4PQRA

Mycobacterium tuberculosis reca glycerol bound low temperature structure iib-bn
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
326
structure length
309
Chain Sequence
PDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Protein RecA, 1st part, 2nd part
total genus 95
structure length 309
sequence length 326
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4pqrA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4pqrA01
4IDHA 3DL0A 2BVNA 1TF5A 2E9SA 2ZJYA 3RS2A 1X6VA 4PZLA 1P4SA 3SEAA 1Q1BA 1AA3A 3DPUA 2WZQA 3ECCA 4NCJA 2Q0HA 1QBKC 3EIHA 3MWJA 4TTRA 5EE5B 1KK1A 1NMYA 3GJ8A 2CDNA 2BKUA 5TDHA 1YKSA 4X8HA 5DGXA 2RGCA 1S1CA 1G19A 3DKVA 1Z0KA 1EGAA 3I3SR 4E09A 4S35A 3U61B 3G82C 5EQTA 1SHKA 1A4RA 4RFSB 1T3LA 2PH1A 5FUYA 3WMEA 4QGHA 2NOAA 5CDFE 4G0NA 2WWYA 1P6XA 3N2IA 4UKDA 2ZYWX 3Q5EA 4F4JA 2FF7A 2WKRA 4B47A 3QBTA 4Y0AA 2GDJA 4BUJA 5ELXA 5C4MA 1SVLA 2WJJA 4C0QC 2FPKA 1H8HA 1N2CE 3E5HA 4FCWA 3SE0A 4WZ6A 4LJAA 3U3OA 2ZSEA 4RY2A 2ZM5A 5DISB 1COWD 5FPHA 2RCNA 5C4GB 4LOAA 1KI6A 4FI3C 4A82A 4B3GA 5CB8A 4ZV4A 2QBYB 5DN6A 3SYNA 4DCUA 3RC8A 1N6LA 4DUGD 4XJXA 3CH4B 4Q03A 3AVYA 2OBNA 1R5NA 1XMSA 1XCMA 3CO5A 4HLUC 4NDZA 1GRNA 1X8KA 5BYKA 5JRZA 5CIQA 2HDNB 3THYB 3P26A 4LJ6A 4I1OA 4XD7D 5JLJA 3TR5A 5C1BA 2P5SA 4M9QA 2B8TA 2HF8A 2VP6A 2ZU6A 4ZDKA 1GAJA 3TSWA 4A6XA 2AD5A 2UZIR 3TQFA 4CGZA 4QGFA 2F9MA 1CEEA 4MQBA 4M1TA 1XTJA 3B1ZA 3QG1A 3NHAA 4TLCA 1U94A 1LF5A 1JR3E 1IN6A 2ZS9A 2JLWA 2EYQA 1XNJA 1SHZA 3LQQA 4LGMA 2DBYA 1JR3D 4LPKA 1P3JA 1E2LA 1KI3A 3PUVA 5FL3A 3AF2A 2QN6A 4XTRA 3CR7A 2GEDA 4ABYA 1UFQA 2A5FA 5SZIA 2JJ2A 1DTSA 3K9HA 3GLIE 2PLFA 4KYUA 3B1VA 2HEIA 1R5OA 1S3SA 4BEBA 4EPTA 1JJVA 4U02A 2ZRJA 4V02A 4EPWA 4YXWD 3H86A 5FFMA 1JQJC 2QQEA 2AR7A 1KDOA 4QGGA 1NVWQ 2BM0A 2YWFA 2IS1A 1V5WA 2OCYC 4I81A 2W6IA 5CJ2A 1LY1A 5FR2A 1YU9A 3KKMA 3FKQA 1GSIA 2IYVA 3QKSB 2MSCB 5JECA 2QE7A 2J5XA 2G1KA 2G0TA 4DDTA 1D9XA 2JJ1A 2CK3D 3E1SA 3HU3A 4G01B 5G41A 1XZPA 1B0UA 2PBRA 1L7VC 2GZHA 2QMEA 3DKPA 3V00A 4ARZA 1GRRA 4Q47A 1L4UA 1ZM7A 2GAOA 4B44A 1QHGA 1Z07A 3FWYA 2AXNA 2VLIA 3B2EA 2N1BA 3D31A 3ZZTA 1Z22A 4M53A 3MUFA 1MO4A 1VG9B 3OZXA 4Q48A 3Q72A 3CB4A 4DRZA 2NPFA 3BAFA 4B3BA 4Q9JA 4BEJA 3O8CA 2Z83A 3K0CC 5H68A 2YWHA 2O8EB 4MGIR 1FMJA 1GILA 2D2FA 2ZTSA 3TUJC 1KMHA 2JGNA 1N6IA 2YV5A 1LTQA 2W83A 4NYMQ 1GOTA 3TGPA 3AGQA 4M4SA 4OYHA 1K5GA 4Z1MD 4HLCA 3NBYC 5F9HA 1YR6A 3FMPB 1U0LA 2B6HA 1E98A 4KI0A 4G5OA 2D7CA 1SULA 4LCBA 3NH9A 5H1YA 1WF3A 1OV4A 3B6EA 1TF7A 3U5ZB 2CJWA 4DB2A 4AWXA 1GNRA 2XXAB 3QPWA 4N3NA 4TMTA 1ETUA 3ND8A 1H8EA 1U9IA 5B30A 3QXJA 4E5UA 3QKRB 4CEHA 5FOSA 3R9XA 4PPGA 3BFKA 4MRVA 4YQFA 3IO3A 1NY5A 2PZFA 1IXZA 4DLUA 3NEYA 2QGNA 4KU4A 4Q1AA 1Z5ZA 4JLVA 2AWNA 5E7IA 3T1QA 3SQWA 3Q7QA 3AVVA 4R7ZA 2WVJA 3ICQB 1DAFA 3THWB 1JEDA 1RYHA 1SZPA 3TE6A 4DHEA 2PMKA 5EXXA 1PVOA 2B8WA 3U6KA 4M1MA 2QT1A 1JXOA 2ZS8A 2L0XA 1AGPA 3T15A 4DLVA 3FOZA 1MO3A 1ELOA 1HUQA 1J8YF 1OIXA 4URVR 2BBWA 3CRRA 4R2HA 2ZI6A 5LB2A 1RW4A 2CXXA 2RHMA 4BFSA 4OJQA 1YZQA 2FSFA 1YZGA 5BWMA 1HQYE 3CH5A 1J2JA 1N6NA 3H84A 1Z08A 4OHYA 4H9GA 2P65A 2VA8A 4A2WA 3HU1A 1XTIA 2ZI3A 1KI9A 3OEED 5DI9A 5FBVB 1X8LA 1YRBA 3WRYC 1W5SA 4UQOA 1IXSB 4BLPA 3CPJB 1II8B 1TMKA 1TQ2A 5DHFA 2VSXA 3AVXA 1DOAA 3CRVA 3RRMA 5IRCD 1Q57A 3WXMA 2FPMA 1ZD8A 2ODBA 2GJ8A 3IEUA 1U0JA 4GMXA 1YR7A 1FP6A 2I1VB 4L16A 3NWJA 2ATXA 1ZBDA 3TVTA 5CK4A 1GUAA 2RKOA 3ZH9B 5B2ZA 3LBHA 3C8UA 4LWZA 4NCIA 3FMIA 4Q9KA 3MAAC 2BMEA 3RWMB 1EFTA 2NO7A 3K70D 4L8GA 3RABA 5HTKA 1I4DD 4TQ9A 3BFVA 4G5QA 3THWA 1OXUA 4TTQA 1T3HA 2CCKA 4IEEA 1P61B 3D6TB 4IVQA 4BZQA 4CT4B 2D4HA 4PXAA 3I8XA 1GNPA 3MMPA 1G6OA 5BQ5A 2DCUA 2DYKA 1CBUA 2O8CA 3NVAA 3GLGA 4EPRA 4PX9A 5JCPA 1XZQA 5FI1B 5GADl 2NMVA 3THYA 1KDPA 2IS2A 2YZ2A 4KLNA 1KJWA 1N5KA 3QI2A 4Q1DA 4PTLA 1RVDA 2P67A 3HYTA 1NY6A 4DJTA 2BMFA 3QPUA 1E9FA 2GHIA 3KKNA 4XVUA 3I72A 2J0UB 2BWJA 2IWHA 4A8JC 5AJYA 4KFTA 2UZ3A 1AN0A 1TQ4A 2Z6VA 1EG7A 3BE4A 3HR7A 4LBYA 4GPTA 3KXKA 2O8EA 4B74A 1TX4B 4CEIA 4TZ0A 5E7JA 3LVRE 2J0QA 4DC9A 2ZSDA 4PAQA 3M6AA 4QHYA 4LHZA 4C2UA 1OIVA 5FPYA 2IT1A 1I4LD 3FFBA 421PA 2LKDA 5E95A 4GP7A 2ERYA 4I4LA 1R8QA 3K70C 1E2QA 3OHMA 3L43A 2BKEA 2QU8A 4GZLA 1T0HB 2WIBA 1AS2A 3KUCA 3S1AB 5EZ5A 1ODFA 2ODWA 1NN1A 1QVRA 2X2FA 2YOGA 5FBLB 5KTYA 3OIUA 3QKSA 3UKDA 1YE8A 4QG7A 4URUR 3E70C 5CYPA 4LYHA 3ZZ0A 5KOYA 1Y63A 4RJLA 1OE0A 4RZ3A 1PUIA 4URWR 2DWQA 3FGNA 4BFWA 3VNUA 1N5IA 4HAZA 4GP6A 2FNAA 3ZQ6A 1VHTA 5LBIA 4OHZA 2ZJOA 4AURA 2P3SA 1G3MA 1QDEA 4BWYA 4DLRA 1Z06A 2WIAA 2F43B 2ZRHA 3W34A 1AJEA 2ECKA 2IW3A 1NMZA 3T1OA 1DAEA 3ICEA 5FTNA 1A82A 4PPFA 2IL1A 3EARA 3U3MA 3SQXA 5P21A 2H18A 2CCGA 4Q02A 1CIPA 4MH0R 3CNOA 1KY3A 1IAQA 2ZQ5A 2QMUA 2YVUA 1COWA 4LZZA 2WJVA 1IM2A 4BFUA 1N6PA 2O0HA 3DO6A 1X8JA 4K81B 2OILA 1OPXA 4NHOA 4HLUA 2VEDA 3QENA 2WWGA 3U44B 3U7EB 3ND9A 1N6KA 4XOIA 3K09C 4BFTA 1NIPA 3CNNA 4D81A 1S2MA 5FI0B 4LV5B 4QHSA 3VQTA 4C9BA 5KSZA 1NVUQ 2IA5A 5EE0A 1KO7A 3K1JA 3AP3A 3QKRA 4OL0A 4GZMA 1CXZA 1UF9A 1W47A 4L5BA 3W90A 1G8GA 5FPKA 2R6GA 3KJEA 2ERXA 1EX7A 3WRXC 4TMWA 1JPJA 2BBOA 4XVRA 