4PQRA

Mycobacterium tuberculosis reca glycerol bound low temperature structure iib-bn
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
326
structure length
309
Chain Sequence
b'PDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
molecule tags Hydrolase
source organism Mycobacterium tuberculosis
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
total genus 95
structure length 309
sequence length 326
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4pqrA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4pqrA01
3KB2A 4UNSA 5FPKA 3K0AB 4DLSA 5KNCA 2JDID 4FMBB 3K09A 1GUAA 3QG1A 4Q9IA 3BWDD 4RFVA 2C77A 3UATA 1XD8A 4DUGD 1G291 2JASA 4NYIQ 1KNQA 4EJSC 3KKMA 3SZRA 1G19A 3BH6A 4GL2A 1II8B 3IQWA 3A1VA 1Z0AA 1N3BA 4JYCA 3MWYW 4C2TA 3HPQA 1A4RA 3DHWC 3FVQA 3KJIA 4RJLA 4D81A 1E4YA 2RKOA 3RABA 1JB1A 1XEFA 1SVKA 2WHXA 4B33A 3GLHB 5JWHA 1A5TA 4PZLA 2IYLD 3GCGA 4IDHA 3HYTA 4IKEA 5HKKA 3U6BA 2QI9C 4DCVA 2BC9A 4I1VA 1VPLA 3CWZA 4AKGA 3R9XA 1S1MA 1SQ5A 2P67A 4O0MA 4US1R 4QNRA 3HWSA 1G17A 4US0R 1E2NA 4Q1AA 2HDNB 3WRYC 4CDGA 5CK4A 3PIRA 4POAA 2QMEA 4R98A 4X8LA 2JLVA 1N5KA 2PMKA 2QAGC 4WXPA 2AD1A 3KJHA 3EW9A 2K5UA 3NH6A 1IM2A 3L43A 3GLIA 4XJXA 3DZDA 2RCNA 3QEOA 3T1OA 3THWA 5IT5A 3Q7PA 2O52A 1XNJA 1QVRA 2CL6X 2E87A 3QQ5A 4IOKA 2VSOA 4EPRA 2QSYA 1JR3E 2VRWA 3BE4A 4FINA 5TY0A 1T5LA 2LCFA 1VHTA 3LAWA 2XJ4A 1VECA 2GF9A 2I1VB 3IHWA 3W6PA 3AKYA 1XD9A 2QAGA 3C14C 3CONA 3L8YA 2F9LA 4C3ZA 3A4NA 5H68A 4DDUA 1U8AA 1TUEA 2G1KA 4LJAA 3TJZA 2L0XA 4A82A 2WIAA 2IS4A 4LJ9A 2VYFA 2XZLA 1K5DA 2ZANA 1U0LA 4G1UC 4ZPXA 4EFMA 4KLZA 3LBNA 3SOPA 1IXSB 3H2YA 4NTZA 4Q9KA 3ZDQA 1M7HA 2DWPA 2FNAA 4M1WA 5FOUA 1HYQA 4E5UA 2X1VA 4A92A 1DOAA 3HJNA 1OFUX 2ZS7A 1Z07A 2H57A 5DH9A 2R6GA 1CLUA 1NG1A 1EFRA 1DO2A 4PSKA 1T3HA 1W36D 2QTVB 3K53A 4WXRA 4QGHA 3F0TA 4TMVA 4B73A 4B6EA 3M1IA 2B8TA 2HEIA 2KE5A 5EUQB 3RRYA 1DVRA 1Z6GA 3Q85A 2RGGA 3ZIAD 4GMXA 1MABB 1CJVC 4FN5A 3TR0A 3RS0A 1NLYA 1S9DA 2HT1A 4M1YA 1EESA 5JCPA 3JVUA 3LVRE 1F2UA 3TUJC 4DT1B 1M7GA 3IILA 3QXSA 3GLIB 1P2VA 2A78A 3MWJA 3BFKA 1ESMA 1XMVA 5CLLA 3EG5A 2ZS8A 4TN1A 4Q4LA 5DNYB 1OIXA 3U2QA 2YOFA 1H8ED 3PENA 1HV8A 2QUZA 1N6KA 2RGXA 4LWZA 2OILA 5GJBA 2CK3D 1P73A 2QE7A 3AKEA 3FWYA 3LX8A 4IOMA 4OHWA 4PFSA 4D4JA 4LJ4A 2JLXA 2ZYWX 4LHWA 4Q21A 4QC2A 3W34A 4E22A 5HR5A 4B32A 3IUYA 3GJ4A 2ZI9A 3VKGA 4JLVA 1FUUA 2VHQA 3X1DA 1KI4A 1ONBA 1VIAA 1N5JA 1L4YA 1UEJA 2VH5R 3OE7A 2RB4A 2WPDD 2QT0A 2QM8A 3VNVA 2F9MA 5A0FA 2MSDB 4WZ6A 2O8DA 2QENA 3CR7A 4YMVA 4B3GA 4RCZA 4FW9A 4V03A 2RHDA 3BAFA 3QF7A 4F7WA 1US8A 1AQUA 3FKSA 2CVFA 1CJKC 3THXA 5G3ZA 3PEYA 4E03A 4XH9B 2WJYA 1SVOA 1T0HB 2O0HA 1LW7A 1OPXA 2QY9A 2QMOA 3X2SA 5SZIA 2YWFA 4DSTA 2P6RA 3P32A 3KFVA 2ZJ8A 4URZR 2HUPA 1UAAA 2XTZA 1LY1A 2W6IA 3CKLA 4QBFA 4EKDA 2IYSA 4XTCS 3HU3A 4JBXA 4RCYA 4XTRA 1JI0A 4ZO4A 4OHZA 3L0OA 1NVVQ 1IJEA 2V8OA 1ZC4A 3EAQA 5C2JB 5FL7A 1V5WA 2YJTD 3FFBA 3AH8A 1XTKA 1YQTA 5KSYA 2W6JA 3BD9A 1KK2A 1D2MA 1HEIA 1XEWX 2ANBA 2GZAA 3E1SA 3K0SA 2FG5A 2ODBA 3K09C 2WOJA 3GLFE 3QXJA 2PT7A 3ZVRA 4LUCA 1YJ5A 2GESA 4AKHA 1UM8A 2CXXA 5JS8A 4TQUS 3CRMA 1WBBA 5AUOB 3ICEA 1VCNA 1UDXA 2WJGA 2GVDC 4TYQA 1NP6A 3BS4A 1L4UA 3AVUA 2VLIA 4JKYA 4NYIR 4WOPA 2WICA 3B1VA 5F2EA 3I5XA 1JALA 2BOVA 4ZDWA 4D82A 5CJ2A 2GEVA 3CRQA 3WHKA 3ZQ6A 5F9HA 2Q6TA 1MH1A 5E95A 4KSCA 3RS4A 4KAXA 2OAP1 1DAKA 4I1UA 2REOA 3WMFA 1ZW6A 4B2IA 3QXHA 2J0SA 2P3SA 3DDCA 1OJLA 1VCIA 3O8BA 4NCIA 1MO4A 1IOZA 2JLUA 1P9RA 2RGBA 4Y0VA 1AGPA 1BO6A 2P6UA 4B6FA 5CB8A 2J0UB 5EZ6B 1ZM7A 3EIHA 1CR2A 3LQQA 2KJQA 1N6NA 3QXXA 2ZPTX 1VCOA 3LVQE 1QHYA 1UBFA 1Z2CA 5B57C 1ZU4A 1Z0DA 3T5DA 4CEHA 4KVAA 4JVMA 5CYOA 3QBVA 4ZI2A 4M21A 1NIJA 4JLKA 4YC7A 1S0UA 2G3YA 3RSLA 2O8EB 3FHOA 1O3YA 3KFXA 5AWFC 1XFAA 4KFUA 2UZIR 3P27A 4C4PA 5FI1B 3TSWA 2GETA 2AKYA 2D7CA 1J2JA 1KSGA 1JR3D 3BXZA 1CR1A 2DR3A 4HUQA 5EE3A 3U44A 3QSYA 4DIEA 3VNUA 4DLTA 3F8TA 4F91B 2XZOA 4C0QC 4Q4JA 1NJFA 4UNRA 3K70D 4IHQA 4M4SA 1JR6A 3ASZA 3PUXA 3KL4A 3FDIA 2F1RA 1KO1A 3U60B 3OIVA 4NKRA 1P60A 1VDZA 1KI1A 4DCTA 2WVJA 5C1BA 2OAQ1 4JL5A 3B13B 3K0FA 3OHMA 1XB2A 4FMCB 4P33A 1OB5A 4NZYA 2ZRGA 3TBKA 4OBEA 2WWXA 3CM0A 1LF5A 2IUTA 1G3RA 4LHXA 5TB5A 2ORVA 3VAAA 4II7A 2AN9A 3CNOA 3S1AB 3A36A 4B76A 3R7WB 1YZTA 1E9RA 1M1YE 1NBMA 3L2OB 2GHIA 1X3SA 4JLPA 1UBEA 1MO5A 3SBDA 721PA 2IF0A 1G3MA 2BM1A 4OHXA 2OHFA 1RJ9A 4OQNA 3U7FB 4RZ3A 5KNDA 1M7BA 3VHLB 2FJUA 4ARZB 2IYYA 4X8HA 4Q18A 1OF1A 4CT5A 4DEXA 1AS2A 2IXGA 3MD0A 5JBQA 2E1RA 3K9NA 3B1ZA 1G5TA 3ZQJA 1ZUIA 2H1LA 2FGJA 1SKYE 1E98A 221PA 2QGZA 4PSAA 2MMGA 4M1OA 3IGFA 4DLWA 3G5UA 2JLYA 4ILEA 1T8TA 1NKSA 2J9RA 4KI0A 2P0EA 4BLSA 2I3BA 4JLMA 3SU8A 1VG0B 3PFIA 3CBQA 3AVQA 1CJMA 4ASUD 5A5GA 2J45A 4DUGA 3H0KA 3TR5A 1YZUA 3W3AA 5J4HA 4HLUA 3N5CA 4ZCIA 3PV0A 1RFLA 4IVPA 3LWNA 3NHBA 1YRAA 5B58C 1WE2A 2YOGA 3W3ZB 5CIQA 4BFXA 4BUJA 3UG6A 1NSTA 4KODA 3IO5A 1OH6A 1UKYA 4GZMA 4Q4HA 1QHNA 1G8YA 4C30A 3I4LA 4TSFA 3H84A 4TMWA 5TVKA 1US8B 3ZS8A 2VP5A 4HLDA 3SYNA 2YKGA 1IY2A 3KJGA 4IFEA 1U81A 2NGRA 4TMTA 1Z63A 4A36A 4AG6A 3CZPA 5DO9A 4Q9JA 3K70B 1U0JA 2XXAB 1TUIA 