4PQYA

Mycobacterium tuberculosis reca glycerol bound low temperature structure iic-n4
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
328
structure length
316
Chain Sequence
TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 97
structure length 316
sequence length 328
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4pqyA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4pqyA01
1ESMA 2X77A 3AP3A 4HAXA 2F3RA 4Q4LA 5A4JA 3DOEA 3FVQA 3NH6A 4GDFA 1F6BA 2IC5A 4TLCA 4DDWA 3ZVMA 3PEWA 2RCNA 2Q3FA 3EWAA 1ZM4A 2F1HA 3VQTA 1SXJD 4Z54A 3DMNA 2V55B 2YC2C 3QBVA 5HKKA 3BBPA 4DCUA 4TLDA 1ANKA 3B7GA 4JT2A 1GM5A 1K8RA 3WRYC 1E2DA 2VF8A 1RIFA 4XH9B 3TJZA 1Z6GA 5J4YA 3BD9A 4HAVA 4JSTA 2REXB 5FL7D 3FKSD 2KE5A 4V0LA 3ZIAA 2ZU0C 1ZD1A 4A2QA 1KZ7B 1YKSA 1W5SA 4WXRA 2Q9CA 4LRWA 2EFEB 1W4BA 2QPOA 1IXSB 1FL9A 2W6ID 4AYTA 4RZ3A 4AY2A 2GVZC 3NEYA 3IO5A 2REOA 4TMKA 1N5LA 3A1WA 4Z8XA 5L3RA 1Q1ZA 3RS0A 4R98A 1ZD9A 3KUDA 4ZKDA 1E4VA 1JECA 2J5XA 2X2EA 3MRSA 2D06A 2FA9A 2ZRMA 1W5TA 2EQBA 4Q4JB 3SBEA 4FMBB 5JZVA 4C0QC 2Z6VA 2A5FA 4TMTA 5JWOA 2G6BA 2QUZA 4P31A 3NTUA 1W2GA 4F4JA 4KCGA 4S35A 1NY6A 5JECA 1T3SA 1VECA 4OJQA 1OXXK 3I73A 1XD9A 3MWKA 3GJ8A 2VQSA 4QM7A 1G6HA 3VX3A 1KHTA 3A1VA 3GFOA 4IEIA 3UG6A 4ARZA 3Q5EA 3C16C 2PT7A 4X8HA 3GLGA 1ZD8A 2MSCB 2CJWB 3ZD7A 4WVFA 1I4TD 2J9RA 1SXJB 1IJFA 1DS6A 4KITB 3REGA 2HT6A 2XJ4A 1TAGA 3GJXC 2O8BB 1TQ2A 4BLRA 2C78A 4DEXA 1S3SA 1ZM3A 4E5UA 4LJAA 1RJ9A 2YZ2A 1LV7A 3VR4A 1S1MA 1R0XA 4L8GA 3AVYA 5IT5A 1S8FA 3E2IA 4IVRA 5CIWA 3LD9A 4G5GA 3CRQA 1UKEA 2J45A 1E79D 2X19A 4JZKA 1EESA 1KSJA 2ZJBA 2ODWA 2QQEA 3OZXA 5IK2D 3K9NA 4HUQA 2QM7A 2RGNC 4Q7MB 3TAHA 1E4YA 2W2VA 1G8FA 3AB3A 2XTNA 3K09C 