4US0R 5LD2C 4NONA 4CF7A 1W0JD 1BO6A 2QRZA 2ZUBA 4KV9A 3VKWA 2GEUA 1OXVA 4UNRA 3LLMA 3IO5A 2OV2A 3CR8A 3QJYA 3GP8A 1G6HA 4MRSA 3PXGA 3W5JA 1IY1A 1FTNA 4B2LA 4BASA 4CEJA 5D3MA 1HURA 1ZAKA 2F3RA 2WKPA 3VHXA 3IEVA 1OXXK 1KY2A 2HYDA 2OO7A 3U7GA 1VG1A 1ZD1A 3SFZA 2NO6A 5AUNB 2FN4A 2VF7A 2FU5C 2O52A 3CWQA 1GFIA 4Q1FA 4HAYA 4QJ4A 5CJPA 4NU0A 3VAAA 2XSZA 5KPJA 3AB3A 4LJ5A 2QROA 2CMKA 2GESA 1D8TA 4PQRA 1R8SA 3WYAA 5DI3B 1ZUIA 3C7KA 3W9YA 3X2SA 3LV8A 4HUTA 1G16A 1FTSA 3EWAA 4B33A 1LS1A 1MV5A 5JSZA 2C77A 2P0EA 2WWIA 4LHWA 4CZ2A 1E1QD 4HLQB 1WQ1R 3FHCB 4Z51A 3T12A 1G64A 1IN5A 2ZIAA 2QEQA 3AVQA 2Q6TA 4LHYA 1LV7A 1DO2A 4ACAA 2DFLA 4OKSA 5KDDA 5A4JA 2OG2A 1CTQA 2PX0A 3Q9LA 2MSDB 3LY5A 3MD0A 4DSUA 3I73A 2CK3A 4HB2A 5J40A 2ZRBA 1E69A 1IJFA 2CNWD 2RGDA 4NYIR 4LSGA 2Q9CA 5HR5A 3VU9B 1G9XA 2FH5B 3ZYCA 1MKYA 2BDTA 1ZU5A 4HLDA 4XSGA 5FBQB 1E2EA 2JATA 1W2HA 4PC6A 1EWQA 2OUKA 1SVMA 1ZM9A 3MG9A 1ZP6A 2DFNA 3T34A 3RS3A 3UWKA 1F5NA 5C46F 2IS6A 4L15A 4D4JA 1XTRA 3CZQA 3FMFA 4OQMA 3WNCA 1OH7A 5KSPA 2ONJA 3SHFA 2CLDX 3L82B 3NKVA 5E4FA 4DLTA 2WJIA 3TKLA 5L3QB 2GA8A 4HYYA 621PA 4TMVA 1IOZA 1E1RA 1PLKA 4HAXA 3AUYA 4JYCA 3IHLA 2ZJAA 3N70A 5F2EA 3WBJA 3PEWA 1XXHB 2ZSFA 2C9CA 4IDQA 2P2LA 2IBMA 4XVQA 2DFKB 3A4MA 2JLUA 1LB1B 2IUSA 2H57A 1YZNA 4PSKA 2IUTA 1E79D 2YC4C 3FDIA 4Q1CA 2FZLA 4HI0E 4D82A 1P73A 4Q4AB 1P72A 5BN3A 3EPLA 2VBCA 2ZPTX 1QZXA 4Q4HA 3KJGA 5JWRA 2P6NA 4F4CA 1D6JA 3WY9A 3K0SA 1DAGA 3KQHA 1GNQA 1AKYA 1G291 3ASZA 5JEEA 2PEZA 1T5LA 3VX4A 3X1ZA 3ZD6A 1JI0A 5C2JB 2OESA 2N42A 3CWZA 2OE2A 3NC0C 3KKPA 4JLOA 2B92A 5EZ6B 1NSTA 4PO8A 1JXMA 2HT1A 2EWVA 3CONA 4TSFD 4HUQA 2C96A 4R2IA 2WV9A 1QHHA 1Z0IA 1RPZA 4A2QA 2FSGA 3EA5A 1ZM4A 3FKSA 3M0EA 2H1LA 4WXRA 3KTAB 4NH0A 3SDZA 3TAHA 1DO0A 3VR3A 2I1QA 1CP2A 3QOFA 2XEXA 3NEJA 4R98A 2HJGA 1T3SA 5JRJA 3PEVA 1GP2A 3K9NA 4JVSB 1VCNA 3GLHE 1WDTA 4BE7B 1YZLA 1Z6AA 1ZNXA 4WZAE 2VIIA 4G5RA 1IY2A 4N0DA 1E0KA 2ZE8A 4FINA 4IVRA 4OHVA 2H7VA 3IKJA 2AHOA 4MGKR 3PJRA 1XPUA 2ZROA 2V9PA 1G3IA 1KNQA 4YC7A 1F2TA 1G1MA 4MITA 3HYRA 1ZC3A 3MFYA 3QF4A 1J7KA 3EPJA 4OI0A 1XDBA 1CULC 3NC1C 3UATA 4NKRA 2TMKA 3CNLA 3EC2A 1FNMA 1W48A 1IONA 1VTKA 1NVVQ 5FUXA 5GJCA 3DM9B 3BBPA 2XJ9A 1RRPA 2QM7A 1ZNYA 1ZW6A 1SQ5A 4URZR 3Q5DA 5DNYB 1ZJ6A 2H8KA 1KOFA 2OM2A 3CX6A 5CB6A 4CDGA 2ZRAA 4Q9LA 3MRSA 1QVAA 1P5ZB 4F91B 4IOKA 1DAIA 1CR1A 3A1UA 2O8DA 4KBFA 4AC9A 3IPXA 4GRAA 3LFUA 3L0PA 2JEOA 2QT0A 1E32A 1SVOA 1TF2A 4A8JA 1Z6XA 5SZJA 1Q3TA 1VECA 2ZYUX 3DOEA 4XH9B 4NE2A 3SYLA 3Q7PA 3KTAA 3CW2A 2GVZC 3QUSA 2RGBA 4MYCA 3WHLA 1U99A 4Q4LA 4C0JA 5CLLA 1S4QA 5DH9A 3T35A 2FDCA 2ZAMA 4KXFB 4LJ9A 4LJ8A 3QVVA 3W6PA 1VG8A 2QMOA 3A36A 4MGYR 3UMSA 1R0YA 5FH9A 2WAXA 2W6JD 2QG6A 1A1VA 3RS7A 1KMHB 5J4LA 3W6NA 3PFIA 2Q9AA 2ZITA 4QXAA 3EPHA 3CUEF 1F6BA 1ZCBA 4Q4AA 5GJWC 2YINC 1D9ZA 4TSFA 1X1RA 5JZVA 5GJBA 3AKDA 1W4AA 1P60A 4IEIA 4M1KA 1XEXA 3HPRA 2R2AA 1HE1C 4RFSA 1AQUA 2HJVA 2PEYA 4MYUA 1XD9A 2IEYA 2Q21A 2VYFA 1Q1EA 1XEXB 4DKXA 3OEHA 2H92A 1S0UA 2WWHA 2EVWX 4ASUA 4KFRA 1OF1A 2FEOA 5KNCA 2Z43A 3R8FA 4V0NA 1I4TD 2JASA 4BLOA 1VMAA 2WAYA 2O8CB 2BBSA 2Q3HA 3ZJYA 4V0KA 2SHKA 4D4LA 2V55B 1ZM3A 1KK2A 1Q20A 4QFMA 3O8RA 1G3QA 2J7PD 1II9A 4FCTA 2ZREA 3NDBB 1TQ6A 1HA3A 2H5EA 1Z8FA 4WOPA 2FSHA 1DAHA 1E6CA 5ANRB 5J4VA 3C5HA 5BYJA 4LV8B 4W5HA 1Z0FA 1CR0A 4JSYA 4GMDA 4GT1A 1JAIA 1U8YA 3QBVA 3TUZC 2OBMA 1ZNZA 4MRNA 1NKSA 1E3MA 2FA9A 2ZI7A 2BIFA 1OH6A 2D06A 4HAUA 1OB5A 1IBRA 3O8DA 1EWRA 1M1YE 1KK3A 2WICA 2XNDA 2ZYVX 3AV0B 3DZ8A 4JLDA 4RFVA 2JLZA 3FYHA 2KBEA 4V0ME 3AF4A 4KJZA 3GLFA 4Q19A 4G1UC 3ZS9A 2WWWA 2RGAA 2QA5A 2Q3MA 4DBLC 1HY3A 4C7OB 3TJZA 2ZI5A 2QNRA 2GBLC 4B34A 1KI8A 4RD3A 4TL9A 2QP9X 1MABB 1OHHD 2MMGA 5JWOA 4JZKA 1I2MA 4NTZA 1KO8A 2ZRDA 1XCPA 5J4KA 1JPNA 5JSZB 2F3TA 4DLSA 3P4YA 1OYYA 5JJKA 2JLVA 1W0JA 4ACBA 4B76A 3AEZA 4XSHA 1KKLA 2IYYA 3QF4B 5IDVA 3WMGA 4LI0A 1G5PA 1Z6TA 1SXJC 5A5GA 3LD9A 3U7HB 3C5CA 3CF2A 5H8WA 4YXWA 4LUCA 2P6RA 3TSZA 3LWNA 2O8BB 2PT5A 2RHDA 3RDPA 2W6JA 3FMOB 5FOTA 2AWOA 1N6RA 5EXTA 3KB1A 3ZVNA 1MR3F 1RJ9A 3HJNA 3PUYA 4C0KA 3QQ5A 5IK2A 5TARA 1FX0B 3W8RA 4DDUA 2W6ID 3U4QB 1CJKC 2XSZD 3GLHB 3CRMA 4FWIB 4I1VA 3EW9A 5KSYA 1NVXQ 4ZCMA 5EE3A 2X19A 5EUQB 5AUPB 1NKTA 1UM8A 2WJHA 3P32A 4DLWA 1CJUC 2IHBA 2VHJA 2QE7D 2ZI9A 4BFYA 4RZUA 2ZE6A 2FX3A 3ZLJA 1FOEB 1PV4A 1TNDA 1XRJA 4BLRA 4LV6A 2I3BA 2IYQA 3AVOA 4ZO4A 4B2PA 3DOFA 1Z3IX 5B58C 1E1QA 3OEHD 5EP2A 1CKEA 4ZKDA 3QEOA 5FUWA 2RGXA 2XXAA 4Y0VA 2CCJA 4G5GA 1MH1A 2RB4A 4CT5A 2BBTA 2ZR9A 2NIPA 2R62A 3AVPA 4LBWA 3RNLA 3EG5A 1Z6YA 2WPDA 2BJWA 2ZAOA 3V4RA 3U4QA 4A9AA 1G21E 1LVGA 3R7WA 4QOSA 4KCGA 5KHOC 1G18A 2J7PA 1N6HA 4H1UA 4TWZA 1GKIA 1CS4C 1N5LA 4JL8A 5CDFA 2W0SA 2ZXUA 3VR6A 4ZDIA 1AZSC 1E2KA 1HV8A 1M8PA 4JL6A 1E4VA 1U98A 4UNNA 5IF9A 2VHUA 1NL3A 1KIMA 1VG0B 3A1VA 2B7BA 3K0FA 1HTWA 4J0QA 1D2NA 5JMTA 1WBBA 1Q22A 2GILA 3SN6A 1GL9B 4L9SA 2IYTA 4D80A 4HAVA 5FOWA 2QPOA 4WA7A 1GITA 3P27A 4EQ6B 1OH5A 1EK0A 4PPNA 2C03A 2UKDA 4KSCA 1PLJA 1XTKA 4QNMA 2ZJ8A 2YWEA 4JL5A 1E2MA 1GL7A 4PQFA 3MCAA 4HZUB 4NYJQ 4P4UA 3FE2A 4B35A 4DIEA 2BEKA 3TQCA 