4KCD A;  4TQU Q;  2REG A;  2RCA A;  3TCH A;  3KEI A;  4F3G A;  1B3G A;  3H06 B;  1INP A;  1P1W A;  4XKP A;  2JJK A;  1LGB C;  2YPN A;  3V5A A;  1R6Z A;  1D4N A;  4U1O A;  4L17 A;  2P3V A;  1B0L A;  2YLN A;  1LAH E;  1H44 A;  1Y1M A;  2WBD A;  1FTL A;  4MNC A;  4PFT A;  4O7I A;  2ESN A;  4BDN A;  3E9X A;  4PGP A;  4QSD A;  1QVS A;  1EZP A;  2ONK E;  3D4C A;  1LBY A;  2DXY A;  3T96 B;  1J1N A;  1Y3Q A;  1DSN A;  3VXB A;  3V8X B;  4FED A;  2F3D A;  3MBP A;  2DE3 A;  1WVJ A;  2F7A A;  3E78 A;  3S9N C;  1A40 A;  3TTL A;  2H4I A;  3W9W A;  1CNQ A;  4NF4 B;  4N6P A;  3GBA A;  5KCJ B;  3G3I A;  1RYX A;  4QFK A;  1LFH A;  3RTW B;  4JWX A;  3K02 A;  3FVK A;  1JP4 A;  5AE4 A;  1D9Q A;  3I5O A;  3IL1 B;  4X9T A;  1HSE A;  5A5X B;  2VD2 A;  3IFC A;  4U1Z A;  3K6U A;  1NL5 A;  3N94 A;  2PVU A;  4GWU A;  4N4U A;  2FVZ A;  4N6D A;  1Y1Z A;  5T3J A;  5FBP A;  2ANJ A;  2DVC A;  4FAT A;  1ZLQ A;  3GYY A;  2QS4 A;  1IXG A;  1R9L A;  3CRB A;  4FEB A;  2QVU A;  4P9K A;  4N8Y A;  2HQ0 A;  1PB8 A;  4OXV A;  4GVO A;  1MXV A;  2DXR A;  5I2N B;  3PUZ E;  2PYY A;  3O6G A;  2OWZ A;  1URS A;  3IJO B;  2O68 A;  4G8H A;  4R6Y A;  3SEV A;  1QKB A;  5LOM A;  4KR5 A;  4R2B A;  5H8N A;  4N8G A;  3G3J A;  2A5T B;  1FBF A;  1POY 1;  3UK4 A;  2PFZ A;  4PGN A;  1FJ6 A;  1LBB A;  1GR2 A;  4QHQ A;  3Q29 A;  3T9X B;  1KWH A;  3KG2 A;  4UA8 A;  3MVY A;  2VP1 A;  5KCJ A;  1M5F A;  1MY2 A;  4G61 A;  2PMS A;  3D4G A;  4NE4 A;  1Q9D A;  2UXA A;  2O1M A;  2QRY A;  4X1B A;  2L5V A;  4OES A;  5A5X A;  2FYI A;  1NNK A;  2DP8 A;  3RT6 B;  5L9S A;  2HCA A;  1YTV A;  3IB2 A;  3RT8 A;  4IY5 A;  3S9L C;  3A09 A;  1IQ7 A;  4NQ8 A;  4QRZ A;  3M8U A;  1LFI A;  4DCX A;  3UA8 A;  4GWS A;  1NNF A;  2Q74 A;  1B5I A;  3GLB A;  3FGS A;  3UOR A;  4DDD A;  5I2N A;  3RPW A;  2F34 A;  4OYV A;  1BKA A;  4O8M A;  3QUJ A;  2OX3 A;  5HBC A;  1XT8 A;  4AQ4 A;  2LAO A;  1RKM A;  3B7D A;  2A5T A;  2QMX A;  4YKP A;  4OVJ A;  3MJN A;  4U22 A;  4LZ5 A;  3LV0 A;  1MDP 1;  2I4C A;  2UVJ A;  4PET A;  3DEL B;  2OBG A;  4ECF A;  5HM4 B;  1FTM A;  2B65 A;  1H3D A;  1HSJ A;  1EU8 A;  3FVN A;  5BUU A;  2ABH A;  2V3Q A;  3H3G A;  3CFL