1IHUA 4V0NA 4RD6A 3RWOA 3IEVA 2OCAA 5F3WB 3ZLJA 3X1YA 5JWRA 2R6CA 3R8CA 1E0JA 4PZZA 2OLJA 2VRWA 1FNMA 2BCJQ 2IT1A 2A78A 4MKFA 2XZLA 3FPAA 2FJUA 4K81B 4RD2A 1LFDB 3GCGA 3SYKA 1Q22A 2YWHA 521PA 1ZW6A 4QGGA 4LJ9A 4D0GA 3IHLA 3N2IA 1S9DA 1BKDR 1X8LA 3BB4A 4HSEA 3T15A 1BO6A 2JJ2D 2LCFA 3GFPA 4GT1A 1JXMA 3IILA 4Q7LA 2ZUCA 4BGDA 4LHWA 5BYKA 3CH4B 3LXRA 1EX6A 3LAWA 1RYFA 3OIYA 4D6PA 5AUPB 1P62B 4A0GA 3KTAA 4XD7D 3BB3A 3LBHA 4URWR 3BIFA 4LYFA 2P5SA 3C15C 2QPAA 1ZIOA 1Z6YA 3CW2A 4Q4HA 4BUJA 4L15A 4AG5A 1E96A 2GTPA 1OXSC 3DZDA 4B2IA 1W0JD 4PO1A 1KK2A 4GMDA 3JVVA 2DBYA 5DYIA 1I4DD 3PENA 1OYYA 3ICQB 5J4KA 2VHJA 3ZH9B 5FBQB 4P0TA 4OI1A 1FNNA 1NG9A 1OW3B 4ARZB 2RGBA 1KNXA 1P7CA 1J8MF 1J99A 4YXWA 1CRQA 1FPMA 1CS4C 4KHZA 3GLGB 1TU4A 4BLQA 1V43A 4JS0A 3L2OB 2VYFA 5DISB 3RS5A 4B47A 2ZR9A 1IN4A 4C4PA 4N1AA 5HR5A 5KSOA 1JALA 3NDBB 4DLWA 1E2MA 1RJ9B 2NG1A 1IY1A 3PUYA 2OG2A 2WOOA 3R9WA 3AF0A 3H86A 1QRAA 1KJWA 4HZUA 4YXWD 1T6NA 4JLMA 1DVRA 2GILA 2G0NA 1TUEA 2N46A 1YHNA 2ZEJA 1N6HA 1T0JB 1JB1A 1JI0A 3B1ZA 3AKCA 4HLQB 1XMVA 3IKJA 1GDDA 4CF7A 3CLVA 3DDCA 1FFHA 1ZU4A 3I8SA 1Q20A 3KXLA 4FIDA 3CRW1 3WBJA 3KKOA 4QJ5A 4HUQB 5E95A 3TK1A 1MO5A 4ZKEA 3T5GA 4QHTA 1G64A 1YQTA 2J87A 1KY3A 3KXKA 4URZR 2CCKA 3VR5A 3KDSE 4DT1A 1E32A 4C9BA 1B23P 2V3CC 2WKPA 1OT3A 1JAHA 2ODBA 2PH1A 2Q9AA 2WMNB 4JLVA 2G3YA 3O8RA 4PO8A 3EA0A 2XITA 4MITA 4K8OA 1MV5A 3UXMA 1HA3A 4NCNA 1QHHA 4DSOA 5FBVB 3WP0A 2IF0A 5FPYA 4UNSA 3VX4A 3W3ZB 4TYWA 4A4DA 1KI9A 5GJBA 1G19A 1EFHA 1VCOA 1W4RA 2F1IA 2C5LA 1TF7A 3KKMA 4OK5A 2VP9A 3ZJYA 3RS4A 3X1WA 2PZEA 3KTAB 1BIFA 1N2CE 1NBMA 2H5EA 4IFEA 1QHNA 4TQAA 4C0JA 5DI9A 4Q4HB 1KO5A 3NIBA 2PX0A 3BH6A 4TL9A 2BM1A 1IONA 4D81A 1X8JA 