2LWIA 1OHHA 3ADDA 2DWOA 3K0EA 3NG1A 2VF8A 3LBNA 4XWOA 2W2XA 3U3RA 1Q1QA 1IY0A 1E79A 5FL7D 1G7RA 1AS0A 2WKQA 4K46A 4MKFA 4HZIA 4W7SA 3UMFA 3ZVRA 2BC9A 1QG4A 3IHWA 3EZFA 8OHMA 3H2YA 2XB2A 5HZKA 3GJ5A 4HDQB 1HQCA 2WSMA 1OFHA 3T1TA 1M7GA 1TPZA 1GKUB 1W5TA 1N3BA 4UXHA 2YHSA 4EIWA 4EPXA 1Z0JA 3KFXA 4JKIA 4LC1A 2BOVA 1NLYA 3TW8B 4IRUB 3AF1A 3NH6A 2J45A 1XMVA 2WMOB 2J59A 2ZANA 1XJCA 3NBXX 2EFHB 1QHNA 1PLLA 3G5UA 2X2EA 5HPYB 1GDDA 4IOJA 2CHVA 1QHHB 521PA 5DSZA 2OBLA 4TQAA 4F38A 4FMDB 3P1JA 4HUQB 1W1WA 1YVDA 4UJ5A 5L8VA 2YC2C 3NBZC 1W0KA 2BM1A 1UKZA 1EESA 3IGFA 1JALA 2QBYA 3I5YA 3HPQA 5L3SA 1UKEA 1KI7A 1OW3B 1IQPA 1D5CA 4LK2A 1SVKA 4NCHA 3RLFA 2FSIA 2YKGA 2J0SA 1CJTC 1Y3AA 4Q4JA 2ZE7A 4N0EA 5D3MB 1NSFA 2V6JA 1KJYA 3LRPA 3I62A 3LX8A 3WBKA 4JLAA 3TIFA 3H0KA 2ZVQX 2QL6A 4AG6A 1E2IA 2OCAA 2ZUDA 1YR9A 4OJKA 1VCMA 2Q9BA 5LDDC 3MWKA 2CVHA 2F1IA 2ZE5A 1OFTA 1ONBA 2A30A 4QL3A 3GMTA 4PFSA 4CYMA 2VL7A 2VQSA 1ZYUA 2F7SA 1J8MF 2F43A 2X77A 2XNSA 1DG3A 2AD1A 3H1TA 2FV8A 2PJZA 4PHTA 4TT3A 4M1WA 2RAPA 2NO0A 3QNUA 4B6EA 4HATA 2R8RA 1CR4A 1Z6GA 4P4SB 1W49A 5AUOB 2E87A 1W4BA 2GKSA 3R9IA 1BMFD 5L3QA 4BFXA 1SXJE 3A6PC 4AIIA 3KXIA 4O2RA 3F8TA 3GEHA 2GCOA 3EZ2A 4CIDA 2GZAA 2V3CC 3VKHA 4A4DA 2Z4RA 4B3DA 4LJ7A 1N25A 3ZVMA 3LAWA 4A92A 1NF3A 1S8FA 2ANCA 2JJ2D 2FJUA 4B48A 4RCZA 5HCIA 2XOKD 3EZ7A 5TY0A 3ASYA 2QY9A 1QF9A 3CRW1 1XMIA 4PAMA 4X8LA 1QHIA 1E9AA 2VH5R 4NCKA 2VPPA 5AWFC 3T1VA 1KDRA 2HXYA 2A5DA 1OYWA 1P7CA 2BJVA 5LD2B 2ZRGA 4B3CA 2XTNA 1K6MA 1RRFA 1US8A 1M2OB 3PUWA 2GXUA 1KO4A 3T5DA 2DFTA 2JIZA 4DB4A 1FZQA 2JCSA 3PEUA 1Q1ZA 3DM5A 2GBLA 4CEHB 4HDCA 3PVSA 2A5YB 2PZGA 2C9YA 4QJ3A 4RKFA 3K53A 4NYIQ 2QPTA 4HDOB 1H65A 2VTKA 1Z83A 3LW7A 4W9MC 3ADCA 3TR0A 3FVQA 3FTQA 3IBGA 1P9NA 2WM9B 3NTUA 1KSGA 1JNYA 1T8TA 2KE5A 3RAPR 4B3FX 3GLGB 2GTPA 2BMJA 3DZDA 1IJEA 4IXMA 3N2EA 4EJSC 3SI7A 1WMSA 4M1SA 1XP8A 1KAGA 1TUIA 2W2TA 4ZI2A 4P4TA 4ITRC 1KHTA 1VCIA 4OQLA 2OXCA 4Z1MA 1T8UA 1NBMA 3SJZA 4B73A 2B21A 2JDID 3MWLA 5FTLA 1V43A 1OFUX 4II7A 5L3SB 3PV0A 3D7MA 1WE2A 3KL4A 1UBGA 1AS3A 1KYIA 4PAOA 3EIQA 5F3WB 1H8ED 2JLXA 2ZJBA 3IIJA 4YLGA 2DPXA 4DWJA 3BK7A 2J1LA 2KWIA 1G3UA 2BHRA 4HAWA 3A1WA 3CF6R 1FUUA 4YMTA 4YMVA 4AKHA 4QKQA 1II0A 2ODNA 5C18A 1LNZA 4D26A 3SFVA 3CM0A 2REBA 1DE0A 1QHYA 4PHHA 4Z8YA 3TRFA 4BZXA 3CX7A 3LXRA 4JBWA 4V0MA 5CLQA 1BMFA 2GK7A 4D0NA 2R44A 3B78A 4IOMA 4OI4A 2F1RA 5CYOA 4A6PA 2BMDA 1Z28A 2A2ZA 3QVUA 1XWIA 1LW7A 4A0HA 4D6PA 4JT4A 4AKEA 3KQLA 2VRWA 1GIAA 5KUTA 2ZRFA 2QQ0A 1GG2A 2A5GA 2XZOA 3ADKA 3UIEA 4NL4H 3GJ7A 5LPNA 1Q3HA 1WBDA 4WVFA 5E7MA 3MWYW 3P4XA 4US2R 1G5TA 3HP1A 2F6RA 2W2VA 3C16C 3CIOA 1YQTA 3ZQJA 4MDEA 2EFCB 1S3GA 3AGPA 5G3YA 5GVSA 3F3YA 2QAGA 4M1YA 1FQJA 2X1VA 1XTQA 3MSXA 4PZZA 4P4SA 1PZNA 3B9QA 2DB3A 3A1SA 1NN3A 2GJSA 4JVLA 1E9BA 3WP1B 3OE7D 2IEZA 4I1SA 4Q21A 2DWPA 2D74A 3HR8A 1NN0A 4OI1A 3C15C 3VNVA 3EX7C 2FMXA 1XJQA 3L2OB 4KFUA 4DIDA 4K8OA 1DS6A 2F1JA 4AYXA 3VFDA 5JFGA 3AQ4A 5SZKB 3K0AA 3SC3A 3SYKA 2ODEA 4NPHA 2OXRA 2GF9A 4LY6A 2QP3A 4QC2A 2WPDD 5K8IA 3GLIB 1P62B 2BCGY 2HUPA 2O5VA 3KJIA 4PSVA 1KTVA 2YJTD 3GCGA 3GJ3A 1UDWA 2B7CA 3NBFA 3NHBA 4A2PA 4CW7A 4ZDJA 2REOA 5DN6D 3ZGXA 1VIYA 4IW3B 3WNDA 4BPBA 4F92B 4DUGA 4I99A 2CL6X 2QM8A 1X1SA 3TLXA 2FFAA 1E1RD 2LKCA 4CEJB 5CIWA 3RS4A 2VP9A 2G88A 1N6OA 1EXMA 1R10A 2ZSAA 3B82A 3NIBA 1W4CA 1XF9A 2FG5A 4LPSA 3FHOA 2G9NA 3RWOA 1NN5A 3R20A 5TMPA 3EXAA 4EFLA 3SBDA 3DEFA 1BS1A 1LF0A 1XFAA 3GLHA 4JVNA 4P33A 3UMRA 3TSOA 1T4GA 4Z8XA 2O8DB 1BYIA 3SS8A 3PUXA 2HLDD 3EPKA 2GF0A 1U2RA 3GJXC 5JBQA 1ZIPA 4ZKEA 2C99A 3CRQA 4PC3A 3LH5A 4TLAA 3W3ZB 4AKGA 721PA 1UEIA 4EKDA 3ADBA 2AKYA 1L4YA 1TUEA 2XB4A 5KNDA 3BH0A 1G4UR 2FPLA 3H4MA 3QXSA 1CU1A 4M1OA 4OHWA 5HCNA 4QM7A 4IOLA 5IHPA 1FW6A 2AFHE 1T5IA 1I2DA 1U81A 4KHZA 3CBQA 1W44A 4DT1A 3RRYA 4Q5IA 3VR4A 4H1VA 3RVBA 4MA4A 3U3KA 1E2NA 1NIJA 2QORA 1R5BA 4FMCF 4YMWA 2CBZA 3FKSD 5EP4A 3SU8A 1Z47A 2DY1A 1Z2AA 4US1R 4BECA 4OHXA 4Q7MB 4E03A 2OCPA 3VHLB 2GXQA 4OK6A 4GFDA 4DLZA 1NG9A 5FTKA 4DSNA 3GJ0A 2QAGB 3KX2A 1X3SA 3PITA 1MABA 1UBEA 1G8PA 3MJHA 4LX0A 1DELA 1XD2A 3EA0A 3HU2A 3BC1A 4C7OA 4GNKA 2BCJQ 2WJYA 3FPAA 4YDSA 1XEFA 3K9LA 3UG7A 2ATVA 1KZ7B 3OE7A 2WOJA 3A8TA 3HWSA 1NI3A 2QZ4A 1F2UB 4DT1B 1TU3A 4RSGA 4O3MA 1KI4A 3PG5A 1OFIA 1Z0DA 5AUQA 2O0JA 3C4JA 4U5XA 3RHFA 1SKQA 2IYZA 1GL6A 4NP6A 4R71A 2J7KA 4PR0A 3RSLA 2ZRLA 2I4IA 5AJVB 3GFOA 1R7RA 4Q4JB 1A2KC 1FPMA 5CITA 2IYWA 3KZ1E 1XB2A 3BH7A 2V7QD 4QBGB 5CM9C 1KI6B 4LC0A 3UK6A 4YDHB 4D0LB 4IVPA 4B3XA 1OLOA 4B6FA 1HE8B 1P2VA 2ORWA 2KB0A 3PCRB 4KITB 4NZYA 3TAUA 4PHFA 5JS7A 3AF3A 2R6CA 5E3HA 2V1XA 3GPLA 3VR2A 3TK1A 3EZ9A 1IHUA 1P9RA 1ZM2A 2C04A 3QKTA 4JKYA 4WZBE 3REFA 2ZETA 1NNEA 3DMDA 3THXB 4TLEA 1AZTA 3OFND 3DVLA 2ONKA 3I32A 3AUXA 3W5IA 3U44A 2HLDA 2IYRA 4RZXA 1MO6A 2AK2A 4Q00A 4C0LA 2V54A 4MKHA 2HYIC 2PZEA 2HCJB 4KVAA 2HT6A 2F1HA 3B85A 3K0AB 1WXQA 3WYFA 1HEIA 4Q1BA 1FP7A 1J99A 1KNXA 4BGDA 1F60A 5AJZA 3QKUA 4GL2A 3D3QA 3Q8XB 1XCGB 4EAQA 3QXHA 1F2UA 2XOKA 5H70A 2XITA 4IXNA 4W5JA 1E2PA 1T0JB 2C8VA 2VSOA 4PZYA 1NVVR 4MRPA 2EU8A 1T9HA 2VHQA 