A;  2CZK A;  4PF6 A;  1MXX A;  1UIV A;  1QUI A;  4ZE8 A;  1R1N A;  5IKB A;  1NV2 A;  2QPQ A;  3HST A;  3BIH A;  2ONS A;  3ZSF A;  1OQH A;  3MYU A;  2F3B A;  4EF2 A;  4UAC A;  1Y4T A;  1FBD A;  4ZZA A;  3V89 B;  2AL4 A;  2Y7R A;  3IO6 A;  4JXI A;  4OEU A;  4GIZ A;  1FTO A;  4N17 A;  3FJ7 A;  4EQB A;  1JW5 A;  3TYH A;  3DLN A;  1IXC A;  3TPA A;  3MZ9 A;  3KJT A;  3TCF A;  3FD3 A;  1FJ9 A;  3C34 A;  2I3W A;  4HE1 A;  4P0I A;  3H6W A;  1AL3 A;  4GOT A;  3TFL A;  2WYP A;  1FPF A;  3U1O A;  4H46 A;  1YYZ A;  5CM6 A;  5I58 B;  4X1D A;  3CG1 A;  2XX9 A;  3LBS A;  3FBP A;  3UP9 A;  4O3B A;  4H8I A;  4JVD A;  5L9O A;  3BBR A;  3MVW A;  1NUY A;  1ZU0 A;  3OEL A;  2ZYK A;  4ELQ A;  3K00 A;  1Q35 A;  3EHS A;  4PBH A;  3PUY E;  4ZED A;  1YCJ A;  2QJE A;  5CC2 A;  3IOW A;  2A5S A;  1FQB A;  1FQF A;  1AH5 A;  1OLA A;  4F31 B;  2XXW A;  4ZEF A;  5FTH A;  1T0K A;  4N15 A;  4AB5 A;  4AS5 A;  1MXW A;  1MQJ A;  4OHN A;  4JWO A;  4JVI A;  4OVP A;  5H8H B;  1LEV A;  3HHG A;  4POX A;  4F19 A;  3OO9 A;  1Z7M E;  3U93 A;  3PTY A;  3OEM A;  4YB7 A;  2DVZ A;  2XXV A;  4MF3 A;  3QXM A;  2FIE A;  5I2K B;  5I58 A;  1O63 A;  2XXK A;  4R9F A;  3C36 A;  4H6D A;  2G93 A;  3NOH A;  3ONM A;  2F36 A;  3IOR A;  2QL3 A;  4PBQ A;  4ONY A;  1S50 A;  5CMB A;  4EXK A;  5A5L A;  4PFR A;  1DMB A;  1SYH A;  4QFP A;  2NUV A;  4ZEB A;  1P1Q A;  3DM0 A;  1Y3P A;  1MQH A;  3MZ1 A;  3OO8 A;  1ZJL A;  4IGT A;  4OMB A;  2ZZV A;  3TAJ A;  2CEX A;  2H9B A;  5EYG A;  2P0S A;  2Q8J A;  1A8E A;  4FE8 A;  4O3C A;  1MPB A;  5DVJ A;  4ZDM A;  5B70 A;  1NV6 A;  3DP4 A;  1GTK A;  3G3K A;  5H8H A;  1QJM A;  1WDN A;  4NF0 A;  2DE4 A;  5FHO A;  3RPL B;  4WKM A;  2GFE A;  3EKI A;  4OEV A;  5EHM A;  3OOA A;  2QMW A;  4QSC A;  2B3F A;  1DCU A;  2CZH A;  1VFD A;  2FBP A;  3FUZ A;  1EH3 A;  4NF8 B;  4OVS A;  1B7U A;  4MIJ A;  3A29 A;  2WEF A;  1P1O A;  1IMB A;  5ICQ A;  4DXB A;  2I4B A;  4I3Y A;  1TFA A;  3IR1 A;  3RLF E;  1D9Y A;  5I5P A;  1N3W A;  4I1D A;  4PP0 A;  4X8R A;  5ITP A;  2HAU A;  2RC8 A;  4HCY A;  4QF9 A;  2Y7P A;  2I6E A;  3C4M A;  4LON B;  1LST A;  4RPO A;  3RNN A;  1MY0 A;  4PC9 A;  3GBB A;  4R6K A;  