4PQRA

Mycobacterium tuberculosis reca glycerol bound low temperature structure iib-bn
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
326
structure length
309
Chain Sequence
PDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 95
structure length 309
sequence length 326
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4pqrA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4pqrA01
3TE6A 4PC2A 1VIAA 4XSHA 2VF8A 1PZNA 2WJGA 4IDNA 1SVMA 3HYRA 3T61A 3VU9B 2OUKA 4DWJA 2C9OA 1LVGA 2HLDD 2XJ9A 3U3OA 5AJYA 2AX4A 3GLIB 3CR7A 2V3CC 1E2DA 4ACAA 4G5QA 3FHOA 3OHMA 5KPDA 1NBMA 1UFQA 2BCGY 2AR7A 3ZDQA 1KDPA 1EG7A 1SGWA 3ZGXA 3AVWA 3FFAA 2VO1A 2F6RA 4DSUA 3NDBB 1R8SA 1GWNA 4HAZA 1QG4A 2R65A 3JZMA 1XTQA 1M6NA 2O52A 1XXHB 4Q1AA 3U4QA 3THYB 3U5ZB 1U99A 2OZEA 3FMOB 2OT3B 5FUVA 2YOGA 5CB8A 2E9SA 2J7KA 2GXAA 2NO0A 4A8JB 1Q1QA 2XSZD 2D06A 4M1SA 2OBMA 2MSEB 4Z54A 2XZOA 2BEKA 2CVFA 5KSPA 4O25A 3SYLA 2GEDA 1E0JA 4PANA 2CCJA 4KYIB 5KSZA 5KO2A 3K70C 2WJVA 4PPQA 1KI2A 4NONA 4MQBA 2BC9A 3KFXA 3PJRA 1GVNB 1JR3A 1Q12A 2B6HA 2WIBA 3NH6A 1GM5A 1BOFA 2BMFA 4GNKA 1N6NA 4YXWD 3MD0A 1T8UA 1N6HA 1YZKA 3BRWD 1NP6A 4Q01A 4Q4JA 4WZ6A 1NMYA 1XTRA 2NZJA 1Q22A 3RHFA 3AP1A 3I92A 1AIPA 1XU4A 1RRPA 5SZIA 5LB4A 1LNZA 1OXVA 4A2QA 3AVYA 5FL7A 3W6OA 3U4QB 2WWWA 3QXSA 3RS5A 1GKIA 3GJ8A 2ZI5A 2ZI9A 1ETUA 1KGDA 6Q21A 1IXSB 4G5GA 5JHGB 1W36D 2HF9A 2P5TB 3AKDA 5FBRB 1KO4A 1T5IA 2H5EA 5HCNA 1UKZA 3L0IB 4LJ5A 1AN0A 1X8LA 3A36A 1UKVY 1OH7A 1QHGA 2IYZA 3T34A 4A8JC 2PEZA 2YWFA 1JB1A 1KI9A 3NH9A 2OLKA 1P75A 4TL9A 3CRRA 1W49A 4WA7A 3RRZA 4ZCLA 4BLTA 4TL6A 4B47A 3NWJA 2AKYA 3HP1A 1KDRA 2GRJA 1OT3A 3DZ8A 3WXMA 1QDEA 1ZC3A 1X8KA 2IYUA 3FTQA 3AVTA 1IOZA 2WHXA 4Q4JB 3C4JA 4NH0A 5A0FA 3N70A 4OI1A 3CO5A 2ZJOA 2LKDA 4DB2A 3EPLA 2PZEA 2PT5A 4PO1A 2ZPTX 3BB3A 1G3QA 5TB5A 4PPFA 5KYKA 2ZE6A 1U2RA 2KJQA 1E96A 4NBSA 2F3TA 1UBCA 4X8MA 5CB6A 2Z83A 4TWZA 1ZUIA 4NYMR 1E2HA 4B6EA 1YR8A 3AP3A 5TY0A 3IEVA 3EC1A 3L43A 4NTZA 1L7VC 5E95A 3U3JA 4L9WA 1AGPA 4GMDA 4MYTA 5F9HA 1ODFA 3UG6A 1TQDA 4Q02A 1W4RA 2FSHA 2C04A 1N5JA 4PC7A 1F2TB 2YHSA 1YKSA 5KNBA 1G18A 2HCJB 3OIUA 4W5HA 3AVPA 2NO9A 2BIFA 1RJ9B 4TMTA 5KU1A 1NJFA 1N0UA 4A4DA 4F4JA 2YWGA 1E69A 2J0SA 2AFHE 2F43A 3FE2A 2JJ8A 4OK6A 3U3MA 3U61B 3OIVA 4C4PA 3KKNA 2IL1A 5FR1A 2QGZA 4MITA 1VDZA 4EUNA 2OV2A 2Q6TA 3GPLA 1OFUX 4V02A 3CUEF 3KTAB 2V6IA 3EA5A 1KNQA 3M0EA 3K9LA 4EDHA 1E1QD 1N25A 1CJMA 1OHHD 4LI0A 2VSFA 4DCTA 1PLKA 1RFLA 4HSEA 5F2EA 4E5UA 4JBYA 4AC9A 1A82A 1DS6A 5AWFC 1VCNA 1PJRA 1T4GA 2QP9X 4TN1A 4RZ2A 1JEDA 3K0CA 4HDCA 2QA5A 3Q7QA 3QOFA 2LKCA 2OBNA 4GBMA 4XVRA 2AL7A 3B1ZA 1C9KA 1XD8A 3N2EA 5ANRB 5BN5A 3OE7A 1E2KA 3GLHE 4LHXA 1D2MA 5J4VA 1GAJA 1OFHA 1W2GA 3QY0A 1AA3A 1ZU4A 4LJ7A 4BEJA 3SE0A 3U7EB 1JPJA 1IN6A 4U5XA 4LOAA 2J9RA 1KI1A 1P4SA 3AKYA 1EFUA 2WMNB 3CM0A 3RC3A 1J90A 3TAHA 4BPBA 5LD2B 2QE7D 1GSIA 1HH4A 5K8UA 1Z08A 1Y3AA 4Q7JB 3PCRB 1KJZA 2YVUA 4TQUS 4AK9A 2AWNA 3LVRE 3NKVA 2GZHA 1XEFA 3CRW1 4Q7LA 3UMSA 2FGJA 2WJYA 2JLXA 2QAGB 5JS8A 4BE7B 1XPRA 2QMUA 1FL9A 4ESVA 1PLJA 5EP3A 1DAKA 1S4QA 1U81A 1IHUA 1Q20A 1FUUA 1DPFA 4BFSA 1ZMXA 3ETLA 4LBYA 2OM2A 4HB4A 4IEIA 4PQRA 3O8BA 1TF2A 3ADKA 4IXNA 2BBSA 2NO1A 4EKDA 3QSYA 3S1AA 1Z0FA 2ZU6A 2ZAOA 1GG2A 4FXPA 1J99A 3R9WA 1F2UA 5EZ6B 4PR0A 1X6VA 3DL0A 5KSOA 4JBWA 3CLVA 4HDQB 5CYPA 5DLQC 2RHDA 5DN6A 3WYAA 2P6UA 1MO5A 2GILA 4JJKA 4WXPA 3EC2A 1ZCAA 5FTLA 4DUGA 2FDCA 2QPOA 5FR2A 4ZCMA 2J1LA 4O2LA 5DNYB 3N2IA 2ZE8A 3NIBA 2QEQA 4C0SA 3T1OA 1UEIA 4B35A 2EYUA 3KXKA 1H8HD 3SN6A 4NCIA 4B3CA 2QRNA 3R7WA 4B32A 3WP1B 3CZQA 4RKFA 4K46A 2I1QA 2BWJA 3IUYA 121PA 1T3SA 2AD1A 2C95A 4V03A 3S1AB 4RFSA 1VG8A 3K0CC 1F2UB 4JVSB 2C96A 1W0KD 5H68A 1NSTA 3WMEA 1II8A 3EWSA 1I4DD 5A5GA 4Q9HA 2H18A 2C5LA 2VPPA 5G53C 4DSNA 3CKLA 5FOXA 1ZNYA 3TIFA 1TQ6A 3RLFA 4PPGA 1U98A 3M1IA 3X1WA 2ZUDA 1JNYA 1LS1A 3AP2A 4UJ5A 1Z0AA 5CIQA 2FFHA 5HCIA 4MYUA 4V0MA 3BD9A 3IDQA 5EXTA 1UKEA 3V4FA 2O0JA 2ZRFA 5CDFE 4XWAA 5CYOA 2OILA 4O3MA 4TTRA 1FPMA 1W0JA 4B3BA 1KMHA 4DIDA 4LV6A 1BMFA 2UVQA 1VG0B 2PLRA 1E2IA 2V4ZA 3R7WB 4PC1A 1NLZA 4JL5A 1EX7A 3JZAA 3B1YA 3NXSA 2VP4A 2A7QA 4L4UA 4ZDIA 4MRNA 3W6NA 1FMLA 1SKQA 2AD5A 4LBZA 2ZEJA 4OHWA 1ZNZA 2CLDX 2CXXA 3A58B 3VKWA 4JL6A 4LUCA 3RWOA 2IA5A 1II8B 1P2SA 3VTKA 5CK5A 4JZKA 5BXQC 3TSZA 2C98A 4DXAA 3ZVMA 2GCPA 1VG1A 2P5SA 2G0NA 1Q44A 1OFTA 2IW3A 5EP4A 4RJLA 5BQ5A 2QN6A 1NL3A 4C0KA 2V55B 3MSXA 1IJEA 2ASEA 1W36B 2WIAA 3T5DA 4UKDA 2J87A 4PC3A 1OH5A 1XWIA 3LO5A 2YINC 4M2LA 4OJQA 4Q19A 1Z0JA 4LBWA 5L3RA 2QTHA 2ZSDA 1BKDR 1P3JA 3LX5A 3SOPA 3U2QA 3CNOA 4C0HA 1WB9A 4M9ZA 4GT1A 2CHVA 2IS1A 4POAA 2J7PD 4MRVA 1WXQA 2CEAA 4BRUA 4TTQA 2REXB 2B92A 3MMPA 3RRNA 3H1TA 2VL7A 1TX4B 5AUOB 4RD1A 4G5SA 4X8OA 1II0A 5K8LA 3K0EA 5D3MA 1DAMA 5CM9C 4AY2A 4HI0E 5EP1A 4TYPA 3AGQA 3TMKA 2GA8A 5GADl 3G0HA 4D4LA 3FOZA 3P32A 1GTVA 2JA1A 4QFMA 1MO3A 4EIWA 5HKKA 2IS6A 2G77B 2GXUA 4EPYA 3ONWA 4B76A 2FN4A 1W4CA 2C9YA 2A5FA 1R0YA 1GRRA 2CNWD 2WKQA 2H1LA 2VP2A 2Z4SA 3OAAA 3F0TA 2GAAA 2EYQA 1LF0A 1OLOA 2BBOA 2ZJAA 4JVLA 4NCJA 4PO9A 4MGYR 1TMKA 