4PQRA

Mycobacterium tuberculosis reca glycerol bound low temperature structure iib-bn
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
326
structure length
309
Chain Sequence
PDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 95
structure length 309
sequence length 326
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4pqrA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4pqrA01
2FSHA 1E79A 3EIEA 4QGAA 2W6IA 4B75A 3OEED 1DAEA 1IY2A 1LY1A 2ZS8A 4M1OA 4MRSA 4YQFA 4TWZA 3QE0A 2EU8A 3E70C 4ILEA 1CXZA 1ZUNB 2B21A 2LWIA 4B6EA 4DB4A 3OHMA 5KSPA 1DG1G 1KI9A 3CZPA 1JR3A 3BORA 4LJ9A 5IT5A 5E7IA 1IQPA 3AP1A 1GZSA 2W58A 3W5JA 1L4UA 5GJVC 3P20A 4M9QA 3RS4A 3TK1A 2OCYC 4HUQB 3W3ZB 1OXXK 4UNSA 4NCJA 3DMNA 4RFSA 4M0LA 1VCNA 4TYNA 3E5HA 3AGPA 4XSGA 1UKYA 1K8RA 2WAXA 1U9IC 1ZNWA 4O3MA 1W2GA 2NPFA 1E2IA 4BRUA 2EFCB 2VA8A 5E7JA 4NCNA 1FP6A 3KTAB 4EPYA 1ZD8A 3IIMA 1GP2A 2OILA 4LGMA 1TF2A 4PTLA 1G291 3EC2A 5CYOA 4P31A 2NPIA 3HP1A 5FBWB 4A36A 3GEHA 2FDCA 1VG9B 1JR6A 1UBFA 4MKIA 2XXAB 3BD9A 4IDNA 2BM0A 1SQ5A 1ZW6A 2D4HA 4DHEA 2XNDD 2C9YA 2DWPA 4MKHA 5F9HA 1LVGA 3K09A 4JIMA 4NHOA 1NVWQ 2WKQA 2ZYTX 5KPDA 1ZNXA 5IK2A 3K70D 5G3YA 2ANCA 3B5JA 3NBXX 1E96A 2CBZA 4URVR 3ASZA 2REXB 4LBWA 1O3YA 1MABB 4GDFA 3ZZTA 3H84A 4Q48A 2V1UA 1P4SA 2R2AA 4YONB 3IGFA 3PEYA 4HATA 3U3RA 2JLUA 2ZRDA 2XTZA 3EPLA 5JWRA 5CDFE 4EQ6A 1G3MA 1WRBA 3QKRA 1P60A 4YMVA 5DISB 3RRMA 1RRGA 1Q44A 5CJ2A 5HZKA 2O8BB 3W6OA 1RZ3A 3RRZA 4AK9A 2J7KA 1CP2A 3KDSE 2N1BA 4AKIA 3U2QA 1IM2A 3RC8A 3CRMA 3PJRA 1CRQA 5LB4A 1DAKA 4LYAA 4Q4HB 2ZUCA 4LC1A 5FI1B 3UWOA 1S4QA 3AF1A 1Q12A 2EW1A 4HI0E 1SVOA 2VF8A 5K8TA 1KNQA 5JHGB 1XMSA 5UKDA 3QI2A 2FFQA 2C8VA 4NTZA 5SZKB 2LKCA 4JS0A 4OQNA 3TQCA 1OB2A 2ORIA 1GOTA 1E0JA 4TZ6A 1G1MA 5FBQB 4M21A 4QM7A 2C98A 2BMFA 3D3QA 1NG9A 3NHAA 1KJYA 2EFHB 4M1MA 1XXHB 4D0LB 3VKGA 3K8YA 3IDQA 4LZZA 3W90A 3LA6A 1SKYB 4MGZR 4B48A 2A5FA 2IYSA 2XOKD 1GUAA 2BHRA 3CWQA 5JZVA 4ZDIA 4QBHA 1KKMA 2OCAA 2AK2A 1GRNA 4DIDA 2EFEB 4LYHA 1CBUA 4MA4A 4DZZA 4IVQA 2Y8EA 1R7RA 2FH5B 4QL3A 1NJGA 1OFUX 3L0IB 1Z29A 3C8UA 1M7HA 1TL7C 1NVVR 3O8DA 5KNDA 3SR0A 2ZVQX 5FUVA 5G3ZA 3DMDA 3VU9A 5GADl 2D2EA 4LV5B 1A2BA 1KJWA 1D5CA 1RYFA 3JVVA 4NYIQ 3BXZA 2JLRA 4MQBA 3CF2A 4GRAA 1W0KD 4FCWA 5ELXA 1NVUQ 4TT3A 3EZ2A 3UATA 1H8HD 5TB5A 3KZ1E 2ODBA 1KZGB 2C96A 1XXHE 4TMZA 3D8BA 2KE5A 4NL4H 4TTRA 3WBJA 4M9SA 3CIOA 1SKYE 2IS4A 1EXMA 2OXCA 1PUIA 2CEAA 4I99A 4GPTA 1GM5A 2FPLA 1LB1B 2R9VA 2ZANA 1R5NA 4LHZA 5FTMA 2V6JA 1IXRC 4ZDKA 3U6BA 3CF6R 1T8UA 4TLAA 1P6XA 4JLMA 2YWHA 4EKDA 1Z07A 2JJ1A 4HLUC 4WA7A 4URXR 1FX0A 4AI6A 4PQYA 1VDZA 3B6EA 4OHVA 3CM0A 4JT4A 1XEXB 1EWQA 1LW7A 4XVUA 2RMKA 2NO7A 3BJIC 3P27A 3PQCA 2HCJB 2OV2A 1XF9A 3IBGA 2XSZD 4TMWA 1GFIA 5DHAA 4LK2A 2YWEA 1P5ZB 1RC8A 3GD7A 3DO6A 3FHCB 3KQKA 4XIGS 4WAUA 1KI6B 3IPXA 3WYGA 3IO3A 2JIZD 3AVXA 3K0SA 3PCRB 5E4FA 4F4CA 4B71A 1ZYUA 4AKHA 1AM4D 4MGKR 4NMMA 4JBXA 4C3ZA 2B92A 1GKIA 4O0MA 2ZUDA 2ZXUA 3RSOA 1N5IA 1AGRA 2OBLA 2CVHA 2PL3A 3B1YA 3TW4A 3VR1A 1GSIA 5GVSA 2A3RA 5DO9A 3A1SA 2MMCA 4PHHA 3SYNA 1W7AA 1DBSA 2RGNC 3KTAA 4LV8B 1E0SA 1SGWA 1W48A 4Q21A 1U98A 1XCPA 2YVUA 2ZJ5A 3BK7A 2R44A 2R8RA 2WZQA 3E1SA 3QG1A 1XPOA 1OJLA 1AIPA 1L8QA 5SZIA 3GFTA 5CIQA 1WXQA 1Z22A 4TQ9A 1RVDA 4GP7A 1G21E 1N6IA 1ZMXA 3SHWA 1X1SA 4IVRA 1X3SA 2ZRJA 2GXSA 3U61B 4JBWA 1CU1A 1FZQA 4DLZA 4PO8A 4Q5IA 3QPWA 4KO8A 3VMFA 3LH5A 5JJIA 4RCZA 2QM8A 3ZLJA 4S35A 1G41A 1XPRA 1VIYA 3B9QA 5G41A 2VL7A 1JEDA 4IDOA 1PLLA 1F6BA 3U3JA 2ZSEA 1XTRA 1YRAA 3TR0A 4ZI3A 1XEWX 4URYR 2AHOA 1KO8A 1F2UB 4TZ0A 3V4FA 3B1ZA 3EZ7A 4TTPA 1P9WA 4BFYA 4TL7A 3WHLA 2QU8A 1F48A 4ERNA 4F93B 4HB0A 3N2EA 5E95A 2VF7A 2VHTA 1CR2A 2H17A 3K0FB 1ZVQA 3LX8A 1KOFA 3FFBA 3VR5A 4XWKA 4LYJA 3OFNA 5FI0B 2BBSA 2BMJA 1Z3IX 4OI4A 1J99A 2R6DA 2W83A 1CTQA 2VQSA 3UMSA 4C2TA 1EFRD 4G1UC 4Q4AA 1ZINA 2OBMA 3CRW1 2IUSA 1II8B 1TEXA 2YZ2A 1IN8A 4K81B 1Z0KA 2GCOB 4BECA 1GL6A 5KYKA 1MT0A 1Z6YA 3ZH9B 2DYKA 4FN5A 3QBVA 2CJWB 4UXIA 1DVRA 3CF0A 4V0LA 4IOMA 2H57A 1N3BA 1DOAA 3OE7A 4B3XA 1GL7A 4BZQA 1W36C 3I8SA 3QENA 5IF9A 2NTYC 2I1VB 1D9XA 3H86A 1W44A 1I4TD 4QHSA 5EP1A 3OZXA 4A92A 4YMTA 1JQLB 3EZFA 3UG6A 4BLSA 3GEEA 3SJCA 2FSIA 5FL7D 1W49A 5JS7A 5HCIA 4TN1A 3LLUA 4LJ7A 2W2TA 3KKQA 4BQSA 1E2JA 2J9RA 3SJBA 2XTNA 1IXZA 1XD9A 3EASA 3EXAA 4PPNA 5HZHA 1U9IA 3Q5EA 1GKUB 2QP3A 1QG4A 3QXHA 3W34A 1EFTA 3W5IA 2AXNA 2Q3HA 4KCGA 4UNPA 2Q21A 1U94A 2IUUA 1M8PA 1L4YA 1JNYA 4LCBA 3T1QA 4Z54A 1N6HA 4C2UA 2O0JA 4I1SA 4EFMA 5TMPA 2FGJA 1U90A 1YR6A 3KKPA 4DCSA 3AKDA 5EE9A 3MD0A 4ZI2A 2AWOA 5DGXA 2ERXA 2C2HA 2R6GA 1PLKA 2IYUA 1G6HA 2IYLD 2OLKA 4D4LA 1Z0JA 3C7KA 2V7QD 3WBKA 1YZTA 3GJ7A 2WM9B 1G3IA 2DPXA 1YJ5A 2IBMA 1KDTA 2GVZC 4PHFA 5D3MB 3EIHA 5FOVA 1I2DA 5TVKA 4KYIB 4URWR 1MRNA 3GEIA 2B6HA 4ZCLA 1GILA 1IHUA 3Q8XB 1NBME 3T1VA 3IBYA 1NN3A 3MWJA 1UM8A 1XTIA 3FKSD 1NN1A 4RKFA 1NY5A 4TYPA 2P5SA 2V6IA 1DAIA 2ZRPA 2C77A 4IOJA 1BH2A 1D2EA 3EIQA 3LVQE 2A9KA 2ZE5A 2P6RA 1ZRHA 3C4JA 3EAQA 5HPYB 3R9XA 1J90A 5BN4A 3PVSA 1SVWA 2V8OA 4LI0A 3A36A 1CLUA 3KKMA 3AVVA 3I92A 2PZEA 