4F18 A;  1MRP A;  2XHD A;  3U8Q A;  1Y4C A;  4Q30 B;  3LC8 A;  3R26 A;  1NFT A;  2AYS A;  4UAB A;  4XIG Q;  3USD A;  3C32 A;  3FZV A;  1IUD A;  3CR9 A;  4KYE A;  3T66 A;  1QW0 A;  2RC9 A;  3RPL A;  4DLD A;  4HCW A;  2VD3 A;  4H8J A;  1RDY A;  2X7Q A;  5JEI A;  1MY4 A;  3HFU A;  1NV7 A;  3LSX A;  3FV1 A;  4NF8 A;  4YMB A;  4NTL A;  4PFB A;  1NV0 A;  1MG1 A;  2F78 A;  2B4L A;  2FIX A;  4IO5 A;  5H8S A;  5CRY A;  1VFE A;  3O2A A;  4G2Z A;  2RCB A;  4XFE A;  2PBW A;  3KOT A;  5F1Q A;  2Y5K A;  1MH3 A;  3QIM A;  1LBZ A;  5ICT A;  1PC3 A;  2ONR A;  1Z7N E;  5I7I A;  1URG A;  4IO6 A;  4GX4 A;  1SW1 A;  1SW5 A;  3IOT A;  4N81 A;  3HV1 A;  4KFQ A;  4NF6 B;  2OK2 A;  4U4S A;  1DTZ A;  2DYX A;  4GWO A;  1FBP A;  3CI8 A;  1IXH A;  5DYH A;  1LAF E;  1NI9 A;  1B05 A;  4OAN A;  3UIF A;  1M5E A;  2NOO A;  1YXI A;  4Q5T A;  1NV4 A;  2VGQ A;  4JSO A;  4QFO A; 
#chains in the Genus database with same CATH homology
 2DS9 A;  2GHB A;  1JNF A;  4ELR A;  4H67 A;  3QAX A;  1O64 A;  3FJG A;  4LUB A;  5TU0 A;  3FXQ A;  1QKA A;  2XXX A;  1NH8 A;  5H8N B;  2BJJ X;  1N3X A;  4XKR A;  4NWC A;  4IO7 A;  3H6T A;  1DPP A;  2IEE A;  1BP5 A;  4YZZ A;  4LQ2 A;  2R9J A;  3BFU A;  2XXT A;  1OVT A;  2F7B A;  2O51 A;  2Y7W A;  3HPI A;  1XOC A;  4Q0C A;  2V84 A;  1B4H A;  1YAE A;  4YKJ A;  1I6Q A;  3VV5 A;  3K0V A;  4XTC Q;  2ZYN A;  1JQF A;  5BWJ A;  3L6G A;  1LBC A;  1NNP A;  1OQG A;  4NF6 A;  1JVX A;  2F6G A;  2UVG A;  2XXH A;  1M5C A;  4E0X A;  5EHS A;  3OD7 A;  1FQD A;  3O6H A;  4U4X A;  3S4U A;  3MZB A;  1A54 A;  3A3U A;  5AA2 B;  1JEV A;  3GXA A;  3CG3 A;  1B6H A;  1FTK A;  2GH9 A;  3CSB A;  5CMC A;  2Z23 A;  4ZZE A;  4ISU A;  4TOZ A;  1IXI A;  3PPR A;  1A55 A;  1SDX A;  2VOZ A;  3PMV A;  2XXQ A;  2R71 A;  1TXF A;  1B3F A;  3S9M C;  3TOD A;  3O66 A;  1H45 A;  2Q88 A;  4MLQ A;  4BDL A;  2ALU A;  1N7W A;  4G68 C;  2DWA A;  4WEP A;  3QSL A;  1B32 A;  3SER A;  3SKP A;  3L6H A;  4ZEI A;  4N13 A;  4JDF A;  3K4U A;  5KZT A;  4GFR A;  1ZIU A;  3JV9 A;  3WAF A;  3S2V A;  4DXC A;  3EQ1 A;  5AA2 A;  1LFG A;  4JSD A;  3B6W A;  4FAJ A;  3TTK A;  1B3E A;  5J1D A;  3MW0 A;  2D5W A;  3SET A;  