2YOFA 4Q01A 2GETA 2CLSA 1UEJA 3BGWA 4B32A 1F48A 1KK0A 1JJ7A 3F5FA 4CRWB 3QF7A 2QENA 3FFAA 3B9PA 3AVTA 4Q7LA 5CM8B 3HDTA 4JBXA 5J5CA 4TMXA 4G3XA 4EQ6A 1JQLB 1E9CA 2JIZD 1ZVQA 3T06B 1CRPA 5HZHA 2IX3A 4LJYA 4JSTA 1P9WA 1HT1E 1E9RA 2H17A 1FMLA 2EFGA 1ANKA 4Q1EA 3QIAA 4O0MA 1FNNA 2JAQA 4AYWA 3REGA 2A5JA 2CNWA 1ESNA 3AKYA 2G3YA 2D3WA 2R6AA 3NDPA 4OQFA 3K09A 1XEWY 2G1JA 2H16A 1GRQA 2OLKA 2CVFA 2J3EA 4JMPA 4MKGA 4FIDA 4HB0A 4DSOA 3PENA 1DPFA 3EASA 4LYAA 4P0TA 2ZJ5A 4ZIRA 1BIFA 1EFUA 3LO5A 1OIWA 1OT3A 4FXPA 2A78A 2QMHA 3R7WB 2CEAA 2IHYA 2IF2A 4UXIA 4TL6A 4DDVA 1Z0AA 3KJHA 4A0RA 4IDOA 3M1IA 4M9XA 1TEVA 4XWAA 4B43A 1WA5A 5HE8A 2G83A 5FPTA 3A1TA 2V7QA 4DVGA 1VHLA 2PMDA 5JJIA 1GZSA 4JJKA 3EZ6A 4OI2A 1U8ZA 3BD9A 4EJSB 1QG2A 1XX6A 3L8YA 3L0OA 4LJ4A 1CLUA 5G40A 5EP3A 1DG1G 3UXMA 3TMKA 2NZJA 3R9WA 5JJLA 2NZ8A 4M9SA 2R9VA 4FCVA 1W36C 1G41A 3I92A 4HSEA 4MYTA 4ZCLA 4C0HA 4XD7A 1TL7C 2CLCX 5EE9A 3AP2A 4C3ZA 3RRNA 1A5TA 1R4AA 1HYQA 3ETLA 5AK0A 3SJAA 4JT2A 1JEEA 1NP6A 5TVKA 1P75A 1NJGA 2O8BA 4GBMA 4UNPA 2QTVB 1Q0UA 3AH8A 2NPIA 1N0VC 2GJKA 3GD7A 4HB3A 1M7BA 3AF0A 1CR2A 2FFBA 3KDSE 3OESA 1JB1A 4HB4A 3PEYA 4OK5A 5JI2E 4DZZA 4JBYA 3WNBA 2OAQ1 2QP4A 4A0FA 1G7TA 1BKDR 2YOHA 5FTJA 4ZPXA 2OEPA 3KXLA 4Q9HA 2XGJA 2QTFA 1XXHE 2AX4A 3U60B 2VP0A 3SZRA 4YMSA 4D2IA 1GKYA 1Q44A 2PLRA 4KYIB 4C2TA 4AYTA 2HCBA 3BRWD 4RD1A 1XXHA 1G20E 2OFOA 3VTKA 4XIGS 4C0SA 1E0JA 1E2FA 4FWTA 2OT3B 1E0AA 2J0VA 4D25A 2AL7A 2J87A 2RH5A 2CL7X 4ON9A 1E4YA 2V1UA 1KMQA 2PCLA 4M0LA 3BXZA 3CKLA 1OH8A 1KI2A 2ANBA 4KVGA 4DXAA 1NG1A 1SXJA 3JZMA 3WP0A 4ZI3A 2PX3A 2JJ1D 4PPQA 1N0UA 3IDQA 5B57C 3GLFB 1L8QA 4JLBA 1QRAA 2CE2X 4WIAA 3DHWC 3ZZUA 2VHTA 2F55A 2WSSD 4NYJR 3B5JA 1E0SA 2JJ8A 1IN4A 3J81k 5DLQC 3B7GA 4PHGA 4LHVA 2KBFA 4TMKA 4IFEA 2X8AA 2WHXA 3VR1A 3I1FA 2CHGA 5AR1A 3CZPA 3GFTA 1DARA 4BRUA 2ZJZA 3LVQE 4R9UC 4RZ2A 1QHXA 2ZRIA 3GFPA 3W8NA 5JHHB 3X1XA 3O47A 1RC8A 3Q85A 5AJWA 4URYR 2G6BA 1AKEA 2ZI4A 3KKQA 3AKEA 4QHTA 3QE0A 3VR5A 5K8UA 4CEIB 1AQYA 2XZPA 1D2EA 2GAAA 4V0OA 5EP1A 3C41J 4Z54A 4M9ZA 1W7AA 3AVWA 5A0FA 4JLPA 2RGGA 2P5TB 4P31A 3KQKA 2BEJA 1VYVA 2NQ2C 4ZCIA 2NG1A 1IN7A 3B8HA 4O25A 4TYWA 1E2DA 5DYGA 4IDNA 3K0CA 1S9HA 3P20A 2Z4SA 4BZPA 1KKMA 2CJWB 2FOLA 1SVIA 5DHAA 5UKDA 1ZUHA 6Q21A 2BV3A 4M22A 2NGRA 4N1AA 1AK2A 1A7JA 1W4RA 4LYFA 1OXTA 1VPLA 4LDJA 5KU1A 2EFEB 3M4YA 3PIRA 1RKBA 2GXSA 1RFLA 4UNQA 2HXSA 1DADA 4GOXA 3U7FB 2J9RA 4ESVA 2R6DA 4TYYA 2ZR7A 2QTHA 3GEEA 3PQCA 5F98A 1EFRA 2FFHA 2R65A 4PSAA 4L4UA 3CF0A 1UAAA 4U7DA 2OLJA 1ZU4A 2A9KA 4DLXA 3K70B 3GLIA 2ZU0C 4GDFA 2LCFA 5FOXA 1K5DA 3ZIAD 1RZ3A 3B1YA 2ZSBA 4XTCS 1R0XA 3EWSA 4TMZA 1PJRA 5TXGA 2W00A 1KO1A 4P32A 4QBHA 3LXXA 4FW9A 1MOZA 2ZS7A 3FB4A 4ARZB 3U3JA 3D8BA 3A4NA 3GEIA 4O2LA 1RYFA 2V6IA 1O87A 1OKKD 2O0KA 4JLNA 1TTTA 3L8ZA 3KQNA 4AI6A 1XJ0A 4AG5A 3WYGA 5JI3E 3CPEA 4BLTA 4MUBA 4RKEA 3KQUA 1SXJD 1VIAA 1OXSC 3WMFA 2FGKA 4EPVA 4UXJA 1ZC4A 4Q66C 1EFHA 4NCNA 5FPSA 4ESHA 1WP9A 3F0TA 4Q18A 2JLRA 1Z2CA 1UBCA 1BYUA 2WSSA 4L9WA 4ZIRB 3IIKA 1XU4A 1G8HA 3G0HA 1VKJA 1XEWX 3LA6A 5L3RA 1C9KA 1L2TA 2ZRCA 2GCOB 2RMKA 4ERNA 3MJRA 2NTYC 3JZAA 2FE4A 4MGZR 1C4OA 2EFDB 4PC2A 5EUMA 1F2TB 3PR1A 2IXEA 4TYNA 1YJ5A 1ZD9A 1IN8A 2DHRA 4TL7A 4BRWA 3VU9A 1U8AA 2ZRMA 3ZS8A 3BFXA 2V8OA 2QSZA 4TT3D 3BOSA 2IYXA 1BOFA 5BXQC 4QM6A 3LDAA 5J4YA 5GVRA 1CRQA 2HF9A 4HZUA 2O8FB 1DEKA 1J90A 4TYPA 5FOVA 5TB5A 2PCJA 3TVDA 1S96A 5EJEA 3K0FB 1HT2E 2QAGC 3A37A 4PO9A 1AIPA 2QUZA 4NBSA 5GJVC 3E2IA 5DI3A 1SKYE 3UANA 1UPTA 2ORVA 4FN5A 5D3QA 2XX3A 4IKEA 4EPYA 1DVRA 2C2HA 4Q7KA 4P3YA 4RVCA 1KDTA 2FGJA 3Q3JB 2PJRA 3TH5A 3IIMA 3I4LA 4IDPA 2HV8A 2XZLA 1M74A 4Q9IA 1GTVA 3WHKA 4TYQA 2E1RA 1R2QA 1RRCA 1C1YA 2DR3A 1EFRD 5TV2A 4WBSA 1YHNA 4G5SA 2PL3A 5B64A 2ORIA 1XBTA 3EIEA 3SNHA 2GCNA 4MRRA 4KODA 3OF5A 4Q4HB 4W5WA 4WAUA 5FTMA 5KPDA 4KFSA 2OSBA 1EX6A 1Q12A 1VDZA 2AK3A 3B1XA 5LB4A 4JS0A 3X1WA 3C14C 3BH6A 3K8YA 4LBZA 1MO5A 5DYIA 3X1DA 3ZIAA 3B13B 4EFNA 2XJ4A 2J41A 1NLZA 2QGZA 4GI7A 1GWNA 4BFVA 2IK8A 1NJFA 5KNBA 2Z5FA 3BORA 1NRJB 3O8BA 2PT7A 3SJBA 4MUAA 4DCNA 2G77B 3KFVA 3TNFA 2MMCA 2UVQA 4EJSA 2ZRKA 1TADA 2ZR0A 5JS8A 5FBWB 5F9FA 2VP4A 4LHXA 1E9DA 2OZEA 5DE3A 3OIYA 3QY0A 4PANA 1AM4D 3RRZA 1E99A 1UJ2A 3VMFA 2JA1A 5KYKA 1ZMXA 4C0BA 4E22A 1K8RA 3KB2A 2KJQA 2JLYA 2YNMA 3NXSA 4DEYA 2GVDC 2A3RA 1D2MA 5KSOA 1XMJA 3B60A 1KSFX 1NLFA 3GJ4A 2V4ZA 3JVUA 3B1WA 1YR8A 2EW1A 3I5XA 1P2SA 4QRHA 4TL8A 1ZNWA 1XPRA 1BH2A 1XD8A 1Z63A 5K8LA 2JDIA 2GZDA 2KSQA 4OK3A 5AJXA 3BB4A 3EAQA 1KZGB 1ESMA 4D0GA 1KSHA 3VKGA 5KDLA 821PA 4JIMA 3X1YA 2MSEB 1G5RA 1ZIOA 1SXJB 2N46A 4JVMA 1G3RA 2D62A 3QG5A 3TW4A 2G0NA 4C0AC 4E07A 1UBFA 2EQBA 4BLSA 2CE7A 4S2EA 1FQKA 2FZ4A 1RIFA 4F93B 1XD2B 2VP5A 4POAA 2VHCA 3DMNA 4I1UA 3THOA 3GLFE 1OSNA 2Y8EA 121PA 2GCPA 4F7WA 4TLDA 4RD2A 2YYZA 4GSYA 4MKIA 4OBEA 4TLBA 2FWRA 1G4AE 4UJ3A 4WXPA 5FL7A 1KAOA 3TUIC 1W36B 4M21A 2IYLD 2NO9A 2YWGA 1ZCAA 2IF0A 3L0IB 2EWWA 3GJ6A 1Q21A 2VP2A 4C30A 1QHSA 4GOJA 2C78A 3AP1A 4QJ5A 1U9IC 3QXXA 1WCV1 4B75A 1KJZA 3QSYA 4DCVA 1GVNB 1U0HC 3CX8A 3AKCA 4DDWA 4FMDF 3U6BA 1Z29A 1ZINA 