4UXIA 3W8NA 1RKBA 1YZGA 2FF7A 3QKTA 5CM8B 4DUGA 5JHHB 4TLEA 1NBMD 2ZYWX 1XEFA 1UFQA 1VMAA 1JPJA 2ZJYA 4AK9A 5JWHA 3BFXA 2WWXA 3TQFA 5GVRA 4AD8A 4G5QA 4C0SA 3UPUA 4DLSA 1AGPA 3B8HA 5FTNA 1OV4A 2V1XA 4EPXA 1E9BA 1U8AA 1KO1A 2ZJ5A 1XPRA 4M1SA 2WM9B 5D3QA 3I8XA 4P4SA 4HZUB 1XCGB 3T12A 3LVRE 1TADA 1RZ3A 2HF9A 1G5PA 3A1SA 2OXCA 1NKTA 1UEIA 2IYVA 1TF2A 4QBGB 3THOA 3WMEA 5DLQC 3SC3A 4PPNA 5CLLA 1FOEB 2GA8A 4DLTA 3KQUA 4GSYA 4KBFA 3KKPA 1R10A 3KUCA 1AA3A 5FOXA 1WBBA 2WJYA 1MO4A 4PPFA 4OI4A 4DLRA 4DT1B 4JLAA 4M9ZA 4B3BA 4QGFA 1Z5ZA 4PAQA 1OH8A 1E2FA 1MOZA 3L0IB 3M6AA 4RCYA 1Q21A 1QG2A 2VLIA 4P33A 5G3YA 3B13B 3MG9A 1QHHB 5TB5A 4QBIA 3WYFA 3U3JA 1RE0A 1F2TA 4I1UA 3UMRA 3GLIE 1G3MA 3EZ2A 2HXYA 3HU2A 4BEJA 1A2BA 3EXAA 1KDRA 4N0EA 1XJQA 8OHMA 1HEIA 1RRPA 3CRMA 3RC8A 1NP6A 2EWWA 3CX6A 4QHYA 2OZEA 1LNZA 3QVUA 5FTJA 4HLCA 4Q19A 1G9XA 3KKQA 4Z8YA 1ONBA 1ZNXA 1YZNA 2IUTA 5E7IA 2VTKA 3RRMA 4FN5A 2EFCB 3H2YA 4FWIB 3AEZA 4JVMA 1U0JA 3ZVNA 4RZ2A 3B1VA 3PV0A 1CBUA 4WXPA 2Q3HA 1NVWQ 4ILEA 3IO3A 2ZE6A 4B2LA 1RRFA 3QY0A 2IXGA 4IOJA 4FW9A 1GNRA 4EKDA 3NC1C 4TT3A 2VHUA 3AV0B 3AVWA 1S4QA 2QSYA 4IXNA 2GEUA 3PUXA 3FMPB 4ESHA 4DB4A 1ZNZA 5FI0B 4Q9LA 1X86B 4L5BA 4P4SB 4PANA 5J4LA 2QMUA 3K70D 2HCJB 5HCIA 3WHLA 1O3YA 2BV3A 2CLSA 1UBEA 4GOKA 1WP9A 3DHWC 4WZBE 1D2MA 3GEEA 3L0SA 3DO6A 1TF5A 2CMKA 3QKRA 1SVIA 2NO9A 4MRNA 3GFTA 1AKEA 1P2SA 1DTSA 1UDXA 3CRVA 2FZLA 2WAXA 4LHXA 2L0XA 3I4LA 4DB2A 2O8DA 2YYZA 5BYJA 5JJKA 3H0KA 1KSHA 3C41J 3SFZA 1M7BA 4C0HA 1H8EA 3CPJB 1G291 4TMVA 2HUPA 2BDTA 2FOLA 1YVDA 4Q9IA 3EIEA 4QNRA 4Q9HA 2PX3A 4EAQA 2ZRLA 3V4FA 1KAGA 2QAJA 3TLXA 3U6KA 2XTZA 3OAAA 2DR3A 5JCPA 1N5KA 1F2TB 4R71A 2WVJA 5KOYA 3RABA 1XEWY 1R2QA 