1B2H A;  3T9H B;  5IAI A;  3ZKK A;  4JB7 A;  5L9M A;  2GHA A;  1MXU A;  5AA3 A;  3PPO A;  4YKK A;  2RIN A;  3IOV A;  2F97 A;  2H5Y A;  1NH7 A;  3O9P A;  3RGY A;  4TLM B;  4R74 A;  2AL5 A;  1S9T A;  1PB7 A;  4BDO A;  1SYI A;  5HPQ A;  5CBR A;  3QK6 A;  3Q27 A;  4H0W A;  2D21 A;  1I6A A;  4MLV A;  2RF1 A;  4QFL A;  3H6V A;  2O7I A;  2NWJ A;  3IO4 A;  4OTE A;  4F2Q A;  1XHY A;  4HS7 A;  1MM7 A;  1VE4 A;  3PUW E;  2ZMB A;  3IOU A;  3SES A;  4RXL A;  4OQO A;  3MWB A;  3SEW A;  2DWH A;  1UQW A;  3OSR A;  3KZG A;  3TTM A;  3ILU B;  3BFT A;  3KN3 A;  1VR5 A;  5M2V A;  3KBR A;  4F3P A;  2FNC A;  4WED A;  4OER A;  3FV2 A;  4O3A A;  4G8M A;  1B3L A;  3N5L A;  4C1U A;  4LP2 B;  3MPL A;  4EQ7 A;  1UTH B;  3ZS6 A;  1O7T A;  2Q9T A;  2HAV A;  3TEL A;  2X7P A;  2RKM A;  1SBP A;  3M3K A;  1MDQ A;  1Y9U A;  2UVI A;  4EQ9 A;  2QSX A;  3W15 C;  5DTB A;  1NKX A;  3LR1 A;  3KJ7 A;  1N84 A;  4KCC A;  4OEN A;  1B3H A;  3C9H A;  2V3T A;  3E4R A;  1PEB A;  4U21 A;  4XXU A;  2HXW A;  2VHA A;  3GZG A;  4DZ1 A;  2ZNU A;  1LB8 A;  5I56 B;  3LSW A;  1FQE A;  3OXN A;  4HW8 A;  3C31 A;  1N76 A;  3SDF A;  2XXR A;  3DP8 A;  4GXA A;  4GQO A;  4RNS A;  2Y84 A;  4JBZ A;  1SW4 A;  3UGW A;  2DOJ A;  4ZEK A;  1B4Z A;  4NWD A;  4P11 A;  2RC7 A;  4I9D A;  3OMB A;  3TQW A;  4G77 A;  1UTH A;  2DQV A;  3OSQ A;  5H8F B;  4POW A;  5I84 A;  2NXO A;  5CI5 A;  3CFZ A;  3SEY A;  3UN6 A;  5AA4 B;  4MFI A;  1OVB A;  3LUY A;  3FJM A;  1ZBM A;  2Q89 A;  2Z8F A;  4YKI A;  1LLS A;  2O69 A;  3U92 A;  3ECR A;  1FQA A;  3MP6 A;  4EXL A;  3CFX A;  4F3S A;  4JWY A;  1LAG E;  2Y7K A;  1A7L A;  5I56 A;  3PUV E;  3VLV A;  1F9B A;  1P1N A;  2XX8 A;  3FVO A;  3V83 A;  1N04 A;  4RK9 A;  2WKY A;  3IJX B;  3T9U A;  1MM6 A;  3B6Q A;  4U23 A;  3O29 A;  5AA1 A;  2I58 A;  3F11 A;  3TMG A;  4BDR A;  1PBP A;  4M4G A;  1B52 A;  4HTG A;  4LAT A;  2PT2 A;  3CSG A;  3OEN A;  3VLW A;  2O7U A;  4RPN A;  5H8F A;  3VVD A;  1JW4 A;  1S7Y A;  3VFJ A;  3MVZ A;  5FHM A;  5DVF A;  3MPK A;  5AA4 A;  3FXU A;  2P1S A;  1SI1 A;  4R72 A;  1WOD A;  4OWD A;  5DEX B;  3H6U A;  4GF8 A;  1B5H A;  2THI A;  4LQ5 A;  1FW0 A;  3KGC A;  3PU5 A;  1B0H