2D3WA 3RRYA 2C95A 1HY3A 1MKYA 1TTTA 4DJTA 1M2OB 2X8AA 1OFHA 1NF3A 2WKPA 2O8EB 5EE0A 4ZCMA 3B2EA 4JVSB 3T34A 3QUSA 1VG8A 2WSMA 4DDWA 2GETA 2QMUA 2XJ9A 4WZ6A 1H8ED 3GFPA 1YR8A 1E6CA 2PLRA 2N46A 3NHBA 1J7KA 2R6CA 4EJSC 3B13B 1IAQA 1ESNA 3PXGA 3ECCA 2ZJZA 4OI2A 1U2RA 4UKDA 5AJXA 2ZRCA 1R8QA 3A58B 2P67A 4NPHA 5FUYA 2FX3A 1BMFD 1G4AE 1J8MF 5G40A 3WP0A 3THWA 2AWNA 4DEYA 2H16A 1NSFA 2G0NA 5KSZA 2RGXA 1T0HB 1Q57A 1W0JA 3NVAA 2DWOA 1QBKC 4RD3A 4HB4A 1E2EA 1OSNA 5HR5A 1N5KA 1NLZA 2ZIAA 4CEHA 1IN4A 1XD2A 1VIAA 2WSSA 4UJ5A 1OH8A 2GTPA 4R2IA 3CW2A 3TH5A 3KFXA 4A15A 1U8ZA 4QKQA 1Z06A 1Z6TA 3KKNA 3IHWA 2D7DA 1Z28A 3DKVA 3KB2A 2P0EA 3CKLA 2H8KA 1AS2A 3I5YA 1CJUC 1P72A 2YINC 4US0R 3BFVA 4LSGA 4KSBA 3VR3A 1S2MA 4HLDA 4D81A 5JFGA 1KKLA 1FQJA 4RD4A 3LNCA 1C1YA 5FTLA 3TW8B 2RGCA 5FBLB 3C5HA 3P32A 3VTKA 3K0FA 1NN0A 4D25A 3QY0A 3SNHA 4YDSA 3E2IA 3HU3A 3V4RA 3BH0A 3LAWA 4CW7A 3Q72A 4W5WA 4XOIA 4ZV4A 1D6JA 1KI1A 1XFAA 1P75A 1FUUA 4HLUA 3ZGXA 3OEHD 2OESA 2JJ2A 3AUXA 3OF5A 2G9NA 3UK6A 2QP9X 1S1CA 2JLWA 1CS4C 1FP7A 4C30A 1X6VA 5JWHA 4M4SA 3DM5A 4KVAA 1G5RA 2IT1A 2IYYA 3AP2A 3TR5A 2QTFA 1COWA 3CRVA 2O8BA 4ZDWA 4PO9A 3Q3JB 4CGZA 4YDHB 3ZQ6A 4IDPA 3A6PC 4ZDJA 1DADA 4X8OA 4A2PA 4LJ6A 2GZDA 4EPWA 2P6NA 3ADDA 4YMUA 2IK8A 5DE3A 3WNBA 5FR2A 1A2KC 4FMCB 4GMXA 3QF7A 3LQRA 4V02A 4FXPA 4A8JB 2ORVA 2ZSAA 1E2GA 4MYUA 2BCJQ 1XBTA 3QQ5A 4L9SA 1EFCA 1NBMA 1TF7A 2ZROA 3PFIA 1FL9A 4TLEA 4M1TA 2QQ0A 1M34E 1UDWA 3TNFA 2YNMA 1Z6GA 2ZM5A 4LBYA 3LLMA 1F5NA 3OAAA 3NEYA 4Q9LA 3RWOA 2J0UB 4EJSB 2I1QA 2RGNA 3TVDA 1E1QA 1ZU4A 4TQAA 3NC1C 4LV6A 1Q1BA 2XTMA 2ZE8A 4B3GA 2QTVB 4WZAE 2BJVA 1KDRA 2AR7A 2O0KA 3T35A 2ATXA 1EWRA 3PEUA 1KDOA 3GJ5A 3WHKA 4QGGA 3R8CA 2PEZA 1GL9B 1S8FA 3U44A 3MGCA 2EWWA 2AD5A 1N6NA 5C1BA 3SI7A 1Q3HA 4NKRA 1XDBA 1DE0A 2JLXA 4CRWB 4PC2A 4PPQA 2BBWA 4DUGA 4PAOA 2ZI7A 3FGNA 4Q4LA 1E79D 1QHSA 4B33A 3X1DA 6Q21A 2W6ID 4PSVA 2FJUA 3NH6A 3SJAA 3O47A 4DLRA 3K70B 2ZJBA 5CK5A 5DLQC 1UEIA 3L43A 4NDZA 1N0VC 1MO5A 3BB3A 1JR3D 1G17A 3MWYW 1JXOA 1DAGA 2CHQA 1W5SA 1RKBA 1Z2AA 3DEFA 4HZUA 1HA3A 3P4YA 2NIPA 4MGIR 4OI0A 4QOSA 2AX4A 4M1SA 4TSFA 3NBZC 5JLJA 2JEOA 4AYTA 2J7PA 1XB2A 1KK1A 2PJZA 4DCNA 1W47A 4K8OA 1QVAA 4MITA 2JLVA 1VMAA 2F7SA 3NDBB 3ADBA 4JSYA 1AS3A 1YU9A 4A0HA 4C0AC 4H9GA 5LB2A 1QG2A 1N6KA 3M4YA 2O8EA 4EPVA 1RRCA 1F2TB 3CLVA 1B0UA 1S3GA 1ZM3A 4RZXA 3U7GA 1NKTA 4F38A 4WOPA 1U0JA 2QUZA 2XZPA 2ZSFA 3EA5A 4TLCA 3Q85A 4B6FA 5A4JA 1T91A 5BQ5A 4UNRA 4BLPA 4JSTA 5IK2D 3QEOA 1TQ2A 2CLCX 3AVWA 1KMHB 5EXPA 2HYIC 1LNZA 1YRBA 2VPPA 1W1WA 4B76A 3VKHA 4DLVA 2IS1A 2HF9A 1A4RA 4TYQA 1PLJA 4RSGA 1G8FA 2MSCB 1LFDB 2CCGA 2F9MA 2QGZA 4TYYA 1G7RA 4KODA 1GRQA 4Q4JB 4Q9JA 4W9MC 4AYXA 1WCV1 4WVFA 3GJ3A 5AK0A 2FEMA 3W6NA 5H68A 5L3RA 4FWTA 4CIDA 1E99A 1G3RA 1Z2CA 1ZC4A 1SVIA 4P32A 2IWHA 5KPJA 1T4GA 1G19A 1JJ7A 2NGRA 4KSCA 3VAAA 3GLHA 5KDLA 4B35A 3U4QA 4F4JA 3A8TA 1UEJA 1KI2A 3BB1A 2GEDA 3HYTA 5EUQB 2Q3FA 2QQEA 2HXYA 3LDAA 3TSWA 5EP2A 1EX7A 4NCIA 1E9CA 5KHOC 1LTQA 2O8CB 2QI9C 4D2IA 4U5XA 4DT1A 1BO6A 2UZIR 1P3JA 1MO6A 1R0ZA 1XP8A 2ZE7A 5DI3B 4DLSA 3GMTA 4IJMA 4NYJQ 4XJXA 2QT1A 3C41J 4F4IA 1KGDA 5GJBA 1N6LA 3AH8A 3UMRA 1CR1A 2PH1A 3QJYA 4JLDA 2ZRFA 1SHZA 1ZIOA 2EFDB 1WE2A 1NLFA 4R7ZA 2RCNA 4HB2A 4Q9KA 4FMCF 5DH9A 3GLIA 2BOVA 1AJEA 3G5UA 4Q1BA 2A7QA 4BWYA 2IYQA 3HDTA 4GBMA 3QBTA 5KDOA 3H1TA 3BH7A 3PUXA 4C0LA 3F3YA 4JLKA 3N70A 1IN6A 1B23P 3KQLA 3S1AB 1NIJA 5TXGA 4V0NA 5KTYA 1TUEA 1A7JA 2ZRBA 1E9BA 5AUOB 5CYPA 2L0XA 3Q9LA 2OCBA 2YC2C 2BV3A 2OCPA 1YZNA 1Z6XA 3X2SA 3G82C 5JWOA 3IO5A 3AP3A 4GSYA 1VG0B 4LHYA 1S9HA 1MRSA 3CH5A 3HJNA 1T5IA 1E2DA 2CK3A 3PIRA 2F1RA 1RIFA 1BKDR 2J87A 2IWRA 1DG3A 4C0QC 3QF4B 4L15A 2C99A 1Z0DA 4Q00A 3UG7A 2PCJA 2OFOA 4XTRA 1WA5A 2ZUBA 1GIAA 4TT3D 1Q3TA 2H7VA 2F43B 4M1WA 2VP2A 1MOZA 1FFHA 5A0FA 1I4DD 3UIEA 4B34A 4PR0A 2FFAA 3GLGA 2CCKA 1HQYE 4CVNA 2Z0MA 4W7SA 3X1YA 4BRWA 1TQDA 2J45A 3AVYA 3NEJA 1II0A 2QZ4A 1VCOA 1UFQA 2OUKA 4KXFB 4US2R 2N42A 5EE3A 4OK5A 1TUIA 3HWSA 1E0AA 4QJ5A 2JJ1D 1JJVA 1W4RA 4OYHA 1HT1E 1ZUHA 3B7GA 2VRWA 3ETLA 4NYMR 4LRWA 1U8YA 5FPTA 4LJAA 3U7FB 3T5DA 4D4MA 1EK0A 2EYQA 2MSDB 3ZJYA 3THXA 4NH0A 2FWRA 4QG7A 1U99A 3I4LA 2GEVA 1JALA 1SXJA 2GA8A 4ZIRA 4NONA 4DCUA 2B8WA 5B64A 4BFZA 4P33A 1OIVA 3LV8A 3U3KA 4Z8XA 1N6OA 4Z8YA 2OLJA 2XGJA 3CWZA 2ZR9A 1AGPA 4A2WA 4K46A 3ZZ0A 3ZVRA 4C0HA 4RZ3A 1FW6A 4W5HA 1FTNA 1N25A 4BFSA 2XX3A 5LPNA 2EYUA 3THOA 3B9PA 4AURA 3LX5A 3DPUA 1HEIA 2GNOA 4P4SB 1SULA 1HV8A 2ZR7A 2J0SA 2B7BA 2CLDX 2KSQA 2ZI4A 5KNCA 1QZXA 2GK6A 4CEIB 1XZQA 1N5LA 2GF0A 4EPRA 2ZYUX 4JL6A 4DLWA 5J4YA 5AWFC 4L5BA 1NLYA 4IEIA 3SJZA 4M1YA 4M2LA 2IYVA 4GT1A 4JLVA 2EWVA 3QPVA 2HCBA 4NCHA 1SZPA 1N5JA 3QVVA 1CJKC 5JECA 3THYB 2O8FB 1HQCA 3K0AB 4HAZA 2GESA 3DDCA 3F0TA 3AVUA 4PAQA 4Q1CA 4N0DA 1R8SA 4LJ4A 4YMSA 5C4MA 2FFBA 3QKTA 4MUAA 4Q4JA 2ZJ8A 1DPFA 2XB4A 5GJWC 3CPHA 1US8B 4HDOB 2IYRA 5J4LA 4XD7A 4EIWA 3K0CC 3FHOA 1S9DA 5P21A 5C46F 3U3MA 1HUQA 1DAMA 4WXPA 2KWIA 4C0SA 4C7OB 4TYWA 1ZJ6A 4OQFA 2FNAA 2ECKA 1UDXA 5CDFA 3VNVA 2EQBA 3BH6A 3ZVLA 4X8MA 3EZ6A 4HUQA 1AK2A 