1TMKA 1IN4A 3VHXA 2EW1A 5FBRB 2A2ZA 4AYWA 3TUZC 3GFOA 4RD3A 3FGNA 1NVVR 2HJVA 1M34E 2OG2A 5JRJA 3DKPA 4DXAA 4PO9A 1W0JA 3BB3A 1OKKA 3D8BA 4LYFA 2PEZA 2XTMA 3QKSA 1Q3HA 3OAAD 1G5RA 4YXWD 3NVAA 4NDZA 1J70A 2R6FA 1RRPA 2ASEA 3WRXC 2IL1A 3DO6A 4KCGA 3F3YA 1EK0A 3ECCA 3TAUA 4OI0A 1PLJA 4PQFA 2CBZA 3QPVA 1KGDA 4DDTA 5FOXA 3NTUA 2F3TA 5J47A 2B7BA 2VHTA 1KNXA 1F2UB 3ZS9A 4US2R 3RANA 1VKJA 2BVNA 4NYJQ 2XTNA 2JLRA 5KSOA 1QHGA 4TLDA 2F55A 1TL7C 1R8SA 2AHOA 4Q7JB 5AJVB 5ANRB 1UPTA 3C16C 1T8UA 3GLHA 4KFTA 4BFUA 1XF9A 2GCOA 2DHRA 2ZREA 3I1FA 1GRQA 5K8LA 2WKRA 1C9KA 2ZTSA 4L8GA 4ZIRA 3ND8A 2KBEA 1E2HA 1DADA 4GSYA 1W0KD 3B1WA 5KUTA 1YR8A 3BERA 4HAZA 1E2QA 2EYUA 4LBZA 2DWQA 4Z54A 3I3SR 3VKHA 1ZD1A 1T4GA 2GF0A 3OF5A 2VP9A 2PCLA 3ADKA 3Q8XB 3B6EA 4DSUA 4FIDA 4RKEA 3SYKA 4QGAA 4AG5A 2JIZD 4PHHA 2BWJA 1ZNYA 2QAGB 2WIBA 4NE2A 4NCNA 1CRQA 1AJEA 4XWKA 4TL6A 2ZIAA 3BORA 4HSEA 2D2FA 1FQJA 4B43A 2O0KA 1M6NA 5FOTA 3KTAA 3OAAA 5CB6A 3CRW1 5FUXA 3RAPR 1D9ZA 3CW2A 3A58B 3H4MA 1KO5A 2DYKA 4LPKA 4BFZA 3W90A 1OHHD 1IN6A 1QHHA 1XTSA 2BV3A 2O8FA 2IHYA 3GQBA 2Q9AA 3LNCA 3GLGE 4BZXA 3EZ9A 5FR2A 2WWYA 2CCJA 1YZKA 1KI6A 4OQFA 4YMWA 3ZD7A 3KJEA 1NSFA 2OT3B 3T1TA 5LPNA 4CYMA 4LHVA 5JJLA 2G9NA 1YU9A 3PUZA 3LX5A 3SEAA 1N25A 2O5VA 1SXJD 2NIPA 4M8NE 3WP0A 4NHOA 5IK2A 1H8EA 3OEEA 1E2PA 1NVWQ 3U4QB 4PPNA 4LX0A 1S1CA 3UPUA 4MGIR 2J1LA 3AF1A 4MRRA 2WJHA 3BRWD 2VTKA 2GZDA 1W2GA 2QORA 2A7QA 2O0JA 5FUWA 1GP2A 1S3SA 3LDAA 5D3MB 3UMRA 3EA0A 2GJ8A 1UKEA 2OBLA 2VA8A 4K81B 2MSEB 3TQFA 5JJKA 5HPYB 3ZVMA 3RYTC 1SULA 4LCBA 1KI6B 4BLOA 2IUUA 3W5IA 3NBZC 1XCMA 5LD2B 1W4CA 3KZ1E 3Q9LA 4URXR 4D80A 1S9HA 4Q02A 4KHZA 5HZHA 5C4GB 2W00A 1GM5A 2IYUA 1HT1E 3A4LA 4JSTA 5FUYA 4BEBA 3SQXA 2IYWA 3RVBA 3GJ5A 2F1HA 3THOA 2HT6A 3QG5A 4IRUB 4A6PA 3GLGA 4OK3A 4DHEA 2ZROA 1UADA 2LKDA 4DB4A 1E2KA 4HDQB 1GZSA 1Q1QA 4DIDA 1E2GA 2PEYA 2R8RA 2C78A 1TF7A 1SXJC 3PCRB 3RS5A 3VKWA 3WMEA 2J0QA 4EDHA 4LC1A 3KKPA 4XVRA 2XXAA 4CGZA 3K0CC 1OFTA 1EWQA 4Q4AB 2ZSBA 1Z28A 2ORWA 3C4JA 4M22A 4WZAE 1SKQA 4O25A 3Q7QA 3BIFA 4BWYA 2FWRA 5KPDA 3CPHA 4LGMA 1FL9A 1MV5A 2VP2A 4D0NA 1F6BA 4JL6A 1XEWY 5CDFA 4U5XA 4DDVA 5FH9A 2V3CC 2FH5B 4MYHA 4NYJR 4O2LA 3CWQA 4URVR 2IUSA 2WWWA 3K9GA 4RFSB 2GCPA 2JJ1D 2J46A 4OK6A 3QUSA 1LB1B 3T15A 2ZE6A 5JMTA 4PQYA 3NDBB 3PITA 2ZYVX 2GCNA 1E1QA 4M1MA 1HH4A 1F3OA 3CUEF 4EQ6B 2H8KA 1G6HA 1Z5ZA 5EZ5A 2N42A 5H8WA 1YKSA 3E2IA 5C18A 4TQAA 5EE1A 1MO3A 1XPOA 4PPFA 2CEAA 1Q0UA 4P32A 2YC4C 2REBA 3CNLA 3H86A 4EPXA 4TYNA 3EWAA 2BIFA 1ZRHA 3FMFA 3GMTA 2OFXA 3O47A 4UKDA 1CKEA 4EPVA 4AD8A 2VF8A 2R44A 4XD7A 4LC0A 3ETLA 4C0AC 5HTKA 3LD9A 4QM7A 3RS7A 2ZRHA 1PJRA 4Q5IA 1G8PA 1NJGA 4OHVA 1JEEA 3MJRA 4CEIB 1KSHA 821PA 4C2UA 2FDCA 2C8VA 3IHLA 4C0LA 4C0BA 3AM1A 4MITA 3DOEA 4E09A 2B92A 3BC1A 4LBWA 4GDFA 1Z3IX 1G5PA 1N0VC 4BRWA 3X1XA 1G20E 5E4FA 1GOTA 1E9EA 4RZUA 4V0KA 1Y63A 2E9SA 4LK2A 5EE5B 5JHHB 3IQXA 3MRSA 4Z1MD 2XOKD 4DRZA 1QBKC 2QBYB 1P9WA 4EFLA 1RRGA 1XX6A 2JJ1A 5JSZA 1OH7A 1E79A 2HLDA 2J0VA 3AF0A 1HA3A 2A5GA 4JLBA 2IS6A 3OFND 1OE0A 1Z8FA 4HB2A 4Q7MB 3FHCB 3KTAB 4JIMA 3WBKA 3ZZ0A 4Q4JB 4BLRA 1CRPA 2ZQ5A 3M0EA 4D4LA 1I4DD 4LYHA 3TLXA 1QG2A 2N1BA 5CJPA 5FUVA 1XPRA 1JJ7A 4IXNA 3KQLA 1NF3A 3EPKA 2PZFA 2JATA 2ZU6A 4Q1CA 2GJAA 2ZUDA 3LXXA 4KSBA 1E0JA 1OFIA 2WM9B 4WA7A 4TLAA 1RW4A 2BM0A 2LKCA 1V43A 2F43A 3QIAA 2QTHA 2X19A 1VIYA 2ZSFA 4MGZR 4P0TA 1P3JA 1VYUA 1NMYA 5HKKD 2DBYA 4HZUB 2XB2A 1G8HA 2JJ2A 5DN6A 4ZDJA 3FB4A 2RGDA 2AKAB 3NHAA 2ZUBA 4DWJA 1X8LA 1J8YF 3VX3A 2ZYTX 3KQUA 2GK7A 2H16A 1YZNA 2WJVA 5BW8A 4JJKA 1RYFA 2G1JA 4FCTA 1TF2A 1SHZA 2XJ9A 2XB4A 4CIDA 4CEJB 1HE8B 4LJ7A 3QPWA 1AZSC 3X1YA 3PUYA 2YV5A 1EFTA 1ZD8A 1GIAA 3U7EB 5JFGA 1XPUA 1NBME 3FKSD 3CPEA 4IJMA 4M1TA 3NBFA 5FTMA 4BFYA 3X1WA 3B8HA 1XTQA 2J3EA 1ZM4A 4MGKR 1SKYB 1Z6YA 3V4RA 2O8CB 1OLOA 2X77A 3PQCA 1KY3A 1R0WA 1XCPA 2F3RA 1KJZA 4P4SA 4UJ3A 3PEWA 5F98A 4DLUA 1F5NA 1VG8A 3PR1A 3DKVA 4MKGA 3E70C 4DJTA 4HAUA 1N5LA 1XXHB 3AEZA 4FMCF 3D31A 5EJEA 2PJRA 2IS2A 4V02A 2IEZA 3LBHA 1Z83A 2ZI7A 3BB4A 3DMNA 3M4YA 3SBEA 3SI7A 4OI2A 3C5HA 2V54A 1MOZA 1C1YA 4FMDB 2Q3FA 3QEJA 2C9YA 4BFVA 3R20A 5L3SA 3P26A 2OBNA 1CF4A 4F92B 2WWFA 3GJ6A 3WP1B 1G7RA 1CP2A 3GEEA 1Q22A 3U6KA 2X2FA 3B2EA 4PX9A 1SVSA 2QEQA 1GG2A 5CLQA 4Q66C 4ASUA 3EZ6A 2V9PA 2ZJOA 2O8EA 2GA8A 4UNQA 3VTKA 2GXSA 3WMGA 5BN5A 3SE0A 3MAAC 3WYGA 1H8HD 4IFBA 3CRRA 4ZCLA 1AQYA 1RYHA 5BYKA 4BGDA 1VYTA 1Z6TA 1D2NA 4DLXA 2VSXA 3OIYA 3LLUA 4LY6A 2OCYC 4GOJA 3ZH9B 3HU2A 1ZNWA 4WZBE 1HUQA 2AWOA 3GJ0A 3NEYA 5EP2A 1P2SA 4B3XA 2O8CA 2AK3A 4TMXA 1IJFA 1OSNA 2BBTA 2GXAA 3SDZA 2A5YB 5SZKB 4J0QA 3L0PA 2DWOA 4PHTA 4V0ME 3IIMA 4IOJA 3AVPA 3MUFA 3R9WA 3C41J 3SJBA 1UDWA 4A15A 1N6RA 1FP7A 3R8FA 4M2LA 1BYIA 3KUDA 2WBLC 4H1VA 5LB4A 2A5FA 1CJTC 1Z0JA 1NY6A 2J7KA 2QA5A 5KDLA 1L8QA 1Z08A 3NBXX 2XSZA 4CEIA 4KJZA 4UXJA 3WNBA 4IVRA 5H70A 1DO0A 2ODNA 2QSZA 3KB1A 3ZJYA 4TTQA 1AS3A 1D2EA 4BFSA 4PZZA 2WWIA 2ODWA 2DY1A 2QT1A 1OV4A 2YWEA 2ZE8A 4L9WA 1ZIPA 3U3KA 2NO7A 4A4DA 1XXHA 4TQ9A 3RLFA 2ZR0A 3AF4A 3DMDA 4BFWA 2A9KA 4BECA 4LYAA 2ZE7A 2ZR9A 2CLDX 3LA6A 4C0JA 