2QRZA 2GTPA 1MR3F 5C1BA 1N6OA 2PZGA 4B3DA 2ZITA 2ATVA 4C0QC 4C0AC 1KSHA 2WSSA 3AKCA 3CH4B 3EZ6A 3KL4A 4R98A 5EXSA 3UANA 2EFHB 2FV8A 1O3YA 5DISB 3A1WA 1ZIOA 3VX3A 5D3MB 1NNEA 1NKSA 2RMKA 2R2AA 4K8OA 4B34A 1KNXA 5HPYB 3BH7A 4R9UC 3CW2A 5E7JA 1KJWA 3LX8A 5C4MA 1W5SA 4O0MA 2D74A 1E9FA 4XD7D 1JBKA 4GP6A 4TYYA 4FCTA 3WRXC 1P2TA 1IN5A 4LC0A 4NYJR 3U44B 2FOLA 1W1WA 2OSBA 2RGDA 4LHWA 1R7RA 3FB4A 3LFUA 1IY0A 3VR3A 2WMOB 1E0AA 5CLLA 5FBQB 3F8TA 4JLPA 5JWOA 3VR2A 4E03A 3EWAA 1M2OB 2HEIA 4JLVA 2EWVA 5FUYA 5AUQA 4TZ6A 1GRNA 2IXFA 1XZQA 4MRPA 5FOUA 1XMIA 1UKYA 3C5HA 1ZC4A 3CRQA 5HZHA 3CWZA 3QUSA 1Z8FA 2EW1A 1G3IA 1OKKD 2WKRA 4IKEA 2IBMA 4NPHA 1N5LA 2JEOA 2GF9A 4QNMA 4B2LA 4GL2A 4ZDWA 4OHZA 4MYHA 2VHCA 1M74A 4EJSA 3OF5A 1XCPA 1PV4A 1G3RA 1BIFA 3LLMA 2CJWA 3RSOA 4EPRA 2ZUBA 1FX0A 1ESMA 1Z6XA 3MJRA 2G1KA 4WXRA 1L8QA 2VTKA 3RRMA 5AUNB 3UWKA 3GLIE 3W8NA 4D82A 2ZRBA 5KTYA 1WE2A 3AH8A 5E7MA 4MA4A 3PUWA 4C30A 2XOKA 4QJ5A 3TQFA 3O8CA 3GEEA 2NGRA 2A3RA 3DMNA 3QKUA 3GFPA 2QROA 1LFDB 2ODNA 2ZRDA 4BLSA 2VRWA 3TBKA 3ND9A 1XXHE 5DHAA 4D80A 5IK2A 1T6NA 2O0KA 5FTJA 3ZVLA 3OEED 3VR6A 4TLBA 4JYBA 1G8FA 3L8ZA 5E4FA 1V5WA 1Q21A 1YVDA 2FZ4A 2JJ2A 2R8RA 4KFTA 4LJ9A 1UPTA 4OQLA 4HZUA 1G291 1ZM2A 3VQTA 3DO6A 2F7SA 5J40A 1AJEA 3KUDA 4BFXA 2FJUA 3R20A 4A15A 1ZP6A 3W5JA 1E2EA 2R9VA 1J8MF 1UDWA 4RD4A 2YV5A 1DOAA 2CJWB 1HEIA 4GDFA 1YE8A 1XTIA 5E7IA 2ZSFA 1NY5A 4KCGA 5SZHB 1GDDA 3LDAA 4AKEA 1XBTA 2XNSA 2JLRA 2RGCA 5EUMA 3R8CA 3O47A 5FTKA 3GEHA 5EXXA 2V7QA 5FPTA 2GZAA 1AZSC 2ZRGA 2W6ID 4QGFA 3GP8A 1TTTA 3VR4A 4S2EA 3BOSA 3KZ1E 2FWRA 3I8XA 1WBDA 2AKAB 2XNDD 1S9DA 1ZUHA 1NMZA 1H65A 1XMJA 4RZ3A 3RS3A 2X2FA 1COWA 1DEKA 3CRMA 2FG5A 4N1AA 1E1RA 2EFEB 3VAAA 4Q9KA 1KAOA 4P4SA 3HYTA 4HZUB 1RKBA 4U02A 2PH1A 4HLDA 2A78A 2PJZA 5TXGA 4P4UA 5AJWA 2XGJA 2ZRPA 4LHVA 2ANCA 1P6XA 3K9NA 4NZYA 1R0ZA 2XEXA 5HTKA 4AURA 3KDSE 4CRWB 4PQFA 2ZYTX 3PG5A 4Z1MD 4X8LA 1KI4A 4CF7A 3AF0A 2Z5FA 4A2PA 2QU8A 4EJSC 1Z83A 3PXGA 2N46A 2J0QA 2Z6VA 1F6BA 4JVMA 1YZUA 3K1JA 3IBGA 3NDPA 4NYIQ 5BN4A 1NKTA 3DMDA 1NIPA 5HR5A 2RHMA 1E79D 1VYUA 1OXSC 2JIZA 1MRSA 4NL4H 3BFKA 2RCNA 1SQ5A 4YQFA 521PA 1MKYA 1W4AA 4XJXA 3C5CA 4TMZA 3LBHA 4M1OA 1OSNA 2HJGA 2WOOA 3WBJA 3J81k 3ZQ6A 1L4YA 4EFLA 3VU9A 4W5WA 4IFBA 1D2EA 4P4SB 1KI6B 1VECA 1B0UA 2D62A 4XOIA 1XF9A 4TT3D 3AGPA 4BLPA 5C2JB 1I2MA 4IRUB 1MO6A 1E2NA 2C99A 1Z5ZA 1U8YA 3C41J 1YZQA 2PZFA 4HB3A 3P27A 3T12A 5HE8A 5G41A 1OYYA 1I2DA 4URXR 4QNRA 1GNRA 1MRNA 5CITA 2QT0A 2L0XA 2HV8A 1G4AE 1NJGA 2B8TA 2ZSEA 3R9IA 3THYA 3VX4A 2IXGA 4I4LA 2GWHA 3IKJA 2ZUCA 4LHZA 2VF7A 2FU5C 1J70A 3MUFA 1CR1A 4P3YA 1N0WA 1OH8A 2ZI6A 4FWTA 1G19A 2O0HA 4F7WA 5JJIA 4LJYA 3I32A 1MO4A 3LQRA 3B8HA 2WICA 1A2KC 1KY2A 2WBLC 4Z8YA 1RRFA 1JEEA 1DARA 1QZXA 4ZI2A 1Q1EA 4PSAA 1ZYUA 3LWNA 3I3SR 1G3MA 3OEHA 2ZRIA 4YMSA 2WOJA 2G88A 1IAQA 3NBFA 4Q9LA 3D8BA 4HAUA 3NHAA 2MSCB 4XTRA 1D2NA 3DDCA 2CDNA 3B13B 3K09C 4WVFA 1KYIA 2HYIC 3GJ4A 3U60B 3VKGA 2ERYA 1TPZA 1SVWA 3ZZTA 3ADDA 4MUAA 1W47A 3AF3A 2R44A 5KDOA 4V0OA 4MKHA 3U6BA 4OQFA 2BCJQ 4A36A 4RKEA 1ZM7A 1D8TA 3CF0A 3GJ3A 5GVSA 3WYFA 2W00A 2DFKB 1UEJA 4B3GA 4Q4AA 4S35A 2HT1A 1R0WA 5GVRA 3QKTA 3PITA 3QXHA 1WBBA 2D4HA 5DI9A 1FQJA 4C0BA 1ZU5A 3RWMB 4E22A 4CDGA 4N0EA 1K8RA 2ZRLA 1IONA 4F38A 3QIAA 1II9A 1XMVA 2NOAA 4BFWA 5KPJA 4LJ8A 1NN0A 4QM6A 1JR6A 1DAFA 2FEOA 2VLIA 5CK4A 2NPFA 3RVBA 2W0SA 5EJEA 1OXTA 1WDTA 2GJ9A 3B6EA 3IGFA 4KHZA 4OHVA 2ONJA 3TW4A 3X2SA 3THWB 1M34E 1IQPA 3B82A 1XX6A 1RW4A 4TSFA 4IJMA 2E87A 2W6JD 4TMKA 4G3XA 2G83A 1NSFA 4HLQB 4LSGA 1NVVQ 2N1BA 5JECA 2ZVQX 1XB2A 2ZU0C 3OFNA 1KKMA 1U9IC 2A5JA 4IOKA 4M0LA 4B44A 5H8WA 4Q4AB 3RABA 1R2QA 1N6IA 4Q4HA 2OXRA 1I4LD 3NVAA 4XVUA 1YHNA 2JJ1A 1NVUQ 5J4LA 5K8TA 2JLQA 1CR0A 4I81A 4RFVA 3EPJA 2Q3FA 3FKSD 3HU2A 1NG1A 4OK5A 1GKYA 1F2TA 4OYHA 2ZYUX 3VHXA 1E9DA 5IDVA 4DT1B 2VSXA 3O8RA 1DG3A 1RJ9A 2WPDD 2RH5A 4LV5B 1E0KA 2C77A 3A37A 2QM7A 4KO8A 3K9GA 1NVWQ 1G41A 2YC4C 2ATXA 3A8TA 4V0LA 4FMDB 4PHHA 2Q9CA 4JLJA 2X2EA 3LNCA 2J0VA 2IS2A 1E9SA 4LYFA 4RCZA 1OW3B 4X8HA 4B71A 3BWDD 4YDHB 4Q48A 3KTAA 4HUTA 2CCGA 3W34A 1P62B 2A9KA 1XMSA 1ANKA 1RC8A 4MDFA 5DHFA 5IT5A 5DH9A 3KKQA 1KK1A 4BZPA 4Q4HB 3AF1A 3IHLA 4HUQB 4BZXA 1RPZA 3P4YA 3O8DA 4EPWA 1F3OA 4FN5A 3VKHA 4ON9A 5EE0A 3BB1A 5LPNA 4NCHA 5FOTA 3U3KA 1XEWY 5FUXA 5JFGA 5CM8B 2QUZA 5J4YA 1KSJA 3DEFA 4GZMA 1Q57A 1I4TD 2ZROA 4FW9A 4B3XA 4U7DA 1VKJA 1J2JA 1DAGA 2ZM5A 1P60A 4LCBA 5JWHA 1FQKA 2VA8A 1SVIA 2DY1A 1W48A 4JLOA 4DDTA 5F3WB 2JCSA 1AQYA 1Q1BA 4F91B 4TMWA 2GBLA 3QVUA 3EW9A 1SXJA 3QPVA 4UNRA 3IHWA 2QAGA 2Z43A 2OCBA 4GI7A 3FMPB 4MRRA 4V0ME 2GJKA 3KX2A 3K53A 1GL7A 1OIVA 2ZRJA 1CJKC 3GFOA 4RSGA 2I3BA 2GHIA 1N6RA 1KDTA 1UDXA 3NEJA 3NTUA 5TARA 5AR1A 1RYHA 1Z0KA 4ACBA 2GK7A 1A1VA 1ZUNB 3QG1A 4M1TA 1UM8A 3PUVA 2HXSA 4HB0A 3T35A 1CBUA 1UF9A 3UMFA 3QF7A 2CK3D 1SZPA 2R6FA 4A6XA 4DLTA 2A5YB 4TTPA 4M1MA 1XEWX 1NN1A 1ZM4A 1ZINA 4PSKA 2HYDA 2RGBA 3DVLA 5J47A 1OPXA 4LX0A 2FSFA 4US0R 3TVTA 5JJLA 5HE9A 3AKEA 4US1R 3AVVA 3DM9B 5L3QB 5JCPA 1KMQA 1SXJB 2YOFA 2KBFA 3TSWA 1E94E 1KZGB 2VHTA 5BW8A 