2NOAA 1E9EA 2YHSA 2QY9A 3P26A 2JJ8A 2PZGA 3AF0A 5CJPA 4YXWA 3TMKA 1IN7A 1HE8B 4H1VA 3QIAA 4YC7A 3TUZC 3OFND 4NZYA 1JPNA 5BN5A 3OIUA 1WBDA 4PPGA 2WMNB 4BFUA 4TLDA 2H5EA 2D06A 2GEUA 4ACBA 3AF4A 2V4ZA 2OEPA 4QHYA 2OM2A 4HDQB 3GPLA 4MH0R 1XJCA 1E4YA 2P65A 5KO2A 4RD0A 3B1XA 2ZU0C 4W5JA 1OKKA 2CMKA 2XXAA 2WWHA 4N0EA 1KO4A 4LHWA 4LJ5A 4DVGA 1R2QA 3KQHA 5FBVB 1XEFA 2OXRA 4HEJA 1E2QA 1DAHA 4UXJA 4PX9A 3VNUA 3OE7D 4OHZA 1RRPA 2HJGA 4MGYR 3GLFB 3F5FA 2IF2A 4DC9A 1SHKA 3MRSA 1MABA 1WQ1R 2BM1A 3QNUA 4KYUA 1UF9A 4QJ3A 4MKFA 5CB6A 1TU3A 2VSXA 3A37A 2Q6TA 2BIFA 2H92A 2JLSA 3AF2A 4MYTA 4KVGA 1DO0A 3B78A 3A1UA 2D62A 4Q19A 4X8HA 4XVQA 4JLAA 4V0OA 4IXNA 5KSYA 2WWGA 4B73A 5H8WA 1G7SA 4NP6A 2CNWA 1E98A 3BB4A 3I73A 4Q18A 4KLZA 1D2NA 2GJKA 3RC3A 4B3CA 3J81k 3SS8A 4I4LA 1P7CA 3AGQA 3FDIA 3IEVA 3TJZA 2RH5A 2IHYA 4Q4HA 5G53C 4DIEA 2PX3A 2JGNA 4IW3B 3D6TB 1OH5A 5JI3E 3CX6A 2IA5A 2Q0HA 2Q9CA 1D9ZA 1MO4A 1WDTA 2YOFA 4RD6A 4WZBE 3X1WA 1NG1A 3HPQA 2IXGA 2BDTA 2GXUA 3Q5DA 1KY2A 3QF4A 4L8GA 3ND9A 3WMGA 1XMJA 2WMOB 1HURA 5AUNB 3RWMB 1SVMA 1E69A 2E87A 1GDDA 3LBIA 3HU2A 3I3SR 3GLFE 1CR4A 2Q9BA 1R6BX 3U6KA 1R0YA 4ASUA 3BC1A 1WMSA 3KJHA 3RS3A 5DYIA 1JB1A 1XXHA 4L4UA 2IF0A 2E1RA 1IY0A 1WP9A 2CLSA 3NTUA 2WWFA 2Z83A 4PQFA 1RRFA 3ZIAA 2ZAMA 1ANKA 3NH9A 1XD8A 1JXMA 5AUPB 3SU8A 1TEVA 3WXMA 1HE1C 3L8YA 2FU5C 1E9FA 2ANBA 2OO7A 1K5DA 2ZEJA 4IFEA 2ZJYA 2ZJOA 1GVNB 1AZSC 2CXXA 4HZIA 4RVCA 4FCTA 1ZNZA 2WOOA 4QFMA 1QVRA 3TAHA 3GJ6A 2QNRA 3AVPA 4D0GA 5K8UA 1Q0UA 4RFVA 1ZCBA 1UPTA 1Z0AA 2A5JA 2PLFA 1NIPA 1O87A 2QSZA 4Q9HA 2ZU6A 2QTHA 221PA 2RAPA 5FTNA 4D0NA 1OB5A 2VEDA 1IXSB 1GNRA 3B82A 2YJTD 3SZRA 2ZI3A 821PA 4LPKA 2HLDA 2GBLC 2W6JA 1EFUA 1JBKA 3CO5A 2DWQA 2P5TB 3LWNA 1KK2A 1W4BA 4JL8A 4D26A 4M9XA 4JJZA 2FPMA 3EX7C 1RPZA 3Q7QA 2BWJA 5KUTA 1P62B 3ZS9A 2G1JA 2FEOA 3I1FA 4OL0A 4QM6A 3UPUA 4BZXA 2Q3MA 5F2EA 4DSNA 3CH4B 2WPDA 4DSUA 3VHXA 5BXQC 1OHHA 3NIBA 3QKSB 4O2LA 1Q22A 1P2UA 2OZEA 4LJYA 2ORWA 2V9PA 2HT6A 5FH9A 3KFVA 3I5XA 5JSZB 2BMEA 2RGDA 2XITA 2FZ4A 4XSHA 2C9CA 1T5LA 1W0JD 1SVLA 2OFXA 2QP4A 4E22A 4M8NE 2O8FA 1ZM2A 4A0GA 5KOYA 5C2JB 1E9DA 2QMHA 2ZS9A 3NWJA 1Z83A 3V00A 1XEXA 1G8PA 1XU4A 4G3XA 4BLQA 4GL2A 4Q7MB 3KUCA 2WSSD 3ZZUA 5IDVA 3LXRA 3I32A 3K09C 2QG6A 1US8A 3SYKA 3AV0B 1EG7A 3K1JA 1F60A 1U8AA 1KI6A 2VYFA 3LY5A 5L3SB 3TVTA 4QHTA 2KI5A 4YLGA 2RGBA 3AEZA 4AD8A 3ONWA 5JEDA 5FTJA 1I2MA 1UKEA 4A8JC 2QRNA 4Q1EA 4QGHA 1AQUA 2P2LA 5JMTA 4BGDA 4D82A 1Q21A 4TQUS 4UJ3A 2QA5A 4JLNA 4LUCA 1KMQA 3MSXA 4G5GA 5CK4A 3RDPA 4EPXA 2AN9A 1AN0A 3RS5A 1YR9A 4CEJB 2B8TA 4BE7B 5LDDC 3LBNA 3PR1A 4IFBA 4KU4A 4CF7A 2ODWA 4LYFA 4LHXA 3TLXA 5M04A 4PSKA 2Z4RA 4QNMA 2IS2A 5DNYB 3M6AA 3GP8A 2X1VA 4JKIA 1AA3A 4CZ2A 2QBYB 3CR8A 3ND8A 2JJ2D 2DB3A 2CHVA 5BN3A 3BRWD 3D31A 3PENA 3FMPB 4KFUA 3SC3A 4IOKA 2QM7A 3DZDA 1COWD 3CNNA 1WBBA 1XX6A 4KHZA 3H0KA 1XCGB 2XNSA 4OHYA 2Z4SA 3PUZA 3GLFA 4TMXA 2X2EA 3RABA 1E2HA 2BBTA 4ESHA 1FOEB 2FZLA 1S0UA 2G83A 4A6XA 2AKAB 2VP4A 3G0HA 5EXXA 1G6OA 1N6PA 1UAAA 2QL6A 1G18A 4E5UA 1NBMD 2I3BA 3GJ0A 1NKSA 3K70C 4C9BA 3KJIA 2RKOA 1PUJA 3W3AA 2GWHA 3TE6A 5H70A 1LF0A 1F2UA 2XJ4A 3OAAD 3B60A 5BYKA 1NI3A 4MKGA 2EVWX 1E1QD 2V55B 4B43A 2GILA 2ONJA 4C4PA 5J47A 1VG1A 2DFNA 2HUPA 2V1XA 2YOGA 5EE1A 5FOTA 5GVRA 3ADCA 4PZZA 1D2MA 4AG6A 5FFMA 1SKQA 4JYCA 3AM1A 1TF5A 2NZ8A 2WIBA 3CUEF 4DBLC 421PA 3JVUA 5FOUA 3IHLA 2ODNA 1UADA 3RHFA 3BFKA 2JLQA 2GAAA 5ANRB 3IEUA 1KY3A 1E2MA 1II8A 3R7WB 5FPKA 1P2TA 4Q9IA 2BKEA 2GCOA 1FNMA 4HAWA 2IEYA 3EC1A 2GF9A 4CT4B 4O2RA 1ETUA 4I1OA 2CJWA 2P3SA 4DUGD 2A5DA 4DCVA 3TQFA 5CM8B 3SOPA 2IHBA 3LFUA 4JKYA 3K0CA 2BEJA 3T06B 2REBA 1G64A 1BYUA 4OQLA 4PFSA 1E0KA 1S1MA 4MRPA 1MO3A 8OHMA 4QGFA 1P9RA 2HDNB 2HYDA 521PA 3AKYA 1E1RA 1VECA 1M7GA 2JDIA 2OE2A 2QAGC 4NYIR 3PEWA 1N0WA 4EQ6B 2BMDA 1QDEA 3QKRB 2QORA 4J0QA 3SQWA 4TSFD 2ZI6A 5L8VA 2J7PD 2X77A 3T12A 3AUYA 2J0QA 1IJEA 1VPLA 4P3YA 3TKLA 3I8XA 5J40A 2O8DB 3AB3A 1RFLA 3GJ8A 4FI3C 4B2PA 4D6PA 2WBLC 2WJJA 3EARA 4Z1MA 1OT3A 4OHXA 4ABYA 4QXAA 4KBGA 1QHHB 1EX6A 4JVMA 2J3EA 3T15A 1KI7A 1Q20A 1GNPA 5CLQA 4JZKA 2F3RA 3RS2A 4TLBA 1SVKA 3IUYA 1LS1A 3LO5A 5DN6A 4XVRA 1W36D 4B44A 3I72A 4URZR 1GKYA 1N0UA 3HPRA 5D3MA 4N3NA 1CULC 2QRZA 3ZVMA 1DELA 4ARZB 2YYZA 4A82A 2CE2X 2DBYA 2MMGA 4ZKDA 2W0MA 4B3FX 4GFDA 5JSZA 2HEIA 1TMKA 1Z47A 4JBYA 4E03A 4TL6A 4UXHA 5EE5B 2A78A 3VQTA 2IYZA 3RNLA 3ZVNA 121PA 2HV8A 2WJVA 5DSZA 4DWJA 4ESVA 3U5ZB 5L3QB 1ODFA 1JPJA 3L8ZA 2GAOA 1R10A 2VBCA 2WICA 2VSFA 4B2LA 4D4JA 2ZRLA 3ZD7A 2QE7A 4MUBA 3DOFA 2Z43A 1AKEA 5FPHA 1S96A 3RAPR 1P73A 3GQBA 1P9NA 5EQTA 3FFAA 3VX3A 3EPJA 1KK0A 1OIXA 3VU9B 1XRJA 1GTVA 4JT2A 2OG2A 3NBYC 2QN6A 3RS0A 3WYAA 2G0TA 1WF3A 1G4UR 1XMIA 4FIDA 2ZVPX 3BE4A 4QNRA 2HXSA 2I4IA 2ZETA 3C16C 1MR3F 3FKQA 3A1VA 5FBRB 1Z0IA 2DHRA 1A5TA 2QEQA 2ERYA 4DKXA 1XJ0A 1XNJA 1GRRA 1DARA 3WMEA 4YMWA 1F3OA 4BASA 1RYHA 1ZC3A 1NMZA 3KQNA 2VTKA 4KBFA 2VH5R 4PZLA 1KO1A 4BZPA 1W4CA 2ONKA 5JJKA 4DCTA 1KI3A 2CDNA 2GZHA 2QAGB 1E94E 2VIIA 2WWWA 4RY2A 3C15C 1XEWY 2GJSA 3IIJA 3REGA 4U02A 5J4KA 1FX0B 4Q66C 4F7WA 1OLOA 