2CL0X 2J0UA 3LX5A 1N5JA 2IYSA 3L0SA 5JHGB 1M7HA 2IXFA 2NO1A 3IPYA 5KDOA 3THXA 1JAHA 3ZDQA 4M2LA 1O3YA 1GM5A 1JECA 3MGCA 3SBEA 2Z0MA 2GWHA 4AD8A 1DAMA 1U90A 5BN4A 1WB9A 3ZD7A 4URXR 2F9LA 3BJIC 5J47A 1AGRA 1CJVC 3VX3A 1LFDB 2FFQA 2C9OA 3LQRA 3MLEA 5SZHB 4QNRA 5FBRB 5M04A 1NMXA 5HKKA 2ZRPA 2QRNA 3V9PA 1WRBA 2KI5A 1IXRC 1KO5A 1W0KD 1AA9A 1DBSA 4ASUD 4TN1A 3W6OA 2XTMA 3SJCA 4EFMA 1MRSA 2D2EA 3KKOA 2VO1A 2ZUCA 1SVWA 1P2UA 2K5UA 4EUNA 1VCOA 1JBKA 1RJ9B 4AKIA 2C95A 3JVVA 4JYBA 3TBKA 4HEJA 1S9DA 2GNOA 5JEDA 4TQUS 2RGNC 3QEJA 2D7DA 2IXGA 2CHQA 1VYUA 3N5CA 3BB1A 2XTZA 2REXB 2J46A 2GXAA 1M34E 1E96A 4A1FA 3AVUA 1X86B 1ZUNB 1II8A 1E2JA 1TQDA 1UKVY 2VSFA 4V0LA 2OFXA 221PA 1KI1A 5J4HA 3SOPA 2RGEA 2XNDD 5EXPA 2Q3FA 1ZRHA 1MRNA 3LLUA 3T61A 3IQXA 3RANA 2RGNA 4LBVA 4B2IA 1UADA 4RD4A 1FFHA 3FHTA 2WJGA 1G17A 2OFWA 4FMCB 4F4IA 3OIWA 1B23P 3LNCA 4DLYA 3OIVA 3PUZA 2O8FA 2OAP1 3DDCA 3U2QA 2WWXA 1YRAA 3RS5A 4A36A 4FD2A 3OAAD 3BIFA 3UG6A 1E2HA 1UKYA 2C98A 2GJ9A 4JLJA 1TEXA 4D4KA 5G53C 1RE0A 4X8OA 3I8SA 3V4FA 3IILA 3S1AA 4RCYA 5DIFA 5IT5A 2OCBA 1E9EA 2AXPA 1E2GA 3LBIA 3AM1A 2GK6A 2JLSA 2QI9C 1OJLA 5EE1A 1G7CA 3SR0A 5BN5A 4U00A 3I61A 2IWRA 1A2BA 4EDHA 2WOOA 1RRGA 5EXSA 5IK2D 1FL9A 2ZJ2A 1MT0A 2JLQA 4BLQA 3UWOA 1OB2A 1W2GA 3OEEA 5K8TA 2OHFA 4OQNA 4AY2A 1T6NA 3BS4A 2ZYTX 2IS4A 2AFIE 1JR6A 2C5LA 2GEVA 2R6FA 4M8NE 4PC7A 1E94E 1HH4A 4IJMA 4TZ6A 2IYUA 3BB3A 1G7SA 4LYJA 4DSTA 4TTPA 2WBLC 4GOKA 4C4PA 4A15A 5HKKD 3KUDA 1SKYB 4KO8A 5HE9A 1OKKA 1DAKA 4RD0A 1FX0A 1P2TA 1PUJA 4KAXA 1FUKA 4OQXA 1R0WA 3BERA 4KBGA 1KGDA 4JLMA 1H8HD 4QBFA 3RSOA 4YMUA 1UDXA 1W46A 4X8MA 4AK9A 3LW8A 2W58A 4XWKA 4KLZA 4DCTA 3ONWA 3W3AA 2IUUA 1SVSA 1TU4A 3A4LA 1G8YA 2ZEJA 4CVNA 5DO9A 1NBMD 1N0WA 2WTUA 4PO1A 5FOUA 4Q7JB 3RC3A 3SHWA 1T91A 4FMBB 2W0MA 3GQBA 5G3ZA 1TAGA 4B71A 2EYUA 2QAJA 3IBYA 3UPUA 2GJAA 3IUYA 1EFCA 4NMMA 1M6NA 1CJMA 2QPAA 4V03A 4KSBA 4YONB 1YZTA 2AN9A 2ZRNA 4JJZA 4A0GA 2XAUA 3QXCA 2IC5A 4RD6A 4PQYA 2GRJA 4WW0A 4A8JB 2WWFA 4UNSA 3RS0A 4MDFA 1US8B 3OFNA 1LS6A 2FEMA 2QSYA 2ZVPX 5JWHA 2ASEA 2WMNB 5FR1A 3BWDD 4D4MA 4MYHA 1KSJA 3R8CA 3IQWA 4ILEA 1YZUA 3CLVA 5L3VA 1YZKA 3A58B 1SGWA 5BW8A 3OAAA 5JCZA 3CPHA 1R6BX 3RYTC 1J70A 1NBME 5CK5A 1JR3A 5KO2A 1XPOA 4ZDWA 4JLKA 3ZVLA 5FUVA 1XTSA 4PC1A 3GLGE 2P6UA 4IFBA 1W36D 1S1MA 4IHQA 1E9SA 1R0ZA 2A7QA 4NYMR 4QGAA 1VYTA 4QBIA 4BQSA 3K9GA 1G8FA 4DCSA 1CF4A 1F3OA 4DEXA 4BFZA 3QPVA 3T5GA 2AKAB 4LRWA 3EC1A
chains in the Genus database with same CATH superfamily
1MW9X 4IDHA 3DEZA 5LBTA 3C6YA 2XLBA 3V4PB 3DL0A 3LF2A 5CBPB 4MW9A 2PUCA 1TF5A 2N1MA 2BSXA 2EC5A 2ZJYA 2QMZA 1AA3A 3LG2A 2WZQA 5ALUA 3W0LB 2Q0HA 5JAHA 5HGXA 3WQQA 1XWFA 1T25A 3HN2A 5A05A 2CDNA 1IHYA 3ANMA 4BNJA 1VPDA 1YKSA 3MXOA 4EL5A 1JVSA 2RGCA 1UIMA 3DKVA 4K6OA 5HF5A 1Z0KA 1EGAA 4IIUA 3DBVO 2PZBA 4ZXFA 5EQTA 4RFSB 2B2NA 1T3LA 2PH1A 3B5EA 3PNBA 4KIFA 4L57A 5FUYA 4AKTA 2VTBB 4WEOA 1SC6A 1O5IA 3G2OA 2WWYA 2DPYA 1U7UA 1LK0A 1PL6A 2ZYWX 1QF6A 1RAEA 2ZBEA 1SZDA 2FDRA 3C7CB 3H9GA 4FZ3A 2ACWA 4B47A 1SVLA 2FW7A 2WJJA 2P9BA 4OFWA 4TUYF 1N2CE 3GLUA 3PE4A 4HDNA 2CNNA 5GV7A 2C07A 3HBFA 3UUEA 3S81A 4ZEWA 5JC1A 4P3NA 5DISB 4ZREA 2C9DA 5IU6A 3V8VA 3B3GA 5C4GB 4P2BA 3VKVA 1DFGA 2B36A 4I8IA 5JSFA 2DXIA 2XI4A 2GK3A 3W3AD 4BQNA 2YH2A 4ZV4A 2R6ZA 3DOUA 3HLTA 5DN6A 3RC8A 5BNFA 4XJXA 1YUBA 3CH4B 1CIVA 3TNYA 4EO4A 4ZOQI 1JQKA 1QO0A 3BE5A 3H7IA 1DXQA 3DBRB 1XCMA 1ZI6A 3CO5A 4HLUC 4NDZA 3GUUA 1DV2A 4KE9A 4O2AA 5CVUA 3WZMA 3KKLA 5JRZA 2I65A 3R1IA 1PU2A 3BXPA 4WTOA 1LPSA 4LJ6A 1P2BA 1QWSA 5JNTA 4G0UA 4DQVA 4RPKA 4JJ8A 1ISIA 2RD2A 2ZU6A 2VP6A 3AR4A 3TSWA 1QP0A 4EGQA 1J0AA 1AU9A 2CLKB 4MYRA 2RONA 3S40A 3N76A 1FK8A 3A1DA 4CGZA 5CLIA 4DA9A 4UBJA 1POWA 2H9AA 2CV1A 5KYUB 2A0FA 3G0IA 3LYAA 3U9LA 4Q4CA 1RI4A 3NHAA 4TLCA 5F7OA 1JR3E 1XRNA 1IN6A 3FR8A 4HNGA 4ES6A 2EYQA 1XNJA 1L8XA 1SHZA 1X7ZB 3PU6A 4H7KA 2N3ZA 3UN1A 3GHYA 2HDHA 2DBYA 1KL7A 2Z98A 5D87A 2QS9A 3DQQA 1E2LA 2J5KA 2YWJA 4G09A 4XTRA 3FNHA 4LISA 5E6UA 5EIHA 1K9SA 1WCXA 1P7PA 3I9KA 5C1DA 2IDJA 3PA8A 4WCFC 5AVJA 1E8DA 1U0EA 3AHFA 1E1DA 5ENZA 5TJ9A 4J7AA 2PLFA 3E22A 3ECAA 3B1VA 3INRA 4IJKA 2OZPA 3RBVA 3PHHA 2W4IA 1JJVA 3IV6A 3EVEA 4V02A 4LZPA 3CLHA 4PRZA 4M0KA 4N0QA 5FFMA 3R3SA 3PLNA 1U2GC 1NBEA 4R81A 1R5JA 4CLEA 1DBPA 3UUGA 4L0MA 2IS1A 1PQPA 3G8CA 3HZZA 1LY1A 5FR2A 3V8RA 1AV6A 2I66A 5K2MA 3KKMA 1XVVA 4A10A 1GSAA 1GSIA 1MLDA 2H2HA 3M5WA 3N0RA 3U62A 1E3WA 2V9CA 4L6AA 4YUWA 2VQEB 1P4RA 3EDQA 3FDFA 1MB3A 2J6IA 4IKPA 3SQOA 2VDWA 4DPMA 3DV0B 4OB6A 1FVFA 1TCVA 1FLDA 2CK3D 1EQAA 2FSPA 1A8QA 2CJXA 1LC3A 2JJ1A 2ZJ3A 2QMEA 1SCBA 2GBIA 2ZT8A 4Q47A 4BVLA 1L4UA 4OF4A 3FVVA 5ICFA 1QHGA 3TEJA 1JYFA 1N2GA 2OXFA 3VU3A 4G25A 1Q7RA 3D4IA 3ABIA 3E9QA 2W2LA 3FZYA 1K08A 2RJ3A 3HKBA 1VG9B 4NQZA 5LUBA 3CB4A 1KOLA 1J5EB 2DE0X 4M3NA 2WK1A 1CUHA 1T6ZA 1GZ5A 3OJLA 4B3BA 2Z83A 3KP1A 4LCEA 4NZ9A 2ZUTA 4Z4GA 4KXUA 1PV2A 2YWHA 4OUDA 3CTPA 3PQ8A 4LZJA 4OB7A 4DC1A 5JR3A 4DV4B 2O8EB 1DGQA 1FMJA 1GILA 3EE6A 4N5DA 1SCDA 3CVJA 3N3AC 2OV3A 3BGIA 2BH2A 2LIPA 3H05A 1GOTA 5JFOA 1Z62A 3WYEA 5FWXB 3AGQA 