3KJEA 1R0XA 2OE2A 4DJTA 1HTWA 2Q3HA 4UXHA 1OV4A 4NMMA 3ZJYA 4CZ2A 1JI0A 1QHYA 3FHCB 5KSYA 4DLWA 1WRBA 4QG7A 2F1HA 3PUYA 1AZTA 4W5JA 1QHNA 2RAPA 3NG1A 2HLDA 2NQ2C 2X19A 2VP9A 1A5TA 3K8YA 4DCNA 2REBA 1SVSA 4NCKA 5DO9A 1WF3A 3MGCA 4F4IA 4LC1A 2B7BA 1OB5A 4BGDA 5CJ2A 5FPYA 2GCOB 2WAYA 2XTZA 2ZIAA 3MLEA 5DSZA 4BFZA 4JBXA 3CNLA 3VMFA 4QGAA 3ZIAD 2QPTA 3BBPA 4ARZB 1N5IA 4PO8A 2ZSBA 1GOTA 3EIQA 1EFRD 4LPKA 2YYZA 3LD9A 2WTUA 2A2ZA 1DG1G 4JSTA 2XSZA 3Q8XB 4B2PA 4LPSA 5B58C 5LD2C 3AM1A 3X1XA 4Q1CA 2EVWX 4D0NA 1FTSA 1K6MA 3AF2A 2AK2A 3GJ7A 2K5UA 1N3BA 5EQTA 2C9CA 3GEIA 4ZDKA 3GLFA 1JQJC 2VSOA 4FMCB 2QP4A 3SHWA 4ZCIA 1LB1B 3U7GA 3ZZ0A 2QAGC 3KKPA 1AM4D 1FTNA 2BBWA 2KSQA 1VG9B 2Z4RA 4KBGA 4P33A 3PEWA 1CP2A 1XTJA 4Q7KA 3W5IA 1KAGA 2OAQ1 1CEEA 2C03A 2J5XA 5KNCA 1SKYB 1NMXA 4YXWA 2HCBA 4KVAA 2IWRA 2MMGA 5FBVB 2WWIA 1NIJA 1EWQA 1N2CE 2GZDA 3MRSA 4LV8B 1KO5A 3T15A 4A6PA 3GLGB 4OI0A 4QHYA 4H1VA 4M9XA 3P26A 3X1ZA 4BECA 4NHOA 5JLJA 3QENA 1S2MA 3W3AA 4QBIA 5BYJA 3Q5DA 5JJKA 4LYAA 1HE8B 3D31A 3PVSA 5DIFA 2QORA 3CBQA 1H8ED 1IXZA 1DTSA 2JDID 3GLFB 3B1XA 1DO2A 1DE0A 3I73A 4BFUA 3KQNA 1XCMA 3PEUA 4Q1EA 3Q5EA 3EG5A 1XRJA 3TUJC 4ZKEA 4KJZA 4R2HA 1EGAA 2B21A 5FUWA 4OJKA 3I72A 1RVDA 2R6GA 3B2EA 3G5UA 3NBXX 1BYUA 4XTCS 1E9AA 2DBYA 4HB2A 3B9PA 4ZPXA 4A0GA 1FNNA 3DOEA 4RCYA 4BZQA 4AG5A 3HPRA 1XTKA 3QKSA 2WWYA 2FZLA 2OCYC 3A1SA 2JASA 5EE5B 1P73A 2XX3A 1YR6A 1EK0A 3EZ7A 4LRWA 4HAVA 3E1SA 3K0FA 4B75A 4DCVA 1KSGA 1F60A 4EFMA 1VYTA 2J59A 1YQTA 4IDHA 3K0AB 1A4RA 4BRWA 1VCIA 2YKGA 1BYIA 3WYGA 1YR7A 1C4OA 1CKEA 1YZLA 3NHBA 5FPSA 1DAEA 1HQYE 2OXCA 2B8WA 5FBWB 2RB4A 1ZRHA 4C0LA 1AS3A 1G4UR 2ORIA 4DC9A 4CVNA 3V4RA 2A30A 3ZS8A 3F5FA 4BFVA 5HZKA 3CH5A 3OZXA 4XH9B 2BJVA 3TGPA 2P3SA 1WP9A 1UJ2A 3WNCA 2IYRA 3I61A 3SS8A 4K81B 3LQQA 4Q1BA 4D2IA 5B2ZA 1OIXA 3QKRA 3QKSB 4TLEA 1RRCA 5AJXA 4OQMA 4JYCA 2O8FB 2FF7A 3LVQE 1VIYA 3K0FB 4JLAA 3CPEA 3L0OA 5GJVC 2IF2A 2QM8A 4ABYA 2G6BA 1E1QA 1OHHA 3AUXA 1Z6TA 4PZYA 3GJ0A 3TKLA 3U44A 1P2VA 4AYTA 2P0EA 1S3SA 2IX3A 4RD0A 4LGMA 3K70D 1OYWA 1PVOA 3DHWC 4N3NA 4DB4A 4HAXA 1QVRA 1W36C 2WWXA 1US8B 1JXOA 1X8JA 3TLXA 3GCGA 3WP0A 5F98A 1S1CA 4Q18A 2O8CB 1ZJ6A 1CLUA 1G8GA 3CB4A 2FPMA 4RZXA 3REFA 3ICEA 4IOLA 1HE1C 2VHQA 3SDZA 1TF7A 3MWLA 3QKRB 2OEPA 4L9SA 2REOA 2QY9A 3ECCA 3EZ2A 1P5ZB 1KDOA 3BGWA 2QE7A 1SVOA 4XVQA 1Z47A 3IEUA 3KJGA 2ZJ8A 4Q00A 3PEVA 3QPWA 1T91A 2WWFA 4GPTA 4NE2A 3K0SA 4PAMA 3A1UA 3EPHA 2Q9AA 2QI9C 2VHUA 3AQ4A 3IQXA 2P2LA 4IVQA 1Z29A 2ZSAA 1Q3HA 1SVLA 1R8QA 1XP8A 1CS4C 3BK7A 2IYQA 1KIMA 5SZKB 1SULA 2F9MA 1WQ1R 2O8EA 5DYIA 1KO7A 2G1JA 4JMPA 5CDFA 2J3EA 2PCLA 3BXZA 1E0SA 3RRYA 4UXIA 5FH9A 5KHOC 3FGNA 4KYUA 4Q1FA 4UNSA 2P67A 4Q03A 3CR8A 1KY3A 1CR2A 2AFIE 4JKIA 1XZPA 1Z2CA 4H1UA 1QHHA 2D7CA 4PZZA 2YJTD 4TMXA 221PA 1KK3A 3H86A 4YDSA 4C7OB 1CJVC 4FI3C 1NBMD 1E2MA 5BYKA 3W6PA 2OBLA 4YLGA 1NG9A 4MRSA 3ZVNA 4C2TA 1HURA 2CL7X 3FKQA 2OFXA 4KFUA 5JRZA 3KB1A 4B6FA 5FBLB 4NYJQ 1EWRA 1GRQA 4AD8A 2DWQA 1GUAA 2Z0MA 1ZAKA 2GEVA 3MWYW 1H8HA 3DKPA 1FFHA 3MFYA 3L0PA 2O8EB 2IT1A 5AJZA 4J0QA 2N42A 4R2IA 1E9EA 4TLAA 4UQOA 3SR0A 1G21E 5TVKA 4M1YA 1X3SA 3TR0A 4HYYA 2NZ8A 3ASZA 3BS4A 2IS4A 1S96A 1W46A 1N0VC 4CT5A 5JI2E 3CWQA 3LRPA 1W0KA 1JR3D 1QHHB 4BLOA 3WMGA 3B5JA 5L8VA 3K9HA 2ANBA 3QI2A 2GK6A 2V1UA 4QBGB 2CBZA 4Y0VA 2IF0A 5L3SA 1FW6A 2F1RA 3SBDA 1RE0A 4URZR 4WIAA 2BKUA 3R9XA 2BJWA 5J4KA 3KQLA 4CGZA 1NF3A 5FL7D 3U7FB 2FNAA 2H7VA 3OESA 5JCZA 1GIAA 1G20E 3QE0A 2IHBA 4DLUA 5LDDC 4JLKA 4WW0A 5D3QA 2KWIA 2G9NA 2C78A 3EARA 2CLSA 4DDUA 2YWEA 2HF8A 4LJAA 3DKVA 1KHTA 2W0MA 1T0HB 2NPIA 5JEDA 4JS0A 4KLNA 3H2YA 1Z6GA 1GILA 1XDBA 4I1SA 4XWKA 3FFBA 1A7JA 5GJCA 3L8YA 4OQNA 2ZTSA 2OFWA 3IILA 4LZZA 3LXRA 3SHFA 1LTQA 4ESHA 2VBCA 1ZD8A 5L3SB 8OHMA 2QL6A 1CJTC 2UZ3A 5FPKA 2X77A 3EASA 2JAQA 4L8GA 2ZE5A 1CRQA 4EFNA 2PT7A 1FZQA 2QQ0A 2ZETA 3ZS9A 1KI6A 2W2TA 1GZSA 4IOJA 3RAPR 1K5DA 1W4BA 4NYIR 2G0TA 2WJJA 4MKFA 3RS2A 4FINA 4OL0A 4TLCA 2BBTA 4D4KA 3ASYA 1IBRA 1UAAA 2JLWA 3X1DA 3TVDA 1FP7A 4I1OA 3MWKA 1OB2A 4C3ZA 4DSOA 2VHJA 2CHQA 1TF5A 3PR1A 4IDQA 1AKEA 4CT4B 4GZLA 5C4GB 1IY1A 2WWHA 3U6KA 4W9MC 2GJAA 5G3YA 2CMKA 2H16A 1Z6YA 2I4IA 2J7PA 5H70A 4TQ9A 3MJHA 2CCKA 5H1YA 3CRVA 5TDHA 4AI6A 4AYXA 3EXAA 2C8VA 4Q66C 3RYTC 1MT0A 4MKGA 3UMRA 2ZR7A 1KK0A 1MH1A 4NU0A 3RS0A 2XTNA 3NEYA 2CE7A 1D5CA 4Q21A 2IWHA 4ZKDA 1T3LA 1JXMA 4EQ6A 3B7GA 1DADA 4KFSA 4QHSA 1U90A 2V6JA 2YOHA 4URUR 1P61B 3A4LA 4B33A 1QHSA 2H8KA 3LXXA 3RDPA 2ONKA 3DPUA 2D7DA 4HEJA 3CPHA 5EXPA 4E09A 3VNUA 2CNWA 3T5GA 2RKOA 4BLQA 3FDIA 4G0NA 2XTMA 3BC1A 1XJ0A 2NTYC 2QAJA 3ZH9B 3H0KA 1G16A 2NO7A 1BO6A 1EFTA 2OESA 2XXAA 3OE7D 1NN5A 4KBFA 2CE2X 2IUUA 1KI3A 4W7SA 2IHYA 2YNMA 4M22A 3AVUA 4TLDA 1ZNWA 3F3YA 2ODEA 3KFVA 5JSZA 2MMCA 2F9LA 2ORWA 3MWJA 2C2HA 1CJUC 3GMTA 4G5RA 4P4TA 2RGGA 2IYLD 2F1JA 3BORA 3TNFA 4DDVA 2J46A 2DFLA 1K5GA 1AK2A 4PAQA 1GKUB 4EQ6B 2O5VA 1BS1A 4IXMA 5L3VA 4XD7A 1YU9A 3HWSA 1FUKA 2ZAMA 2QMEA 2R62A 3EX7C 3THOA 4D0LB 1NVXQ 4YMTA 2ZI4A 4HAWA 2IYVA 5EE9A 2LCFA 1XD2A 1F48A 3BB4A 3QQ5A 3K70B 4AG6A 5KDLA 1DVRA 4JKYA 