1A2KC 1DAGA 2CNWD 3KQHA 2RHMA 2HCBA 4IDOA 5AUQA 2F1IA 1DAHA 1VHLA 1N6HA 5BWMA 5IK2D 1MABA 4YMTA 4B74A 3VU9B 1X6VA 4IEEA 1SVLA 5C4MA 2DFLA 1E94E 5FPTA 1T3SA 4RFSA 3BFXA 2AXPA 3AVWA 5SZJA 2TMKA 3PUVA 3W5JA 1XU4A 1JNYA 1R2QA 2GNOA 4DVGA 3MFYA 2Z43A 5JSZB 4K46A 4DCSA 1SVIA 3PUWA 2AL7A 2FPLA 2IYTA 4G5QA 2IWRA 4TMZA 2ZUCA 1OXVA 1N0UA 5DGXA 2EFCB 2GXUA 1Q3TA 4QL3A 1UEIA 1FTNA 5FOWA 1N2CE 1CULC 1W49A 4Q4AA 4DC9A 4LJYA 3QF4A 4JSYA 2O8DB 3CH4B 1AA9A 1KJYA 4HUQB 1FMJA 2NMVA 3L8ZA 1PV4A 4URYR 4B48A 5EXSA 2IBMA 3W9YA 2OXCA 1N6LA 4N0DA 2QAJA 2EVWX 4DCUA 5KPJA 4BASA 1FFHA 3T1QA 2ZI4A 1GFIA 3RS2A 4N0EA 1OXXK 3O8RA 4RY2A 4CEHB 4OHYA 3CF2A 2IK8A 1NN5A 1W2HA 5JHGB 1COWD 2RH5A 4B3FX 2AFIE 2HXYA 3BBPA 5CDFE 2QRNA 3AUYA 1AGRA 3U3MA 1Y3AA 3JZAA 4C0HA 4OI1A 3U3JA 4AWXA 3TAHA 1G18A 3AP1A 1R4AA 1ANKA 1D9XA 1E1RA 5FBLB 2Z83A 3TNFA 3CLVA 4A0FA 1QG4A 3MG9A 3IDQA 4BLTA 3GFPA 4L9SA 1WF3A 4DCNA 1E9AA 2Q3MA 5FBQB 4P3YA 5B30A 4B2LA 4KFRA 1DE0A 1U98A 1CR0A 4G5SA 5DYGA 4CZ2A 5AJYA 2XNSA 4ABYA 2NTYC 2QQEA 2OZEA 3I61A 1S4QA 4UJ5A 3CF0A 4GRAA 4HAYA 4GT1A 3NBYC 1NG9A 1JPJA 4XSHA 3UK6A 1II8A 1XDBA 2FFBA 2C96A 3GJ7A 3PEVA 4MKFA 4OQLA 2RAPA 4IW3B 1R0YA 4R2HA 5L8VA 2JLQA 5KYKA 4D25A 1ESNA 1FMLA 1Z0IA 2V6JA 3Q72A 2ZITA 4RD0A 1R5BA 4N1AA 1R8QA 2BJVA 3A1UA 5CM8B 4UXHA 3FPAA 3CX8A 1U94A 3LW7A 3TUIC 1QHHB 4YMUA 2W2TA 4IXMA 1JAIA 2DFTA 1KJWA 1J90A 1U9IA 1KMQA 2Z4SA 4GOKA 2QP3A 4LJ5A 1N6IA 4MGYR 4QJ5A 1G7TA 4TL7A 5HCNA 4HB3A 3W6NA 3EX7C 2H17A 4FD2A 3THYB 4WIAA 1KSFX 1XP8A 4L16A 2F6RA 3K9LA 1YR7A 1GNQA 4QKQA 2CCGA 2DCUA 3AP2A 1SXJE 3GLHE 1MKYA 1KI8A 4R7ZA 1JXMA 1IN7A 3NEJA 1X1RA 3EWSA 4G0NA 1IN8A 2ZRDA 2EFHB 2MMCA 3KXKA 1E69A 4M9QA 1JR3A 1HY3A 1D6JA 4NU0A 3GFTA 3K0EA 2ZM5A 1OHHA 2FSHA 3MCAA 3GLFA 2QE7D 3NC1C 4TT3D 4JZKA 4EAQA 3TMKA 1DAMA 5LB2A 1KZ7B 3REFA 1OT3A 4B71A 4CW7A 1ZAKA 2PBRA 1NI3A 1OH5A 4M1SA 4BRUA 5DYIA 3OESA 4LBYA 3U7GA 2HJGA 5D3MA 1GVNB 2CLSA 2RGEA 4MKIA 1CEEA 1GILA 1ZD9A 5GJCA 3TW8B 5TMPA 1FP6A 3TVTA 2WTUA 1LFDB 1N5IA 3D7MA 4LYJA 1U0HC 3A8TA 5KNBA 1AA3A 4E07A 3ASYA 4GP7A 4M9ZA 4RD2A 2IEYA 2W6ID 4QFMA 2QPAA 2W0MA 3WHLA 3QKUA 2BKEA 2C04A 3SJCA 1ODFA 1FNMA 3B60A 1LVGA 1WP9A 5J40A 4OJQA 1T3LA 2GAAA 1M2OB 3QE0A 3BFVA 3ZVNA 5JCZA 1TTTA 2XNDD 4L15A 1EFHA 2W83A 3QOFA 4IDQA 4TZ0A 5JZVA 3KQKA 2ONKA 2ECKA 2WSSD 1SZPA 3K8YA 2CLCX 2R6CA 3VR3A 3A37A 3TGPA 1F2TB 1M74A 3DL0A 3AF2A 1LNZA 5KDOA 4WW0A 3RWMB 2X2EA 4MRPA 1II9A 4DLYA 2B8WA 5AJZA 1ETUA 1BMFA 2GDJA 4A0GA 4DLZA 4BPBA 1DELA 4V0MA 3VFDA 1NY5A 2ZAMA 4D2IA 4H9GA 3GJ8A 3RNLA 4KITB 3GEHA 3QPUA 2FEMA 2IYZA 1GITA 2XZPA 1GL9B 1RRFA 1WRBA 1XZPA 2VP6A 4GI7A 5JEEA 3KDSE 2AX4A 2QMHA 5AR1A 1NN3A 5AUNB 1A1VA 1OKKD 2FF7A 4B2PA 1ZC3A 3BB1A 2RGCA 4BLQA 2QN6A 2O8FB 2R9VA 5JI2E 1SGWA 3EPHA 4EIWA 4ZI3A 2DPXA 4JVSB 1OXUA 5AJWA 4GPTA 2YWHA 4L4UA 3L0IB 4JLJA 4YXWA 3UIEA 1N0WA 4X8OA 4MH0R 3K70C 3U3OA 1BIFA 3C5CA 1GTVA 4PO1A 4QBIA 3LBIA 1DEKA 2KWIA 4GBMA 5EE9A 3EASA 2JLSA 2JJ8A 2R62A 2D74A 2V7QD 4I1OA 3LRPA 4JVNA 3AV0B 1JJVA 2VQSA 3QXCA 4Z51A 1LV7A 1ZJ6A 4F4IA 1E2FA 2JDIA 2P2LA 3P4YA 3IPYA 4RD1A 4Q47A 2CMKA 2WWGA 2AXNA 1E2IA 2BCGY 3VR4A 3FMPB 1DARA 2IW3A 1W5SA 1K8RA 2NZ8A 5G40A 4KU4A 2PX0A 5EXPA 2BBSA 4TSFD 3K1JA 4W5HA 3KKQA 1FX0B 2G6BA 1FTSA 4UNNA 2H92A 4BEJA 3CPJB 3HR8A 2ORIA 5L3RA 3T5GA 3SS8A 2WV9A 4D0GA 4DLVA 4ZIRB 3AKDA 3MLEA 1YZGA 5CK5A 2KB0A 2FA9A 5TDHA 3WYFA 1TEVA 2CJWB 2QZ4A 3MMPA 3ZLJA 2Z0MA 1FNNA 2EFDB 2D06A 2XGJA 5FBVB 5EP4A 3NC0C 4Z8XA 1U8YA 2H5EA 3KXLA 3FKQA 3GLIE 3V9PA 1GKIA 1ZUNB 1KDRA 2C5LA 4IVQA 2QP4A 4Q01A 2FSIA 4WBSA 4XOIA 4TYWA 2CL7X 2YHSA 5DLQC 3FE2A 4HLUC 2GBLA 3SC3A 4Y0AA 1IY0A 1ZIOA 2QQ0A 1G16A 3DVLA 5KSZA 1MO6A 2W6JD 1PLLA 2ZRAA 4PC7A 1UFQA 3B85A 2C9OA 3QJYA 3E5HA 2DB3A 4NCHA 2QG6A 3EZ2A 4MRVA 2GAOA 4AKIA 1Q20A 4LPSA 3NWJA 3Q5EA 2ZE5A 2J7PD 5H1YA 4HUTA 4BFTA 2NO1A 4LBVA 1G41A 1I2DA 4JLDA 4G01B 4DEYA 4F4CA 4KXFB 2QMUA 2P5SA 1L2TA 5E7IA 3BJIC 1BKDR 4Q1DA 2OBMA 4HZIA 4W5JA 1QHIA 2W0SA 3KQNA 2BBOA 2CHVA 4CRWB 2ZVPX 4R9UC 2CE2X 4H1UA 1EFCA 2VIIA 3AP3A 3W8NA 4B47A 4V0LA 4G5GA 5JS7A 4LHZA 2G83A 4QNMA 4YLGA 1RRCA 1YRBA 1R0ZA 1BH2A 3AVYA 3U5ZB 4F38A 3AVVA 5F9FA 2ZSEA 4AY2A 5JLJA 3BGWA 3GD7A 2I1QA 4LV8B 4OQMA 2O8BB 4PZYA 3WBJA 2PX3A 3NDPA 3CH5A 3IIKA 621PA 3IBGA 3QI2A 1WBDA 2IXEA 2JA1A 1Q1BA 3B1YA 2GILA 3R7WA 3I32A 3SHFA 4P4UA 4BE7B 1U90A 2ZRNA 3CIOA 2QL6A 2QNRA 2OEPA 1SVMA 4HB4A 4QBGB 1XEXA 4PC2A 4JVLA 4URUR 3SQWA 1CJUC 1LTQA 5GJWC 4Z1MA 2VF7A 3AUXA 2V6IA 2OLKA 1KOFA 4Q9LA 4A2QA 5L3QB 4QHYA 1G3UA 1KI7A 1YR6A 4N3NA 5IF9A 4MUBA 4XWAA 3LQRA 3SFZA 5J4KA 5GVSA 1FW6A 1E9DA 1XJ0A 3I8XA 4A2WA 4X8MA 2B21A 1KO4A 1R5OA 3ZIAA 2ZRBA 2FEOA 3RS3A 1J99A 4URWR 1E0KA 3DOFA 3QKRA 5FPYA 1DG3A 4B35A 4Q1BA 1RJ9B 1XJCA 2HV8A 4TTRA 5K8UA 3EPLA 1T0JB 1OXTA 1E0SA 2CDNA 1TNDA 4A0HA 4QBHA 4TT3A 1EFRD 3FMOB 1ZUHA 1Q1ZA 1P9NA 4BZPA 2QP9X 4AC9A 1L7VC 2AFHE 4FWIB 4JYBA 3LH5A 4BLPA 2JJ2D 5DN6D 3OE7D 1OYWA 2BHRA 4AKEA 4KV9A 3OIWA 4TLBA 2ZU0C 1TX4B 4TLCA 1E99A 2PL3A 3TSOA 1ELOA 4XVUA 1HQYE 4C0SA 1GSIA 5DIFA 4KFSA 3OZXA 4FCVA 4DKXA 2WSMA 4TZ6A 2IX3A 5HE8A 3BK7A 4JBWA 