5EA2A 1K5GA 3B6KA 4HLCA 2P4HX 5F9HA 1XQXA 4YMLA 2ZJFA 3M6LA 4KQ1A 1CJSA 1DO8A 4E5VA 5KWJA 4G5OA 2I55A 3PGLA 3BFJA 4K9RA 1TJ3A 3URMA 4DNXA 4C3OB 3OE4A 1IBSA 1PZXA 1UCFA 1TF7A 2CJWA 4DB2A 1GNRA 3EIFA 1K98A 5DWDA 4FEYA 3ND8A 3S7TA 1H8EA 1U9IA 4GMKA 5JYDA 3QKRB 3T6KA 5FOSA 3U13A 1XVIA 3IS3A 3D7SA 3BFKA 3GGSA 3L6EA 2PD6A 3IO3A 2B37A 4YAGA 5KJFA 3HUTA 3GPDG 3L4BC 1OX5A 4KOEC 3GUVA 2C8KA 2QGNA 1ZWKA 1OLSB 3DC7A 3M6XA 3ME5A 2AWNA 2V58A 2YW2A 4JLVA 3T1QA 1I3OA 3Q7QA 3W1VA 3SQWA 2WVJA 4F9FA 2EF1A 4OJTA 5DXJA 4ALLA 2PXAA 2B82A 5ELMA 3A0RB 1Q95A 4BX9A 3T0FA 4DWWA 1D0SA 5EHGA 3DVSX 1ULZA 2I4TA 4J6EA 1RQLA 1RYHA 2NX2A 4KQEA 5C8YF 1JEJA 2C3MA 4EGFA 1C8KA 3SGLA 5COAA 3HL4A 1AT1A 1IEXA 2ZYIA 2B8WA 2HRRA 2R00A 4DV3B 2XY4A 2R1TB 1CNEA 1UDBA 4XASA 3T15A 1D6NA 2WJZB 4DLVA 1X19A 1MO3A 5JSKA 3DAYA 4QEDA 1ID8A 3AUJB 5CNMA 1TZMA 2IU0A 4D6PA 1O9GA 2CXXA 2RHMA 5AM5A 1UBRS 2O2GA 3BSSA 5ALFA 5BWMA 4FR2A 4PYQA 4HNQA 2HK9A 4R1PA 3W4IA 4BQRA 4V0SA 1I0IA 3QVJA 4YI3A 2GKGA 3HFGA 1OAAA 2FZWA 1FPQA 1N6NA 1H94A 1VSBA 3G2MA 3IC5A 2OMKA 3A9CA 3IYLW 4OHYA 3FM9A 2A4MA 3FYUC 2O2ZA 3GNQA 3TS1A 2C7OA 1E62A 1R88A 2W2NA 5HCUA 3RK0A 2O8NA 1Z4NA 5HA5A 1SBCA 3JQ6A 4AX4A 4UFPA 5FBVB 1TA0A 1YRBA 2GR9A 1GV1A 2I8AA 4KQFA 4PW0A 5CIYA 2EQ5A 3CPJB 1ZH4A 5DHFA 1YDFA 3AVXA 3D4NA 2TMGA 3RRMA 1CUZA 3N9IA 4GE0A 1ORIA 1Q57A 1RQNA 1T1IA 4NX2A 3KVVA 2XRYA 3PJDA 2GEKA 5K99A 2JHPA 4BVBA 2H1SA 2Y0CA 1U0JA 3C74A 2I1VB 2P6OA 3L4BA 2R7AA 1UFKA 3VYRB 5DYWA 3BK2A 1EFPB 2C42A 5CK4A 4BN0A 2RKOA 1LLCA 3AI7A 2VPWA 2VSNA 3GDWA 3YASA 2B8EA 2GARA 3C8UA 4JNKA 5FJIA 3ZXYA 1WAMA 3DUFA 4Q9KA 3KALA 1EFTA 2NO7A 2IIVA 4ARAA 3K2QA 2R47A 5HTKA 4E1BA 1I4DD 1QP4A 2PX5A 3THWA 3NM6B 2QRMA 2IITA 4RVOA 4IEEA 2KLBA 4IVQA 1T2FA 4YUZA 3L7LA 3I42A 3LY9A 3EDMA 4TKUB 1EP1B 4C22A 5L4LA 5BQ5A 2DCUA 5JYCA 2DYKA 5DHQA 1Z0SA 3RSGA 3Q41A 3R0XA 3ORQA 5DHPA 2GN2A 5REQB 1QNFA 4EPRA 4PX9A 4U0KA 3NHPA 4GWKA 3ZTWA 1ZVVA 5JCPA 3KD2A 3PXCX 1XZQA 2B5VA 1J9EA 1B6TA 3MINA 4ZMBA 2NMVA 1Q84A 2GVNA 2PRKA 1V1MA 4MB2A 4BNLA 1KJWA 2RARA 1GY8A 3I64A 3IP1A 4PTLA 4Q1DA 2GO1A 5KAMA 4TZKA 3JPWA 4DAEA 1UT6A 1FEZA 2ODPA 3VYUB 3JQ8A 1DHRA 1E9FA 2NW6A 4XVUA 1MPTA 3A9WA 4IG9A 5DBIA 4K8RB 3BL5A 5HJ5A 1SKUA 2FMIA 4KQIA 1EBUA 3LHKA 4HBZA 1XQYA 2IWHA 3OLYA 5LDHA 2Z6VA 3HR7A 2C84A 2DHQA 4HNHA 1QJ4A 1Q7CA 2C31A 2PS9A 5E6SA 4CEIA 3KAKA 3LXMA 3QVTA 4XLZA 2ILVA 4TZ0A 4NG5A 5ALKA 2I87A 3QLUC 4HVTA 4QHYA 3UHPA 4EEXA 1IC6A 3WK7A 2FEKA 1HG0A 3LJKA 5KJCA 4LW8A 2IV3A 3GUYA 1XTZA 5LQAA 4PG6A 3C7AA 3RVOA 3CINA 1ONPA 3ECSA 4UEOA 2Q0QA 2ZUSA 2FQ1A 3WGVA 3SBXA 3GNTA 1IZZA 1I1HA 1VJ5A 2B1RA 2DHEA 4AY4A 3KETA 2QU8A 5AHKA 4D82A 1T0PA 3WHPA 4GYJA 5EQJB 4AAYA 4IM7A 2QJFA 2OM6A 2Z09A 1ODFA 4CLOB 5MF6A 1TKAA 1L5FA 3BWVA 3ENQA 3LWDA 1MH9A 4IG4A 4L6CA 4G9EA 5G2OA 3PJFA 4AFNA 4LOJA 1TRHA 1GEEA 4QG7A 2P77A 4EO7A 2XD4A 3E70C 3Q7TA 3G2NA 4LYHA 3PYMA 5FWDA 2WU8A 4LF4B 3VV2A 4DBLE 4RJLA 4Z4IA 1PUIA 3CC8A 4BFWA 1WMEA 2VPTA 3VI3B 3VRHA 2ZW9A 4I4TB 1JMVA 4F9TA 4HAZA 3FRJA 3UHFA 4NR0A 1BN7A 1VHTA 1DC7A 3OJCA 2HMYB 1QMPA 2CF6A 4K1XA 1ILWA 2ZJOA 1TXGA 2ATIA 2P3SA 2Q2QA 4AURA 4BWYA 3WLPA 1MX1A 1Z06A 2WIAA 3TEMA 3OVMA 1NYRA 4H15A 3F6YA 2QN7A 1O6GA 2A0UA 2HSEA 2NVOA 2Q6LA 1TKRA 2IY8A 2V97A 3FJ1A 3LBFA 4IIJB 2IL1A 3F6BX 2H18A 1JVBA 2CCGA 2BGIA 2RGWA 4WXHA 4CT0A 1SQ0A 4GR5A 1OZHA 3CNOA 1KY3A 1IAQA 2A84A 2AI3A 2QMUA 1Z5NA 2AEMA 2H00A 1COWA 3HL0A 3FWKA 4LZZA 5C8XA 4JUIA 1YHYA 2TS1A 2ZJ4A 5KVVA 1QZUA 2AFVA 2VAWA 2WRZA 2BY4A 1Z13A 2FEWB 2FLVA 1GGJA 2Q1XA 1CD5A 2Q29A 2JANA 3B89A 3HFJA 4HLUA 5A3SA 3AFNA 5K0TA 1NX6A 2G80A 1T15A 3U7EB 3OU7A 3EK2A 3D8UA 1B8PA 1Z5VA 3HCDA 4W7IA 4XOIA 1NIPA 5BOVA 5U4XA 4K6FA 4D81A 2A1UA 2H85A 4HEA1 5I7AA 4H6XA 3UVEA 1W581 1A9YA 1JS1X 3CG4A 3EWNA 4H1HA 4C7JA 5DW0A 4GZMA 1CXZA 3W2TA 3D6MA 4L5BA 1TAQA 2FCRA 5FPKA 2CXTA 4KB5A 3DULA 3AIIA 1DKPA 4CMAA 2B2CA 3MTEA 2HHJA 2B8NA 1OTYA 1UQRA 1A8SA 1ZLXA 5JNSA 4FYYA 4TMWA 1XAGA 1JPJA 1O2DA 4XVRA 3PP8A 4CF7A 5IJZA 5KWIA 1W0JD 4ZRMA 1BO6A 2QRZA 1SUEA 3D6JA 4BNNA 4UNRA 1OREA 5EIEA 1UBUS 4RNDB 3OCJA 2OV2A 1ZIDA 3TTUA 2Y9PB 4MW0A 4HT3B 1VGQA 3N74A 1FTNA 3KJZA 3UT5B 4YP0A 1FXWF 5D3MA 3OWOA 3WB0A 2F3RA 3KSRA 3B3FA 5T64A 2NZUG 5H9WA 4F3RA 1KY2A 4MDHA 5K3BA 3FAZA 1UMBA 1ZD1A 1LRJA 3P8ZA 3ZLUA 1YE3A 3KQTA 5BV8A 1P6UA 1E59A 2OV6A 3PD7A 5ALJA 2JZOA 3NGXA 2FU5C 3BSYA 3D4LA 2XYQA 3CWQA 3L7IA 4KQMA 1Z82A 3T0IA 4B31A 1KMMA 4C78A 3UTCA 5GMOA 1KWGA 3HN6A 3B36A 3M6IA 3OO0A 4NU0A 2XSZA 4IGEA 4LJ5A 1QGYA 3LA8A 5DI3B 3ZD8A 4FIZA 1EEXB 3C7KA 4C05A 1JN0A 1H69A 2GN0A 2PKQO 4YJGA 3UV3A 3X2SA 3T7JA 1JMYA 3LV8A 5DZSA 4RC9A 3QOWA 1G16A 1XVUA 1C9MA 3JAKA 4IUYA 4P92A 5E9AA 3TCXB 4BNVA 4BMSA 1LS1A 1TK3A 1RJEA 2EGUA 2Z95A 3C24A 3FN4A 1NJ1A 2A9QA 2MYUA 4U1RA 1BD4A 3ANSA 1W94A 3VA7A 1V3VA 3JALA 1DO2A 4NK5A 4OFXA 5IVDA 4OKSA 5A2QA 4Z0TA 1FYDA 1J39A 4LWQA 4KLRA 4UHBA 5KDDA 2OG2A 1CTQA 1GYQA 2W22A 2MSDB 3WC4A 3MD0A 5C1OA 3I73A 3UQYS 3A6FA 1E4EA 4HB2A 2I6UA 4B6SA 5CFZA 1E69A 2ZRBA 1R74A 2EBUA 2EZUA 3HCNA 2XBMA 1B6GA 2J48A 4LSGA 2BRUA 4CPDA 3VU9B 4AS1A 4KE8A 1IJBA 3HNOA 5SY9A 