1WA5A 3THWA 2DR3A 4JVNA 3LBIA 2IUSA 2IYWA 1IJFA 3THXB 4TQAA 4FMDF 4KFRA 5JRJA 2QTFA 5DI3A 3CONA 4DIEA 2UZIR 2XXAB 1X86B 1U94A 1B23P 2GVZC 4NKRA 1ZIPA 1TU4A 1O87A 4MGKR 4FD2A 2MSDB 2VP0A 3A1TA 1QVAA 4IOMA 3QXCA 5JSZB 1AQUA 1X1SA 2YC2C 4IDOA 1G7CA 1Y63A 2X8AA 4RD3A 3WRYC 2QQEA 2FPLA 1OKKA 4Z8XA 5DN6D 2P6NA 3EZ9A 1SXJE 1L2TA 4DT1A 3SYNA 2WSMA 3IPXA 2JGNA 3HU3A 3TAUA 4DUGD 2P6RA 4HDOB 1QBKC 1X1RA 3GD7A 5B64A 3EZFA 1EX6A 1NVVR 1D9ZA 4IHQA 1XD2B 3SJCA 1NLYA 1Z0IA 3SYKA 3GFTA 4Q1DA 3BFXA 4AKHA 3KQHA 2CVHA 4Q9JA 4B43A 2QP3A 1G7RA 2XZLA 5DI3B 3IO5A 1AGRA 3EPKA 2J45A 4ASUD 4L16A 4DSTA 3I5XA 4Q9IA 3BFVA 1CU1A 3AV0B 4IDPA 4P31A 4OBEA 2GJSA 4QKQA 1ESNA 4EPVA 4MKIA 1LW7A 2DYKA 1D6JA 4HUQA 3WHKA 2FE4A 2OO7A 3B60A 3T06B 4YONB 5JI3E 4LHYA 5LB2A 1JECA 1R10A 1VTKA 3OEEA 4ZO4A 4DRZA 2A5GA 4ZDJA 1YZNA 4TMVA 2RGAA 4TYQA 3GJ5A 5DGXA 2EFCB 3ZQJA 3QNUA 2H57A 5FOSA 4CEIA 3C15C 2Y8EA 1IN4A 2IEZA 4P0TA 2BVNA 1OIWA 2KBEA 1G8YA 1Z6AA 4KU4A 2JLZA 1U0JA 5C46F 1VCOA 1G7SA 3RS7A 2QNRA 1W0JD 5P21A 1BMFD 1T8TA 4OQXA 2QTVB 2FFBA 4XIGS 4PQYA 3CZPA 4OK3A 4KSBA 1TL7C 2ZJ2A 1SKYE 1QG2A 4IVRA 1XEXA 4EPXA 4DVGA 4TYWA 3RSLA 2BDTA 2WAXA 3BE4A 3BH0A 2ZQ5A 3SJBA 3SFZA 3QEJA 4MDEA 1V43A 1JALA 2W6IA 2GETA 3GLGE 2FEMA 3SJZA 2OAP1 2XNDA 4PHTA 4JLDA 4AIIA 1AA9A 3IIJA 1AS0A 2JLUA 3QJYA 1QHIA 5SZJA 3FMFA 1AKYA 3AVQA 1PUIA 3B1WA 4DEYA 4FMBB 2F55A 1W7AA 2CL0X 4KVGA 1CF4A 3DZDA 4CEIB 2EQBA 2ZJYA 5AJVB 2R6AA 4PPNA 4BASA 2FMXA 1U8ZA 2DCUA 3H84A 1ZCBA 1VPLA 3GLFE 3I5YA 3I8SA 4PXAA 2ZVPX 4Q4LA 1ZM3A 2ZRKA 4Z1MA 3SBEA 4URYR 5JMTA 4Y0AA 1KI7A 4L15A 4G1UC 3W9YA 5EE3A 4MGIR 1LS6A 5FI0B 4OHYA 4DCSA 4UNPA 4BFTA 1DO0A 1GITA 2J0UA 1XEXB 3LW7A 5L3QA 2W2VA 1E79A 1RRGA 4JLNA 2V9PA 5G40A 1GP2A 4NYMQ 1XPUA 2GXQA 1L4UA 1CIPA 4GMXA 4PX9A 3B78A 3LA6A 3LH5A 5AUPB 3TH5A 2ZS7A 3ADCA 2CLCX 1TQ2A 1JAHA 1G7TA 4GP7A 2AHOA 1KZ7B 4P32A 3LW8A 2EWWA 4FCVA 1NY6A 1N5KA 4LK2A 2QT1A 2WJIA 4B48A 1WMSA 1Q0UA 4LY6A 1E98A 4TT3A 4FMCF 2ECKA 3JVUA 3IIMA 4PC6A 3VR1A 1TEXA 4JJZA 1P9NA 2IK8A 2P65A 1P7CA 3RC8A 3SNHA 5HKKD 1M7BA 1QF9A 2O8BA 3PEYA 3Q9LA 2PLFA 2BM1A 2QGNA 3QBTA 1G6HA 2GCOA 3SQXA 3RANA 4F93B 2GXSA 2IEYA 4JL8A 3OAAD 3PUXA 1FP6A 1J7KA 4A9AA 4OKSA 4ARZA 2VIIA 1VYVA 2J0UB 1E2FA 2FSIA 4CIDA 1E32A 1Z07A 2XAUA 3TK1A 4XWOA 2HXYA 4UNNA 1ZM9A 3D7MA 3T1VA 2WSSD 2F43B 4KSCA 4TL7A 421PA 2VEDA 1IM2A 3KJIA 3FYHA 1RYFA 3QPUA 3TW8B 4PTLA 1XTSA 2JLSA 3QVVA 3LAWA 2ZI3A 1R5BA 5DE3A 1TADA 2IXEA 5EP2A 2D2FA 4UXJA 5CJPA 4KITB 2F3RA 5FPHA 4M9QA 3AUYA 3TSOA 4BQSA 5KUTA 4CYMA 2IYSA 4BLRA 2O8BB 4M9SA 1E9RA 5E3HA 4A0RA 4M4SA 3IIKA 1IN7A 2B7CA 2WV9A 3GLGA 2BV3A 3QBVA 4C9BA 3B85A 4RD2A 2ZRCA 1OJLA 2XZPA 1UADA 3CPJB 3ZD7A 2FFAA 2NO6A 4R7ZA 2IC5A 2QMOA 2WJHA 2GKSA 1LF5A 1EFCA 1R6BX 2ZS8A 2PL3A 3P20A 4BWYA 4BUJA 2RGEA 5IHPA 2GBLC 3REGA 5JS7A 1TAGA 4WAUA 1SXJC 3BAFA 1N6KA 3QXXA 2HUPA 1CR4A 5GJWC 3BERA 1XJCA 4LYHA 4LJ6A 3ZD6A 1IN8A 2G3YA 2J41A 5FTNA 4RY2A 1P72A 1NN3A 2GF0A 1M8PA 2ZR0A 2VP5A 3MAAC 4A0HA 4B74A 4QGHA 4RVCA 1G9XA 2D3WA 2PX0A 3QXJA 2XB2A 3L82B 4KXFB 2ZRNA 1LY1A 4IVPA 2XITA 1E2LA 2D2EA 4DCUA 5JHHB 3AF4A 4JIMA 4ZIRA 4DLSA 2GESA 4BFYA 1BH2A 2CHGA 3KXIA 2W6JA 5EZ5A 2WWGA 4ASUA 3PENA 2QBYA 4O2RA 2XOKD 3K0AA 1YZTA 2VP6A 4DZZA 3C16C 4JT4A 3AVOA 2YWHA 2EU8A 4PFSA 3UG7A 2SHKA 4D6PA 1KSFX 2ORVA 4HZIA 3KUCA 1IY2A 1JJVA 2FA9A 3GQBA 4G01B 3FKSA 1VMAA 1Z3IX 3KJHA 2ZJBA 1U8AA 4AKIA 5IK2D 3HPQA 1YRBA 3A1VA 4WBSA 3ZLJA 4HAYA 4GRAA 3GJXC 2BEJA 5FFMA 1HA3A 1M7GA 2WZQA 1HYQA 5JBQA 2JJ2D 3FMIA 4GOKA 2WPDA 3UK6A 1YZGA 1JQLB 4D81A 2GDJA 1MOZA 4GOJA 5IF9A 1YRAA 3C7KA 4PSVA 1LV7A 1OXUA 1S8FA 3C8UA 3EA0A 3GLHA 3QEOA 4ILEA 5C18A 5CIWA 1CRPA 3TUZC 1T5LA 4N0DA 1C1YA 4ZIRB 1N6PA 4A92A 2O8FA 1R4AA 2PEYA 1KO8A 3WBKA 3L0SA 1EFHA 2BMEA 5EE1A 4ZI3A 2QBYB 4URWR 4QC2A 2FH5B 5A4JA 4YMWA 2ZYWX 4Q7MB 4RFSB 3E2IA 2QMHA 4B73A 2DFNA 4ZV4A 3W3ZB 2V7QD 1M1YE 4E07A 1DELA 1Q1ZA 2ZYVX 2PJRA 2VQSA 1E2JA 2JLVA 2BM0A 2AN9A 3W8RA 4KLZA 2AXNA 1US8A 1COWD 4WOPA 1AS2A 3B9QA 4QJ4A 1E1RD 1FOEB 4DLVA 2O8CA 5DYGA 3EIEA 3BH6A 2NMVA 1JAIA 2CL6X 2WM9B 1GNPA 3SZRA 4RD6A 4WZAE 3SC3A 1CULC 2YZ2A 1FNMA 3GLHB 4KV9A 2GAOA 2QG6A 2DWOA 1KMHB 2Q0HA 3SEAA 2KI5A 2NG1A 2PMDA 5B30A 1KJYA 4RZUA 3TR5A 4FWIB 4A2WA 2GEUA 1J8YF 4FIDA 2O8DA 4FCWA 1XFAA 4QOSA 1HT1E 2LWIA 3WHLA 4MUBA 1Z2AA 821PA 2JIZD 3ADBA 4GSYA 3RS4A 1TQ4A 4B3FX 1E2PA 1KO1A 4M8NE 5FOVA 3WNDA 721PA 3HDTA 3KB2A 5J4HA 1ZW6A 2RGXA 2OLJA 2BHRA 1U0HC 4R71A 2ODBA 2BKEA 1IXRC 2RGNA 4C0JA 4D25A 1KK2A 2WVJA 3TUIC 3A6PC 3E70C 1HQCA 1A2BA 1KI8A 1XJQA 5UKDA 4KAXA 3RNLA 4QGGA 2CK3A 2WKPA 1OXXK 1TUIA 3NC1C 1FMJA 2R6CA 4AYWA 3TRFA 4C7OA 1E99A 3PUZA 4M53A 2QPAA 3LLUA 2R6DA 3G82C 3UWOA 1MABA 1NLFA 4NDZA 1KOFA 3M4YA 2FPKA 1ZVQA 3ICQB 4BEBA 5G3ZA 2O8DB 1S9HA 1F5NA 4UNQA 1E9BA 2BMDA 4M1KA 1N6LA 2Q9BA 3PV0A 1ZD1A 4Q47A 3CX6A 5JWRA 1NRJB 1DBSA 3HR8A 3I1FA 2PMKA 4LWZA 3VFDA 4D4MA 4IEEA 4OHXA 4QBHA 1DAHA 4NP6A 1Z22A 1JPNA 1G17A 4IFEA 4AWXA 2JLYA 5BWMA 1W44A 3BJIC 3D6TB 4TL8A 4DLXA 2HT6A 1SHZA 3UPUA 1YR9A 4HLCA 4QRHA 4B2IA 4URVR 1ELOA 1RIFA 3OEHD 3C14C 5FOWA 