2CNWA 4LOAA 2VO1A 2Z6VA 3U7HB 1Z47A 2G77B 4A0RA 4GOXA 3LO5A 2ZRFA 2EQBA 3R9IA 2WKPA 4HAVA 2VL7A 2QBYA 1IY1A 1VMAA 1ZNXA 2QU8A 4FI3C 1FZQA 4MQBA 1HTWA 3GJXC 3RC8A 5J5CA 1DTSA 3N2IA 3MSXA 5L3QA 1W4AA 1Z22A 1W36C 2JEOA 2XNDA 5DISB 4HLQB 5BXQC 4HDCA 3VR1A 3N70A 1FQKA 1VYVA 1E32A 5F3WB 3KUCA 3UG7A 4YONB 1KYIA 2NPIA 3PG5A 2ZETA 2ZRCA 2FFQA 4KBGA 1XBTA 4PPGA 3EZFA 2FFHA 5K8IA 3WYAA 1EX6A 1U99A 5A4JA 4CT4B 4IDNA 2FOLA 4A8JB 1KO7A 3LXRA 4P31A 3RRZA 4F93B 4O2RA 3TIFA 3UKDA 2V4ZA 4PXAA 4TTPA 3MGCA 4MDFA 1G7SA 3WY9A 2F43B 4IEIA 5IDVA 1S96A 3T61A 1P7CA 3F5FA 3P1JA 1KHTA 4B75A 1R6BX 3RRNA 3QKTA 1GWNA 4EJSB 4ZKDA 2WPDA 1E3MA 1R0XA 2IYRA 3ZD6A 1TU4A 4MDEA 1XZQA 1GL7A 1E9BA 1U8ZA 5E7JA 3S1AA 3TVDA 1G3IA 4V0NA 2KSQA 1OYYA 2OCPA 3TW4A 2CHGA 5KO2A 1XCGB 5AJXA 1OB2A 3CZQA 2B7CA 3RSOA 3P20A 3SYLA 1TU3A 1ZINA 4C0KA 1JBKA 2UZ3A 5KSPA 1EG7A 2GZHA 2FE4A 2J59A 5FI0B 2H7VA 2QPTA 4DB2A 1W44A 3LV8A 4UXIA 5TV2A 3OEED 3A1WA 3PJRA 2GJ9A 2VEDA 3TKLA 3I8SA 2FU5C 5EXXA 1LS1A 1P6XA 1NL3A 5P21A 4B3DA 1R5NA 3EIQA 3UXMA 1AM4D 1TEXA 2G88A 4HAXA 4ZDIA 2WMNB 2OE2A 4TL9A 2KBFA 1FUKA 2ODEA 1OIWA 3U44B 2V55B 2ONJA 4QM6A 1NN1A 3SN6A 1X1SA 4AK9A 4FWTA 1H65A 3FFAA 5TARA 3SFVA 4QOSA 2ZJ5A 1RIFA 2YWGA 3B5JA 4LHYA 1FX0A 4HLCA 5HE9A 1YVDA 2ZJZA 1R7RA 4A2PA 1E0AA 1KI2A 5FTJA 3QKRB 2JGNA 2V1XA 2W58A 4NP6A 3VX4A 3NKVA 2OLJA 3GJ3A 1X86B 3HPRA 3EC2A 2EWVA 1G8FA 4OKSA 1W5TA 1WMSA 4LZZA 3CB4A 4JLAA 4QHTA 4R71A 1KAOA 4U02A 4PAMA 1W7AA 2C98A 2OFWA 2WKQA 2FPMA 3N2EA 2WOOA 3SR0A 1EWRA 1ZVQA 3GPLA 2WSSA 4FXPA 2B6HA 4M53A 2C99A 4RZ2A 1NRJB 1DBSA 3BOSA 5B2ZA 3ADDA 4PTLA 1G4UR 5FR1A 1E96A 3EC1A 2JCSA 1GNRA 1HURA 2SHKA 1QDEA 4CEJA 4JLNA 5AK0A 1DAEA 4B3CA 1LF0A 5J4LA 2OCBA 1KKMA 2ZEJA 4TYYA 2YNMA 5HCIA 2CK3A 1E2DA 2HF8A 4PO8A 4XIGS 3UMFA 5HZKA 1WCV1 1E2JA 3LW8A 3SHWA 5IHPA 5JI3E 4PR0A 1AZTA 1IQPA 1P4SA 2YOHA 4MA4A 1P2TA 3AVXA 5BN3A 4NBSA 3IBYA 4KO8A 1JQJC 2ATVA 2D2EA 1W46A 5L3VA 2R6DA 2N46A 3KXIA 2Q9BA 2F1JA 3U3RA 2J5XA 1CTQA 4CVNA 4RZXA 4Q48A 1RE0A 2FV8A 4G5RA 3ZGXA 1IN5A 1K6MA 4ESVA 4L5BA 3HYRA 3TQCA 4W5WA 5KOYA 121PA 4KBFA 1JECA 2XOKA 1P62B 4ITRC 1RVDA 4JLOA 1JPNA 4WAUA 8OHMA 3ZZUA 1TAGA 4GFDA 3THYA 4M9SA 2OESA 1G4AE 4RD6A 3Q5DA 1ZYUA 4S2EA 3V4FA 4WVFA 5LD2C 2JLWA 1I4LD 2PLFA 1CR4A 1E2LA 4G5OA 4YDSA 2R65A 2KI5A 2J87A 1NLZA 2ZJAA 4U7DA 1E9CA 1XD2B 3RDPA 2IC5A 3U61B 4W9MC 1UBGA 1C4OA 5ELXA 5D3QA 5CM9C 5FTNA 1Q44A 4XD7D 3EXAA 3DM9B 1G21E 4KYUA 1OH8A 5FPSA 1KMHA 1YE8A 5KHOC 4JS0A 2A3RA 1KAGA 2ZRPA 1E2MA 3HDTA 4QGGA 4OI4A 5FOSA 2Y8EA 3B82A 2P5TB 4FMDF 2ZSDA 2WAXA 4QXAA 5CIWA 3IO3A 2F7SA 1MRSA 4Q7LA 1AIPA 2C9CA 1VG1A 3ADBA 1E9FA 1DAFA 1F2TA 4QJ3A 3AF3A 4PHFA 2C03A 2GEDA 2V7QA 3IEVA 3GLGB 2NO0A 2CCKA 3H1TA 3HR7A 2IHBA 5JWOA 3TSZA 4OJKA 1KK1A 4RD4A 1AKYA 4GMDA 5E7MA 5CYPA 1U2RA 1G7CA 2IF2A 4OL0A 1S3GA 1CU1A 1J8MF 3K0CA 1WA5A 1G6OA 3MWKA 1IXZA 5SZHB 2HXSA 2DFNA 4MKHA 5J4VA 1RPZA 2GVZC 1HE1C 2HF9A 3KKNA 3LLMA 4Q1EA 3AGQA 1SHKA 2BKUA 4AI6A 3W8RA 4D26A 2QRZA 1CS4C 4FCWA 2JLZA 1ZMXA 1W36B 1PZNA 2AD5A 2J7PA 2ZI3A 1KKLA 3PVSA 3QKSB 1KSJA 4ESHA 4QG7A 3EZ7A 4Q1FA 1E1RD 1W4RA 4NH0A 4EPWA 2A5DA 2OO7A 3U4QA 2DFKB 1YR9A 2NO6A 2PT5A 4D6PA 3MWLA 1JQLB 4W7SA 1DAIA 4ACBA 3QBTA 1KIMA 2ZRLA 1G64A 3LY5A 2IWHA 5FTLA 2P6NA 2GJKA 2WMOB 1DPFA 1W0JD 2BJWA 4S35A 3AKCA 4DDWA 3EARA 3D6TB 5LBIA 1ZM2A 1QF9A 1XD2A 3LFUA 5GADl 3MJHA 4C7OB 3IKJA 2NO9A 1XTRA 2Q3HA 2XEXA 3QVUA 2R2AA 3TRFA 3DM5A 1E9SA 5G3YA 4AIIA 4DLRA 3FMIA 3TE6A 2V1UA 3FHTA 4NONA 5UKDA 4B34A 3QENA 4LJ6A 3AVTA 3AQ4A 1P5ZB 4TL8A 4KLNA 4KVGA 3C8UA 6Q21A 5G41A 5EP1A 1NMXA 1F60A 2UKDA 1I4TD 4JBYA 2ATXA 2ZRMA 1XTJA 1YHNA 2VP0A 2VHUA 2D7DA 4K8OA 5EQTA 2GEUA 2YVUA 3VR2A 1OFHA 1VTKA 1WDTA 2W2XA 4ARZA 1T9HA 4GP6A 1KTVA 2ANCA 5DI3B 4AURA 3I72A 2ZJ2A 2FN4A 2G0NA 2BMJA 3UMSA 2PCJA 4KYIB 1XWIA 1NVXQ 1O87A 1TQ6A 3WXMA 2R6AA 2RGNA 3I73A 1G8GA 4NMMA 1NMZA 3SJZA 3CRVA 2FSFA 1Q21A 4PSVA 1D5CA 2NQ2C 1RZ3A 4QJ4A 2VP4A 1HT2E 1IBRA 3W6OA 4V0OA 5J4YA 1YZQA 3OEHD 4Q9HA 3QF4B 3NXSA 1JEDA 1T6NA 3T1VA 5KTYA 3M6AA 4EPTA 2HYDA 2RGAA 4MYTA 3ICQB 2ERYA 1I2MA 2GBLC 3A1SA 1QVAA 1GKUB 1IAQA 5FOVA 3P4XA 3GLFB 4Q4HB 2FZLA 1FOEB 3QY0A 2OCAA 5KDDA 1X8JA 2FFAA 4OYHA 1PVOA 2FSGA 2ZAOA 4QHSA 1N6OA 1E6CA 1ZCAA 2X8AA 4HYYA 1A7JA 2WWHA 4GNKA 1G3QA 3T34A 2ZVQX 4DBLC 3AB3A 2XAUA 2A30A 2VPPA 1EXMA 3VU9A 3I92A 5B64A 1TQ4A 4Q19A 1MRNA 4DSOA 4MRNA 1X8KA 3T12A 4A9AA 4Z8YA 2ZRIA 1AS0A 2CE7A 3C7KA 2QROA 4JJZA 4YMSA 1QHXA 2HCJB 3IIJA 4PC1A 3R8CA 3B1XA 5G53C 4BZQA 2ZJBA 2IXFA 1Q12A 1Z06A 1AK2A 4Q00A 4NYMR 1Q57A 4EPYA 4UNPA 5AUPB 3J81k 2D62A 3IEUA 1T91A 5CITA 2HYIC 1P2UA 4UQOA 5GJVC 1PUIA 2CL0X 4TMKA 2ZXUA 5DHFA 1B23P 3BH0A 1J7KA 1G1MA 3G82C 1TQDA 1UKZA 2P65A 2ZS9A 2GCOB 4B3BA 5LDDC 5DE3A 1AKEA 1KDPA 3B9PA 2FX3A 3NH9A 2BCJQ 4MRSA 1Z29A 1ZU5A 4ON9A 4Q7KA 1EX7A 4HI0E 3UWOA 3ND9A 1XEXB 2WJJA 2QTFA 1UKVY 3K0FB 4TLEA 1NNEA 2QPOA 3DEFA 4ACAA 4DSNA 4YQFA 3HU1A 5JECA 4EJSA 2J41A 2ZI6A 2EFGA 1NVUQ 2FGKA 3WNDA 1MR3F 2Q9CA 4HDOB 2BDTA 2IS1A 3EA5A 5JEDA 1RKBA 3TK1A 1UJ2A 3BH7A 4HZUA 1KDTA 4JL8A 3RWOA 1EFUA 2YC2C 3QNUA 1EGAA 1F48A 1IHUA 