4FD2A 3IKJA 3QXJA 3CRRA 5AJVB 4BLOA 4BFXA 4MDFA 1KAOA 1NL3A 1X8JA 1U81A 2CK3D 4TL9A 2AFIE 4PQRA 3K9GA 2ZI9A 4OBEA 1VCIA 1JEEA 2GBLA 3M1IA 5HTKA 2IYXA 5B2ZA 2CL7X 2REOA 5KU1A 1NY6A 5HKKA 1E4VA 3NC0C 1E2PA 4US1R 3AQ4A 4UNNA 4R71A 3OIYA 2J5XA 2R6AA 4Y0AA 1ZNYA 3VR2A 1KO5A 5J5CA 2VP6A 3JZAA 4MYCA 3LQQA 4R9UC 3EPHA 2UVQA 2JA1A 1NRJB 2ZRIA 1YZKA 4IDHA 1JAIA 1JECA 2GHIA 4H1UA 1WB9A 3R9WA 1W5TA 3K9NA 5B58C 1YR7A 2Z5FA 2BC9A 5FPSA 3T5GA 1OPXA 3FTQA 4OQXA 4EPTA 1T3LA 4IKEA 3N5CA 1KO7A 2F1IA 3R7WA 5FPYA 1CKEA 4MRVA 1DS6A 1ZD1A 4AKEA 2WWIA 2R62A 5LD2C 1T6NA 4JVLA 2ZQ5A 2J0VA 3LXXA 1I4LD 4M22A 1JAHA 1KK3A 1AZTA 4DLXA 3CPEA 1KSJA 1SXJD 1QHGA 3AF3A 4QBGB 3VR4A 5SZJA 1YVDA 3PUVA 621PA 5JHHB 2F6RA 3GFOA 1VYUA 3BS4A 4CYMA 2IS6A 3PITA 4G0NA 3U60B 1UBCA 2F55A 2C9OA 2ZRGA 2WIAA 1BYIA 1G5TA 2GZAA 5AJZA 1G3UA 2AKYA 4A8JA 1OXSC 4B47A 3DHWC 3LVRE 4PC7A 2CCJA 2NO9A 4X8LA 3WMFA 1OH7A 1UKVY 2RHDA 3OEEA 4DB2A 3B1WA 3K9LA 3KJEA 5LBIA 1TX4B 1LS6A 2JATA 2TMKA 2ASEA 2VO1A 3KUDA 1R5OA 3BOSA 4OQMA 2J0UA 4EJSA 1TNDA 2O8DA 3O8BA 4R98A 3WNDA 2IYTA 3T61A 2ZYWX 2YC4C 3X1ZA 4JYBA 2QENA 1E3MA 4P0TA 3NG1A 1TADA 1QHHA 5K8IA 2KB0A 4RKEA 4BLRA 5JRZA 2DR3A 1UBEA 1ZD9A 4B3DA 4LC0A 4QRHA 3O8RA 3AVTA 4V0ME 2NQ2C 4Q4AB 4XTCS 3WRYC 2O0HA 3K53A 3SFZA 5CB8A 1TQ6A 5HE8A 5L3VA 4I81A 1YQTA 3TAUA 4DRZA 3VKWA 4ARZA 2AK3A 2RB4A 2XNDA 1VTKA 2G88A 3CB4A 2ZREA 4XD7D 5EXSA 1MV5A 4KV9A 5TARA 2FOLA 1UBGA 1Z8FA 1G5PA 3LRPA 3NBFA 4LPSA 2OT3B 1KSHA 3T1OA 2GRJA 3JZMA 5SZHB 3L82B 4M53A 5L3QA 3FE2A 3L0OA 5B57C 1G3QA 2QAJA 3B1VA 3QKUA 721PA 4OK3A 2DFTA 3BFXA 4YXWD 3MJRA 4OKSA 3TGPA 1E9SA 4KI0A 1NJFA 3X1XA 1M74A 2AL7A 2WOJA 5H1YA 2ZR0A 1ESMA 2PMDA 3L0SA 3I61A 5EP4A 4Q1FA 2XEXA 2NG1A 2OAQ1 3DM9B 1AKYA 4KITB 1GITA 4I1UA 4KJZA 3NKVA 4ZPXA 1W2HA 2GCPA 3EZ9A 1FMJA 1R0XA 3UWKA 3BGWA 1IBRA 3NDPA 2FE4A 3EWAA 4KFSA 4JLBA 2O52A 1FMLA 1R4AA 4WW0A 5EZ6B 1F2TA 1QHYA 5LD2B 2BEKA 1OKKD 1P61B 4G5OA 2XZLA 1CRPA 3OESA 4U7DA 2R65A 4IRUB 3QG5A 4OJQA 2PT5A 3QXXA 1G7CA 1K6MA 2VHCA 4BLTA 1T3HA 1KI4A 1Y63A 4JMPA 2PT7A 4NE2A 1KMHA 1QHNA 1XTKA 2AD1A 3AKEA 4RZ2A 1E2NA 5EZ5A 2X19A 2J46A 1NMXA 5EJEA 4BEJA 4HUTA 2ZITA 1Z63A 4UNQA 3ZD6A 1OFIA 1MH1A 2WHXA 4MRRA 1X8KA 4URUR 5AR1A 2BKUA 3WNCA 2V54A 1S3SA 2QAGA 2OSBA 4TMTA 4GNKA 4HDCA 1JQJC 3IQXA 4OJKA 4PHGA 2CNWD 2BBOA 3UKDA 2A5GA 1G20E 2XOKA 3WRXC 2PEYA 5DI9A 2ZE6A 1CIPA 1KNXA 4GMDA 2OFWA 1YZLA 1L2TA 4O25A 4PHTA 1G7TA 4B3BA 3MWKA 1E9AA 5B30A 5E3HA 4TMKA 4G5QA 4WIAA 4AC9A 4Q1DA 1GWNA 1M1YE 5K8LA 2O8CA 1XTSA 2WJGA 1II9A 1M6NA 2JAQA 2NZJA 1LF5A 2EFGA 2OAP1 2C03A 1UJ2A 2GK7A 3PEVA 4II7A 5FR1A 5EP3A 3MAAC 5DI3A 3QXSA 3ZDQA 3THYA 2MSEB 4E09A 5F98A 2A30A 2VP5A 2FSFA 2QSYA 1OXVA 2D2FA 5C18A 1KIMA 1KDPA 2ZSBA 1G8GA 5JBQA 3QVUA 4ASUD 1EGAA 4PZYA 3FB4A 3SE0A 1W0KA 4GI7A 1FTSA 1XZPA 2ODEA 2AXPA 1Z5ZA 1H8HA 4RCYA 2ZJ2A 1YZUA 1IONA 1YKSA 5FUXA 4A0RA 3HR8A 3VFDA 2B7CA 2A2ZA 3ZIAD 1ELOA 2ZAOA 1AS0A 2QMEA 3S1AA 1CJMA 1BOFA 3TIFA 4QBIA 4MDEA 1QHXA 1RJ9B 5JCPA 2JASA 3DVLA 3MWLA 1Q1EA 2WKRA 3THWB 1DEKA 3DOEA 4PPFA 3TSOA 3CX7A 4PO1A 1VHLA 4PANA 4HB3A 4Q03A 4DLUA 3QPUA 2ZPTX 3EA0A 3HYRA 4V0MA 2FG5A 4DDVA 4B32A 3KX2A 5F9FA 1VYVA 2H18A 2KBFA 1T8TA 3FVQA 5AJYA 1ZU5A 2GVDC 4CEHB 2CL0X 2W00A 1XD2B 4LBZA 2HLDD 1ZP6A 2IYWA 3U3OA 2NMVA 2XSZA 2W6JD 3ADKA 4F92B 3I62A 3CPJB 5FUWA 3A1WA 3ZQJA 4PC6A 4C0JA 2PCLA 2WVJA 4GZLA 4HYYA 4KFTA 4LJ8A 1XMVA 1QF9A 4I1VA 2F43A 1FQKA 4V0KA 2JIZA 2F1JA 3FOZA 3AVQA 3KXIA 3TRFA 2JCSA 4FMDB 3P1JA 2D74A 3N2IA 1P2SA 4ACAA 2FMXA 1X1RA 3SHFA 4PSAA 5IHPA 3CR7A 2WPDD 1OHHD 1V43A 3F8TA 2G77B 1DTSA 2ZRKA 4RJLA 4AG5A 5GJCA 3VHLB 1NN5A 2IX3A 1Z08A 2H1LA 4DSTA 1TQ4A 3MUFA 3IIKA 5JRJA 2O5VA 3IQWA 2NO6A 3A1TA 4FINA 4JVNA 4PAMA 2VSOA 4RD1A 1ZIPA 3PG5A 4IEEA 3KQUA 3NXSA 3SFVA 1KSFX 2ZI5A 4M1KA 1CF4A 1N2CE 2UZ3A 4AYWA 3WY9A 2IW3A 1G8YA 1D8TA 1X8LA 2G1KA 1A1VA 3DZ8A 4QC2A 4Z51A 4G5SA 4EFLA 3LW8A 1BIFA 3RS7A 4AWXA 1VCMA 5CIWA 1SVSA 4EUNA 1J8YF 2VLIA 5D3QA 1G8HA 4KFRA 2QPOA 5JS8A 2LKDA 3K9HA 4Q02A 2XB2A 1H65A 4E07A 3CBQA 3LD9A 3A4MA 2YWGA 3GJXC 3IPYA 4N1AA 1W4AA 5TY0A 1OXTA 2YOHA 4B2IA 1G9XA 4DLYA 4LHVA 4P4SA 4GP6A 2WJYA 1XTJA 2IEZA 2J41A 3FMFA 3UXMA 3V9PA 3W8NA 3K0EA 1KTVA 5FOWA 1HT2E 2R6FA 4CEIA 2HF8A 3U7HB 2WJHA 4BUJA 4IDQA 4JLJA 2ZYVX 2RHMA 2G6BA 1ZBDA 3L2OB 3R9IA 1CJTC 1Q1QA 3FMOB 3WP1B 1NNEA 4HSEA 1C4OA 2Z6VA 3RVBA 1FUKA 2C78A 4EDHA 1J70A 1EFRA 1T0JB 2DCUA 2WV9A 2GJAA 3PUYA 3SEAA 3K0AA 4DDUA 5J4VA 5JI2E 3QSYA 1YZGA 3OIWA 2PMKA 3FPAA 4Q7KA 3U44B 4HAVA 4WXRA 3A4NA 1E2LA 5F3WB 3MLEA 1TAGA 2G3YA 3EWSA 1KYIA 2KBEA 1TPZA 3BIFA 2W0SA 3TUIC 5CLLA 1GNQA 1OF1A 1LV7A 3TUJC 3HR7A 2DFLA 4LWZA 1ZCAA 2WWYA 1IN5A 2FGKA 5FOXA 4AY2A 2IL1A 4BFTA 3EPKA 4C7OA 4NYMQ 4NBSA 4DEXA 3GCGA 3Q7PA 4DXAA 1OXUA 2ZRHA 4LBVA 3FWYA 2VHUA 5FL7A 1OYYA 2X2FA 3CNOA 3U7EB 3IILA 1XWIA 4HZUB 4RZUA 2LCFA 4NYJR 2SHKA 4HAXA 1FNNA 2FFHA 2J59A 4F91B 2PBRA 1NVVQ 1NSTA 3ICQB 1VHTA 4OK6A 4UQOA 2W2VA 2ZS7A 5C4GB 1NMYA 5IRCD 3QXCA 3QEJA 2ZRAA 4HAUA 4ITRC 2FSGA 3MFYA 4A9AA 1OE0A 3AVOA 3EG5A 5AJWA 5BYJA 1ZM7A 5DIFA 4ZKEA 1ZUIA 2QROA 