4QXAA 3VR5A 1XD9A 4V0KA 5J5CA 3SU8A 5JZVA 3Q85A 3WMFA 1Z0DA 2IYYA 1VHTA 5AK0A 3NC0C 2ZE7A 3HJNA 3TJZA 4QJ3A 4F92B 1G5RA 1S0UA 2HDNB 2ERXA 5FI1B 5KNDA 2ZRMA 3SI7A 4Q5IA 1MABB 2OCAA 2PX3A 2W58A 3ZIAA 3OIYA 4DHEA 4OI4A 3UXMA 3CX8A 2OCPA 1QHXA 3R8FA 1EFRA 2ODWA 3FWYA 4XSGA 2FX3A 3PIRA 3CF6R 1QRAA 1E4VA 2KB0A 3IBYA 1E9CA 3GJ6A 2KE5A 3Q7PA 1HY3A 1Q3TA 1ZD9A 3BIFA 4Z51A 3LY5A 3AVXA 1R5NA 4TYNA 4DDWA 2ZRAA 1T3HA 3E5HA 2DHRA 1CTQA 2BMJA 1T0JB 1G8PA 4M21A 3KQUA 1G5PA 1KTVA 5B57C 3UATA 4A82A 2VH5R 5KDDA 4TZ0A 1JJ7A 3SJAA 1G6OA 1G64A 4L5BA 3W90A 1T9HA 2DWPA 3P4XA 2OFOA 4I99A 4QL3A 3PFIA 3NBYC 3D3QA 1OFIA 2QSYA 3CIOA 1E3MA 1HUQA 2RGNC 1GFIA 3PQCA 3EAQA 3AB3A 4LJ4A 2W83A 4D0GA 1E2GA 3CNNA 4DKXA 4PHGA 4JT2A 2FSGA 2W2XA 1MV5A 2IYTA 3A4MA 4LYJA 1S1MA 1UBFA 2QZ4A 2V54A 4TSFD 4CEJA 3M6AA 5GJBA 4CEHA 5FTMA 4DLRA 4OI2A 5EUQB 2ZS9A 4QBFA 4F4CA 4C2UA 2ZXUA 3OFND 4A1FA 5ELXA 3QF4A 1H8EA 4YC7A 3A4NA 1XNJA 1ONBA 2PCJA 2JJ1D 2JDIA 4H9GA 4JSYA 3I62A 3N5CA 1S3GA 3IQWA 3B1VA 1GL6A 4DLYA 2GCNA 2X1VA 1ZNXA 3KKOA 3KQKA 3V00A 2DB3A 3WNBA 2AK3A 4ITRC 3V9PA 4CW7A 2V8OA 3Q72A 4II7A 4UJ3A 1HV8A 4EJSB 3UIEA 4PZLA 2A5DA 1OF1A 5CLQA 4U00A 5F9FA 3IO3A 4PHFA 4HLUA 1FX0B 5LBIA 3H4MA 4DEXA 3FHTA 1TNDA 2JATA 3WY9A 1DAIA 1SVKA 1Z28A 4QM7A 2ZJZA 2ZREA 1P9RA 2AXPA 2QSZA 1SHKA 3KKMA 3UKDA 3Q3JB 1OH6A 3KXLA 4CEJB 4I1UA 1W5TA 3VHLB 4CEHB 1EESA 1NBME 3I4LA 4EPTA 4ERNA 1G1MA 4PAOA 2GVDC 3ZYCA 4LDJA 3DOFA 2Q3MA 2H17A 3FVQA 3T1TA 3QF4B 4IW3B 3CF2A 4LBVA 2V1XA 5TV2A 3ND8A 4V0NA 2XJ4A 2QENA 2I1VB 1GL9B 3JVVA 3HU1A 1D9XA 1PLLA 1RZ3A 2FGKA 2ZJ5A 3DM5A 2NIPA 1VCMA 3K09A 1WCV1 1E4YA 3ZZUA 4KI0A 4QHTA 4A0FA 3MG9A 5K8IA 1P2UA 1P9WA 2UKDA 1G5TA 2H92A 3IPYA 1KKLA 3U7HB 2OG2A 1VHLA 3VNVA 1R5OA 3OIWA 4YMVA 4GFDA 5TMPA 1XPOA 1E2QA 4M1WA 3SQWA 3X1YA 3LBNA 1JR3E 3P1JA 4MYCA 1TU3A 1E6CA 4MGZR 5M04A 4DLZA 3EIHA 4AKGA 2ZRHA 3TQCA 1SXJD 1G8HA 621PA 4JLMA 5IRCD 2PBRA 2GNOA 1U0LA 1EXMA 5FL3A 2BOVA 1PUJA 2E1RA 2IYXA 2VYFA 3THXA 5BN3A 4US2R 2EFGA 2ZI7A 1OE0A 5KOYA 1G3UA 2AWOA 5JEEA 2HJVA 2DFTA 1W2HA 1UBGA 1TUEA 3T1QA 3LV8A 2ZANA 2DPXA 3GLIA 1Z63A 4D26A 4MH0R 1Z06A 4G5OA 4NCNA 4JLBA 2F1IA 1NI3A 4D4JA 2Q21A 3SFVA 4I1VA 1XCGB 4KODA 2EFDB 4YMUA 4HATA 1U9IA 1TEVA 2GJ8A 1YJ5A 1M7HA 3FPAA 4DBLC 1UBEA 1XXHA 2TMKA 3ZVRA 3U3RA 3CX7A 4HLUC 1HT2E 1GNQA 2IUTA 2XB4A 1CXZA 3L2OB 4A8JA 3NBZC 3AEZA 4GOXA 4EAQA 2OHFA 2ZR9A 4WZBE 3MCAA 2FFQA 1ZBDA 3QG5A 3HR7A
chains in the Genus database with same CATH superfamily
1YACA 2BT4A 2W48A 4QFBA 1PZNA 1PJ4A 2Y1XA 3T61A 3ZKWB 3ANLA 3ZX5A 2OUKA 3BJEA 2Q49A 4OOEA 5FNVA 5TEVA 2DHQA 2HLDD 2GZ1A 4F3RA 1FFDA 2NSDA 1AUPA 1E2DA 5L4LA 2JI4A 4XPZA 2OXIA 3LTEA 1JU4A 4GKKB 3ZDQA 2I8AA 1YFLA 2H4FA 2GPTA 4D9BA 2YVQA 5ITSA 4KPUB 4LZLA 2CDBA 4RJJA 2X9NA 1RXUA 1YBFA 3OQOA 5J2UF 1DIOB 4BBPA 3IEPA 4OJMX 3QX3A 3C3MA 3HH8A 1T34A 3B12A 4TV9F 1Z26A 4C4TA 3HBJA 1AHPA 1U99A 3U4QA 3U5ZB 1O9BA 3ED5A 3FNRA 3FMOB 3GLUA 1CRLA 3O1JC 4FR5A 3SHVA 3TSYA 1QLHA 2I9PA 5CB8A 3ZDBA 1J9ZA 3G23A 3TZHA 4XIJA 1TJPB 2G8LA 2SKCA 4I3HA 5EIBC 4RSHA 3ESZA 1PS9A 4D8XA 4Z54A 2XZOA 3H11A 4QPDA 2CVFA 4UBNA 4Q05A 5KSPA 3L7BA 1K7FB 4MQLA 1R0KA 2O3RA 3LC0A 4TV8B 3TTWA 2QRJA 3SYLA 3V1UA 4AL4A 3BXXA 3STWA 4PANA 1N0HA 2HEGA 3MTDA 3RSFA 5KO2A 4DAOA 1B8VA 2QMYA 4B4DA 1HZJA 2OR3A 1ZIYA 2XOEA 1U3WA 1CV2A 2OTCA 3HHPA 3KFXA 4D8TA 1HDGO 2YMQA 2B6HA 5CFZA 4Z3DA 5K6AA 3NM4A 4EUHA 5HUJA 5F2OA 5LLTA 1N6NA 1P18A 1L3IA 1NVEA 2EKBA 2JC3A 4M49A 1FFSA 3BRWD 1XLUA 1NP6A 1PT8A 2C5EA 4WZ6A 5D3ZA 3TX2A 1YNSA 1Q15A 1LVUA 2NZJA 2PV7A 3RHFA 3L40A 1RRPA 1JSRA 2Y1KA 4NBLA 5SZIA 4RTQA 4KNYA 4S1WA 1R27A 2QG4A 2XMGA 2FW7A 1GKIA 2Y67A 3NX4A 4JMLA 5FO1A 4OGKA 4DMGA 4E5NA 1W75A 3RO7A 3TUZC 5I9NA 4JUFA 2E4VA 4G5GA 5JHGB 3A1DA 1UWVA 3QUTA 4NDAA 3IKVA 4YPFA 4C7BA 2CGEA 4YRFA 1UKZA 1VXOA 2Z58A 3EWIA 1O6CA 3AHIA 2ZUUA 3HYLA 3U1VA 1B26A 1TXGA 2H1OA 3WJ1A 4A8JC 4G41A 1JB1A 1Y9ZA 2JAHA 4I50A 5IM4F 5J4YA 2Z98A 1X14A 2UUPA 3E9ZA 4KPFC 4K05A 1NNLA 1PT5A 1W49A 3D2BA 2A57A 2GSDA 3IJRA 3OCJA 4FDLA 3D64A 4R5HA 3NWJA 3VVBA 1I7SB 2GRJA 4AG3A 3GNSA 4KQJA 1X15A 4X5OA 3SVZA 1KJ9A 3DZ8A 1E66A 1HK7A 2JI9A 3HY6A 5K03A 1QDEA 5BVGA 2NT4A 2IYUA 3FTQA 1DC5A 2JLBA 3F1KA 2WHXA 3NONA 4JK3A 2E5LB 3KPYA 2IH5A 1LJLA 4CL8A 2Y76A 3HJTA 5A0FA 1JT9A 3PDWA 3RVSA 3AL2A 4KI7A 4DB2A 1RMTA 2CFCA 2IUYA 2R96A 2PZEA 2QUIA 1LRLA 1ND6A 4EM6A 2EZ4A 1G3QA 3K1AA 4PPFA 5TB5A 4C6TA 3IV7A 5KYKA 2ZE6A 1EDBA 1QK4A 2AOVA 4JBHA 2KJQA 4U39A 3UAYA 1Y9DA 4XKJA 1QGOA 2ST1A 4YMHA 4BMSA 1QE0A 1K6EA 4KLCA 3S40A 3USES 1ZUIA 4B6EA 1YR8A 3AP3A 3IEVA 3L43A 3TXYA 1PWZA 1I3LA 1LQUA 3JD2A 3HXQA 1QE5A 3B3JA 5FUMA 3HN7A 1ODFA 3D6JA 3GFSA 3UG6A 4FQ7A 4KR6A 3ABSB 1W4RA 2C04A 2HDOA 2QD5A 1F2TB 3C3AA 2ZXEA 2HCJB 3OIUA 2XE7A 1BMQA 2R1TB 4JI0B 3R6LA 3IPCA 5DK6A 2P5YA 3PC3A 3U37A 2YWGA 4JP3A 1FRVA 2C61A 4QREA 3A26A 1U02A 3FE2A 3IV9A 3U3MA 3CUVA 3KOZA 3SICE 3R3SA 1UC4B 4WBNA 1RAFA 1VDZA 3D6HA 5T5QA 5KREA 2M1ZA 2Q6TA 4QUGA 3GPLA 1C4XA 5L6MB 1OFUX 3ELWA 3CUEF 4B3IA 1FLAA 4XDHA 1J5PA 5I7HA 1XAIA 3K9LA 1E1QD 1N25A 2R7KA 4HDRA 4LI0A 4ZO9A 