4PAOA 1SXJA 1OXSC 2QGNA 2MSCB 2IYQA 4U00A 1ZCBA 2CVHA 2WJIA 1SVWA 1P75A 2XSZD 2C2HA 1BYUA 3RHFA 2G0TA 1MT0A 4RSGA 1KZGB 1OW3B 1GL6A 2AR7A 2PZEA 2XITA 1ZM3A 4EUNA 1QZXA 1IXRC 2BEJA 4A6XA 2AWNA 1WQ1R 2VHCA 1GRRA 2OSBA 3FYHA 4QRHA 2PH1A 3REGA 4LRWA 2I4IA 1FPMA 2OM2A 4MYUA 2A5JA 3VQTA 1WXQA 1ZP6A 4XSGA 1AN0A 3C15C 4DZZA 3FTQA 3RRMA 4PAQA 1D8TA 2Q0HA 4LJ8A 4BQSA 5E3HA 3AGPA 3JZMA 1B0UA 3L82B 1Z6XA 4M0LA 5FTKA 4PHGA 3I62A 1CXZA 2JIZA 4LDJA 1VG9B 1ZNZA 2C95A 1VCMA 2VSFA 1GRNA 2EWWA 2OFOA 2Z5FA 2PJZA 2FPKA 1TQ2A 1NLFA 2IYXA 2OXRA 2ZRKA 3PEUA 4JT4A 2BEKA 2JAQA 4PPQA 3KX2A 4NPHA 3NIBA 5KU1A 2REXB 1S8FA 3ZZTA 4NYMQ 4ZCMA 3EIEA 2NOAA 4NL4H 3SNHA 1CBUA 1N6PA 4PQRA 3Q3JB 2GKSA 4I4LA 4D0LB 1Q1EA 3KKOA 4HEJA 3T06B 3ZYCA 4LV5B 5JWRA 5L3SB 1K5GA 3CX7A 3O8CA 4PC3A 4OQXA 4OK5A 1BS1A 2O8BA 1COWA 2VHJA 2GRJA 3AVOA 2ZYUX 2UVQA 1XRJA 4M9XA 3A4MA 2NG1A 521PA 1A82A 1Z0KA 2BMDA 3V00A 1LS6A 1TPZA 2BBWA 3DPUA 2EU8A 2Q21A 2PLRA 4ZV4A 3A6PC 1ZM9A 4A8JA 2D3WA 2GXQA 4Q03A 1NIPA 4PANA 3OFNA 4LI0A 2YINC 1Z0FA 2D4HA 3CO5A 2J0UA 3OEHA 3ONWA 1IONA 1DG1G 1GNPA 3TH5A 5TXGA 1U9IC 1W47A 1UF9A 2ZSAA 4D4MA 4NCKA 1JXOA 4EFNA 1GKYA 2PZGA 3O8DA 2GK6A 1RC8A 4B44A 2FZ4A 1CIPA 2IA5A 1PLKA 1HQCA 2GJSA 4C7OA 2LWIA 5EUMA 2GTPA 2IYVA 3WNCA 2CHQA 1GAJA 4XVQA 3A1TA 5JRZA 3EPJA 2BMEA 3FOZA 1PUJA 4AYXA 2GWHA 3UANA 4R2IA 2Z4RA 2YZ2A 4ZDKA 3THXB 1OIVA 1WB9A 4LV6A 3PXGA 4GZLA 3B9QA 1KK3A 1P61B 4JKIA 1P72A 3QVVA 2AK2A 2ZRJA 3T35A 1TADA 1DS6A 3GP8A 4O3MA 4I1SA 4I81A 2RGNC 2CJWA 1Z2AA 1W48A 1KO8A 1JAHA 3CX6A 4HB0A 4RKFA 2XX3A 3CF6R 4G3XA 4ZKEA 3X1ZA 1W0KA 5C46F 1SXJB 1QHSA 2IT1A 3NG1A 3VR6A 4C9BA 5IRCD 3L0SA 4QGFA 1BMFD 1XXHE 5JJIA 1A2BA 1KY2A 1NN0A 3GEIA 4JMPA 1YZLA 1ZBDA 4A1FA 1E79D 4TWZA 2HLDD 3CNNA 2QM7A 5BYJA 3HP1A 2OUKA 4MUAA 4P4TA 1KI3A 4YDHB 5GVRA 1NKTA 4P4SB 1KDOA 2VBCA 4DT1A 3K9HA 1R10A 4NCJA 4XWOA 4D4KA 2EFEB 2BMFA 5DSZA 3G0HA 2ZJYA 421PA 5FL7D 2NPFA 3D3QA 1XMJA 4JT2A 4ERNA 5EXTA 4AYTA 2RMKA 1II0A 2ZI5A 1TF5A 3B7GA 1UBCA 1KI9A 5BN4A 4F4JA 1NBMD 5BQ5A 1W4BA 4RVCA 4A8JC 5DHAA 2WZQA 1KMHB 2OV2A 2H18A 3OIUA 4HATA 3CR8A 2PMDA 1H8HA 4IDPA 4PC6A 5FL3A 1XTIA 1Z6AA 5FPHA 2NZJA 3VR5A 1E2EA 4MYCA 2WAYA 5DI3A 4HAWA 4IOLA 3SJAA 5M04A 3RC3A 5FBWB 1XMSA 5FFMA 2EYQA 2FMXA 2ZR7A 1S2MA 3ZVLA 1W1WA 2W2VA 3DZ8A 1KK0A 3UWKA 3K0AA 3IPXA 3ADCA 4LSGA 4M1KA 1XJQA 1E1QD 4TYPA 1XMIA 4EQ6A 1T5IA 3JVVA 3VMFA 1GDDA 5DI9A 2YYZA 1M8PA 1BOFA 1E4VA 2ERXA 3B78A 4I99A 5EE0A 5EP3A 4CF7A 3I5YA 5K8TA 1G9XA 1QRAA 3THWB
chains in the Genus database with same CATH superfamily
3KB2A 3CT6A 3M6FA 3AJEA 3K9QO 2FWIA 4UNSA 2K7FA 5KTKA 4DLSA 4RE6A 3R2JA 4CR6A 3PZRA 2JDID 2HQBA 3K09A 5A4AA 1GUAA 2B2NA 5D51S 4L0QA 3K9CA 2JBWA 1XD8A 1GFSA 4JU9A 2E4AA 1UWLA 1WEHA 1Z7BA 3OJXA 3Q88A 4EG4A 4F4HA 2PGXA 1LWNA 1SN7A 3LTEA 4J07A 4EJSC 4IUCS 4S04A 4OTZA 2A35A 1MJ5A 3BH6A 3GVPA 1DDGA 4ZYVA 1KFEB 4F46A 2RJOA 3J81A 1L5MA 4GL2A 1NNLA 4NENA 1RPTA 3CLKA 2YS6A 2FXVA 4C2TA 1Q7GA 2HMVA 4YK7A 4DRYA 1VBNA 1ZGZA 1E6LA 2X0RA 2VXCA 1YHYA 4XIYA 4RA6B 2FVXA 1J7JA 3KJIA 3QW4B 4B6GA 4DLPA 1E4YA 2PE5A 3JATB 2N75A 3EDMA 1TGYA 1SU4A 2PQ0A 2PUVA 4B33A 4PZLA 1KH2A 2J5QA 1Z7YA 1FVOA 1YKFA 5HKKA 4DCVA 4CR7A 3U80A 2BC9A 5EZYB 4QGSA 3WGLA 2P67A 4FI3F 1W5FA 4QNRA 4BKOA 4JJFA 3HC7A 1T2FA 4US0R 3KZOA 4IIXA 4JENA 1MXHA 2R48A 1GGEA 2QMEA 4TRJA 2D00A 1KS2A 3SE7A 2X5JO 3EW9A 2K5UA 3IPRA 4MV7A 1EZZA 1MB2A 5E9AA 4XJXA 3DULA 3G7NA 4K0RA 4D46A 2EKZA 4CM8A 4X92A 1Z4LA 4QUBA 4UU8A 4EKIA 1TB4A 2O52A 1E5DA 4IOKA 4B4DA 2C88A 1TTHA 2VRWA 3BE4A 4FTWA 4KUHA 4HFJA 4XIIA 1VHTA 1FFWA 1HT3A 1VECA 4Z0NA 3IHWA 4KXXA 5AKZA 4Z9FA 1ZIXA 4PSCA 3CONA 2XYGA 3H19A 4OXQA 3STHA 2Q62A 4FNOA 1EEXB 1K6JA 2V45A 2O3SA 4P3NA 1UL1X 2O3RA 2QX4A 5ITVA 1CUWA 5FEMA 4EECA 4EI7A 2WU0A 2G1KA 2JIMA 4A82A 2IS4A 4QTUB 1T5SA 2P6PA 1K5DA 4YRZA 4IWYA 1CSEE 1H4TA 3AY0A 1ZS9A 2JGEA 2A8YA 2LIVA 2C2MA 1ZVJA 3LBNA 4KLZA 5CX4A 3VDXA 1IXSB 1YRLA 2YN2A 3WIDA 5CCXA 5KNLA 2PQMA 4CV0A 4NFLA 3ZCXA 3JASB 2JGIA 3CEJA 4MUNA 2RBGA 3EFHA 1OFUX 2FG6C 2ZS7A 3JD3A 3MMNA 3BMQB 1MX5A 4W6QA 4OCZA 2WTEA 4Z99A 2GPWA 3HU5A 2X0NA 3E1KA 1UMDB 2H00A 2JJYA 1GZ6A 4JA0A 3MYYA 1XQ6A 3C3MA 1DO2A 4FR5A 4W1RA 5I3CA 1WNTA 1FDIA 1XZIA 1W36D 1DKLA 4TLLB 2D5BA 3U7RA 3H9UA 4G89A 1TRHA 1BGVA 3HDGA 3F0TA 4B73A 2FW8A 4O2AA 1JXAA 1ML4A 1PEDA 1DVRA 5JZMA 4A4DA 5JXWA 1CJVC 2AZ4A 2XH8A 4HPJB 1HF3A 3MEQA 3S4YA 1NLYA 2HT1A 4F5YA 1CUHA 1EESA 1BRTA 1HE5A 3IILA 3QXSA 1J09A 1Z4NA 2OG1A 3ZHTA 3HKDB 2A78A 4FSDA 5CM2Z 3WLTA 3EG5A 3WOVA 1OIXA 4C88A 2CC2A 3ROKA 2YOFA 2BFEA 2VI5A 3PDUA 2QUZA 5AHKA 4I4CA 2PNJA 1KIAA 2I71A 1N6KA 4LWZA 5KEIA 4N4AA 2CK3D 3AERB 3GN2A 2BR5A 5D3KA 1WSAA 3CIFA 3ONEA 1R8JA 4FGSA 2Q2OA 4CV1A 2WUWE 3NHRA 4WBNA 3M4JA 3OUZA 3VPFA 5JCOC 2ZI9A 4DYVA 5BRJA 1VIAA 2WVHA 2Y6VA 4LXHA 1L4YA 3BMOA 1E1CB 4NQZA 2RB4A 2WPDD 3OETA 4K9RA 4P08A 1OI4A 4TV8B 2JFGA 3L7JA 2X3YA 4WZ6A 5A0FA 3CR7A 3ZGLA 1RM5A 4YMVA 1YH3A 4X1YB 1ISSA 1PL6A 2ORYA 3CR3C 4QYXA 2LRHA 2OGSA 3ACBA 2R85A 5EYPB 3VV2A 3EIXA 3WMWA 3SKVA 3PF9A 1US8A 4JAVC 2P3OA 3FKSA 4YRFA 1TM3E 1CJKC 2HK8A 5L6LB 1VLVA 3THXA 