4NE2A 1L4YA 1S2MA 1YZTA 1H8ED 2R8RA 4XIGS 2DFLA 1X1RA 1F48A 1SHKA 2GF9A 4BLSA 2QMEA 1Z0IA 2RGCA 1N5IA 2REBA 3K0SA 4QG7A 3L0OA 4OQMA 3SE0A 3OE7D 1JAIA 1E1QD 1KMQA 1CJMA 1Z0DA 3DM5A 3OAAD 1NRJB 2A30A 3FGNA 4Q7KA 2FX3A 1G17A 3MCAA 1ZM7A 2BKUA 4RD1A 3K70B 4V0OA 1D9ZA 1LTQA 1N6NA 4ZDKA 4DDTA 2OEPA 2NO1A 3T34A 1LS6A 4IEEA 3C5HA 4TYQA 3EIQA 3TSWA 3AGQA 3TUIC 1Y3AA 3W8RA 3UG7A 3T5DA 3WNCA 5GJCA 2R6DA 1P5ZB 2GK6A 2QORA 2WWYA 4WAUA 1OIWA 1N6LA 2Q3MA 2WIAA 3DZ8A 1GP2A 4UKDA 1RW4A 1DO2A 3AF1A 4O0MA 5E4FA 3CKLA 1QHYA 1G7RA 2EFDB 1A7JA 2QZ4A 4Q47A 2AXNA 5KNBA 5LDDC 1P2VA 1OB2A 1AK2A 1NLFA 1PV4A 3NDPA 2H1LA 3ADDA 3QKRB 1TX4B 2RGNA 1FP6A 2IXFA 2QE7A 3K09A 4OHXA 1NJFA 1XX6A 3F8TA 2W00A 3VU9A 2F9LA 2ZU6A 2CLDX 4ESVA 2YVUA 4B3CA 3NC0C 3UMSA 1NMZA 2O8DB 2HXSA 2GF0A 3AQ4A 3TSOA 4FMDF 3QG5A 4OYHA 1GTVA 1NJGA 2W2XA 2Z83A 1DG3A 1XBTA 3P20A 3DEFA 4O2LA 4WW0A 2CHGA 5FUWA 4PC1A 5E7JA 4HEJA 5AR1A 2GJSA 5DGXA 2I1VB 3LQQA 5KTYA 1KNQA 1NIPA 1G4AE 2CL0X 3I5YA 2D74A 2J46A 3EWSA 4AYWA 4Q02A 2ODEA 5JSZA 2RH5A 3RDPA 1WQ1R 5EUMA 2RAPA 1E1RA 2LWIA 4CEIA 3PFIA 5DO9A 2IEZA 2BMJA 1I2MA 3QVVA 4BFTA 1NIJA 1SVWA 1G3RA 3IDQA 2MMGA 2H8KA 2ECKA 2MSDB 1VG1A 5KNDA 1Z0FA 3SZRA 2GAOA 2ZRKA 1XWIA 3FYHA 3QNUA 3TRFA 2BMEA 2OV2A 5LD2C 1PUIA 1Q57A 1S9HA 2BIFA 4FMCF 5D3MA 2ZI5A 1CEEA 2ANBA 4PR0A 4LBVA 5GJWC 3RHFA 3PVSA 1E9SA 1BYIA 4M4SA 1XXHE 4PZYA 2W0MA 3KJIA 4YMTA 4JLPA 4PO9A 3GLHE 2QGNA 2ZRGA 3A4NA 1YR8A 2JLVA 2HYDA 1DBSA 1TL7C 5ELXA 2SHKA 5CLQA 1A4RA 2VP2A 3GEIA 4JVSB 3M0EA 4Q1AA 5K8LA 3QKUA 3RC3A 1T5LA 4D0LB 3X2SA 2C9YA 4L4UA 2N42A 1P3JA 3BFKA 4QJ4A 2ZRAA 1OHHA 4MA4A 3SJBA 2FH5B 2QI9C 1NN5A 2CVFA 4KYIB 5AJYA 4ZDWA 3WY9A 721PA 4RVCA 2QM8A 5FBLB 2P3SA 5KDOA 