3ICEA 4POAA 3MJHA 3KL4A 5EXTA 2FN4A 3KKOA 1E2KA 4Q1AA 2IXFA 1XPUA 1PV4A 4Q7LA 1RW4A 2VP9A 2V7QA 3ZS8A 3SQXA 2QPAA 1W36B 4FW9A 4Y0VA 2PJRA 1R0WA 3RANA 2W2XA 2JLYA 2RGEA 3DKPA 3EW9A 4P4TA 3SDZA 1E1RD 2WAYA 1RJ9A 2F9LA 2JDID 1R5BA 4S2EA 2CVFA 4ZO4A 3R8FA 1IY1A 1T3SA 4FMDF 2BVNA 4JLOA 2YWFA 1N6RA 2GCNA 3FKSA 1X86B 4L16A 3CX8A 1XTQA 4DLTA 2RGAA 3GLHB 4JLPA 4MYHA 2QT0A 5KNBA 2C04A 3CZQA 3P4XA 3U4QB 5CM9C 2ZRMA 3MMPA 1V5WA 2F3TA 4XWOA 2CL6X 4TL8A 4RFSB 4A4DA 4LY6A 1SXJC 4Z1MD 4P4UA 2FF7A 1XJQA 2OBNA 3SBEA 1KJZA 2PZFA 3GJ4A 1IJFA 1QHIA 1VKJA 3BERA 3VR6A 4AIIA 4CDGA 4DT1B 1OH6A 1JI0A 5AUQA 4BEBA 4L9WA 3RYTC 4BPBA 3OIVA 4BFVA 4Q7JB 4Q47A 5DN6D 1OIWA 3BAFA 1AA9A 1QRAA 3BBPA 2IC5A 2K5UA 1A82A 3MCAA 4A2QA 5JEEA 1E2FA 1KZ7B 1YE8A 1Z0FA 1E32A 1EFHA 4GOJA 4OI1A 1H8EA 2ZRNA 4G01B 3GLIB 2AFHE 1U0LA 1C9KA 1OW3B 1XCMA 3TBKA 4A1FA 4CT5A 4NU0A 3CRQA 5JCZA 2OHFA 4LX0A 1FPMA 2XAUA 2PX0A 1KAGA 3LW7A 5TV2A 1ZAKA 1AQYA 2WTUA 4GOKA 5TDHA 3REFA 1JR3E 2F1HA 1DAFA 3GLHE 1HH4A 1BMFA 2FV8A 1ONBA 2WWXA 3RRNA 5CITA 4KAXA 2QE7D 4HAYA 4IXMA 4IHQA 3CONA 2VHQA 2GXAA 3B85A 5DYGA 4AKGA 4IVPA 2ZSDA 4FMBB 1ZM4A 4G5RA 4HLCA 1Z6AA 2D7CA 2VP0A 4MRNA 2GJ8A 2E9SA 3CNLA 3RLFA 1RE0A 3BWDD 2RGGA 2KJQA 3PV0A 1U0HC 1VYTA 3W8RA 1Q1ZA 3R20A 1KSGA 2JLZA 2P6UA 4XH9B 3VX4A 1YHNA 2QMOA 4DSOA 3PUWA 3MG9A 2UKDA 2BCGY 1CR0A 2VHJA 4LDJA 1OYWA 2HT1A 3GLIE 2C5LA 5EUMA 1CJVC 1GG2A 4PXAA 3KXKA 4OHWA 2CE7A 5FOSA 4WBSA 3AKCA 3GLGB 3SN6A 3QKSA 3SBDA 4R2HA 2V3CC 3T1TA 5BW8A 1ZM9A 1BS1A 5E7MA 2FA9A 5DHFA 1G16A 4PC3A 1K5GA 2HJVA 3OEHA 1E9RA 2FPKA 5BWMA 2DY1A 4TTQA 3L0PA 5A5GA 3O8CA 3W9YA 3A4LA 4XWAA 4BFWA 2Q9AA 3THXB 3HU1A 4HLQB 2GJ9A 3H4MA 1PJRA 4ZIRB 1SXJB 2ZJAA 4D80A 1UKZA 1OV4A 5L3SA 4IOLA 4QJ4A 5HKKD 3FYHA 4A6PA 4D4KA 2NO1A 4FWIB 4ZCIA 2YV5A 5FTKA 2NO0A 5HCNA 1NVXQ 1HTWA 4JL5A 4B74A 4GZMA 2QPTA 4EAQA 3M0EA 3KB1A 1OFTA 4CEJA 5HE9A 4FCVA 3GLGE 4U00A 3W6PA 1KI8A 3KJGA 5KDDA 1PVOA 2IXEA 4LOAA 2ATVA 3H2YA 1L7VC 2GKSA 3RSLA 3C14C 2QBYA 3FHTA 2WJIA 4V03A 1DO2A 4RD2A 4A0FA 4ON9A 2YKGA 3TSZA 1M7BA 3SYLA 3KXLA 3ZYCA 2CHGA 1HYQA 1CEEA 3DL0A 4KLNA 1P2VA 3FMIA 2A5YB 2ZTSA 2XZOA 3B8HA 1KHTA 1T9HA 2QGNA 5J4HA 1YZQA 1NP6A 2IUTA 3UANA 4C0BA 1TU4A 4DDTA 1SXJE 2J1LA 1J2JA 3ASYA 2GDJA 2DFKB 1PZNA 4NCKA 5KSOA 3LBHA 5JJLA 4JJKA 4QBFA 3UMFA 2BJWA 3WYFA 1Y3AA 4C0KA 1EESA 1W46A 3QOFA 4TMVA 5FL3A 2GXQA 4GOXA 3D7MA 1GAJA 4Q01A 4EFNA 4PC1A 4M9ZA 3C5CA 1IOZA
chains in the Genus database with same CATH superfamily
1YHYA 2FSHA 1E79A 2AFHA 1ZLYA 4WOKA 1QIKA 3A6PC 2EU8A 3LUKA 4I46A 1CXZA 2B21A 2G1PA 2BR3A 1N9ZA 3OHMA 1KI9A 2PMFA 3EGEA 4WXMA 3URKA 4I5FA 1VDMA 2GQ0A 3C97A 4NU8X 1I24A 1GADO 2W58A 5CBKA 1L4UA 1IQ0A 1RPTA 1Z4MA 4U2DA 1X7ZB 2F3QA 3RS4A 3TCXB 3TFOA 2IFTA 2OCYC 1NU6A 4HUQB 4EB3A 2PNJA 4YRPA 1ZGHA 5EKDA 4UNSA 1OBHA 5JMOA 4M8LA 2B2NA 1VCNA 2PYIA 3IS3A 4XSGA 5FYQA 3RKSA 2YHIA 5B6PA 2WILA 3MC1A 4QXPA 4CIBA 4R9NA 2C7GA 6ADHA 3JWGA 3F49S 2X0FA 2NPFA 3VR6H 1E2IA 4OB8A 4ALIA 5C31A 5E7JA 4BNIA 3KTAB 3CLTC 3IIMA 2DFDA 1GP2A 4LGMA 1M72A 5EC8A 5EZYA 2E4WA 3SMQA 3QLUA 5FAKA 1Z39A 2BUCA 2AS0A 3DS8A 4GZ5A 4WCVA 1ZI6A 4C7BA 1RPAA 2G8NA 3REQB 5FBWB 2JKZA 4A36A 3QNMA 5DHTA 3IODA 4PNEA 2Q6VA 2AVDA 3OMXA 1D4AA 4NLLA 4MKIA 4Q3NA 1OZ0A 3BD9A 4AO6A 1W34A 1SQ5A 2D4HA 4J16A 2XNDD 4V38A 4IIDA 9LDTA 5F9HA 2AX3A 3MBOA 2ZYTX 4B3SB 5EQDA 3B5JA 3AFIA 4JEMA 1Q74A 2H59A 4URVR 4LF5B 1JU9A 2YDYA 4FEYA 2I6UA 1FYFA 1MABB 4GDFA 3C7TA 2WK1A 1HF3A 4YDRA 3NP7A 4DYHA 2V1UA 1P4SA 3CLUD 4BIMA 5IXJA 2YVLA 4BNHA 1NBWB 4O6VA 4HATA 4RHEA 3VXKA 2ZRDA 1JA1A 2BN4A 2V7BA 2C5AA 2XTZA 4EQ6A 3FDXA 3JQBC 3IE2A 3O1JC 4D57A 1DPGA 2PO7A 2QJFA 5DISB 3OZSA 3JQ6A 4UCWA 3W5UA 3W6OA 5HZKA 2O8BB 3IT3A 1XOIA 1P5FA 2J7KA 2VPQA 2XYGA 3KDSE 3KPYA 2XCSB 1Y9AA 2J48A 1WIWA 4MTCA 3U2QA 4G0UA 1CY6A 3PJRA 1CRQA 1R0RE 5LB4A 1XZLA 3G8BA 3RYIA 1E6WA 3ND5A 4LC1A 5G0WA 3UWOA 2VCEA 4BJ3A 1BDIA 1XN1A 2DQZA 4J9UE 4CQMB 5TT0A 4BNWA 3PWKA 2EG9A 3R3YA 2Q28A 4K9RA 1CQIA 1XYYA 3DO8A 4O0LA 3ANXA 2WUFA 2UYQA 5UKDA 2X9GA 4L5CA 2P0YA 1KQ3A 4L07A 5JDCC 1UPUA 3HNOA 3S55A 2C8VA 3LC0A 1RP7A 2O2YA 2HJWA 4OQNA 3TQCA 3VU3A 3FUTA 3CU5A 1E0JA 3STHA 4KMOA 3L7KA 4M21A 3HXKA 2QIPA 4WERA 3GJTA 3EFHA 3NWOA 1GL3A 1YU6A 3RC1A 2QTCA 1GEEA 5ALFA 1C7JA 4M1MA 3K9FC 3G2OA 4YX9A 3HGTA 3CLRC 1FK8A 2QRKA 5LYYA 5TQJA 1PQ4A 3K8YA 4LZZA 3AEKB 2A0XA 4MGZR 1ZPDA 4RL6A 4BP1A 3S8EA 2V7VA 3CWQA 3DKRA 4MAMA 3P9CA 2PJDA 2J08A 3GA5A 3N6XA 5AVXA 4ZVKA 4U2FA 4G65A 3KVNA 3A9SA 4LYHA 1ZGAA 4WFQA 1PL0A 2DKFA 3I9KA 4PYJA 5LSAA 2ORYA 2FH5B 2WE7A 4S2UA 4M0CA 2ACVA 1OFUX 5LP6F 2YWCA 4HRAA 4OLFA 5L4NA 2HFKA 1G38A 5B55A 3MZ0A 4MWSA 1NVVR 1NP3A 3O8DA 1STOA 1KAEA 3EGDA 2BI8A 1UFVA 3DMDA 3VU9A 4OHCA 4LV5B 1A2BA 5JYDA 5DLDA 5JVDA 2L18A 4P3KA 4TXJA 3PFGA 3HYCA 3TXAA 4ARSA 4ZODA 4C05A 1RXSA 2P8SA 4PLHA 4A91A 4NDAA 1GCAA 4BQOA 4EKNB 1Z56C 2G5GX 2PS9A 4JASB 5CT4A 2IV3A 1U0TA 3EZ2A 2C42A 2HJHA 4MQLA 4QQRA 1JVNA 2VNKA 4E2YA 4FYMA 2NVUA 1H8HD 2J67A 2JNWA 2ZYGA 3DOOA 5ESXA 5TB5A 2WEKA 3GLUA 1L5LA 3C3KA 2ODBA 2PKRA 1RRVA 2ISSD 2KE5A 5AHRA 1TT7A 3D5QA 