1PEAA 4XH9B 1JIVA 4Q3NA 1T0HB 4AP5A 3L4KA 3ANTA 5HX7A 2FLVA 2QMOA 1RWWA 2HHHB 4O1MA 5IWAB 1YA4A 4MQLA 1P1HA 1PV2A 3EJ6A 3WLHA 4URZR 2ZCUA 3OCJA 2D2VA 3STXA 1CUFA 3QGMA 2Q46A 3CKLA 4EKDA 3FOFC 3HJRA 4OJMX 5LSAA 2XMPA 1QG0A 2MR6A 3OT4A 4JBXA 1XJWA 4J29A 4RZSA 4LF6B 2H85A 4KO4S 5JW6A 1EGQA 1ZC4A 3JAWB 4AP9A 2QLBA 2WW8A 5BN5B 3UT0A 1V5WA 2AFHB 1Y5IA 3K3PA 1JTEA 3SOZA 4G97A 5IAKA 2B4QA 3UWMA 2W6JA 1PV1A 3BFJA 4YHBA 5JAQA 2QTRA 1WIWA 2ZT8A 4C03A 2FG5A 3K09C 3RFFA 3PEEA 1A7UA 3ZTYA 1NBWB 4GLOA 3QXJA 2DHEA 4QPPA 2WHRA 2EQAA 1SQGA 4NVRA 5AKEA 1PP4A 2FSVA 4HDKA 4LY0A 4YMGA 3GLIA 4CT0A 1FTQA 3CRMA 3K96A 1NAIA 3TW0A 4CIYA 3ICEA 2AFIA 4YUXA 1IJKA 1UDXA 4IKOA 2WJGA 5DF1A 2GVDC 4R1MA 3BREA 3CC8A 3G0CA 3TDNA 1QG6A 1PJTA 1L4UA 3GZTB 3AVUA 3MMSA 2VLIA 5ED0A 4R2JA 3EG9B 5F2EA 3JQ7B 3I5XA 4WZBB 3NWOA 4J4TA 5DNDA 4QA9A 3TCXB 3ZLTA 1UJMA 5CJ2A 1QX3A 4FIZA 4JFAA 2IYFA 1YJQA 2Q6TA 5E95A 4CMCA 5F9HA 2W2QA 1CZNA 3L0CA 1SA0A 4XUGB 2XLCA 2OAP1 4K2HA 1DAKA 3QI7A 4LDRA 4F71A 5A5FA 4ZHQA 8GPBA 1QRTA 4NCBA 1ZW6A 4B6QA 3VGPA 4UQLA 1GZ4A 4M54A 3HN6A 3Q5GA 5E9JA 3DDCA 1AT1A 1ZAYA 1P29A 3ZHXA 3O8BA 4DZRA 4RAQA 1OY1A 2G9RA 3E8SA 2GBCA 5FADA 4H35A 1RYYA 2BE7A 1AGPA 5TJHA 4B6FA 3KLNA 3TLMA 2WA1A 2PIDA 3PUIA 4RYLA 5E1MA 3WICA 3EIHA 4H7KA 1CR2A 1M5TA 3DHVA 2C4UA 1SOAA 4BMYA 3AG5A 3J7TA 1N2HA 2CUZA 2VRCA 4B3HA 3BA6A 1C50A 3GBVA 1PQYA 1X7YB 4WVLA 4BJ3A 1Z2CA 1JMVA 4H7EA 3LXMA 2QRVB 2PDAA 5LP1A 4G5YA 5CYOA 4ZI2A 2WU8A 1Q6ZA 1NIJA 2IGTA 3OIFA 1W2WB 2NYAA 2BMVA 2ZQYA 2QRHA 1XFAA 4LE2A 5C34B 2UZIR 3UYLA 1IHOA 1KJNA 1MT3A 2AKYA 3C7AA 3W2TA 3IA7A 3ORYA 4H6XA 1JR3D 3WDMA 4EA9A 4WADA 2BFDA 3EOZA 5E9QA 4EGSA 5EE3A 5K3AA 1RCTE 2VWQA 4DIEA 3WA6A 3P2KA 1RHUA 4F91B 3HNPA 4C0QC 1WD5A 4UDOA 4GRIA 5IJ9A 2H3HA 4I50A 4UNRA 3KPVA 4LK3A 4ZCQA 1IUNA 2WVAA 4F12A 4M4SA 4ENWA 3JY6A 3OUTA 4LSWA 3E2MA 3VR6H 4MVJF 3FDIA 5CHEA 1WY5A 1RPNA 5ESDA 4ETMA 4IIYA 4BFCA 3FI0A 3U60B 1C9DB 4R8RA 2MT9A 1WDLA 4AMGA 3NGMA 4KXQA 4DCTA 1I24A 2WVJA 4XQ0A 3P94A 1C9NA 1KP3A 2CVPA 3NKLA 4IDAA 4EB6B 5LWHA 1UAYA 2CDRA 4KLAA 4UM9D 4K05A 3K0FA 1GU1A 4X84A 2Z2ZA 3H0CA 1KP2A 3ZI0A 3FUTA 2BKXA 4GSLA 4OBEA 3D7SA 4LIPD 4QT0A 2G9ZA 2K4MA 3CM0A 1G3RA 2D0PB 1VKZA 5TB5A 1U7ZA 3VAAA 1LKZA 2HNKA 4N48A 2DPMA 2HIGA 3RU3A 1TCBA 2FUNB 4K0KB 4JASB 4N7RA 3LQYA 1YZTA 4LGVA 3FYDA 3RHTA 4DMCA 3W06A 1L5SA 4WZBA 3PA8A 5EMHA 3RJMA 3S7TA 4JLPA 4RHFA 3B2NA 5DBFA 3T99A 1VIVA 4MWSA 1V95A 1G3MA 2BM1A 3LPDA 2AXEA 4GEKA 3IP6A 3O95A 3WB2A 4OQNA 2AFIB 2OHFA 3H05A 1ABFA 4RZ3A 3T5CA 5CFNA 1PYDA 3VHLB 5C3MA 4CL2A 3UZUA 3BPSA 3DFUA 4K87A 3RSZA 2IYYA 4GOND 4X8HA 4CMIA 3PBKA 4ZVTA 3SVTA 3LUDA 1H2BA 3ROPA 1V0JA 4DQ0A 3IAM6 3ZQJA 4EVSA 4D5EA 2V3VA 3ML1A 3UK1A 1XCBA 2QGZA 2YX1A 1T2NA 1Z4IA 2B37A 1F5SA 1MLDA 2YH2A 3IGFA 3R3XA 4R9VA 2JLYA 4ILEA 2Q99A 2HMWA 1PFUA 1IPHA 2Q7XA 3L1VA 2DWUA 2FSPA 5HBGA 2WY2D 3SU8A 3WS7A 5AW5A 2R5NA 3AVQA 5J59A 1FMFA 3EY9A 1Q95A 3O2QB 3H0KA 1S2IA 4V3BA 4YJGB 5SYMA 3G6WA 2CLFB 3N5CA 1HRDA 3PV0A 4PGAA 3ETCA 1N77A 1QJCA 3G0GA 4YJ3F 2D1FA 1WE2A 5J2UF 1GN9A 3UG6A 1NSTA 2QW1A 3IO5A 4EOGA 1UKYA 3VC3A 1ECGA 4CXMA 1G8YA 2VAWA 3KYCA 4C30A 2JFOA 3I4LA 2D0IA 1C3OA 3AJRA 3H84A 1OGYA 3GARA 1SD2A 2UV8A 1T4BA 1US8B 5TVKA 1L5HB 3LVBA 4WCFC 3ZS8A 4J91A 1DBVO 4D4HA 3M82A 3IAM1 5IABA 2YKGA 4TMTA 1U81A 2GMWA 5DCYA 2WC1A 5H9VA 3ZX4A 1UDRA 2QLNA 2IDZA 4Q9JA 5F3RA 3K70B 3FWKA 3QOWA 1TUIA 1Z5OA 1A95A 1DC4A 1BEUB 5FBRB 3VYTB 2IYOA 1NVVR 1PZMA 4HDNA 6GPBA 2VN8A 5LQMA 2CHFA 2OG2A 3A9UA 3DKPA 3HSKA 5JSFA 2AS0A 1R9MA 2XYPA 2J3QA 4FYKA 1B00A 3T9DA 4A3SA 3IT1A 2O3QA 3RSQA 3RT9A 1IUOA 2I4LA 4FDVA 2PJDA 1H6BA 3DO5A 2NYRA 4NDZA 3D1VA 1GQ2A 1NQOA 2ASEA 2R6FA 1QB7A 2IL1A 1QFSA 3HJAA 3BF8A 3M6MD 1YS9A 4I1YA 4KCGA 3DKRA 2Q5IA 3P0IA 4WLFA 3ECCA 4OI0A 3ZXSA 3KJZA 3G02A 6PFKA 3T0FA 5KCZA 1KGDA 2ZR8A 3BGOS 5FOXA 3L7BA 1G60A 2GB4A 2GZMA 4N8DA 5AJUA 2QX9A 2VHTA 4R41A 2PL1A 1RMTA 1YDMA 3GFRA 1Z74A 1SVUA 3E9DA 4X7MA 4E6EA 1NX6A 5KJCA 1DTWA 1G2QA 1PNQA 1V5IA 1XFDA 2BVNA 2FN8A 3L4BC 1QHFA 2OMEA 2R8OA 3R5HA 4NDNE 4NYJQ 1P0FA 3TLAA 1ZZEA 2YV1A 2F55A 5CBKA 3GG9A 3HLYA 4N6OA 1AV7A 1D2CA 1R8SA 5CVUA 4A73A 3MJSA 3L18A 3LLCA 1TU0A 2D1TA 4L6CA 5AJVB 3TIVA 1DIRA 1UPTA 2YYAA 1IEQA 3C16C 3R3VA 5E6UB 3WAKA 4BFUA 4AQ7A 2LPMA 2VF4X 3BMOB 3PKJA 3GRUA 1FSZA 2A5LA 2OQIA 2ZREA 4FW8A 2ACVA 5JAMA 2VYVD 5K8LA 3S40A 2Z2KA 1CDEA 2VS1A 4W9RA 1SFRA 4WBNB 2AB0A 1BHJA 3GJTA 5A5DA 2BH2A 3EBPA 3ND8A 2KBEA 2WM2A 3I9KA 5K2OA 1QONA 1MH9A 4R68A 2JKYA 1DADA 1OPRA 3JASA 1W0KD 3F4BA 2I2WA 4QTXA 5KUTA 3COWA 3VXKA 3KC2A 4HAZA 1K6IA 1K0FA 1QTNA 2BFEB 1Y81A 2XIJA 5AW1A 3A3YA 2VDWB 2QZPA 4IV5A 3ZN2A 2PCLA 4LZJA 1BWPA 3Q8XB 4FIDA 2VH2A 4Z6KA 4OFZA 4UU1A 4DG9A 5BPHA 1U8EA 3IAFA 4MRMA 1X0VA 2BEUB 5LJIA 1OBOA 2BWJA 2YUIA 1JR2A 2JIRA 2GGSA 1V5FA 4N8EA 2HLPA 2VSYA 4CKXA 1HO3A 3ZU2A 4BMSA 2GT1A 1PL7A 1QMPA 4HSEA 1FQJA 1C80A 2O0KA 4F5DA 4QEKA 2BFMA 2C4WA 1MW8X 4I4TF 1YC5A 3WJAA 2W37A 3Q7SA 1I94B 4BFZA 3V8NA 1K4MA 1JH9A 3I64A 3PXXA 3N0XA 5EXDA 2IHYA 1UXGA 1H2ZA 2Q9AA 3PZBA 4YJ3A 3KKZA 3N8NA 3AUTA 4M49A 4YJDA 3NNNA 1Q0LA 5FR2A 2BGWA 