3VU9B 4B34A 3IBYA 4DCSA 4KXFB 3LWNA 1G41A 4BFXA 1CJUC 4H1VA 1E3MA 1KI6A 2VEDA 2NPFA 1LF5A 4TYNA 4OQFA 1G8GA 3AF2A 5GJVC 1A5TA 4TWZA 2Z4RA 4MH0R 2AFHE 2BVNA 4B48A 3F5FA 4BFVA 4A6XA 1UKZA 1P9NA 1UAAA 4UXHA 1XD2A 1JNYA 3IUYA 1BYUA 2JASA 5A5GA 1AN0A 2EFGA 4MGYR 1BS1A 2WWFA 2JJ8A 4L9WA 3U7HB 2XOKA 4YMVA 2C9OA 4II7A 5FR1A 5JSZB 1AJEA 2ZSEA 3VHXA 3BK7A 3ZS9A 2F1RA 4CEIB 3CONA 3Q72A 4OK6A 3U60B 4B74A 3CM0A 4OQXA 2WSSA 2O8CA 3RYTC 1GOTA 2AWNA 4LDJA 4DSNA 1GITA 1DELA 2IA5A 2V54A 2B21A 2QMOA 3BRWD 1A2KC 1EFRD 3BH7A 2DHRA 4GPTA 1ZUHA 3AVVA 4A8JC 1R0YA 4IXMA 3CF0A 2XOKD 1G16A 3WHKA 4GOXA 3OIWA 5D3MB 2GNOA 2ZXUA 2P67A 1GSIA 2ZUDA 3B85A 5EE9A 2H57A 2WWHA 2R65A 2FFHA 2QG6A 3ONWA 1ZBDA 3NWJA 3QBTA 5KU1A 2GJ9A 2DWPA 3HPQA 3WBKA 2VL7A 3ZD6A 2GZAA 4OQNA 4W5JA 5AUOB 3T1VA 3BJIC 4DLVA 2QNRA 4TTPA 1S0UA 1OXVA 3UK6A 4DHEA 4CDGA 3PUWA 4MGIR 1OYWA 1WBDA 1PVOA 4JVNA 3AKDA 4TL6A 3LW7A 1XMJA 2DPXA 3QI2A 3D3QA 2AK2A 2J7PA 4RKFA 2O0KA 3LBIA 3NBYC 4C3ZA 1SXJE 5FPTA 5TDHA 4JYCA 3BGWA 4CVNA 5CB6A 3DL0A 1DOAA 5FTKA 4KODA 2BMDA 5FH9A 4B6EA 3PUVA 4Q9KA 3B78A 4KJZA 4DCVA 3IIJA 1YE8A 2OILA 2PLFA 3PIRA 5CDFE 6Q21A 1PJRA 4HYYA 4LJ7A 2J7PD 4DZZA 3KB1A 2JLXA 1KI6B 3GJ0A 5JRZA 2ZJ8A 4KFRA 3KKNA 1NF3A 2OFXA 1N6IA 4XSGA 5HTKA 1NN0A 3V00A 5HKKD 2CNWA 3GJ5A 1U9IC 2ZYUX 1G20E 2AL7A 3P32A 3T1OA 1XD2B 3GJ3A 3LV8A 3ZIAD 1CIPA 3CUEF 1EK0A 2MMCA 5F2EA 3WMGA 2XB2A 2IYRA 2WWGA 2CE2X 3T35A 5G53C 3AP1A 4LYJA 2QBYA 2GEVA 2GZHA 3HYTA 1W1WA 4OL0A 821PA 3CX7A 4BFZA 2GBLC 1NMYA 4KVGA 2O8CB 1II8A 2WSMA 4H9GA 2CNWD 1UDWA 2JLWA 1JR6A 4RJLA 2DYKA 2BMFA 4HB0A 4IOKA 2BBOA 2E87A 4GP6A 5FR2A 3CZPA 3KL4A 2KBEA 2HV8A 4CRWB 1US8A 1R8SA 2QAGC 4KSBA 4RKEA 3GLFE 4JMPA 3UANA 