A;  5K2Y A;  3TQL A;  3IX1 A;  2F5X A;  3K01 A;  3PD8 A;  2PX1 A;  4F1U A;  4AB6 A;  3SEU A;  4ZS9 A;  3N26 A;  4R9G A;  5I57 B;  1RYO A;  2M8C A;  3JYR A;  3PPN A;  2OJT A;  3HO7 A;  1I69 A;  1ZMG A;  3I3V A;  2I3V A;  4DIG A;  4FJP A;  3TDJ A;  1US5 A;  4H65 A;  4PFY A;  1PDA A;  4KPT A;  1NMU A;  3Q28 A;  4EUO A;  2PT1 A;  3O97 A;  4MBP A;  4RYA A;  3IK6 B;  5DEX A;  4G4P A;  1H76 A;  2XXU A;  1Y20 A;  4ESW A;  1DPE A;  3KFM A;  2O1L A;  1BLF A;  2I0B A;  5I59 B;  1ZTY A;  3MVX A;  5CBS A;  3LSF B;  4OET A;  3HCQ A;  3TTN A;  4XKQ A;  2XXI A;  5ISU A;  2V25 A;  4RK2 A;  1ELJ A;  1USY H;  1MPD A;  4K3F A;  1CE2 A;  4NED A;  2CZL A;  3K6X A;  2NVU B;  2Q2C A;  2OWT A;  3CIJ A;  4F29 A;  5I57 A;  3G3G A;  4ELP A;  2UYE A;  4N07 A;  1QUK A;  4KQP A;  5JK4 A;  3HHF A;  1IZ1 A;  3OO7 A;  4E0W A;  3MC2 A;  5TP9 B;  1TT1 A;  1R9Q A;  3VVE A;  2F6P A;  4LA9 A;  3G3H A;  3JZJ A;  3PV0 E;  5DVI A;  3U94 A;  1MY1 A;  1OIB A;  4BDQ A;  1LAX A;  2H98 A;  1A8F A;  4BDM A;  1XS5 A;  3OEK A;  4QFN A;  1JW1 A;  3PUX E;  3PGF A;  2Z8D A;  3VE1 B;  4IO3 A;  5I59 A;  3RY3 A;  1DOT A;  2B3B A;  1B58 A;  2V3U A;  4RA1 A;  4LZ8 A;  4RJZ A;  2I0C A;  3VLU A;  2Z22 A;  3O28 A;  2XXY A;  1HSL A;  2UVH A;  4H5G A;  2D3I A;  3U72 A;  1SD3 A;  1FQC A;  3VXC A;  3RUM A;  1MXY A;  1JVY A;  1AMF A;  3T9V A;  5TP9 A;  4OFO A;  3RQT A;  3IB0 A;  2REJ A;  4I62 A;  2O6A A;  4KYD A;  2ZXT A;  1H43 A;  1MQD A;  1QUJ A;  3K1M A;  2QS1 A;  2O84 X;  3MUQ A;  1Q1K A;  3TKD A;  1B5J A;  4THI A;  5K2X A;  3K6W A;  4R73 A;  3Q26 A;  1PBQ A;  4KD5 A;  5L8D A;  1MQI A;  1B7H A;  5AA2 D;  1BIY A;  4NF4 A;  4MH5 A;  1MS7 A;  2W7Y A;  2CMO A;  1QUL A;  3PMX A;  1ZKB A;  1N7X A;  1CB6 A;  1MPC A;  2H99 A;  1D3K A;  1FTJ A;  1JEU A;  1B7Z A;  1OLC A;  3I6V A;  4YU0 A;  2KLF A;  1D9V A;  4GXS B;  5TPA B;  4YMA A;  3RTF B;  4PQJ A;  1TWY A;  2E1S A;  4DE8 A;  5CMK A;  1IIW A;  3TZA A;  2IA4 A;  2XX7 A;  4F39 A;  3W9V A;  2GRV A;  3E13 X;  4Z0I A;  1B1H A;  4OFJ A;  1ANF A;  1B40 A;  4X48 A;  3FVG A;  4EDP A;  4GL8 A;  1I6B A;  3WAE A;  4Z7E A;  3QYT A;  5F7V A;  1TFD A;  3EHT A;  3PPQ A;  4F2O A;  