1TO6A 1ADCA 4DR5B 1YZKA 4YAJA 2C57A 5GINE 4OQFA 1NXWA 1E7WA 1QTIA 1EFVA 2UVPB 2ZIXA 3CX4A 2BGRA 3KJEA 5IASA 1VHWA 4BX3A 3CEHA 2CKMA 3S99A 4FJ1A 4LHVA 2O50A 2H7CA 3JQBA 2C29D 4WECA 5HUHA 1MQ9A 1RWPA 2HHCA 4CNQA 4A23A 2ILVA 3ESXA 5CDGA 3BXHA 3PKZA 1KE2A 1E2PA 4LX0A 1XRNA 1S1CA 1UK9A 2J1LA 2RI1A 3ENVA 4XPZA 2WJHA 2O05A 2ZIWB 1AURA 3CUYA 2JCBA 4ME6A 2QORA 4N5MA 1PDVA 2I80A 4PYMA 2NXEA 4PG8A 3P9RA 2IIQA 1CQPA 3EAGA 3EA0A 3GLKA 5EMKA 5JXIA 4LYEA 2GJ8A 2VPWA 1PTJC 2EKDA 4RANA 1DQNA 2DHDA 2MSEB 3G9QA 5JJKA 3JZFA 1JGTA 3L9WA 3WGJA 5HPYB 1IBKB 3KU4A 1KEWA 4DVJA 3QM1A 1SBNE 4XDGA 4UPEA 1G2OA 4LCBA 1KI6B 3PQEA 2ID4A 4G09A 1ZGGA 4JELA 2IUUA 3W5IA 3EGEA 2C8KA 4MROA 3EQZA 5HDBB 2XZDA 5JSKA 4O33A 3E3LA 3SD7A 2CJPA 2R25B 3UC9A 2BR3A 1NATA 1QK4A 3LBAA 3IL2A 4KHZA 3IFSA 1AB5A 3U9TA 2I67A 4QQNA 3OZRA 3QY9A 2IYUA 5IEBA 3RGWS 1Y9AA 4HX5A 3REQB 2HT6A 4XQEA 1FP4A 2I29A 3THOA 3EEFA 3KWFA 3LKDA 2AW3A 2Q49A 3O83A 2QRGA 4DHEA 4JB8A 2ZROA 2LKDA 4DB4A 5C1IA 4MULA 4WDRA 4LYYA 1W0CA 1ZI6A 4A16A 3RNOA 1QGOA 1Q1QA 3MQFA 3ZV4A 2PEYA 1ZRMA 2BFBB 5I9BA 3JALA 2R8RA 3PCRB 4EABA 3VKWA 1PTJA 5HUJA 5J1TB 1XWFA 3KKPA 3L02A 1Y80A 5EUBA 1H6AA 1OVGA 4Q4CA 2PLNA 4I9FA 2XQIA 5HEKA 3EUFA 1ZMRA 2B34A 3N8KA 1EWQA 4CCYA 4RE5A 4FZ5A 3WGKA 4DSAA 4HRAA 2ORWA 3GV0A 4L02A 4O25A 3V1UA 3DBRA 3NAMA 5HIJA 1REQB 3UFBA 4JV5B 5KPDA 1KIFA 1CUDA 1SZCA 5LBUA 1MRZA 4KUGA 3H13A 4D0NA 1F6BA 4JL6A 1OLUA 3DE2X 3HB7A 2SECE 3G5LA 4U5XA 3HR4A 3WKBA 3PT9A 4BNKA 4PG6A 3ITDA 3DMYA 3LQKA 1QAOA 3T7TA 3OTIA 2ZT7A 3TD2A 5DM0A 3M6XA 4AMBA 3HBFA 5IDYA 5LQAA 2C5FA 3T95A 3BJEA 3QWFA 3GF4A 3DBLA 3KVOA 4PHCA 3FFTA 4YQEA 3TLKA 5JMTA 1D07A 4G0VA 2ZYVX 2J08A 3DH0A 1JP7A 4U4AA 2GCNA 3MWFA 1NZJA 1X14A 3N39C 4EF5A 3WMRA 5BURA 4CIWA 3EVFA 5GP1A 2JH8A 4C3UA 3Q3EA 5JS1A 1A3CA 4UVDA 1W85B 3RC9A 4QXRA 4MUKA 5I5EA 5MGNA 1WUHS 2ZYRA 4TQAA 4OV6B 4WZAA 1Q0UA 4P32A 1Z5UA 4ENPA 2YC4C 4D9MA 1ACLA 2FETA 4IDCA 4JC8A 4YRJA 2FSVC 5B3LA 2REBA 5AW3A 3H86A 4QVIA 4JXXA 3EMVA 1RHMA 2PD3A 2BIFA 4FDLA 2W22A 3EWIA 1XA4A 2QYHA 2GEBA 3FMFA 4KRGA 4XD2A 3MAJA 2Q6OA 4B3MB 1GGMA 3ETJA 5H3HA 3PHGA 3ZHZA 1W29A 3K0HA 3ETLA 3SIXA 2NADA 2WV7A 5HTKA 4IHAA 5E6SA 3T5AA 5ELMA 2ZRHA 3WLFA 5JASA 4ARCA 1NJGA 1DOHA 3FNGA 1JTFA 4XPIA 1Z4JA 1AX9A 4AF6A 4BWVA 2C8VA 4KH1A 2H0AA 1SKAA 5KIAA 3AM1A 4MITA 5KTOA 3KVVA 1JL3A 4CTNA 1H2HA 4HX2A 1ZGBA 1G5PA 1G8JA 2Q29A 5CA0F 1N0VC 4GX1A 4U9HS 2H2GA 2IOFA 3DAYA 1Y63A 2AV6A 2R6JA 1NQVA 2VHZA 3E7WA 4RDCA 4RK4A 4PS1A 5EE5B 3ZJ5A 4RPHA 2AUNA 9LDTA 4DRZA 2QT9A 1QBKC 4DR3B 3KJNA 4FYXA 4WN3A 1P9WA 4KWTA 5T64A 4ESEA 3CW9A 4QU8A 3ZHQA 4B87A 2JJ1A 5JSZA 2AZXA 4RDIA 4MW4A 1NAHA 4DDKA 5HXAA 2ON6A 4U7TB 2MSNA 4WOKA 4Y8VA 3IJRA 1QBGA 5K0FA 4JLBA 1KQNA 4DA6A 3E3NA 3IE1A 2PKWA 4XEUA 1EK5A 1Z8FA 2PZKA 3UT6A 4CDGA 4MAMA 5AQ1A 1UBNA 2YJ4A 1M75A 3EVBA 3KTAB 1SG6A 2EC5A 5EZQA 4EW2A 4UHKA 1A9RA 1K2WA 1CRPA 2JI4A 3M0EA 1IG0A 1NVEA 1UBSB 1I5EA 4W6ZA 1Z56C 4YFYA 1KOLA 1WXEA 1LH0A 2YBDA 1JJ7A 4GI2A 1YB4A 3HCBA 4N7JA 4ALNA 1L3BA 1ORDA 2BDEA 1QV6A 2UUCB 4ND8A 1WVIA 3DE6X 3HBLA 4KSBA 4IH4A 3VO9A 1F4PA 4EX6A 3RRXA 4AU1A 2H3EA 5JQWA 3AWDA 2LKCA 3OZEA 3GHYA 3R7LA 4CCSA 3LGSA 3LHIA 3RR2A 2QTHA 2X19A 3V1YA 5FV4A 3F6BX 2PSFA 1N5OX 4OXRA 1AXRA 4DCGA 4IX9A 5KWSA 4N8SA 1EE9A 3TZ6A 4WERA 5DW3A 3IVMA 2YZNA 4HZUB 4A8TA 3ZBTA 2JJ2A 4ZDJA 5I7OA 2RGDA 4DWJA 1RWMA 3FM9A 3IOCA 4EKEA 1GZ7A 2NVOA 2GK7A 3FLEA 2H16A 1GZHB 4CIDA 4R8LA 4KOAA 4IG4A 1HE8B 4B1FA 3ER8A 4Z2YA 4D1YA 4HVTA 3X1YA 3FDZA 5LDHA 2OZLA 5BSWA 3OU2A 1I2CA 1DJLA 2YV5A 3L7NA 5FNVB 4YLYA 1WX1A 4CIBA 1TZMA 1YV9A 3U7EB 1BQ4A 3BD6A 1NBME 3FKSD 2IOFK 4IJMA 3W77A 5B1DA 1K7SN 3ND7A 4IUDS 1EWKA 2WWVD 3DB1A 1PD1A 3Q3GE 1A5AB 4MGKR 4MZXA 1Z6YA 2BSQA 1EVKA 2P41A 3I9OA 3V4RA 5LXTA 2PVPA 2O8CB 3T0GA 1UUFA 2X77A 1FDWA 1FTGA 1TC2A 3HDYA 4LMBA 2I33A 1VJ5A 2CXNA 2XCUA 4FHFA 4W7IA 3BXEA 4UJ3A 4XGRA 4KW7A 4XARA 4MX8A 1VG8A 5D6NA 1GPAA 3PR1A 2I91A 3O4IA 2XMSA 3I9FA 4MKGA 2W98A 5D5PA 4BPRA 4YXFA 1XXHB 2ZZNA 1GA6A 5EJEA 5J2TB 2J9ZB 1SNYA 1Z83A 1H2YA 3DMNA 3SI7A 1I9GA 1ULSA 4FMDB 3O38A 3SYRA 3C3YA 3CCCA 1VKHA 1JU4A 3N58A 4K9PA 4LKOA 4XEHA 3QEJA 3WO0A 2IZ1A 1H85A 1MJFA 1ZJYA 3OVMA 3WDLA 5EINA 4F92B 2WWFA 1MO2A 1G7RA 2ZBVA 4IJ5A 4XX0A 5B3JC 2X2FA 3B2EA 4PX9A 3OWXA 4G4IA 1ZHHA 4OHBA 1YUMA 3LDUA 5WRFA 3EZ6A 2XOEA 4D3FA 4EEXA 2O8EA 1P3DA 2D3TA 2PX2A 2BFCB 2KQUA 2NZXA 2P2ZA 4KPUA 3U4DA 4D9CA 3NV9A 4G4GA 1IVNA 3SE0A 3WYGA 3L1UA 1H8HD 3QP9A 5ALSA 3CISA 2GTHA 5DXFA 3V9AA 2O9JA 4OJTA 3DD1A 2CKDA 4K6KA 4GI3A 3IT0A 2PH5A 2VTEA 4LY6A 4P0PB 3C8ZA 3DDHA 4XJTA 2GM5A 2UZ1A 2AWOA 2P40A 1GPWB 4B3XA 4D56A 5ICGA 2WWTA 2BBTA 1LPMA 4DUZB 1FS5A 1UWVA 3PFCA 4MS3A 3L0PA 1MC8A 1OI3A 3CLRD 4FGLA 1S6YA 4CUJA 4G5HA 4O3FA 5DMXA 4M9RA 1Q2XA 2V8BA 3CMCO 4BMOB 2WBLC 4R5HA 4RQTA 4HPWA 1Z0JA 2WJ6A 2O57A 1IZZA 2J7KA 3DGFC 3OI7A 4FYVA 5BQPA 1KY4A 5KDLA 1L8QA 3ABZA 2VK8A 4EBFA 2JBHA 3HEAA 3CVWA 3WNBA 5BPFA 2IH4A 3S8YA 2ODNA 1LLUA 1T3TA 3T3EA 4ZYWA 2G1AA 3SQDA 4J6FA 7ABPA 1K97A 4OYLA 3KCQA 4LGYA 1NHGA 1D2EA 2BP7B 2GM4A 5I4BA 5A2GA 2NO7A 4GX2A 5KKAA 5BUZA 3PX2A 5DZSA 3RLFA 