3GL9A 4G26A 2BDTA 3B38A 2PUVA 3R4CA 3DE5X 4YCJA 2Q3CA 2XT6A 3ILYA 1EWQA 2OUKA 1DEHA 1GVHA 1SVMA 3T34A 3G17A 3G0BA 3UWKA 1BS9A 1WHTB 1ADJA 3TCKA 4I19A 4MINA 2XCUA 2CDCA 2Q28A 2B99A 4GGMX 2PANA 4PYOA 3KO8A 2R1VA 5EMLA 1QS0A 4F2GA 4JR0A 4MR7A 2PO7A 1XTRA 5KOHB 3PKZA 2F3PA 2GBPA 5K8JB 3L49A 2C59A 1QIIA 1Z12A 2JGFA 2ONJA 2D1YA 1RLJA 1DDIA 5IVIA 3U3XA 3NKVA 5E4FA 1A50B 5CHYA 2GA8A 5IPFA 2VDRB 3U1VA 4I1PA 4UU8A 4CNQA 1XWWA 2P9JA 4JX9A 1E2BA 1BAPA 1NW3A 4X00A 1MORA 5FTWA 4BLWA 3S1SA 4KI7A 3EEYA 2QSUA 1EA5A 3E8XA 4YCSA 4PEVA 3WKDA 3C85A 1U1DA 4DV5B 4WXYB 5FD8A 4GR4A 3T9BA 2IYOA 5TJHA 3SVZA 4A73A 1V11A 3HXQA 2DFKB 2JLUA 4N49A 4D41A 4KH0A 4JQOA 3R9XB 1LRKA 3JZFA 4Q1CA 3LRTA 3GF4A 1Z33A 1LUAA 1Z35A 3IB3A 4HI0E 4YGXB 3H17A 2HREA 4CKYA 1QZXA 3LCCA 1T4CA 3HJFA 3WL3A 1GAXA 4WBXC 3FKJA 1CSEE 3LDFA 1KZ4A 3KJGA 3MLAA 5ITZB 2Q1YA 3PNLA 5JWRA 4F4CA 3C39A 5J1SB 3WY9A 1BXGB 3H99A 1H2WA 1RADA 1D6MA 4JBNA 5DFAA 4Q05A 2EATA 1TT5B 3DDSA 3BUSA 1FTWA 2OUIA 4Y1EA 3VX4A 1NP3A 1ZICA 2OESA 4J3FA 5A0VA 1QLHA 2OE2A 3K8OE 1V7PC 2EV9A 3PJGA 4ZK2A 5JNRA 4HFJA 5ICSA 4W5TA 5EZ6B 3G9UA 3FZNA 4XA8A 5ITSA 2J5RA 2Q07A 3QX3A 2EWVA 2HOQA 3HGMA 2JEZA 1K66A 4MS1B 4TSFD 3K94A 3RRFA 4QAJA 3GT3A 4Q93A 4YAUA 3SNKA 1ZISA 1NRXA 5E6RB 3ZV5A 4LQDA 3T5PA 1NVMB 4P4LA 2WV9A 3TX6A 1Z0IA 2RH9B 5GINE 4B9EA 3CVXA 5HOQA 1LD3A 2XQIA 1DUIA 2IHZA 4FS3A 4LTNA 2JAXA 5DW3A 1MA0A 2HBRA 1YWGO 2YVLA 3GZ4A 4TS1A 3VR3A 4YDQA 1OWPA 1ZA1A 3P9NA 2DUMA 4X41A 2JFGA 2QL7A 1T3SA 4RQBA 3PFCA 1MV8A 4NJEA 5A4DA 2ACVA 1VCNA 1BOOA 1ZOLA 1YZLA 1Z6AA 3KQOA 4WNCA 1X80B 3AY3A 3TW6A 4E11A 1IOVA 5LN1A 4UOZA 4KIGA 4FINA 4IVRA 3MYYA 3JQQA 1F0YA 2Q5CA 1T2EA 1SY7A 3ZV3A 4V1CA 1XDGA 4C87A 1G3IA 3UMJA 3O93A 3QLEA 4D4HA 4MITA 4HUJA 1S6YA 2H5LA 2OCXA 2BGUA 1Q5PA 4JQYA 2KQUA 3OTGA 5TT0A 4ALNA 3DT9A 4W4TA 2BT4A 3CUTA 1U3CA 3LUBA 1N34B 1EUCA 2SKEA 2PUHA 3DMTA 3EXFA 1ZJYA 5E2BA 2OGSA 4FOTA 4C6SA 4DR3B 1H1DA 1IONA 3DEJA 2FYTA 3HY3A 4DCPA 1T29A 1OTXA 3STWA 2E6KA 1RXVA 2XJ9A 4FCCA 1S8OA 2F8SA 4YUVA 3GA0A 2RH4A 1V7CA 3GRUA 4DKJA 3FIUA 2GPBA 3TRIA 1LV8A 1PI3A 4JJEA 3RQSA 1U3TA 1KOFA 1FP1D 2OM2A 3H2SA 4RK0A 4YCCA 5CH3A 1FS6A 3HTXA 4G37A 2Q7OE 5JASA 1NZJA 4S1PA 1OC4A 4KIJA 1Z9BA 1SHLA 2KHZA 2HXGA 4LJKA 4ND7A 5BNIA 1DINA 4YS6A 2GD0A 1X1QA 2PRIA 1Q0PA 2DBVO 2H1IA 2JCBA 2YN2A 1TYAE 2XMBA 2DQYA 2IE0A 2BFWA 3RYIA 4H77A 1XZLA 2JNWA 3S27A 3QHAA 5ITWA 4ZT2A 4TPKA 1N9GA 3KTAA 1C3JA 4GPD1 3R7DA 3J81k 3PT5A 5EQFA 1KE1A 4D0RA 2F90A 3X2FA 2YIDA 4MROA 4RE6A 2ZAMA 2VDKB 2P30A 2Z5GA 4YT8A 4OV6B 3UB2A 1BHJA 3CX4A 3QVVA 3W6PA 1KJ8A 5G4KA 1CUAA 4K88A 4MULA 2RK4A 5A04A 1R0YA 5FH9A 3GMDA 3I12A 2YV2A 2W6JD 2GM3A 2QG6A 1QYWA 4MCAA 3AL0C 1X8XA 4YIHA 3F7MA 1KMHB 4XB6B 4BEWA 5J4LA 1QRDA 2ZTHA 5K0GA 3EPHA 4QXAA 1LK7A 2Z3VA 3LM8A 4FJ2A 5IYZF 4IUCS 2D0PB 4NY1A 3WLKX 1SURA 4LXQA 3AKDA 2VNSA 4IEIA 5EJMA 1Z16A 4YT4A 2PVPA 1L7XA 4CM3A 1K68A 4K5QA 2CNOA 4Y30A 5CNIA 1U2QA 2WF7A 4EGCB 3PGA1 4PBTA 1A0OA 2AZMA 3HYNA 4L7QA 1M0TA 3AIOA 4BWFB 4JYAB 2QX6A 1BZYA 4FX2A 1U1EA 3OZVA 1Q1EA 4RDIA 5I8PA 1TMOA 1J9ZA 2PMFA 1SEPA 4H3KB 1T9GS 1WDLA 3E7WA 3H3XA 3JR3A 4Y2SA 4L3OA 2QTLA 1F12A 1BD3A 3F3KA 2H1HA 2YRWA 4RCVA 3RYCB 1SJ9A 4KFRA 3R8FA 5DT2A 3BQMB 4YCMA 1V39A 2IE8A 3COWA 4BLOA 5BR4A 1AKTA 1EZ4A 1KR5A 3E5RA 5DHRA 4YQEA 2O8CB 1CY1A 4DLBA 2SHKA 4UQLA 2J8ZA 3JQ9C 2Z6UA 4O4LB 3WLLA 1YR3A 3MC1A 2J7PD 4NABA 1ZRNA 1KE2A 3JRNA 4PZ9A 4JI1B 4YK7A 1F6DA 3B52X 5BYJA 4LV8B 2QW8A 3OETA 2A0XA 4X93A 2VUTA 1CR0A 5HJEA 1EFAA 2FR1A 4U6NA 4YNBA 1U8YA 1X9GA 4EA8A 1JHXA 3TUZC 2OBMA 2SNIE 4C6TA 3QTLA 1U6JA 2ZI7A 3U56A 1E3MA 1EFPA 3VC2A 4Q9DA 5AI5A 4HAUA 1MHPA 4X6XA 1Y6FA 5AM3A 1UMDA 2OO5A 3O8DA 4FXOA 4RMIA 2AOWA 2QX8A 2XNDA 2XYRA 2ZYVX 1YS4A 3AV0B 3ORFA 4L4SA 4TQAA 3UNXA 5NLLA 2H3HA 4KZKA 4NICA 3K05A 3NIFB 3GLFA 2AYZA 3CSUA 3G5MA 2RGAA 1GZUA 4HPWA 5D3ZA 3VZQA 4BNIA 1EDEA 4GBGA 5HXAA 5ILOA 3TJZA 2QNRA 2ZB7A 2I6TA 4B34A 1OVGA 4OYLA 4RD3A 4TL9A 2QP9X 1MABB 1OHHD 1N4AA 1J9GA 4JZKA 2R60A 4BHTA 5JW6A 5JWOA 3K6JA 3BM5A 4J0KA 3QH4A 4QWMA 3HM2A 5J4KA 3PDCA 4EA6A 1CEQA 5JSZB 2F3TA 4X5OA 1XZCA 3JYPA 4YP1A 1BVUA 1OYYA 3I2JA 3N75A 3I6BA 3W5AA 4KNYA 5JJKA 4E6PA 3U48A 3HU5A 3OPQA 3WLSA 1JA9A 3AEZA 3B1JA 2GZ1A 4D42A 5D6OA 3KSDO 1AXGA 3L4EA 1Y7IA 2P2ZA 1R4NB 2I62A 4QOIA 5IDVA 5CB4A 3WMGA 1K7SN 3IULA 4D8YA 1G5PA 2X22A 3O1JC 1V1RB 5IAGA 1Z6TA 2HDOA 2FKAA 1DQSA 4KE7A 4LE1A 5LCXA 4DLKA 4YRAA 1JLRA 4BN5A 1DFHA 3CF2A 1G5IA 4BJ1A 1MDBA 2P9YA 2VOEA 4YXWA 4DMCA 4KE6A 4MQ5A 5ICCA 2AFRA 1VL5A 3LWNA 5TE9A 2RHDA 4KR0A 2W6JA 3MWEB 3FMOB 1N8KA 2ZZKA 5AKHA 3ZVNA 1MR3F 1RJ9A 4C0KA 3ICOA 5DHSA 3QQ5A 3BJEA 3EXG2 3W8RA 2G25A 4DDUA 3U4QB 1BDJA 3JZIA 5JD6A 4EL0A 4I1VA 1W8DA 4LDNA 4V38A 3HKCB 2XE7A 3KYBA 1WMDA 4ZCMA 4RTNA 2ZULA 2R48A 1IH8A 4DLWA 2YQ4A 3GOQA 3VJMA 4HDKA 3LK7A 2IIPA 2PZ8A 1KH1A 1MJGA 2QE7D 2VHJA 3K1TA 4M9RA 1RQXA 3CXUA 2E55A 4GYKA 4CKWA 2H8GA 1H4VB 3CUUA 1W0CA 4E2ZA 1KBOA 5KCZA 3KU4A 1O9HA 1L7OA 4I5FA 5IANA 4LV6A 1WETA 1JKJA 4P84A 3PWTA 3ZPXA 1NW6A 2NLOA 4ZO4A 4M9CA 1Z3IX 2BGMA 2D1TA 1JFLA 1E1QA 2JIRA 2HIGA 2FK8A 2PBZA 