1PB9 A;  4P0G A;  2F7C A;  3H7M A;  4ZEC A;  5DT6 A;  3C33 A;  1N0T A;  4OFL A;  4GRK A;  3T93 B;  3RN8 A;  1GGG A;  5TPA A;  1P1U A;  2OCU A;  3KOS A;  3MP8 A;  1XC1 A;  2ZNT A;  3R6U A;  3A3C A;  3H03 A;  2P2A A;  3TTR A;  2AIX A;  1UIU A;  1US4 A;  5KDT B;  1A99 A;  3EF7 A;  5FTI A;  1B46 A;  1B9J A;  4PFU A;  2H25 A;  3SEX A;  3KN7 A;  2E0S A;  2DSF A;  1FCK A;  3DP6 A;  1URD A;  2G29 A;  4GLI A;  4YB6 A;  4Q8R A;  1B51 A;  5B7D A;  2YJP A;  1YPN A;  1EZO A;  2QS2 A;  4DCY A;  4QSE A;  3MAM A;  3KSX A;  2XD3 A;  2FA7 A;  3G7W A;  4I8C A;  4FEC A;  4RY1 A;  2HZK A;  2DWJ A;  3OO6 A;  1LB9 A;  4F1V A;  2F8D A;  4H5F A;  2R6G E;  4U2R A;  4KI0 E;  3VDF A;  1GVC A;  3S9E A;  5H8Q B;  3C35 A;  3PD9 A;  5KDT A;  1ATG A;  2F35 A;  4OZ9 A;  3K2D A;  4ESX A;  1JET A;  4ZE9 A;  3PMW A;  4NF5 B;  4LZ7 A;  3EN3 A;  3VVF A;  5ELV A;  4ELO A;  3B6T A;  3G3F A;  3HN0 A;  4ND9 A;  3QUF A;  3PPP A;  3K1N A;  1UTB B;  1SQY A;  1MXZ A;  2OZZ A;  1LCT A;  2DE2 A;  4R6H A;  4IY6 A;  4KYS A;  1B1X A;  2HZL A;  2ZNS A;  1IEJ A;  4IO4 A;  4IO2 A;  4PE5 B;  5EYF A;  3AXF A;  2OWS A;  2XXP A;  3ILT B;  3TUS A;  3FAT A;  3MP1 A;  3TCG A;  2Q2A A;  4WXJ A;  3ZKL A;  2Y7I A;  1AIV A;  3N6T A;  3EPE A;  3M3F A;  3IB1 A;  1SI0 A;  3KN8 A;  4PFW A;  1XVX A;  4YAH X;  5H8Q A;  1GV8 A;  5ITO A;  1MY3 A;  4G8N A;  3EHU A;  3KSJ A;  2I49 A;  1XVY A;  1MQG A;  4FOR A;  4GL0 A;  4DXU A;  3LSL A;  4FIM A;  1NNT A;  3FXR A;  4NF5 A;  4YIC A;  3Q25 A;  1SW2 A;  4F3B A;  2I48 A;  2ZYM A;  4NMY A;  5I2K A;  1IIT A;  4EF1 A;  3ODB A;  4G68 B;  2V93 A;  3K1P A;  5JTY B;  1VSO A;  4IB2 A;  1UTB A;  3BKI B;  1OMP A;  4C1T A;  4R75 A;  3IAZ A;  2XD2 A;  1POT A;  3E3K A;  4R2F A;  5FHN A;  4C0R A;  4BLA A;  4XKN A;  4KHZ E;  4IGR A;  2UYF A;  1DTG A;  2Z8E A;  1MH4 A;  2X26 A;  2DWI A;  1SVX B;  1M5B A;  4H1X A;  3R7X A;  4M1V A;  3THI A;  1BTJ A;  3O6I A;  1USY E;  2QS3 A;  4LVQ A;  4F22 A;  4F1Y A;  3K6V A;  4TLL B;  3TEP A;  3T22 A;  1II5 A;  3P7I A;  2ZYO A;  4GD5 A;  3H4Z A;  3CVG A;  1EZ9 A;  5CMM A;  4G68 A;  1M5D A;  4YB5 A;  3MQ9 A;  3M3L A;  5JTY A;  3FIR A;  1AOV A;  1L5T A;  3N6U