3FUVA 3TMYA 4YUXA 4N82A 2WSIA 1TAUA 4HSEA 3TEFA 1MZPA 1T1GA 4MR7A 1ZGGA 4OFWA 4YAIA 1A82A 3BXGA 2GWRA 2V45A 1DS6A 4ISCA 5AWFC 5ADWA 5HRCA 1VGRA 2WYUA 4U7WA 4B4KA 3O1LA 4IYJA 1CFZA 1RP7A 2QA5A 4HDCA 4RQUA 2HWKA 4GBMA 1BQEA 2Q99A 2NU6A 4YJHA 5FBHA 1IZ0A 3BDIA 4X94A 3OE7A 3C3DA 1NTRA 9ABPA 5EJAA 4RIHA 2P3LA 3PYXA 4KDRA 4LHXA 3RIEA 1M34A 4IJKA 1ISMA 3D7NA 3TOVA 4EGAA 3FIUA 1KH2A 1T5BA 1MQ8B 2NUPB 3KOMA 4DIKA 4DNQA 4EDFA 4UCWA 5LZ4A 4PGAA 1DWQA 4LFCB 3SE0A 2P4UA 2JAXA 4CM4A 3RYFB 4UBOA 4A23A 5B7GA 1SPXA 1QRDA 1Z88A 4IVNA 4Y8VA 1P4SA 2ZT8A 4D45A 5H7XA 2QE7D 1HH4A 1PNQA 1Y3AA 3RYHA 2YVUA 3BCRA 5DGCA 1FDSA 2VTEA 1GYPA 4AKTA 5A9SB 1A8QA 2JGEA 1T2DA 3I6YA 3LVRE 3ELUA 4Y30A 4WA8A 2GZHA 3CRW1 3LUGA 2YKPA 1BHSA 2FGJA 2WJYA 1SBNE 1V8OA 2JLXA 3I28A 1LLUA 5CEEA 2FMHA 4FSXA 4L95C 1PLJA 3BK2A 2BCEA 3UA4A 1WVMA 2X0DA 1X7XA 1SFRA 1DIHA 4BFSA 1GTZA 4LBYA 3QMMA 4IEIA 4PQRA 4Y2GA 3SSOA 2C2BA 1XRSB 2J67A 4WFKA 4H7DA 2BBSA 3V8PA 3L41A 3WJ7A 1U7ZA 2HMWA 1YRHA 4GBJA 1F12A 1GG2A 4I4CA 1ZISA 4NPCA 1WF6A 2JA2A 3HCWA 4FXPA 3R9WA 4OGGA 1VL2A 2Y2UA 1BCSB 5AT1A 3DL0A 2CV0A 1AK9A 1CUDA 2FPPA 5C5DA 1IATA 5KSOA 1GSHA 3CLVA 4HDQB 3ZBPA 1ZFNA 1UPBA 1B2LA 1ISRA 2EIXA 4KH0A 4PFKA 4P3NA 1YAHA 4HPXB 1QBGA 1ZCAA 4I2NA 1NUTA 2H9YA 4DG8A 1GT91 3OFKA 2FPSA 1DBWA 4ZEVA 2QVGA 2YYSA 2JFZA 1M66A 2I4NA 3PDIB 5HJ5A 2J1LA 4O2LA 1DBIA 3I9KA 4YB8A 5KYNA 3KHUA 2GAJA 3GOQA 4DA6A 2Z2KA 4F6RA 5SYNA 5CG2A 2WG2A 1HDXA 5JPIA 4BO1A 1DEAA 1EINA 8ADHA 2WFLA 1MTZA 4FGZA 4B3CA 2XDQA 1ADFA 4W6QA 1CNMA 3T3NA 2I1QA 4P93A 4DREA 1I6WA 1P6QA 3SBOA 4JROA 4MQ6A 3CUKA 3NEAA 3FYSA 3S1AB 2WSBA 4EHHA 3UXEA 4BV8A 2WD7B 4IHJA 3UHAA 3COPA 2F17A 1EK6A 2HZ7A 3UN1A 4IQFA 1GZ3A 1LPMA 1W0KD 3IVMA 1UC9A 3A4IA 5KYTA 1IB6A 5AKYA 3WQQA 1I4DD 1UP4A 2PSHA 2C5LA 1PT9A 1VGVA 1WV1A 2E6UX 2VPPA 2XZTA 2PV0A 1D6SA 4IIVA 4L8LA 1P2FA 2XHZA 4LISA 1UC5B 4DSNA 2OHGA 4AN4A 2BY4A 2DP4E 2GBIA 3TIFA 1H66A 5EIOA 1QUEA 3O0TA 2DPLA 3LZCA 3X1WA 3GLTA 5E1DA 1LS1A 4UJ5A 5HCIA 4CN9A 1O95D 1BQ4A 1WZCA 4OOFA 3BD9A 3ZZ1A 4IS3A 3V4FA 2PRIA 1JG6A 2OILA 3SC4A 2GARA 2E1PA 1XZEA 1L5HA 2EZTA 1KS2A 2V4ZA 2HKIA 1AKWA 1L6RA 2QD2A 3HJAA 1NLZA 5MHTA 4JL5A 1EX7A 3H9JA 3IODA 2IXBA 1FC0A 1HKHA 2VUTA 2HSDA 2C4HA 2PL9A 3B1YA 5FV7A 5SY9A 3P97A 1XCBA 4F11A 4L4UA 4ZVVA 4ZDIA 3BSWA 2HJSA 2Z30A 3OM1A 1VE6A 3W6NA 2H5IA 4Q3BA 2PUCA 3JXEA 1FFAA 4JR1A 2YICA 4NBWA 4Q15A 4R7TA 1VB3A 2CXXA 4RLQA 2QXYA 4B5KA 4D56A 3A58B 3IRUA 4JL6A 3RWOA 2IA5A 1II8B 4A3SA 1NI5A 2FR0A 2JI6A 4JZKA 1P8JA 4B7ZA 4DCPA 3LRTA 2NM0A 1E9VA 1XL1A 4B3MB 1W5FA 2F67A 2JH9A 3PFNA 5FBKA 1KZ4A 2WNSA 4HP8A 5TLSA 5KAPA 2IW3A 4HXFB 3PEFA 3PVZA 5IKMA 4UUBA 5BQ5A 3VPHA 4AZ0A 5MGBA 1NL3A 1OLUA 3TSAA 3BQ9A 1N32B 2DUNA 1EVKA 2ZRQA 3O95A 4PGFA 4BEWA 1FP4A 3DAFA 3NOQA 3TG2A 1W36B 2WIAA 2UVPB 1IVYA 1Y3CE 2J87A 5PNTA 3LO5A 1ZA1A 1QONA 2WUWE 4KVZA 5KCZA 3GJZA 2BZ0A 2ZSDA 4KR0A 1U7DA 3LX5A 5AVVA 4JXZA 1TA0A 1IHYA 2IOFA 3HCEA 4YRZA 5BSRA 1VRVA 5KTNA 3K6SA 4J16C 1E1CB 2VZ8A 4MLDA 2CHVA 4FYIA 3MVEA 4WLVA 3NB0A 4CCAA 3D8SA 4LYYA 1WXQA 4BRUA 4LZWA 4BBJA 4ENWA 1ARZA 3H2BA 3IMKA 4MV6A 1TVKA 1EM8B 1T1IA 3WFIA 1O57A 2VL7A 1ATIA 1OWNA 3COWA 3NFRA 1W581 3BRCA 3H65A 4PXSA 1II0A 3BJZA 5C8ZA 2VSYA 3NT5A 4MWSA 5D3MA 1DAMA 4E5KA 2QYSA 3GMSA 4NS1A 4F60A 4AY2A 2DQSA 2I6TA 3GLVA 4MIOA 3AGQA 3TL2A 1VDMA 2BGKA 3FRHA 2GA8A 5HIAA 1N2GA 2VK4A 1PD1A 3FOZA 4H7KA 4KGZA 1SUPA 3M1AA 3PGA1 2FUCA 1TKBA 1U3CA 1VE7A 3EG9A 4EIWA 3HA7A 1L5ZA 4UM5A 2FN4A 1B23P 3NBKA 1R0YA 4K9MA 2CHEA 5HQJA 5ADHA 5DYTA 5FD8A 3OAAA 4FYMA 3F0TA 4KIWA 2GAAA 2O7VA 1P5HA 1K97A 2YWJA 2BBOA 4J76A 3ITNA 4KXLA 4N0QA 1C7JA 3A0UA 4PO9A 5JJBA 1T9CA 3O7MA 2BH2A 3HJFA 1N6OA 4WINA 4Z4CA 3Q1KA 2ZITA 4KO2S 4D98A 5A4DA 4YR7A 1X80A 1XGKA 5JAUA 3CH4B 3KXDA 5DB4A 1DLIA 4N5HX 4G81A 4XQCA 5DISB 5KSWB 4L28A 4LZAA 5IKEA 4GL4A 4UUOA 1NNEA 1NKSA 2FF5A 5IAOA 4R9UC 5KQRA 2H0AA 4FHEA 2WUVA 2XECA 4GWGA 5D7BA 5E7JA 3I2FA 4KZKA 3HHEA 3ITEA 5L40A 13PKA 2GX6A 4REOA 5D5HA 3KT3A 4L6AA 1U2GA 4UCXA 1BWQA 4XD7D 2PU7A 1DJPA 2FB9A 3VZRA 1KH1A 4FCTA 1Y7HA 4MVXA 1G63A 4NYJR 2F00A 4M60A 4H0NA 3ZDYB 5KC8A 3FUTA 1EFLA 3EDCA 3ROKA 5CH8A 1R7RA 3LFUA 3VPSA 3VR3A 4CMCA 3BK1A 4OX9Y 5CLLA 1SCDA 2V6GA 5BSKA 1T5DX 1QB7A 2O2YA 1HGXA 3F8TA 5GONB 2EJVA 3BIXA 3PTLA 3VTZA 1OZAA 3ZYZA 2E5FA 2JB9A 3EWAA 3RVNA 3V8NA 4OHUA 3F9IA 1WHTA 4JLVA 4YRCA 2EWVA 3ITDA 1L8XA 4KXQA 4Y2TA 1GRNA 1NUUA 2HAEA 1Q19A 4P8RA 5C53B 2XPCA 3QH4A 1UC8A 1NJSA 1XZQA 1XMIA 5FOUA 5T6MA 1TM5E 1UKYA 2BTOA 2JIOA 1E18A 3CRQA 1UBNA 3NPAA 3FPLA 3CWZA 3J7TA 4FC6A 3QUSA 1SC4A 2EW1A 2RKBA 2WKRA 1PN3A 1N5LA 2JEOA 5BOSB 2QM0A 1FVXA 2AT1A 5EWJA 2HU8A 3DCYA 1OAOC 5E2BA 4AP9A 3NRJA 4IDDA 3NJRA 4DFDA 3OF5A 5AOVA 1G3RA 1XK7A 1BIFA 2N9UA 4ESEA 4NZZA 6PFKA 4H59A 3ZWPA 3AFIA 3VNBA 1BEUB 3G5LA 2ZUBA 3CS3A 2ET6A 2IP2A 2MCFA 1ESMA 2QIPA 1Z6XA 3MTIA 2G1KA 4YCAA 3KQVA 3Q88A 2QUAA 2WF7A 5AUNB 3EOBI 2XGOA 3UK0A 3R5XA 5DWQA 3W8NA 4D82A 5C7YA 1BN7A 3GELA 3NQ41 3T5MA 3NIDB 4HNSA 4QJ5A 4R69A 2V97A 3TQFA 4BU0A 1ZI6A 2NGRA 1J97A 3UUWA 2A3RA 1TUGA 1R5JA 2VLBA 2UUOA 2MINA 3NALA 