4PLPA 1ZD2P 3EGVA 5A0VA 5KYUA 1EXMA 1P7ZA 2RC6A 3OHSX 4MV3A 1V26A 5IUKC 3TXYA 4CLRB 2JZNA 5K09A 3LDGA 1YFLA 4P35A 4OLAA 1GM5A 2XH8A 1LB1B 2BR5A 2C8LA 2H4HA 2R9VA 1Y1PA 1RAGA 3ZHRA 4F45A 1T9GR 5L4SA 1MA0A 3C4QA 1S02A 5HKLA 4RH3A 4PXSA 1Z38A 5E9AA 3EDMA 2WZCA 1NATA 1Z07A 4HLUC 1FY2A 1CUJA 4WA7A 4B4DA 3HCOA 5EPUA 5CU7A 3ZU4A 1VDZA 3B6EA 2Z08A 3DE6X 3P9RA 1CQZA 3E3MA 1FBNA 3WLRA 5K51A 2YXBA 1ZNQO 2WQ6A 2WFLA 3P9KA 2IHTA 4HDRA 1T15A 5CVDA 2NO7A 2PWBA 3AIMA 3VZQA 5C80A 2FDRA 2OV2A 3NC4A 3IBGA 4TMWA 2FMHA 3HBNA 4FGWA 4ZVUA 1E61A 1Z2OX 5C8YB 3OICA 1Q7RA 2DLDA 3GD7A 3FHCB 1Z9BA 2PK3A 3I05A 4K9PA 4BFLA 5A5FA 3KQKA 5F2OA 2V0GA 3R2JA 3IO3A 3OC6A 4L28A 1VPDA 2JAWA 4CN9A 1C3OB 1Q95A 1TIBA 2QW1A 4F4CA 4ZQCB 3OQIB 1AM4D 1GXSA 1O6CA 5AKXA 5LZ9A 1KETA 3F90A 4H0NA 4NMMA 3PC3A 3TLGB 3ESDA 1H4QA 2BKXA 2SKDA 4JROA 2EWMA 1UANA 3H1GA 3KAQA 1TYBE 2QNIA 3OLVA 1AGRA 1P1IA 2OBLA 1NPTO 2YNMC 3D8HA 2PQMA 3L77A 4V0QA 3IXMA 4DR3B 1XU9A 1T2UA 2A3RA 5JQGF 3OP1A 4RJKA 2MMCA 1CG6A 1ZK0A 3WIVA 4N41A 4H31A 3L6OO 4IX1A 3BZWA 3L9WA 4LJSA 1U2EA 1VLJA 1W48A 5JS2A 3EXG1 1A4UA 5B3AA 1E58A 1N3YA 3OHPA 2R44A 4XIFA 1KPIA 2VJLA 1NVEA 2R7MA 3E1SA 3QG1A 3VTFA 3RGWS 1AIPA 1ZMOA 3IPCA 3N28A 5CIQA 1EE9A 1HKHA 1BN6A 1W1IA 3VR4H 4HV4A 1TYDE 4FNGA 3SHWA 4B47A 1RKVA 2IZ1A 2FPGA 3KQWA 4JT8A 4C3UA 2C7QA 4K26A 2BSXA 5ICFA 4PO8A 3X1JA 1C9YA 4TUYB 3K32A 2RHLA 2IRWA 3ZN2A 5JAMA 2O23A 4H4CA 3COZA 3VMFA 3LH5A 2HNAA 3ZHOA 1Y4UA 3QU2A 5ISMA 1KMCA 1PEYA 2DJ5A 3GFQA 3LUCA 5ADHA 4F85A 1DUSA 2VL7A 2Q1SA 2ZJ7A 3GXBA 3ILYA 4R9SA 2LXNA 1FFCA 2NW6A 1T3ZA 2HWXA 2ZSEA 2PWYA 1FFWA 1XTRA 1DUVG 2GPJA 1RRMA 4KN5A 1Q7BA 3TR0A 1RMYA 2WF6A 4RIGA 4FZRA 2AHOA 1KO8A 4RXMA 3HCBA 4ILKA 4RTPA 1UDBA 4IX9A 4OMCA 1YRLA 4U2CA 3VDNB 1JDUA 1F48A 4OFWA 3ZJVA 4HB0A 3N2EA 1RXUA 5E95A 4P36A 2UU9B 3BGDA 5BNTA 1SZCA 2VHTA 1CLEA 3G6WA 3G8YA 3I04A 2YCBA 4S0XA 2B30A 1FMTA 4HDKB 4LYJA 4MPDA 5DLYA 5T8KA 3TM5A 3WGNA 3ZV6A 4G8CA 3A4YA 2BLNA 4OFBA 1FLDA 3X43A 2O5EA 3U1VA 5DWQA 4NZZA 1E1CA 1P4AA 4BO4A 2YFYA 5KWJA 3M5WA 3DDOA 1ZINA 4G81A 1M66A 3K4HA 3CTMA 1P0FA 1TEXA 2YZ2A 3RYFA 3UGQA 4O3FA 5M34A 3NAZA 2GCOB 2G82A 4EX6A 2XD4A 1YZFA 3FIUA 1OAKA 4U7PB 5ICSA 3NTQA 1QH9A 2O0LA 4FN5A 4Q15A 4EABA 2CJWB 4UEWA 4IIGA 1QBGA 4OQDA 1JEYB 1D07A 4O4LA 5DRYA 1YZYA 2ZULA 3DV0B 2QW8A 5BR7A 3I8SA 5AXAA 4Y7CA 5IF9A 2I1VB 3ISTA 4YMTA 3K92A 4KYTA 4YP6A 5F3DA 2JG3A 1JQLB 2UV8A 5IP5A 3UG6A 2HD4A 2GN1A 1QVZA 3IQZA 3LI2A 4BLSA 2A7XA 4YLYA 3VOTA 4Y6LA 1CF2O 1SG6A 1AXEA 3UK1A 3AMVA 4IG9A 5HCIA 3UFBA 5JS7A 3HWRA 3LLUA 4TN1A 3E22B 2XUOA 2O06A 3FLMA 1PQUA 2NZUG 2YIMA 3K0KA 1E2JA 1JLHA 3OX2A 1G20A 5EA2A 3SJBA 1IXZA 1CUUA 1U2GA 2Y99A 3L8DA 4YV0A 3L92A 3F6CA 4Q4CA 1RM3A 3VPAA 3O4FA 4LYYA 2I8LA 5HZHA 3NQ41 1EFTA 2ZXFA 1IBMB 3U4MA 2Q5HA 4UNPA 1NUHA 3T5AA 4ZRDA 3RS9A 1JIXA 4JJ4A 1G5IA 3QWHA 5IYZA 2IUUA 3IALA 1JNYA 3Q3EA 3RVPA 4Z54A 2JEYA 1P45A 1YKGA 2FLKA 2PLNA 3H5VA 3CCBA 1C1DB 1QIJA 2C2KA 3JALA 3HXPA 1QIIA 1MB3A 1YS4A 3WAKA 3ZU5A 3PGMA 3O8OA 2DUMA 2PX8A 5DGXA 3HUEA 3RUCA 1RR6A 4XUEA 2IYUA 4ARBA 4HXYA 4B7XA 1BN7A 1FUIA 1Z0JA 4CDMA 3G9XA 2V7QD 4RPIA 3S5UA 2WM9B 2DPXA 4OLHA 2N47A 2WJAA 4PHFA 5FOVA 3EIHA 5D3KA 5A2QA 1I2DA 5K99A 3G0IA 3BVPA 4QRDA 2CNLA 2GN6A 1KAHA 3FUXA 4R31A 1MRNA 4TKUB 2F8TA 3GEIA 1KH2A 3R5KA 5J2TA 1OLXB 2OKGA 3A6LA 3GOQA 1TT5A 2GYYA 3PYMA 4MCJA 3UAOA 1UM8A 2W6MA 1FDIA 3FKSD 4MK4A 1NN1A 1SEPA 2DVMA 2ZIFA 4FFBA 5L9AA 4PPYA 1YB6A 2YFQA 4RK0A 4UPVA 3LYUA 1NF2A 3L6EA 4JA0A 3RYCA 1G66A 2H8GA 3CUVA 3L8CA 3EIQA 1DSSG 1PJTA 2OV4A 1JW9B 5A9SB 1QRDA 3SXJA 2P1ZA 3OCXA 1NQ5A 4K40A 1G21A 1T0BA 1N2ZA 3T0IA 4YFVA 4RZQA 3H2GA 5TMEA 4P08A 5HQTA 4UE2A 4BNJA 3JQGB 2QD4A 4B6GA 4L72A 2V8OA 4LI0A 3OTOB 2CV2A 3VR6D 4UC0A 4BATA 1C7IA 1KIAA 4MRMA 3IMFA 1OI7A 1EZ1A 5ALNA 4J0CA 1FXWF 1QTQA 4M8KA 3OJXA 4YAJA 2X8AA 4GYWA 1XCLA 1A0OA 3LPDA 1K66A 4H3KB 4D3SA 1T5SA 1HQKA 3BWXA 4J4BA 3B2EA 4HWOA 4JVSB 3FAKA 3ML1A 4QDUA 3UEOA 1VG8A 2WSMA 3UOWA 3W8DA 1ISRA 3FRHA 1NVBA 2FK7A 3K05A 1PWXA 4F3YA 2IYAA 4HX2A 1HEYA 1CF9A 4Y7DA 3L8GA 1YH3A 5T4HA 3JRXA 1ISSA 2WWRA 1J7KA 4EEZA 1PZXA 2O1SA 3FRJA 1AMOA 3B13B 4JU9A 3QYAA 2JZOA 1DDGA 2OGTA 1KPGA 4JHXA 2OBBA 3PXGA 1JX6A 1XVVA 1U2RA 2D4AA 2ZJZA 3DLCA 4UKDA 5AJXA 2ZRCA 2TECE 3IAFA 2O20A 4EB6A 1LQTA 2W98A 1S89A 3I42A 2W2NA 2XUFA 2GDZA 3NORA 4QODA 3V7NA 2OV8A 3ZLVA 5ECGC 2G0NA 5KSZA 2WM8A 4KZKA 1YBFA 2RGXA 2BRUA 4HCJA 3X1KA 3PZRA 3IUQA 1QBKC 4IDFA 2DAPA 3DBRA 5CUQA 2JGMA 3FHLA 4HB4A 1E2EA 4HRVA 1YZ3A 4JMLA 4K7JA 1NMSA 1Z2NX 2GI4A 4M0DA 1X92A 1N2CA 4PSUA 4UU0A 4K6GA 3FSGD 4NZPA 3UBMA 1QFYA 1RC0A 2R6HA 1VIAA 2WSSA 4WOCA 1FYDA 2BGIA 1U8ZA 2X4IA 4RPGA 4KPEC 4MUGA 2EARA 2ZYHA 3KSUA 1DFGA 4P7BA 4WEOA 3Q8LA 4HX5A 1IZ8A 1FTQA 1M6HA 1P1RA 2A4MA 4O4IB 3WV5A 2J9FA 4NMHA 4HTFA 2WINI 3DKVA 3L3BA 2H8KA 3QLEA 1L7MA 1AS2A 1U6IA 3N6VA 1P5RA 1S2LA 1K68A 5H81A 3BFVA 3PXCX 1PD1A 3DW1X 4HT3B 3SKXA 1FQJA 5FTLA 1ECPA 4QFDA 2RGCA 4ENPA 3LOUA 3ZDAA 1PDVA 3P32A 1SUBA 5HF6A 3K0FA 3VTKA 4C14A 1NN0A 5I7OA 4D25A 1YD7A 1U02A 4OAOA 3BQMB 5K8VA 4YDSA 1WABA 4DSAA 3CUKA 1CQJA 