A;  2OLB A;  2HFB A;  1Y3N A;  2HEU A;  3FAS A;  1LCF A;  1P99 A;  4KCD A;  4TQU Q;  2REG A;  2RCA A;  3TCH A;  3KEI A;  4F3G A;  1B3G A;  3H06 B;  1P1W A;  4XKP A;  1LGB C;  2YPN A;  3V5A A;  1R6Z A;  1D4N A;  4U1O A;  4L17 A;  1B0L A;  2YLN A;  1LAH E;  1H44 A;  1Y1M A;  1FTL A;  4PFT A;  2ESN A;  4BDN A;  3E9X A;  4QSD A;  1QVS A;  1EZP A;  2ONK E;  3D4C A;  2DXY A;  3T96 B;  1J1N A;  1Y3Q A;  1DSN A;  3VXB A;  3V8X B;  4FED A;  3MBP A;  2DE3 A;  1WVJ A;  2F7A A;  3S9N C;  1A40 A;  3TTL A;  2H4I A;  3W9W A;  4NF4 B;  4N6P A;  3GBA A;  5KCJ B;  3G3I A;  1RYX A;  4QFK A;  1LFH A;  3RTW B;  4JWX A;  3K02 A;  3FVK A;  5AE4 A;  3I5O A;  3IL1 B;  4X9T A;  1HSE A;  5A5X B;  2VD2 A;  4U1Z A;  3K6U A;  1NL5 A;  3N94 A;  2PVU A;  1Y1Z A;  2ANJ A;  2DVC A;  4FAT A;  1ZLQ A;  2QS4 A;  1IXG A;  1R9L A;  3CRB A;  4FEB A;  2HQ0 A;  1PB8 A;  4OXV A;  4GVO A;  1MXV A;  2DXR A;  5I2N B;  3PUZ E;  2PYY A;  3O6G A;  1URS A;  3IJO B;  2O68 A;  4G8H A;  4R6Y A;  3SEV A;  1QKB A;  5LOM A;  4KR5 A;  4R2B A;  5H8N A;  3G3J A;  2A5T B;  1POY 1;  3UK4 A;  1LBB A;  1GR2 A;  4QHQ A;  3Q29 A;  3T9X B;  1KWH A;  3KG2 A;  4UA8 A;  3MVY A;  2VP1 A;  5KCJ A;  1M5F A;  1MY2 A;  2PMS A;  3D4G A;  4NE4 A;  2UXA A;  2O1M A;  2QRY A;  4X1B A;  4OES A;  5A5X A;  2FYI A;  1NNK A;  2DP8 A;  3RT6 B;  5L9S A;  2HCA A;  1YTV A;  3IB2 A;  3RT8 A;  4IY5 A;  3S9L C;  3A09 A;  1IQ7 A;  4QRZ A;  3M8U A;  1LFI A;  4DCX A;  3UA8 A;  1NNF A;  3UOR A;  1B5I A;  3GLB A;  3FGS A;  4DDD A;  5I2N A;  3RPW A;  2F34 A;  4OYV A;  1BKA A;  3QUJ A;  5HBC A;  1XT8 A;  4AQ4 A;  2LAO A;  1RKM A;  3B7D A;  2A5T A;  2QMX A;  4YKP A;  4OVJ A;  3MJN A;  4U22 A;  4LZ5 A;  1MDP 1;  2I4C A;  2UVJ A;  4PET A;  3DEL B;  2OBG A;  4ECF A;  5HM4 B;  1FTM A;  2B65 A;  1H3D A;  1HSJ A;  1EU8 A;  3FVN A;  5BUU A;  2ABH A;  2V3Q A;  3H3G A;  3CFL A;  1MXX A;  1UIV A;  1QUI A;  4ZE8 A;  1R1N A;  5IKB A;  2QPQ A;  3HST A;  2ONS A;  3ZSF A;  1OQH A;  4EF2 A;  4UAC A;  1Y4T A;  4ZZA A;  3V89 B;  2AL4 A;  2Y7R A;  3IO6 A;  4JXI A;  4OEU A;  4GIZ A;  1FTO A;  4EQB A;  3FJ7 A;  1JW5 A;  3TYH A;  3DLN A;  1IXC A;  3TPA A;  3MZ9 A;  