4PQPA

Crystal structure of human snx14 px domain in space group p43212
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
102
Chain Sequence
AAWKISIPYVDFFEIPVFCIDVEPEHWSVYRRYLEFYVLESKLTEFHGAFPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQKLLQHPELSNSQLLADFLSPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sorting nexin-14
publication title Structural Basis for Different Phosphoinositide Specificities of the PX Domains of Sorting Nexins Regulating G-protein Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 29
structure length 102
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 4pqpA00
3FOGA 2WWEA 2REDA 4PQOA 4P2IA 2V6VA 3LUIA 2CSKA 4AKVA 2I4KA 1GD5A 1XTNA 2RAKA 4AZ9A 3DYTA 1OCUA 2L73A 4PQPA 4IKBA 1OCSA 4ON3A 4PZGA 1KQ6A 4OXWA 3P0CA 2CZOA 2RAIA 1H6HA 2REAA 2YPSA 3IQ2A 2AR5A 2ETTA 3HPBA 4IKDA 3HPCX 2IWLX 1XTEA 4BGJA 4P2JA 2DYBA 1KMDA 2RAJA 2V14A 4IKBB 1O7KA 4HASA
chains in the Genus database with same CATH superfamily
3FOGA 2WWEA 2REDA 4PQOA 4P2IA 2V6VA 3LUIA 2CSKA 4AKVA 2I4KA 1GD5A 1XTNA 2RAKA 4AZ9A 3DYTA 1OCUA 2L73A 4PQPA 4IKBA 1OCSA 4ON3A 4PZGA 1KQ6A 4OXWA 3P0CA 2CZOA 2RAIA 1H6HA 2REAA 2YPSA 3IQ2A 2AR5A 2ETTA 3HPBA 4IKDA 3HPCX 2IWLX 1XTEA 4BGJA 4P2JA 2DYBA 1KMDA 2RAJA 2V14A 4IKBB 1O7KA 4HASA
chains in the Genus database with same CATH topology
3FOGA 2WWEA 2REDA 4PQOA 4P2IA 2V6VA 3LUIA 2CSKA 4AKVA 2I4KA 1GD5A 1XTNA 2RAKA 4AZ9A 3DYTA 1OCUA 2L73A 4PQPA 4IKBA 1OCSA 4ON3A 4PZGA 1KQ6A 4OXWA 3P0CA 2CZOA 2RAIA 1H6HA 2REAA 2YPSA 3IQ2A 2AR5A 2ETTA 3HPBA 4IKDA 3HPCX 2IWLX 1XTEA 4BGJA 4P2JA 2DYBA 1KMDA 2RAJA 2V14A 4IKBB 1O7KA 4HASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FOG A;  2WWE A;  2RED A;  4PQO A;  4P2I A;  2V6V A;  3LUI A;  2CSK A;  4AKV A;  2I4K A;  1GD5 A;  1XTN A;  2RAK A;  4AZ9 A;  3DYT A;  1OCU A;  2L73 A;  4PQP A;  4IKB A;  1OCS A;  4ON3 A;  4PZG A;  1KQ6 A;  4OXW A;  3P0C A;  2CZO A;  2RAI A;  1H6H A;  2REA A;  2YPS A;  3IQ2 A;  2AR5 A;  2ETT A;  3HPB A;  4IKD A;  3HPC X;  2IWL X;  1XTE A;  4BGJ A;  4P2J A;  2DYB A;  1KMD A;  2RAJ A;  2V14 A;  4IKB B;  1O7K A;  4HAS A; 
#chains in the Genus database with same CATH topology
 3FOG A;  2WWE A;  2RED A;  4PQO A;  4P2I A;  2V6V A;  3LUI A;  2CSK A;  4AKV A;  2I4K A;  1GD5 A;  1XTN A;  2RAK A;  4AZ9 A;  3DYT A;  1OCU A;  2L73 A;  4PQP A;  4IKB A;  1OCS A;  4ON3 A;  4PZG A;  1KQ6 A;  4OXW A;  3P0C A;  2CZO A;  2RAI A;  1H6H A;  2REA A;  2YPS A;  3IQ2 A;  2AR5 A;  2ETT A;  3HPB A;  4IKD A;  3HPC X;  2IWL X;  1XTE A;  4BGJ A;  4P2J A;  2DYB A;  1KMD A;  2RAJ A;  2V14 A;  4IKB B;  1O7K A;  4HAS A; 
#chains in the Genus database with same CATH homology
 3FOG A;  2WWE A;  2RED A;  4PQO A;  4P2I A;  2V6V A;  3LUI A;  2CSK A;  4AKV A;  2I4K A;  1GD5 A;  1XTN A;  2RAK A;  4AZ9 A;  3DYT A;  1OCU A;  2L73 A;  4PQP A;  4IKB A;  1OCS A;  4ON3 A;  4PZG A;  1KQ6 A;  4OXW A;  3P0C A;  2CZO A;  2RAI A;  1H6H A;  2REA A;  2YPS A;  3IQ2 A;  2AR5 A;  2ETT A;  3HPB A;  4IKD A;  3HPC X;  2IWL X;  1XTE A;  4BGJ A;  4P2J A;  2DYB A;  1KMD A;  2RAJ A;  2V14 A;  4IKB B;  1O7K A;  4HAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...