3UXHA 1WXFA 4F6RA 2CFSA 3BH0A 1EUQA 3Q72A 4W5WA 2PJUA 1P29A 4F3NA 5DGHA 2OGUA 4WECA 4S1PA 4D8XA 1PEKE 3OSUA 4HPWA 5K3FA 4H1TA 3GT0A 4YT5A 1JIJA 4L85A 5BSGA 2NX2A 1S1CA 3IAAA 4EO4A 2GWRA 3T6KA 3NHPA 5EG5A 3S8MA 2ZWAA 3ZWQA 4M4SA 1NQWA 4H27A 1EFVB 2IT1A 3AP2A 5LNK1 2QTFA 4B40A 3ND7A 5AKZA 2MCFA 4ZDWA 3H2ZA 2XNJA 5A62A 3K0HA 3OM9A 3H5TA 1RM5A 1J8QA 4IDPA 3ZQ6A 4X8OA 2WF5A 5JYEA 1SM4A 2Y67A 2GZDA 5DM1A 2PUCA 2FUKA 2A0KA 1W1UA 4W7HA 4YMUA 2ZJ1A 5DE3A 3D7LA 3FNFA 3DZBA 5FV4A 5ENZA 2Q6OA 1P2BA 3QF7A 1YR3A 4GMXA 2A92A 3LQRA 4ZYZA 4F56A 3GZNB 1AKWA 3AWIA 2ORVA 2ZSUA 2Z6QA 1WVGA 4J76A 1R6AA 3ZX5A 1XBTA 4L9SA 2ZROA 1U0EA 4X94A 3L5KA 4TLEA 2QQ0A 1E92A 1KDVA 3R74A 3GA0A 3OG9A 2MSLA 4QPNA 2J07A 5GM1A 1KS9A 3IVRA 2XPCA 3C24A 2FXIA 4HQFA 4Y6GB 4ZC8A 3DC7A 4I2NA 5IN5A 2PXHA 1QK3A 4YJDA 3RVJA 4Q9LA 3NBMA 1CY8A 1H2YA 1ZRSA 1ZXXA 2RGNA 2WJ4A 4TQAA 4B0PA 4I9FA 4D9CA 4YAWA 4DG9A 4FE3A 5KB3A 2PZMA 1JKJA 2EGUA 5E2AA 2ZE8A 5K0TA 3GUYA 5K0ZA 1CUFA 3RUHA 1KDOA 4KH0A 2WSYB 1L5HB 2BAGA 1ZICA 3LZDA 3NRJA 5HILA 4QU9A 3VA7A 4AY4A 3HI4A 4N8SA 3MGKA 5AKYA 2Q5CA 3OLZA 4ZD6A 1USUA 2R751 3O2QB 3MGCA 3KS9A 4GQAA 4X7BA 5CDGA 3O90A 1N6NA 3DLBA 4W63A 4MVJM 3S0JA 4WINA 3E2PA 1OQAA 4OHFA 1DE0A 4G8JA 3BTUA 1G2OA 3E2MA 4JNKA 4CRWB 3AT1A 1DFHA 5JXGA 3PTLA 4LFBB 4C04A 1SRRA 3MT0A 2ZI7A 2TMYA 2V7EA 5EMMA 4Q4LA 5CA0F 1EIZA 2W6ID 3NH6A 4G4SP 1E2BA 1V4NA 1QKJA 2WG2A 2IWHA 1YRHA 4P4NA 1TEHA 2FYTA 2ZJBA 4XPIA 1UEIA 3HGQA 5CK5A 5IVIA 2WU4A 1MO5A 1H2FA 1B7GO 2WZBA 3MWYW 4FZ3A 5F33A 5KYVA 1JXOA 1DAGA 3A05A 3MD9A 3QUTA 4MS1A 1UBRS 5AIBA 1L5RA 3DEFA 4UDOA 5D2CA 4L0DA 3GX1A 1P2DA 3Q7EA 3T9BA 2NIPA 4ZT3A 4RZIA 2DY0A 3W9UA 8LDHA 5HVNA 2ZTUA 4R83A 1ZSYA 4M1SA 4R54A 4TSFA 1QGYA 1ENPA 2XB8A 3I6MA 3PDJA 3RBZA 3JQ9A 1XB2A 1Z0ZA 2C00A 2VPTA 5EIWA 1W47A 2HCRA 4GOLD 3OECA 4K8OA 2JLVA 4MITA 1VMAA 4YP9A 2HCTA 3NDBB 1AS3A 1GZVA 4P2BA 2F48A 3IUMA 4QOJA 5LB2A 2ONZA 1U5CA 2Z3WA 3NHUA 3GRCA 1S3GA 1OX4B 2WTBA 1PX0A 4MB0A 5I9IA 2VG8A 3VZPA 5KMGB 1W6RA 4G4IA 2I6TA 4FZVA 5DP2A 4O4HF 1DQNA 1FE8A 3E61A 3QVXA 3QKIA 4KNWA 2AFRA 4TWRA 1VMDA 1OPRA 3C45A 3QEOA 1TQ2A 2IYEA 2EL9A 2OOKA 4FJ1A 3OWOA 1KMHB 1FDVA 1OAAA 2GD2A 4RHFA 4B76A 2PUHA 2FPXA 2VPPA 1H6BA 2A1UA 1U8TA 1A4RA 4TYQA 1FVFA 4FHEA 4OSPA 2MSCB 3U40A 3K2BA 1HDOA 5EZQA 3NTRA 2VNJA 4HS9A 5L7YA 3UMVA 4FFWA 1V7ZA 1I7NA 2YN0A 1JFRA 1K63A 1WCV1 2NU7B 4RU1A 5H7XA 1KAQA 3E7XA 3WISA 1M2VB 3GJ3A 5IUJC 2C54A 2FEMA 4MMXB 1N9GA 4QATA 4UM5A 1KRWA 2E7ZA 4FWTA 1SIOA 3BHMA 1E99A 1G3RA 1I5RA 1ZC4A 1S4MA 2RHCA 3N2KB 4WK6A 1T4GA 1VRWA 3N8IA 4GLLA 1WMDA 2NGRA 2QMYA 4U0JA 4H6PA 3SHVA 4ZVTA 4K05A 4R5HA 1L5YA 2Q1WA 5BSHA 2IBTA 1KYYA 4ZT4A 4B6PA 5KNBH 3AEUA 4I50F 5D86A 3A8TA 4BX3A 3ZK9A 1WLSA 4H7FA 3V3KA 1JG2A 3VR0A 3RASA 3LQ4A 1VJDA 3ORSA 4IHKA 2QQEA 3PE6A 4UVHA 5EUQB 5C7LO 5A1TA 1JHOA 4JXXA 1Z26A 3KYJB 4QGBA 5DDIP 1CUCA 3LCUA 3TL3A 2O8CB 1TVEA 2FHPA 5LOVA 4QEZA 3TOXA 1A88A 3UHJA 1PJ2A 1O6BA 5AM4A 1IL0A 1A96A 2XDQB 3L07A 4TRJA 1R0ZA 1MO6A 2QL7A 5DI3B 2VYVA 3OC0A 2JFWA 3GMTA 1A9TA 3KHTA 1Y3CE 4HQNA 4IJMA 4NYJQ 3T0GA 5KQLA 2W42A 2UXCB 2YWRA 5GJBA 1UIMA 3EY9A 1CR1A 2GM5A 2H54A 4QBKA 5CFZA 1SHZA 2QJTA 1QFMA 4RIHA 5KKNB 3EVGA 1M34A 2P9HA 2YRWA 1LBEA 2FQYA 4BNYA 1RSZA 2PUEA 4TGLA 1P7PA 3U4DA 3L6RA 2M1XA 3ROTA 3WLOA 3HKBB 4OUKX 1FDRA 3L1HA 3CXUA 1AJEA 1MT3A 2ECFA 4RMGA 4C43A 4DV7B 1GPWB 1MJ5A 1ODSA 3BH7A 3A1NA 3R7DA 1E4EB 1W4ZA 3F3YA 4JLKA 4M7WA 2VTBB 1HLDA 1GZ7A 1KBOA 3KQLA 1RJWA 1RYNA 2ONYA 4GX2A 4V0NA 4DLAA 2ISQA 5KTYA 1A7JA 1UMCA 2G8LA 4AX4A 1UQUA 1H6DA 4FFSA 5AUOB 1AXRA 2AZ4A 3H2KA 1ZCFA 4ARUA 2D1YA 2L0XA 1SVUA 3ZY6A 3HXOA 1NAIA 1XAJA 2OCBA 1IDOA 2NTEA 3ANLA 4OVKA 2OCPA 3KKLA 4UDXX 4YAKA 1P7WA 3KSDO 3G82C 4L4YA 4R1TA 3IO5A 2P11A 3AP3A 5KNDD 1VG0B 2VNAA 3K1ZA 2GFQA 4S1WA 4IG4A 1MRSA 4UQPA 5FLKA 4EGQA 1J0AA 2NN3C 3GT3A 5LVAA 5MFZA 4HKTA 5HIMA 1L0BA 2UVPB 2CK3A 1XMQB 3BXFA 3CUYA 3I9V6 1JRLA 1RIFA 4CF3A 2QRPA 1DG3A 1BEUB 1HOTA 1C80A 1OI3A 4B7ZA 5CA1B 4IHJA 1WY5A 2C99A 4MEJA 4S1OA 2ZM6B 2YV3A 3WB0A 4ITUA 4TT3D 4Z9YA 5HA5A 3FZNA 3IV9A 1Q3TA 2F43B 4J7UA 1UXGA 1ZRNA 3SXUB 4CL0A 3UA3A 4KVZA 5I9BA 4BVBA 1HTTA 5KHAA 4OAPA 5B1DA 1I4DD 3U09A 4RK1A 4B3RB 2Y68A 3GZJA 1NBIA 1T24A 1PFVA 2YFKA 1HQYE 2Z0MA 4MVJG 1AXGA 2H4XA 4BRWA 1TQDA 2J45A 4X71A 1TM4E 4YP1A 3DF7A 2CJPA 5DBIA 2Y76A 3PEEA 1NW3A 2EBWA 3DFZA 2VPIA 4MKZA 2N42A 3A25A 5KJ1A 5EE3A 1HE4A 5JAIA 3TTSA 3DMTA 1JHRA 1E0AA 2XMRA 1EEXB 1N0HA 4IQ4A 3TO5A 4F06A 1JAYA 1JJVA 4OYHA 3NRCA 4UHFA 3B7GA 4CL8A 3DCYA 5J2UF 4BVEA 3V42A 4TZKA 3W8EA 5ED4A 3KT0A 4LRWA 1LK7A 1NUTA 4PG7A 1RVV1 4LJAA 3L1KA 1HOXA 4WV3A 5FPTA 4BFCA 4BO1A 3R5JA 3I9LA 3THXA 4NH0A 1NYLA 2YV4A 4BDSA 3EF1A 1U99A 1EQAA 2QTAA 3D59A 4NONA 5C34B 4DCUA 2QQ5A 5B64A 4BFZA 4BAZA 4P33A 3U3KA 3BKWA 1QC5A 1RIIA 3L40A 2XCQA 5DYWA 1NR5A 3D0QA 2W70A 2XGJA 2W6CX 1AGPA 5I3ZA 3CR3C 2QWXA 4L2IB 4MV4A 3AR7A 1EJ6A 4A2WA 1ODCA 4NZNA 1H4VB 4Q93A 2QTNA 2C7BA 1RXVA 5LPNA 2EYUA 1JKXA 4INPA 2WR8A 1P6QA 4FONA 4AURA 3V1TC 1WW2A 2YXPX 3JYQA 4EJFA 4LDQA 1PK8A 4UVGA 3DPUA 1X70A 5AK4A 4V1CA 1K5PA 3ACBA 4TKZA 