3KJT A;  3TCF A;  3FD3 A;  3C34 A;  2I3W A;  4P0I A;  3H6W A;  1AL3 A;  4GOT A;  3TFL A;  3U1O A;  5CM6 A;  5I58 B;  4X1D A;  3CG1 A;  2XX9 A;  3LBS A;  3UP9 A;  4O3B A;  4H8I A;  5L9O A;  3BBR A;  3MVW A;  1ZU0 A;  3OEL A;  2ZYK A;  4ELQ A;  3K00 A;  1Q35 A;  3EHS A;  3PUY E;  4ZED A;  1YCJ A;  2QJE A;  5CC2 A;  3IOW A;  2A5S A;  1FQB A;  1FQF A;  1AH5 A;  1OLA A;  4F31 B;  2XXW A;  4ZEF A;  5FTH A;  1T0K A;  4AB5 A;  1MXW A;  1MQJ A;  4OHN A;  4JWO A;  5H8H B;  4F19 A;  3HHG A;  4POX A;  3OO9 A;  1Z7M E;  3U93 A;  3OEM A;  4YB7 A;  2DVZ A;  2XXV A;  4MF3 A;  3QXM A;  5I2K B;  5I58 A;  1O63 A;  4R9F A;  3C36 A;  4H6D A;  2G93 A;  3ONM A;  2F36 A;  3IOR A;  2QL3 A;  4ONY A;  1S50 A;  5CMB A;  4EXK A;  1DMB A;  1SYH A;  4QFP A;  2NUV A;  4ZEB A;  1P1Q A;  3DM0 A;  1Y3P A;  1MQH A;  3MZ1 A;  3OO8 A;  1ZJL A;  4IGT A;  4OMB A;  3TAJ A;  2H9B A;  2Q8J A;  2P0S A;  1A8E A;  4FE8 A;  4O3C A;  1MPB A;  5DVJ A;  4ZDM A;  5B70 A;  3DP4 A;  1GTK A;  3G3K A;  5H8H A;  1QJM A;  1WDN A;  2DE4 A;  5FHO A;  4WKM A;  2GFE A;  4OEV A;  5EHM A;  3OOA A;  2QMW A;  4QSC A;  2B3F A;  1VFD A;  3FUZ A;  1EH3 A;  4NF8 B;  1B7U A;  1P1O A;  5ICQ A;  4DXB A;  2I4B A;  1TFA A;  3IR1 A;  3RLF E;  1D9Y A;  1N3W A;  4I1D A;  4PP0 A;  5ITP A;  2HAU A;  2RC8 A;  4HCY A;  4QF9 A;  2Y7P A;  2I6E A;  3C4M A;  4LON B;  1LST A;  4RPO A;  3RNN A;  1MY0 A;  3GBB A;  4R6K A;  4F18 A;  1MRP A;  2XHD A;  3U8Q A;  1Y4C A;  4Q30 B;  3LC8 A;  3R26 A;  1NFT A;  2AYS A;  4XIG Q;  3USD A;  3C32 A;  3FZV A;  1IUD A;  3CR9 A;  4KYE A;  3T66 A;  1QW0 A;  2RC9 A;  4DLD A;  4HCW A;  2VD3 A;  4H8J A;  2X7Q A;  5JEI A;  1MY4 A;  3LSX A;  3FV1 A;  4NF8 A;  4YMB A;  4NTL A;  1MG1 A;  2F78 A;  4IO5 A;  5H8S A;  5CRY A;  1VFE A;  3O2A A;  4G2Z A;  2RCB A;  2PBW A;  3KOT A;  5F1Q A;  1MH3 A;  3QIM A;  5ICT A;  1PC3 A;  2ONR A;  1Z7N E;  1URG A;  4IO6 A;  1SW1 A;  1SW5 A;  3IOT A;  3HV1 A;  4KFQ A;  4NF6 B;  2OK2 A;  4U4S A;  1DTZ A;  2DYX A;  4GWO A;  3CI8 A;  1IXH A;  5DYH A;  1LAF E;  1B05 A;  3UIF A;  1M5E A;  2NOO A;  4Q5T A;  2VGQ A;  4JSO A;  4QFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...