3QKUA 4FFSA 1D2AA 3D59A 3X2EA 4IQ0A 1XT6A 2QROA 1LFDB 2Z6UA 2B1QA 4BLSA 2VRWA 2IV2X 2CXQA 3TBKA 3ND9A 1XXHE 4QUHA 3MT9A 1MB4A 2WF5A 1WMDA 5FTJA 3ZH2A 4Z0PA 3GGPA 3EULA 1G8FA 5CLIA 2EEZA 1Q21A 1YVDA 4D0NA 4OKIA 4Q0MA 5E9WA 2X1MA 1XJWA 4D9EA 1T6XA 1G291 1ZM2A 4HZUA 9LDTA 3DO6A 3ROFA 3QU7A 4JB3A 1H6DA 5J40A 1HO3A 3VR6H 2V5UA 1XQWA 4XZ3A 1CETA 3V8MA 2CKMA 1E2EA 2R9VA 1UDWA 5EJ7A 2BLLA 1U7WA 1LPBB 3RTGA 4GDFA 3TIGA 5AVRA 1FVOA 1ZOIA 2ZBDA 3R7LA 4GYJA 4DKJA 1ZD3A 5E7IA 2HHJA 3QKIA 4RHFA 1BDBA 1NY5A 2HCFA 3BD7A 3ECSA 1XKQA 2LDXA 3D2CA 3LPMA 4KCGA 3ZGLA 4AKEA 1W1IA 1BDJA 1SC6A 4CKEA 5AKIA 3GEHA 4L73A 3PXXA 2J09A 2VSNA 3IRVA 3OE4A 5F33A 1X1AA 1AZSC 1WIWA 2W6ID 3GMDA 3I9V1 4MIEA 4QGFA 1WMAA 2OPHA 4E2YA 3I9FA 1M67A 3KZ1E 3FPGA 2AKAB 2WMYA 2XNDD 3NYQA 4M9UA 4QXPA 3QWBA 1XMJA 1IH8A 4RZ3A 4ZOLB 3PP8A 3ZHVA 2O20A 4HPJB 3M3PA 2X2FA 5CXXA 3RS3A 4QSHA 3S8MA 2XNCA 3PICA 4N1AA 1YE3A 2B4KA 1E1RA 3VAAA 4E2XA 3BE5A 1ECLA 1KAOA 2B2NA 3KT0A 2AH5A 3M5CA 3B7PA 3T7RA 5E6UB 1EFVB 4HLDA 1MJHA 1P0IA 4JNKA 4P4UA 1G0NA 5F9MA 2Z2JA 4U1RA 3NLLA 1J39A 1I5OA 1R0ZA 2XEXA 3C98A 3KDSE 4CRWB 1ORWA 1BFUA 3HFGA 4PQFA 1QGUA 2O9JA 1YFJA 3U3DA 2OD9A 1Z2OX 2H7CA 2QQFA 3RIMA 3PJFA 1ZKDA 4CF7A 5I7UA 5BMVF 1S4MA 1QP8A 2D00A 3KP1A 1RHQA 4OV6B 3AFOA 4X66B 1Y5RA 2WF8A 2E21A 1BX1A 2H85A 4FE7A 3ZHOA 2QN2A 3A05A 3EH1A 3K1JA 3H2ZA 4MVYA 1YS6A 3DMDA 5DGHA 4E5YA 2RHMA 5L3ZA 1MIHA 2JIZA 3O1IC 3WRYA 4RELA 3BFKA 4PLYA 4CR8A 1TCAA 3MJEA 5K3BA 3URMA 3FGPA 3LBHA 1CE8B 2HJGA 2QVXX 4ZO8A 4XRRA 3L8HA 3D6FA 3V4SA 2Q6LA 4JOBA 4D3ZA 5B2FA 1L4YA 3OLWA 4EFLA 4X7MA 3VU9A 1BU5A 2QVZX 1GPBA 3I1JA 3H6HA 4B09A 3ZQ4A 2VTVA 2FPGB 2XBLA 4R2LA 4EK9A 4F2PA 3EAGA 3P19A 1L7DA 4XOIA 3E7DA 4C87A 4RVSA 3DBOB 1ULAA 3EFEA 1Z5PA 2AEEA 2C99A 3DBLA 1YCDA 1Z2DA 4OYRA 3QMPA 3T12A 4EMSA 3P27A 1Y8QB 2JFUA 3JTMA 2Z6QA 1NYRA 2A9VA 1I2DA 4URXR 2AFIB 4QNRA 1XZDA 3L77A 1V1MA 2FR8A 5KMGB 2QNBA 5CITA 1K6JA 1FYXA 2QT0A 1A5AB 5KVCA 3OBIA 4RNCA 5BN4B 3GP3A 1KVRA 4CKBA 3VX4A 5K8CA 3WSWA 1JE1A 3TQRA 1DT3A 3SF8A 1VPTA 3T0FA 5A04A 1QV7A 1ORTA 2O2GA 3D8UA 3JWHA 3G1WA 3KS9A 4KPGA 2VF7A 2FU5C 3FZNA 5DV9A 4ZZ2A 1CR1A 5TMBA 1D7OA 3WWPA 3JR7A 5ENVA 3ZE2B 5JJIA 4NZOA 2XCUA 4QO8A 2X4LA 2ZT5A 5A7GA 3ICOA 4BTVA 2PANA 3H8VA 3HRHA 3B8HA 4KNVA 1ZUD1 4XJTA 1RHMA 4Z8YA 1K4KA 1RRFA 1JEEA 1ISJA 2KS6A 1DARA 2CB9A 4C3ZA 1NFRA 4AS2A 4ZI2A 4AQYB 4OLJA 4RGBA 3I3SR 5ICCA 5EIAA 5K0BA 4EYEA 3OEHA 2ZRIA 4GUAA 3VNQA 1NKVA 4JQYA 2G88A 3O93A 3B20A 5IJZA 1O8BA 1E2UA 2YIVX 3WQRA 1D2NA 3RT7A 1Z38A 4GC5A 1PR3A 3DDCA 1H5QA 2P9HA 3B13B 4HWOA 4WVFA 5ERGB 1NPYA 2HYIC 1PG5A 4WLNA 3MQFA 1F51E 3NR2A 3STTA 5E2AA 1JDZA 3DQQA 3I5AA 5KQLA 5JYEA 2IEIA 1W47A 2R44A 1B0AA 1JU3A 2FFRA 3U6BA 1L5WA 2QTLA 4NBKA 1RDFA 5HSGA 5GVSA 1RIIA 4E7PA 4RULA 4D97A 3TECE 3E58A 3OSUA 3QQPA 4R05A 3EGEA 3BEOA 1T4CB 2E4XA 2F48A 2QR3A 3Q2KA 5DVZA 2HT1A 1WHSB 2V9CA 2GR9A 4BLVA 1WW3A 3MWEB 3NWEA 3D3NA 3O4GA 2BFEA 2VJBA 4RA9B 3CX4A 3I2JA 4N0EA 3RD5A 4M8SA 1F38A 5TF4A 2HW8A 3T5TA 3WQBA 5F3DA 2O6LA 4J0IA 4BFWA 3NHJA 5AHWA 4DJDC 4DIBA 3LP8A 3OX4A 2WYHA 4N7JA 2PSSA 1DAFA 1NV8A 4TKLA 1M1NA 1YH3A 4ZJUA 3Q7SA 3DBIA 5TT1A 5EJMA 2NPFA 5EJEA 1GU7A 1KVSA 1OXTA 2DJ5A 3B6EA 4JOCA 5E1BA 1BZYA 3X2SA 4XM1A 5JYDA 4DCMA 1K4MA 5JQGA 3I9OA 4WERA 1JLMA 4FFPA 1MLDA 4BP9A 1TK3A 2GRUA 4HG2A 1EFDN 4TTJA 5JCOC 2HTEA 4Y6SA 5TR9A 5I01A 2K87A 2NADA 4IL5A 3LZ6A 4HLQB 4PLCA 5FAXA 1J2EA 1NVVQ 2N1BA 3FGZA 3K1ZA 5E0OA 5JECA 1GTSA 5CGZA 1XB2A 4KK4A 3NHSA 4BASA 2A5JA 2XE8A 3FNQA 3DJYA 3P5BA 3SZUA 5AI8A 1KEZA 2OXRA 2OZLB 3GVHA 4XOUA 3CUTA 4W1SA 2PSJA 2WU4A 3K20A 1FXWF 2HU2A 1NHWA 2PR7A 2BGUA 4I81A 3EPJA 4EEXA 4C2BA 4ETMA 4ZYYA 1FMFA 2B9VA 1G8JA 4BNUA 4TGLA 1NG1A 3JSXA 5IZ4A 4BVJA 4OK5A 1FZTA 4EGFA 4OYHA 2ZYUX 3LHKA 1WVIA 3Q5GA 2AZMA 3LPNA 4F4FA 1DG3A 3H2IA 4LV5B 2WPDD 1GLVA 3F8WA 4L4SA 3ZWQA 2ILTA 4BOYA 5K6TA 1NVWQ 5A3QA 1GARA 1G41A 1TVCA 3EYWA 3WGUA 1LK7A 2ATXA 3A8TA 4BRZA 1NP3A 4V0LA 1CUFA 5AW7A 1QQ7A 3OQVA 2R8XA 1FYVA 2Q9CA 1SAYA 2X2EA 3HABA 4JLJA 4O29A 4BWGA 4CHTA 1M0EA 1WD5A 1E9SA 2CVOA 2XR1A 1KP2A 3N6VA 1F8YA 1LWOA 4KXUA 4Y7DA 3UH1A 4EAAA 5I48A 2DPYA 1CIVA 4ICIA 1IM8A 5DX1A 2KHZA 1XKLA 1TW2A 4G63A 2CCGA 5DN9A 1P62B 1PL0A 3W34A 1XMSA 1QZ3A 5CDGA 3NTQA 2PZBA 4J6FA 3NS7A 3E03A 3IDZA 2XB9A 3FIJA 1Z0SA 3QLVC 4QRIA 5DH9A 1SQSA 4X3CA 3AF1A 3ANYB 3IHLA 3FUWA 1I13A 3ZWBA 1ODKA 2H2IA 2P9QA 3MPUA 4R8LA 1E7RA 2OXEA 1XFDA 5M3BA 2B2XA 4M36A 4PVDA 4B1FA 2FSVC 3U3KA 5FUXA 4ZVUA 3U4DA 3O91A 2OENG 4J49A 3WJAA 3SMQA 1D1TA 3V4ZA 4DTIA 4J2TA 1UXJA 1E3WA 1JG2A 2PN1A 2HBZA 1ZUNA 1U9ZA 3PXEA 3SQLA 3D4LA 3OPYB 2ZROA 2CNDA 1ICIA 2FRDC 4GLJA 1N2HA 3VPGA 4QEZA 3RUHA 5JROA 4LOKA 1W73A 5EWLB 4UAGA 3LYAA 3TLGA 3G2IA 1O4WA 3ORQA 3PPYA 3S5JA 5DLEA 2XWJI 3HBAA 4MWGA 3MUNA 3E9DA 1GV0A 2C2OA 3A70A 3TLYA 3UJBA 2ZUTA 1Q1BA 4F91B 2N75A 1TC2A 2GBLA 6YASA 1B8OA 2WWTA 4J3FA 4F3NA 3THRA 3HP4A 4ATNA 3EH2A 4MIYA 1ONPA 3W78A 2VF4X 3OEYA 1Q11A 2Z43A 4GI7A 1IG0A 3JQGA 4C05A 3ZK8A 4CMHA 1TM2A 1ZIXA 2GJKA 5D1NA 4CDNA 1OIVA 1KP9A 1PFKA 2ZRJA 4B5LA 3GFOA 2FR1A 2IQ5A 4GXQA 4OLFA 