3T9FA 1HV8A 2ZR7A 4DR6B 1EM8B 2B7BA 2R25B 4F8JA 2G08A 3IT2A 4BNFA 1A8UA 3MAJA 1C0LA 5D51S 3RF7A 3HVRA 4FEAA 4GEGA 5K3CA 1TUGA 4C4AA 2EZ8A 3TOVA 4N5DA 2XLBA 2GF0A 3NGLA 1XHEA 2ZYUX 4FMPA 3O93A 3TRDA 4DLWA 3R24A 3OQVA 4IJ5A 5IUNC 5BQPA 3NYIA 1K8QA 4WK0B 1Q2XA 3SJZA 3COSA 4KG7A 4M2LA 5IMSA 8MHTA 4MVJP 2XUJA 2PVSA 3O26A 5DIZA 4AMZA 4EG5A 1O96B 3LX6A 1SZPA 1N5JA 2Q5QA 4JYAB 3VO1A 1O0CA 2CZQA 2I2FA 3WYEA 3DDCA 1C1XB 4YASA 3AM5A 2CSUA 1YQ9A 4GLBA 1RS0A 4PAQA 2IVFA 5F5LA 1A7UA 3JSAA 4BN5A 5C5DA 1FNDA 1WUJS 3RVLA 5C4MA 2Q1TA 4NBNA 4P54A 3DLIA 5IM5A 2ZTHA 4D8WA 2R0QC 5K0JA 3CXRA 2EQ5A 2BEUA 1B4DA 5GJWC 3ON5A 4JOCA 3CPHA 2JFUA 4HDOB 1D2GA 4I5IA 4XD7A 4YCLA 1K8YB 3MCVA 1LKZA 3FHOA 1B8OA 5JPDA 2LRHA 3N2NA 1C0KA 2QXYA 4EY7A 1ULHA 3NIFB 1VLLA 4KQ1A 4NBTA 5A6SB 3TJRA 4C0SA 5I7SA 4W5NA 3OF3A 3W5HA 1S3FA 4TYWA 1LNQA 1ZJ6A 3HM9A 3OLXA 5HBRA 3NUZA 4DA6A 2ECKA 5DBGA 3OPXA 2EQBA 3BH6A 3NVKI 3G23A 4I3GA 4GI2A 1U6KA 1QX4A 1NUAA 1XVUA 1RQRA 2JJ8A 1P8JA 2QK4A 3BTSA 2IEAA 3ETDA 3IULA 4HQKA 5CJPA 4S3MA 5IVDA 1C30A 3IMGA 4H1VA 5IVKA 4TV9F 3Q3HA 3OFND 5BN5A 1JPNA 1BAPA 5E2BA 1M5UA 4XYMA 2XDWA 5H02A 4FGLA 5DYYA 3NCTA 2XNKA 2FWPA 1SC1A 2VAVA 5M2QA 4Z7QB 4CQNA 2WDZA 2SCUB 2GEUA 1BOOA 3LBFA 1R64A 4ACBA 1CUSA 4NENA 3U9LA 4HNGA 3MYYA 3GPLA 2PR2A 4MH0R 1XJCA 1E3EA 2P65A 4WKCA 4MV8A 3B1XA 4BO3A 3U3DA 1OKKA 3NLLA 3ZBQA 2XXAA 4N0EA 1KHHA 1KFKB 1GZ5A 1OU4A 1QQ6A 2PSJA 4DVGA 4AFNA 1Y8CA 3UGJA 1Y8QB 2OXRA 3IESA 3DFIA 4QYWA 1DAHA 4MW6A 3OE7D 4OHZA 3ZZMA 3OOSA 1JLLA 4MGYR 4HDNA 2X6QA 2IF2A 2FWAA 4YAUA 2VAPA 3IVMA 1GNSA 1EFLA 1WQ1R 2FP4A 1FVXA 2O2JA 3A9CA 3JQDA 4IWYA 4MKFA 4PV7A 3VBCA 4QJ3A 3OOYA 4PZ0A 3I9MA 1RZVA 1XHLA 2A14A 4KVGA 4LC9A 4UTPA 1DO0A 2QMQA 5B1EA 1ST2A 3CKKA 4X8HA 3HWX1 1SKUA 5GWXA 4IXNA 1L4NA 1MGOA 4ML3A 4MVJI 5FA8A 1E98A 4Q18A 5JR3A 1D2NA 3ND6A 1GA6A 5C1IA 2FP3A 2C2MA 5AW8A 2EAUA 3FDIA 5B2EA 4D9IA 1NX6A 3WQHA 2IHYA 3X2FA 5ICCA 3D6JA 2HV9A 4DIEA 1FEZA 2JGNA 5L7WA 1B76A 4FB4A 4UFOA 2BE7A 2Q3DA 2VRCA 1PNRA 4OU4A 1CUXA 2D0DA 3E0QA 1T8SA 5EJ2A 5FFFA 1E64A 3KBOA 2GXUA 3Q88A 5CFPA 2WIGA 4Q16A 1QQ7A 2VTVA 2WHRA 2AE2A 3ND9A 3FYTA 4DDKA 4RADA 3SF8B 5AUNB 4AXBA 3A70A 4URHA 4GECA 3KHUA 1HTBA 1C3EA 3JQAD 4NR0A 1YCHA 2FR1A 4A03A 1NV9A 2QX7A 3LBIA 3OKAA 4ARCA 2Q0SA 2VHZA 3JYPA 5IDWA 5KREA 4R8SA 2PPVA 2R4QA 4X60A 2Q9BA 2C2BA 1UP7A 3GDWA 5BRNA 3LHSA 5AKLA 2NYVA 3DL2A 4FBLA 4BO6A 1WMSA 2P9YA 4RTMA 3EZLA 3QEBZ 3U56A 1TAQA 1JB1A 4DM4A 9ABPA 1M6YA 3MWEB 3I04M 1T13A 5AW9A 5JH7A 3GLTA 1KEWA 3LG2A 1RRFA 2A67A 3YASA 2ZAMA 1ANKA 2GBIA 4V39A 4LE0A 4KE7A 1Z4PX 1TEVA 3WXMA 5K05A 3C7DB 1HE1C 4BU1A 3L8YA 4ZU6X 1YDEA 5FLYA 1ZJ5A 1WXXA 1QO9A 2VHXA 2H2DA 2QUIA 3K2QA 4UZSA 4DGQA 5B4VA 1HNWB 1V11A 2TYSB 3FVWA 4QUAA 2QNRA 3N2GA 5THKA 1L7AA 3ZCUA 3R4VA 2CXHA 3U7JA 1UPTA 2A5JA 1NIPA 2QSZA 3HKEA 3TN7A 4XUGB 1F17A 3OOWA 3F78A 3E18A 3ZZ1A 2VDVE 1Z6QA 4MR9A 2GH1A 4AQDA 1OB5A 4RVNA 1IXSB 1GNRA 4RULA 4KSYA 2YFHA 4G0VA 821PA 3ZWVA 2CL5A 4D3XA 1EK1A 2HLDA 4LZLA 1T26A 3TRJA 1EFUA 1JBKA 1UJ6A 2E6KA 2R60A 4IXDA 2DWQA 3BMCB 2P5TB 3EN0A 3WDLA 3EF0A 1OGJA 3AEXA 2DSNA 1HG0A 4J0DA 4ZO9A 1I6KA 3WMXA 2L69A 2YZNA 3DMYA 4TWBA 2BWJA 5IULC 5KUTA 3RRJA 2G1JA 4X7MA 4E5KA 3C6XA 2C7RA 2IYNA 2XAAA 1CY4A 4C6TB 3EG9A 4YA6A 3TLJA 3NCHA 4X20B 4BZXA 2Q3MA 1IHXA 1BW9B 1ABFA 4I4TF 2AKEA 2Q2VA 3I39X 3K4PA 5BXQC 4OYYA 1FNBA 5KX5B 4HEQA 1Q7TA 1T9DA 2PS1A 2FX5A 1SCBA 3FVVA 2VRBA 2YKPA 3KE9A 3H3XA 2V9PA 4LJYA 2L42A 3WI7A 1HYBA 2HT6A 3DGEC 4EUHA 2ATIA 1T4MA 1FU7A 3KM0A 3TRKA 3I5XA 3I30X 4XSHA 1ULUA 2WLSA 1T1EA 1ZS9A 2QP4A 3C3BA 2OFXA 3HY6A 3IP8A 4RYLA 4YI3A 5H3LA 4A0GA 4YJ2F 4JX9A 5KOYA 2O8FA 2C94A 2VJOA 1XEXA 3RI3A 4GL2A 3RSZA 5KKCA 3JARB 3AR2A 1Y9DA 3KUCA 3ZZUA 3MSCA 2JH3A 4NBUA 1U0NA 1ICIA 4LDPA 4ZVQA 5AVZA 4AY5A 2QN3A 3U7RA 2RH8A 2QG6A 5E0OA 3WAJA 1C7EA 3TMYA 1UKAA 4JH0A 3LUPA 1U8AA 2HDOA 2VYFA 3DNFA 5EWLA 3ZV3A 1JU4A 3DAFA 3A9WA 3K5HA 4O29A 1F1JA 4YLGA 2ILTA 1M1XB 3FVTA 5DJ5A 5CXUA 2Z5GA 4U2EA 2VSYA 3NTLA 4UCXA 1WULS 3MBKA 4ZXFA 2P9BA 2Z9DA 3G6KA 4QGHA 3EYAA 3GJSA 2P2LA 3VR3D 1HRKA 1UK6A 1FRFS 2F64A 2MJLA 3M9XA 1R50A 4OHPA 1YVEI 3GBVA 1KMQA 4JLNA 4G5GA 4TQUS 4EG3A 1YJQA 3UUFA 3Q0TA 1AN0A 2IU0A 3RS5A 4C87A 3PT9A 3PLAE 3KOUA 4XJVA 3PR1A 3DUWA 4LYFA 3E3NA 4NVRA 4LHXA 5CAEB 1NQAO 1J39A 5C8ZA 3F98A 3QITA 2IS2A 1W2WB 1A04A 3GP8A 1V1RB 3LFHA 4FE4A 4UHKA 3THSA 3B7PA 2OV3A 4C4ZA 3P71T 2ENUA 3DA8A 1CK4A 3MRXA 3PGKA 4N49A 3OKCA 3DWGA 1DU4A 1FA9A 5CLGA 3B53X 1ADFA 2BFFB 3O3CA 3U26A 1KMNA 4C4SA 1SURA 3O2SB 1KZ9A 5TQVA 4CTJA 3WGIA 4ZJPA 4UAVA 1W4LA 1T4BA 2JCGA 2NLOA 3Q7SA 4FYPA 2VBIA 5AVKA 5FRDA 4ZYWA 2E82A 3D81A 3KOMA 1WBBA 4KHZA 2VF4X 4EW3A 3ANYB 3WYDA 4NV1A 3GLFA 5F7ZA 3OJCA 3V8PA 1XDUA 3UK0A 1QIFA 3ZWBA 1QMPA 2A0UA 2DSTA 2BBTA 5CLFA 1FOEB 5ALQA 2FZLA 2G83A 4UBNA 3KVRA 3EB9A 5ICGA 1U28A 2SICE 4PO3X 3WWOA 2AKAB 1Y48E 3R7SA 5EXXA 1G6OA 1Z5WA 2RGWA 5FLEX 4JR2A 1D6NA 2QL6A 1L1FA 1RLJA 3O9MA 3VDMA 3GJ0A 4YJFA 4C9BA 1X7DA 4E15A 4OHRA 5DW3A 5U4XA 1PQYA 1PUJA 1QO7A 2Q6IA 3A06A 2P4QA 2VEOA 1ORIA 1ZA2A 3KAKA 2IU4A 4JUIA 3VVLA 5JD6A