3EIOA 3SEZA 4BC1A 4MJXA 1CKEA 4ZKDA 1QMGA 3QUTA 1V41E 2GCEA 2XXAA 4S1OA 4UREA 4OHZA 4LY0A 3V6LA 1BGXT 1KPHA 2J9XB 2JD0A 1NDHA 2ZR9A 3O4JA 3Q4GA 2BTQB 2O19A 4LBWA 3TGLA 4MRMB 1JSCA 2JVKA 1VKRA 2PUFA 5A5FA 4N6GA 1WSWA 1BS2A 1CUFA 4A9AA 1LVGA 4M7PA 4QOSA 4XDGA 1FF9A 5BPFA 4P9NA 5H9VA 4E7OA 3RFCA 1PT6A 1G18A 3JQAA 1LVHA 2OV8A 4B3TB 3A1FA 4KYVA 1B0ZA 1YL5A 4MQ4A 1RD4A 5DBHX 5IZCA 3RYHB 3AG6A 5L9AA 5MDHA 2WW8A 1C9DB 4ZDIA 1V47A 1AZSC 1E2KA 1HV8A 3E9NA 1H2HA 4H7FA 1E4VA 4JL6A 4UDNA 2YYAA 3RK1A 1U98A 3S2FA 4PNHA 4FFMA 4IIFA 1VG0B 1GPAA 2B7BA 4D43A 4JXZA 3HXTA 4IGIA 4FDVA 1WBBA 4ZANA 5JO9A 2WAMA 3WK4A 1T24A 4WNAB 1Q22A 2YZKA 3SN6A 3AHJA 5EIAA 1P7WA 4MQLA 4D80A 4XCVA 1SOAA 3KZMA 3LOUA 4EQ6B 3EF1A 4FYPA 1OH5A 1JSZA 1N1MA 1NBIA 1XTKA 3WLQA 1JFTA 4JL5A 5BORA 1E2MA 3MCAA 1DQZA 1GAWA 3TQCA 2AUMA 1OHHA 3EPRA 1TGYA 3ADDA 1XRLA 1KU6A 2PZLA 3CXRA 2PRZA 4UHFA 2I29A 2VF8A 3PDHA 1QIHA 4RJ2A 3U26A 5IXSA 5LKAA 2EZ9A 4NARA 3Q15C 4MKFA 2WKQA 4HZIA 2BC9A 4RY8A 5B2FA 8OHMA 4FD3A 2O2DA 3M4JA 2Z8XA 1G6Q1 2QRLA 3IMGA 4GI2A 4TVSA 3BVPA 3TAXA 1M7GA 3IP8A 1W5TA 3B9RA 3WGHA 1PX0A 2HSGA 3BE8A 3NZEA 5BMOA 5LFAA 2YHSA 4G0MA 1F14A 1O58A 1ZI9A 1WY5A 4JKIA 1NC3A 3V2HA 3PTAA 4IV0A 4DS3A 4JJGA 3TB4A 2CFRA 3ACCA 3CLUC 4UAVA 3FVRA 3BQ9A 4C7KA 4MV3A 5BUCA 1JFRA 3NH6A 3C3BA 3CCFA 3ZNNA 4YAIA 2J59A 2IGTA 4I5EA 4LYYA 1IATA 1UJ5A 2ZANA 3DBHA 3FMGA 2EFHB 3SOOA 2QRPA 3HY4A 3KQQA 1ORRA 3HS3A 3NBXX 4IDAA 4QUJA 3F98A 4YRTA 2E49A 4GX0A 4BB9A 1V8PA 1TMGE 4R9RA 4O33A 4D0SA 1SUDA 2CMHA 3AOGA 2GN6A 3MINB 3PLRA 4DPLA 2BZGA 4JBHA 1PS0A 4RX1A 1PJSA 3T9EA 1PTJC 4AN1A 3NYRA 4OMDA 1N5RA 1IULA 3P1JA 2QTZA 1DX4A 5EPOA 3TE7A 5L8VA 2MSLA 2VXOA 1GZ6A 1W0KA 3NBZC 1F8GA 2Q4OA 2BM1A 3PTZA 4UUAA 4AZWA 4AT1A 3IJEB 1CY4A 5AM1A 5BN4B 3IGFA 3KVYA 3UT6A 4KKVA 3WYBA 3I5YA 3HPQA 3UF0A 2QBYA 2O1SA 3X1JA 2HHLA 1KI7A 4FT2A 4G86A 4Y9UA 2FSIA 2MR5A 5EJ9A 4BYMA 3GGOA 2HMWA 2QTRA 5I8ZA 2IIQA 1AQ6A 3GCXA 4HJXA 2XCLA 4DMMA 2XR1A 3A04A 3LX8A 4ILKA 4KQ2A 5FXMA 3WBKA 3RCBA 3TIFA 3V8EA 3H0KA 3DJYA 5G4LA 4DCCA 2ETXA 4WZAA 4J1NA 2CLEB 1M5RA 4BYGA 1B00A 4AG6A 3S7ZA 2OCAA 1J49A 3FUVA 1T13A 4OJKA 1CQXA 4DABA 2EHDA 2YWDA 2B9VA 1J22A 4JY7A 3KDAA 2QE6A 5LDDC 5H59A 4EEKA 3UGTA 3EISA 4QL3A 2A30A 3GMTA 2ZSIA 1YDGA 3DB2A 1JZTA 2XUQA 5CFRA 1KPIA 2X77A 1UP6A 2XDYA 1PO7A 3H1TA 1Q7GA 4CI9A 4BGVA 4NSNA 4XDYA 3U19A 3FOAA 4QYIB 3K0HA 3WIVA 2F8MA 3G49A 5KVQA 4HATA 1YTLA 1U7ZA 1YULA 1W49A 2IX9A 5ERYA 5KTOA 5L3QA 5TRTA 4BFXA 2X0RA 4AIIA 5DGHA 1MB4A 1W85A 3KU1A 2P27A 3I0NA 3CLTC 1ZGHA 4O2RA 3E5MA 1U7TA 4O2BF 4WK4B 2GCOA 3ZHVA 3VKHA 3OA0A 4TXLA 1T2UA 3P9RA 3QQPA 2Z4RA 4MMZB 4LJ7A 4F84A 3LUDA 2JH9A 4BP9A 1U1CA 2AVDA 1N2CB 1S8FA 4K05A 4C7XA 3H13A 2JJ2D 3ITNA 3GPCA 1XHFA 3GGDA 1HYHA 1V16B 2CYAA 3EZ7A 3T99A 4FDTA 4Y7DA 4B84A 5I5GA 3O1HB 1X7WA 2Y4OA 1W76A 1JIXA 3D7NA 3DCJA 3NAGA 3RIMA 5BNZA 4XB1A 2CB0A 1M2FA 1KH2A 2AN3A 4JC4A 4CV0A 4LOIA 4BV8A 2CUNA 3QTTA 4BB5A 4ZZ1A 5GGXA 1UC8A 1I36A 4MPRA 2IOHA 2JIZA 1C30A 1JDBC 2QDKA 3QBJA 2WD7A 4DB4A 2JCSA 3NS7A 1TZ2A 3ETGA 2HWUA 3MJEA 5JAPA 1VIVA 2Z9DA 2MSKA 3EG9A 1JPVA 1JB9A 1PT8A 3FNIA 3HC7A 1WVIA 3K53A 4RKFA 5TGDA 4G5XA 4QJ3A 4GECA 1XKQA 1HLDA 4ALIA 3TL6A 4R16A 1BQ3A 2HO4A 4I50A 1J8VA 4OXRA 3VH4A 1P2FA 4R2JA 1FJGB 4KVFA 5HFNA 3LW7A 1MFPA 2JGRA 1TI7A 5CVEA 2FDXA 4F4DA 2MHCA 2W90A 4A0SA 4JYPA 3UJNA 3NTUA 4QFDA 1ZUWA 4Q7QA 1T8TA 1UPUA 3R74A 2R4UA 3DZDA 2PUBA 1IJEA 3BTOA 1DV1A 1RWBA 3I9FA 5D6NA 4RKWA 5JAMA 3RIGA 3I1YA 1FRNA 3N2EA 3WYDA 1JG4A 4M1SA 1XP8A 1KAGA 2A0YA 4ZI2A 5CA1B 4ITRC 1FFCA 4RVFA 4CQMA 1T8UA 4YAEA 1NBMA 2XQGA 3A4YA 1UBHS 1YGYA 4D1YA 5EGNA 2JDID 3MWLA 1V1RA 1VDMA 4GL4A 4WWHA 4URFA 3ZU4A 4F4HA 1LH0A 1FZTA 2VT7A 4BATA 3I0ZA 4KTVE 2WMYA 2IHVA 4LI3X 4P58A 4RSRA 5F3WB 4JENA 4AMUA 5EWJA 3AC0A 4HFNA 2OZLA 5AK3A 2JFBA 2H9IA 2ZGVA 1ODCA 1RM5A 1WCWA 4FP9A 2PNFA 3FNFA 1RLTA 4HAWA 1T9KA 1KEEB 1PTJA 3AERA 4ESOA 3A1CA 1A2QA 2C1ZA 3IAS1 4R83A 3PK0A 2XECA 3JWGA 5IXYA 1EIZA 2CMDA 5DCYA 2E7ZA 2C1EA 3KPWA 1FYWA 1EAYA 1YCHA 1ID1A 3WFJA 3RGGA 4IOMA 4K9PA 1JJIA 1GAQA 2IOFA 3FY4A 2RDMA 3LUFA 3TQHA 3TZQA 4DLPA 4EKNB 1QQ6A 4K6CA 2BMDA 4A6PA 1Z28A 4CCYB 1H4QA 4NCAA 2A2ZA 5MHTA 3LBYA 4IQFA 3MERA 4PGGA 1LDGA 2XUFA 3H83A 3C87A 2H65A 4TV8A 2P9HA 4PONA 1SU4A 4MW7A 3STYA 1GIAA 3NYIA 5KUTA 3L0BA 3ADKA 3CUVA 4K87A 3UIEA 3G0OA 3QFRA 3ZZNA 4B9AA 2G06A 2Z56A 2PSSA 4IL5A 1XN4A 4AF6A 4NC9A 1WBDA 4WSOA 3L6BA 4Y2YA 2GF2A 3DZKA 2A0WA 3MWYW 2BUCA 1G5TA 2G4CA 3G85A 2CUKA 1PJCA 1YQTA 2UAGA 3LLSA 4B4OA 5CA0A 3RSZA 1BJKA 1SM4A 3HVHA 3ITKA 3MVEA 5K0SA 3QEAZ 4LF9B 1DLJA 3DHVA 1X39A 5INTA 3R7SA 6CHYA 4EB0A 2EHJA 4PZZA 3TG2A 6ADHA 4P4SA 3B9QA 3U5TA 2R6R1 1CUUA 5L6LB 1RAHA 3JAKB 3UWDA 1MZPA 1NN3A 2QR3A 4UHEA 5DWQA 2ID4A 3C6QA 4JVLA 4QTZA 3DTVA 3GROA 4FT4A 1M8GA 2WHRA 3ABZA 4OI1A 1VGRA 4A2CA 2WYIA 3L2OB 5C32A 1BHQ1 1WU8A 3KAJA 4DIDA 1MA3A 2GOYA 2F1JA 4P93A 1C7FA 1NKVA 2HNKA 2JI6A 4I3FA 3VFDA 4JYZA 2AC7A 2PKYX 3EVZA 3M6FA 4F3CA 2GZMA 2NV0A 3SYKA 1EH5A 5KQMA 2B9EA 2QP3A 2WPDD 1CUXA 4PU0A 5G41A 2BCGY 5BURA 1P44A 5AM2A 2ZIEA 2IYNA 2ATEA 3JVEA