4PQOA

Structure of the human snx14 px domain in space group i41
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
125
structure length
105
Chain Sequence
LAAWKISIPYVDFFEDIPVFCIDVERPEHWSVYRRYLEFYVLESKLTEFHGAFPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQKLLQHPELSNSQLLADFLSPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sorting nexin-14
publication title Structural Basis for Different Phosphoinositide Specificities of the PX Domains of Sorting Nexins Regulating G-protein Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 23
structure length 105
sequence length 125
ec nomenclature
pdb deposition date 2014-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 4pqoA00
4P2JA 2DYBA 2WWEA 4HASA 2IWLX 1KQ6A 3HPBA 2RAJA 3DYTA 2ETTA 3LUIA 2RAKA 4OXWA 1GD5A 4ON3A 2V6VA 2CSKA 2YPSA 1O7KA 2I4KA 1OCUA 2V14A 3IQ2A 3HPCX 3P0CA 1H6HA 4IKDA 2AR5A 2REDA 4PQPA 4PZGA 1XTNA 2CZOA 4PQOA 2REAA 4IKBA 4BGJA 1OCSA 1XTEA 3FOGA 1KMDA 4P2IA 4AZ9A 2L73A 2RAIA 4AKVA 4IKBB
chains in the Genus database with same CATH superfamily
4P2JA 2DYBA 2WWEA 4HASA 2IWLX 1KQ6A 3HPBA 2RAJA 3DYTA 2ETTA 3LUIA 2RAKA 4OXWA 1GD5A 4ON3A 2V6VA 2CSKA 2YPSA 1O7KA 2I4KA 1OCUA 2V14A 3IQ2A 3HPCX 3P0CA 1H6HA 4IKDA 2AR5A 2REDA 4PQPA 4PZGA 1XTNA 2CZOA 4PQOA 2REAA 4IKBA 4BGJA 1OCSA 1XTEA 3FOGA 1KMDA 4P2IA 4AZ9A 2L73A 2RAIA 4AKVA 4IKBB
chains in the Genus database with same CATH topology
4P2JA 2DYBA 2WWEA 4HASA 2IWLX 1KQ6A 3HPBA 2RAJA 3DYTA 2ETTA 3LUIA 2RAKA 4OXWA 1GD5A 4ON3A 2V6VA 2CSKA 2YPSA 1O7KA 2I4KA 1OCUA 2V14A 3IQ2A 3HPCX 3P0CA 1H6HA 4IKDA 2AR5A 2REDA 4PQPA 4PZGA 1XTNA 2CZOA 4PQOA 2REAA 4IKBA 4BGJA 1OCSA 1XTEA 3FOGA 1KMDA 4P2IA 4AZ9A 2L73A 2RAIA 4AKVA 4IKBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P2J A;  2DYB A;  2WWE A;  4HAS A;  2IWL X;  1KQ6 A;  3HPB A;  2RAJ A;  3DYT A;  2ETT A;  3LUI A;  2RAK A;  4OXW A;  1GD5 A;  4ON3 A;  2V6V A;  2CSK A;  2YPS A;  1O7K A;  2I4K A;  1OCU A;  2V14 A;  3IQ2 A;  3HPC X;  3P0C A;  1H6H A;  4IKD A;  2AR5 A;  2RED A;  4PQP A;  4PZG A;  1XTN A;  2CZO A;  4PQO A;  2REA A;  4IKB A;  4BGJ A;  1OCS A;  1XTE A;  3FOG A;  1KMD A;  4P2I A;  4AZ9 A;  2L73 A;  2RAI A;  4AKV A;  4IKB B; 
#chains in the Genus database with same CATH topology
 4P2J A;  2DYB A;  2WWE A;  4HAS A;  2IWL X;  1KQ6 A;  3HPB A;  2RAJ A;  3DYT A;  2ETT A;  3LUI A;  2RAK A;  4OXW A;  1GD5 A;  4ON3 A;  2V6V A;  2CSK A;  2YPS A;  1O7K A;  2I4K A;  1OCU A;  2V14 A;  3IQ2 A;  3HPC X;  3P0C A;  1H6H A;  4IKD A;  2AR5 A;  2RED A;  4PQP A;  4PZG A;  1XTN A;  2CZO A;  4PQO A;  2REA A;  4IKB A;  4BGJ A;  1OCS A;  1XTE A;  3FOG A;  1KMD A;  4P2I A;  4AZ9 A;  2L73 A;  2RAI A;  4AKV A;  4IKB B; 
#chains in the Genus database with same CATH homology
 4P2J A;  2DYB A;  2WWE A;  4HAS A;  2IWL X;  1KQ6 A;  3HPB A;  2RAJ A;  3DYT A;  2ETT A;  3LUI A;  2RAK A;  4OXW A;  1GD5 A;  4ON3 A;  2V6V A;  2CSK A;  2YPS A;  1O7K A;  2I4K A;  1OCU A;  2V14 A;  3IQ2 A;  3HPC X;  3P0C A;  1H6H A;  4IKD A;  2AR5 A;  2RED A;  4PQP A;  4PZG A;  1XTN A;  2CZO A;  4PQO A;  2REA A;  4IKB A;  4BGJ A;  1OCS A;  1XTE A;  3FOG A;  1KMD A;  4P2I A;  4AZ9 A;  2L73 A;  2RAI A;  4AKV A;  4IKB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...