2ZR0A 4IO1A 1OI2A 2EFJA 3G79A 4G0OA 2CLDX 1OFUA 2Y1GA 4ENQA 1OCEA 1H5NA 1QO9A 1TCVA 2CNWD 2RHMA 2VF5X 3LUBA 2HCBA 3FI9A 3NPAA 5AXDA 4MUEA 3T3NA 4BX8A 2P3QA 1VHLA 3A6ZA 5DFAA 4XOUA 1T35A 1IJBA 3DWEX 1BFDA 3GYBA 4N3CA 2E4YA 3AR8A 5DNVA 3X0DA 5BWCA 1Y4DE 1K8QA 3KOYA 2Q0QA 2SNIE 4Y0NA 1ZA2A 2VAMA 3RC1A 3DBLB 1JIUA 1M76A 4HT3B 4NMLA 3TPZA 3H99A 2QJRA 1U1FA 1T3SA 3OTWA 4RFSA 2G9UA 3BFXA 1ZJZA 3D8UA 3BE5A 3Q11A 3NC4A 4Y6SA 2WM8A 1RQ7A 1FXWA 2OYCA 2AA3A 1J9EA 3CSSA 3WL3A 2QRPA 4HGPA 1GKLA 3INYA 4WQMA 4IZIA 2N47A 4OUKX 5C0OE 4DZTA 3T1YB 2O5EA 1HETA 5BUCA 5TQ0B 2IYTA 1RHJA 4B3TB 2HK9A 2H9IA 3M81A 3WZ2A 2Z56A 3WOHA 2ZIVB 4DCJA 4YLEA 1FTNA 5FOWA 2UZ0A 2OC9A 2ZCVA 5EKSA 1X8XA 4NBWA 5LQSA 5M29A 1GZDA 3QF4A 1R4MA 1AA9A 3UA3A 2QJOA 3CLSC 3ESQA 1UBJS 4URYR 3NHLA 4W63A 5HFAA 4GWGA 1N1DA 1NDUA 1T5DX 4G81A 5T4FA 2G8NA 1N6LA 2QAJA 2HRRA 1JRLA 4K86A 4DCUA 5A9RA 1H5UA 3VVCA 2WUGA 5LZ9A 4ZO9A 1VIDA 2HBYA 5KJFA 1FFHA 3TN7A 4F7DA 1GFIA 3O8RA 2VVTA 1EVZA 3DEYX 4CEHB 5HF8A 3HI4A 1LLFA 3PHIA 1OV6A 1W2HA 4W8HA 1QLHA 3FNBA 3Q87B 1K6XA 2NLOA 4N6GA 2X22A 1LXCA 2W2KA 3PNPA 4GS5A 1G5FA 1X7ZA 2GPYA 3AUYA 1QF7A 4V2IA 5EC8A 3VO1A 3VVBA 3VZCA 3W79A 4Z7OB 3JZAA 5F3DA 1LK7A 4C0HA 1VMEA 3IOYA 3U3JA 4AWXA 2Q2WA 4EYGA 3LCRA 3RODA 1E1RA 5CR9A 4OBWA 3C1OA 4E1AA 2HBQA 1ISGA 3LJKA 4YCSA 1BNCA 1RU3A 4FZRA 1BDJA 4F3YA 4A10A 2XB2A 3EEBA 4WUTA 1NUQA 3TEJA 4F56A 3GFPA 4J75A 1OQAA 4L9SA 4BQQA 2AVDA 5IPFA 1DU4A 4QWWA 1E9AA 4X1YA 3VH4A 5B30A 3HUTA 1CY0A 4LSMA 1UXHA 2EGHA 1Z4PX 1U3CA 2IV3A 4EHIA 2NTYC 1XTTA 2QQEA 3TQHA 3CB2A 4FZ3A 3X1JA 2A4MA 4K7JA 1RBYA 4UJ5A 3V2IA 4ES6A 3NBYC 1H4QA 3C1TA 2C7OA 3HV2A 5CNMA 1NG9A 3O75A 3UK6A 1XDBA 4CT5A 1T5TA 2NVUA 2RAPA 3OLZA 2H1FA 2JLQA 4JC0A 5EFOA 3VPXA 2Q4DA 5KYKA 1A97A 2C2ZA 1MVNA 1CK4A 1D4ZA 2ZITA 2GM3A 3BTOA 1EX1A 3NORA 2GQ0A 2YFYA 3EVAA 1R8QA 1X13A 3OX2A 3TNLA 4IHJF 4BJ5A 3DE7X 2H1IA 3A1UA 1EA5A 1RKUA 5LNK6 1L5KA 1BAPA 1JLRA 1AZLA 3K8ZA 1ORRA 1YBAA 3LW7A 3SXPA 4IXMA 4N12A 2M32A 2YASA 5EWLB 3ACCA 1D0IA 4D4GA 1KJWA 3P2OA 2OFFA 3VAZA 2QP3A 2JIBA 4QVGA 1IHDA 3DOHA 4WKPA 3T7RA 2Y71A 4BVKA 4M60A 4A0SA 4QAQA 1CQJB 1UDBA 3GLVA 1XP8A 3HFSA 2F6RA 3EXEA 5AH0A 3VDQA 3VJRA 3AHIA 3BCRA 5SYAA 1VI5A 3S29A 3AP2A 2M6SA 1SXJE 4EGQA 1NWHA 4P58A 5F51A 2QZ9A 2XGGA 4L5IA 4WJZA 3L1HA 1JXMA 4YMHA 2UXBB 1EXNA 4IQ4A 1LPSA 3EF3A 2I2AA 4R1OA 5KVQA 3FHJA 3HNOA 2EFHB 3NJ8A 3KXKA 3C1UA 1E69A 3E9CA 4DQDA 1D6JA 3N75A 3K0EA 4JQZA 3ZOKA 4GGMX 2ZM5A 3PE3A 3DKKA 2QE7D 3MTEA 2FZ5A 3NC1C 4JZKA 4WCFB 1A5SB 3E9QA 5EWJA 3LCCA 1BGWA 2X7HA 4G1FA 4HZGA 4ZT4A 3RT1A 3TMKA 1W6UA 2DBZA 4JY7A 1OT3A 3REFA 3M3DA 4B71A 4OHOA 3TZBA 2PBRA 1NVMB 4NK4A 4BQRA 1IZ7A 3V7UA 3CXRA 4G5FA 1GVNB 1CUXA 1ZZGA 1OU0A 1G0OA 4QUGA 4MKIA 1THTA 2B1QA 1WZEA 2J9XB 1GILA 5AMXA 1ZD9A 3WLIA 1YRYE 4YT4A 3O03A 4X62B 3O3MB 2VJCA 1U7TA 3TVTA 1MA3A 1CYEA 1LFDB 2GN4A 4POOA 5FLYA 3D7MA 3DEZA 1HGXA 2C3OA 4LF4B 4M7RA 1LPOA 2NSYA 4N0MA 4D9BA 1Y7IA 2J6CA 3IESA 4YS6A 3ZC3A 1QE0A 4RD2A 1RM3A 2I62A 1H0SA 3PWZA 1DKRA 1ZKMA 4I3FA 4J9VA 5DEOA 3ZDRA 5TGZA 4TPKA 2QLLA 4P5PA 4BQOA 4WCFA 3WHLA 1IXYA 4HQRA 1L8AA 2QUAA 3V46A 1LVGA 1BKYA 3SHQA 2H4ZA 2GAAA 3RO7A 3QE0A 4Z3DA 4D0SA 3HYLA 3WZMA 3SEFA 3OT1A 3ZVNA 4BMVA 3P52A 2PM8A 2GYUA 3WGQA 4XB2A 4ZAYA 3EFBA 1U1GA 1T8RA 1DT5A 2W83A 4HK4A 3ZWPA 5JZVA 1YQ9A 4Q9NA 4PM4A 4TXHA 2WSSD 4DJFC 2MYNA 5GAJA 2R6CA 2R8PA 3P96A 4HYEA 2GD2A 4FVTA 4AIRA 1U04A 3LIPA 1R6AA 1AZWA 1M74A 3M8KA 2RIRA 3N6XA 4QUEA 1BXZA 3O2JA 4TVBA 2IJGX 3BXGA 3WGMA 1ENPA 1NQ5A 3INNA 4B4WA 4K6CA 5ELLA 1O54A 5EWLA 3HXPA 1NXXA 3K1TA 3LX6A 4MRPA 2OV8A 2WTNA 3NRCA 3PDIB 2AT1A 2B8WA 3ZE1B 1RIIA 3W5AA 3U1TA 2JHAA 5AJZA 1BMFA 4A0GA 3AHEA 3E03A 3W2HA 4YIKA 2CB9A 2ZAMA 5TS2A 1PFVA 4H9GA 3RNLA 4D2IA 1IPFA 1LPPA 1GITA 2DPLA 1OWLA 2AYZA 2IYZA 2QTCA 2VP6A 3I9NA 3N07A 1FP1D 1GEGA 1W9MA 2WYIA 2VJMB 1JDTA 3PVCA 2ZBQA 4R2XA 5CU7A 1A1VA 5AUNB 3LT1A 2AYXA 4B2PA 1OGJA 3BB1A 3D64A 5KYWB 4W5RA 2QN6A 2O8FB 1SGWA 4NJOA 1WV0A 4EIWA 3EPHA 2XKKA 4YJGA 2O7QA 3NOQA 4NU5A 3A1DA 2KLHA 2O2DA 1VCHA 2V7BA 1YNSA 2ZT6A 4JLJA 4L4UA 3K70C 4GKKB 1D7AA 4X8OA 1QH9A 5I51A 3NBAA 5IDWA 2R4UA 3LT0A 3HG7A 3SF0A 4D6YA 3IH5A 3L01A 4O4LB 2WA2A 4XWGA 3C5CA 1E4EA 4PLTA 3LBIA 3GFVA 2IQ5A 2M6RA 4GBMA 2YVQA 2D74A 3E7DA 4JVNA 3LRPA 4Y2RA 2A9JA 3R9KA 4MHTA 1N2JA 3E0QA 1RXSA 1Y34E 2VXYA 3GXOA 1E2FA 4RD1A 2P2LA 4WPGA 3IPYA 3PB3A 4GXQA 1Y33E 2CMKA 3D43A 5CA0B 2AXNA 3HO1A 1PS9A 1S5PA 3D4PA 3FMPB 3R6GA 1TCUA 5B3AA 4ZMBA 2IW3A 1K8RA 4B3JA 2W6OA 1MVLA 4TKLA 3R77A 1NZFA 2PX0A 5F7OA 3AUSA 1U6KA 2CWWA 2M1XA 3H3FA 4L08A 4W5HA 1FX0B 1P1FA 5C4IA 4BEJA 2PMBA 3HR8A 2HREA 3CPJB 4J7XA 4M99A 2HBZA 1BSVA 1OUMA 1NASA 2C1ZA 4ZIRB 2MINB 1YZGA 3A9VA 3D02A 2ZIGA 1Q15A 2PGLA 1GLVA 3F5DA 3IR6A 3NRBA 1SZDA 3T3MB 3QHPA 3UJPA 4HS9A 2ARKA 1DPGA 1HZZC 4K88A 2A92A 5EP4A 3F6PA 4Z8XA 3KXLA 2JCVA 3V9PA 1C0PA 1CFJA 1ZUNB 2ZWVA 4KAJA 4K9MA 1W25A 1J0XO 2JK0A 4Q01A 1CEEA 1GT6A 1L7AA 2CLIB 4O4IA 1PWHA 4KX5A 2P78A 4KBYA 1CZKA 3T38A 5EZYF 2AG6A 2QQ0A 1Z13A 5KSZA 3DVLA 4R16A 1DC8A 3DXZA 4FGKA 1MB4A 1J23A 2C7VA 3VKUA 1BOOA 1D09A 2RC6<