3VPCA 1KDTA 3FPJA 3OFJA 3NTUA 4NK5A 5AR1A 3ILXA 4A6DA 3A1NA 4ACBA 3UPTA 1SCUB 3LC7O 4QDZA 3UV3A 2JG3A 3T35A 2CF6A 1WOYA 2ZB3A 1UF9A 3GXBA 5G0SA 2YZMA 4EJ0A 3OQIB 4YLYA 4ZCRA 5ECYA 3O3OB 1SZPA 5HXAA 4A6XA 4DLTA 2A5YB 3F5DA 4M1MA 4O2BA 1RZRD 1ZINA 1A96A 4LNUB 1JF8A 4ABTA 3VZBA 3TVTA 4QPCA 1U2EA 2XMDA 2DY0A 1IPEA 3DM9B 2GYVA 1OQAA 3OE5A 2YOFA 2KBFA 2AKEA 1EP3B 2FK8A 3TSWA 1XL0A 4NOMA 1BJRE 1PWYE 2Y9PB 4PGGA 2VHTA 3MT7A 1EB8A 1MP0A 1V95A 1W85A 3FYDA 5D84A 2QSJA 5JMPA 3AI1A 3FPSA 4HL6A 2NVUB 4RANA 7ABPA 1JA9A 4DN6A 1PGOA 1JI0A 1QHYA 5J43A 1ZJYA 4GSKA 3OCXA 4MVJF 5HZMA 1WRBA 3DBRB 4QG7A 4CLOB 4V24A 2GBPA 4L57A 1NC3A 5K2OA 2RHRA 1FE8A 3IURA 5ECWA 2VP9A 2WD9A 3TCNA 3K8YA 1U7TA 4HBGA 3PGXA 4QUJA 1Z74A 3C4QA 4JDPA 3R0QA 4FDVA 2X9LA 1WUTA 2N1MA 4KMRA 3K15A 1T36B 2ZDGA 3KDAA 4M99A 3B9RA 3RI3A 2VTBA 3LWZA 4GU5A 4JBXA 4YECA 4MQEA 1DZIA 1QMGA 2R60A 3KDPA 2QPTA 4XM2A 1ENYA 4BO2A 4YAGA 5IU6A 5E2IA 2WKWA 2DM6A 1GOTA 2L17A 5INTA 4LPKA 3PKIA 1K89A 5BSWA 2A2ZA 4JSTA 3SIRA 1L1EA 1Y8RB 2XSZA 3E22A 4TKUB 5NULA 4BC0A 3AM1A 4TVBA 4RIEA 4Q6WA 3HCFA 2B4YA 3CC8A 2EVWX 1FTSA 3AERB 2TMGA 5A3JA 3U7RA 2K7ZA 2K5UA 3ZV4A 4B81A 4QG3A 1VHJA 1N3BA 4ZDKA 3GEIA 2WM2A 1JQJC 1JIIA 4IQ8A 3U7QB 4IGFA 2C7PA 3OO1A 1AM4D 1FTNA 3EXEB 3PTZA 2KSQA 2AZXA 1DC4A 3F7MA 2XIQA 2H2FA 1RNLA 1CP2A 3LIIA 2Z3WA 4Q7KA 4EG6A 1GDHA 5IASA 3EHEA 1KAGA 2G9QA 2XD9A 2NX2A 4RHTA 5B55A 3LHIA 4J1NA 4UMEA 5FQNA 4KRFA 3RKRA 1Z4LA 2MMGA 2Z08A 4MUKA 4YJ3A 3ZE6A 4BGEA 4C3OB 5FBVB 3H2HA 5K51A 3SZOA 3QOWA 2F64A 3QIVA 4HRYA 4QLBA 2OHHA 1KQFA 1C1DB 4A6PA 3LY9A 1LKZA 2P4QA 4OI0A 5EHIA 3PQDA 4BQNA 3P26A 4AZTA 4ZN6A 5JLJA 3LUFA 1GUDA 5GIOE 4HN4B 3LYHA 4WLUA 2HY7A 5CXQA 3QEBZ 2HWXA 5KYWB 5HKAA 1PRYA 1VBFA 5DFAA 4GPD1 3T1NA 3QJGA 4M1QA 3D31A 2BI8A 3MMSA 2QORA 3G49A 3CBQA 1R4ZA 1Z56C 5BY2A 3WNQA 2G4CA 2JDID 4JT8A 4R3WA 2QLTA 5KOHA 4EJ2A 2HTFA 1WULS 1FA9A 4BFUA 2FCAA 1IOLA 3GEPA 1XCMA 3PEUA 4M7PA 4Q1EA 2Q50A 3Q3CA 4PFJA 1XRJA 4U2CA 5AHXA 1TU0A 4ZKEA 4R2HA 1QVWA 4O4JA 5FUWA 2JJMA 2GM9A 3EEBA 3I72A 3MCZA 4EI2A 1MQ9A 1XDGA 4MKZA 1BYUA 4Y18A 5DM0A 5IP5A 3A6LA 1ZVMA 3AK4A 4ZPXA 2EJCA 5DHUA 4BQEA 1FNNA 2PHZA 2Y1EA 3WIBA 2QLFA 3NYRA 2HJ9A 1KY5A 3AUJB 4IX1A 3HPRA 4PSDA 2WWYA 2EF1A 2JASA 1FUIA 3HUEA 1YR2A 4ZRNA 5EE5B 4R1SA 1P73A 1AF4A 1RAIA 1B6SA 3E1KA 3H8SA 3Q0IA 1M8FA 1U2TA 3ZWCA 2XX3A 1YR6A 4AU1A 3RHZA 4HAVA 3K0FA 1C7QA 1LPOA 5DBFA 2FQXA 1IEWA 2JAWA 3E2MA 5HM6A 3WLFA 1YQTA 1HEYA 4I08A 4O4IF 4TS4A 1Y1RA 2C29D 2HRBA 3R4CA 4XR4A 5H59A 4BRWA 2I2BA 4LGVA 4RHCA 5HUHA 3BMNA 1YZLA 1WXWA 3NHBA 2D5AA 1ZXBA 1DAEA 1HQYE 3QVSA 3JY6A 2QN3A 2B3DA 3L0CA 4TS1A 5JBIA 1WB5A 4EHLA 1ZRHA 3RODA 4BKPA 3A9TA 4DC9A 1SR8A 3O2SB 3DD5A 5DTQA 1KR2A 2CLEB 4JJGA 4UVEA 1WDWB 1OT5A 3UT0A 4BMPB 1ORHA 4EX7A 4ZVQA 4UUPA 5CA0B 2QTWB 3JQ6A 2AOWA 2FHPA 5LA6F 1TT5A 4Z49A 2IYRA 2VK1A 1RQGA 3SS8A 3ELDA 1QFXA 3LQQA 1B76A 2QK4A 3QEMA 3QKRA 3QKSB 2O7SA 2NUTA 4YCCA 3LMKA 5AO9A 2B2CA 1E1KA 3NBMA 3IH5A 1QIKA 3OM8A 4OQMA 3QFRA 3ZY6A 4DR6B 1CUZA 2O8FB 4I4TF 2LVBA 3LVQE 1KOGA 1HRKA 2XUQA 3L0OA 5EIBD 2IF2A 1K5PA 4ML3A 5GJVC 4D92A 2QD4A 2G6BA 2XYRA 4QYWA 1NT2A 4ENQA 3AUXA 1JWBB 5KTRA 2QN9A 1AO3A 1M0WA 3WGMA 2RIPA 2AQHA 1CX9B 3DQZA 4M6WA 2VZ0A 2NO4A 2P0EA 5ILQA 5ED4A 3D8RA 2HXGA 2BRUA 1RXIA 2VJPA 4LGMA 1R4MB 4M0EA 1ISGA 4MV0A 1X1CA 2R87A 4P81A 4XFKA 5AXDA 4M83A 4RF3A 5K0TA 3DHWC 1EWYA 5CDUA 1QP0A 3WYBA 1W36C 2GLXA 3DLBA 3E23A 3WWEA 1Q0LA 3V3KA 5F98A 2XXJA 1CLUA 1R9NA 5BSUA 1X1TA 1REQB 2AVNA 3IKMB 4GBGA 2FPMA 3ZI7A 5KVSA 4EKIA 5A3VA 1HE1C 1IBSA 3O8OB 1DRJA 1QTIA 3AFNA 2FY8A 4TZTA 3CVOA 2JFPA 1STOA 1PVDA 1P8AA 2ZYHA 3EZ2A 1C8LA 1SG6A 4DPKA 3VDRA 4GW3A 1LPNA 3EEQA 2ZVDA 1OBVA 1PG2A 3H4TA 3UK7A 2X0KA 1T91A 1IOVA 4GPTA 1CY8A 1GZVA 2QAIA 4PAMA 3A1UA 3T7CA 4PLZA 2QI9C 4JJEA 3RAEC 1Z29A 1Q3HA 3LPDA 1SVLA 3B53X 1R8QA 4G0UA 1XP8A 3HXPA 3BL5A 4BNGA 2O8NA 3ZV7A 4KGVA 5BWOA 1YOVA 3ADOA 1LBQA 2A9PA 1FNSA 2WZCA 3BCHA 4WZZA 1I4EB 3KOXA 1KO7A 1YZ3A 2G1JA 4JMPA 5KVQA 3UUFA 4MAMA 5IG2A 5KHOC 4UXIA 5ARDA 2JARA 1YHZA 2XWPA 5JALA 4FGJA 1YQGA 2FEXA 3NTLA 3PX2A 4YDRA 3UUGA 2SKEA 1XZPA 1PZHA 1QHHA 2D7CA 3VV2A 1E4EA 3DOCA 4P1ZA 4AKSA 5B1EA 1TM1E 4CGYA 1XZMA 1DKPA 3EN0A 4UVIA 5B7NA 4C7OB 1CJVC 4FI3C 1NBMD 2JIPA 4LKOA 5ALVA 4BGVA 2HU7A 4IM7A 3W6PA 4YV1A 3UH0A 4YLGA 1NG9A 5CW2A 3VR5H 4B6QA 5TS3A 2CL7X 2HNKA 4N6NA 3WK8A 4KFUA 5JRZA 2EEPA 3KB1A 5EMKA 1SQFA 5FBLB 5DM60 1ULTA 3JD4A 1GR1A 1GRQA 2Q3LA 3EDOA 5DNDA 3OQ6A 4QXMA 3I01A 2Z0MA 2QXTA 3DKPA 2KQUA 3IX7A 3R24A 5CFMA 1FFHA 4RY0A 3MFYA 4P5PA 3V46A 4D74A 3L0PA 2J32A 2O8EB 3EEYA 4GMKA 4YXFA 4J0QA 2IUEA 2BF7A 3P2KA 4CV0A 4PG6A 3UC5A 3SR0A 4PX5A 1DI0A 1UANA 4EMUA 3IE1A 5TVKA 1IUKA 5I4IA 1X3SA 1VKZA 5E6SB 2NZ8A 4MQFB 4RPJA 4FT2A 4KR2A 4KR3A 5CMLA 2C4WA 1S96A 1W46A 3TM5A 4CKZA 1IC6A 1N0VC 4WESA 1JR3D 3D8TA 3NWOA 2JD0A 3BN3A 1D4OA 5LQRA 1QH1B 3FOBA 3B5JA 4O2AF 2I3GA 2GK6A 3WIUA 2IF0A 2F1RA 1TYBE 1ETHA 1ZK0A 4ZP1A 1RE0A 1RKVA 2BKUA 2WHYA 4GX2A 1H85A 2BJWA 3R9XA 1P1FA 4B17A 2IOFK 1NF3A 4LW8A 3FUCA 1XZCA 2BONA 4MX8A 4R1LA 2JHFA 3SP1A 3G5AA 1RQPA