2ZS7A 4HLUC 3EPKA 3LY5A 5KO2A 1VDZA 5TVKA 4BFYA 4D4JA 3LO5A 1G3QA 1EFTA 2OM2A 3EPJA 3FOZA 2W0SA 4GNKA 3U5ZB 3OEEA 3P1JA 1YR7A 4Q01A 2WJIA 2ANCA 2D3WA 3FMOB 1DG1G 1MT0A 2ZS9A 5KSZA 1RRCA 1L4UA 3E1SA 1DAGA 3K0CC 4M1TA 5JS7A 2ZAMA 1MRNA 2IYSA 3SJCA 4HDCA 1R0WA 3TVTA 5KSYA 1NN1A 3I61A 5F9FA 1YR6A 4LWZA 3MLEA 4HB2A 4F4IA 2FEMA 2XTMA 3OIVA 4JJZA 1E2HA 2NTYC 1UBGA 1VPLA 2EYUA 2CL7X 1E2KA 1OKKA 3SYLA 1E6CA 1DAKA 1N25A 2RGXA 1BMFA 4IDHA 4JL5A 2WMOB 3AVUA 2F3TA 2ZTSA 1OFUX 1OH5A 1YJ5A 4D2IA 3A6PC 2IUUA 3B6EA 4DDUA 2X8AA 2ZRDA 3U3OA 4CYMA 1P9WA 4URXR 4IRUB 4AKIA 2B6HA 4PC2A 1W4AA 2ZM5A 4DVGA 4O3MA 2QQ0A 1OKKD 2YINC 1ELOA 1MABA 2RKOA 3LDAA 5EQTA 4DCTA 1BMFD 5GVSA 2KI5A 5FFMA 2OBNA 2R6GA 1ZC4A 1KOFA 2ZSFA 3EG5A 4TLAA 2KBFA 4BFWA 1KMHA 3BORA 2QBYB 4MYUA 4UNNA 2GAAA 5KDLA 1W44A 3RSLA 3QPVA 1UKVY 1RPZA 4EQ6A 4QXAA 2BBWA 1II8B 1NKSA 2OFOA 2HEIA 2AWOA 4MUAA 3X1DA 4C0LA 1R5BA 4E07A 4MDFA 1VG0B 1G4UR 2JATA 5DH9A 1FMJA 1US8B 3MMPA 1M7GA 1EFUA 4Q1DA 4DSTA 1MKYA 5DSZA 1O87A 4NTZA 3UIEA 5JMTA 4IOLA 2GJKA 1T8UA 1RYHA 4GOJA 1C9KA 4KFUA 2VA8A 4LV6A 5L8VA 5FPSA 3MD0A 4MRRA 3ZVLA 2J0UB 2GJ8A 4GI7A 5H1YA 1DEKA 1G8PA 1KI7A 1YRAA 5FOSA 3AKEA 1TTTA 3SQXA 2IK8A 2FG5A 1EWQA 4DSUA 1AQUA 3KQHA 1RRGA 3LVQE 2X2FA 2AX4A 3G82C 2PMDA 4V0KA 1IJEA 4EJSC 1XMSA 4W5HA 4NCIA 5JRJA 3T1TA 1CR2A 5E3HA 1GRRA 5JEDA 1Z22A 4LHYA 3MFYA 4JSYA 5FTMA 1AM4D 2HLDA 2O0JA 2QTFA 5EJEA 2G83A 1J2JA 1XZPA 1K5DA 1KAOA 2JEOA 4JJKA 1ZRHA 3RAPR 2D2EA 4M1WA 121PA 2VIIA 3RVBA 4LYAA 2DFTA 4RD3A 3EARA 4RD0A 3RANA 3K9GA 4HZIA 4NH0A 1IM2A 1G6OA 4TLBA 1QVRA 4PHGA 3QUSA 4MKIA 1VCIA 4H1UA 4MKHA 4PHFA 4F91B 2ZIAA 4M9SA 2HLDD 3CWZA 4LYHA 1QG4A 2BKEA 3AVTA 2CXXA 1CU1A 2ZANA 2P0EA 1U8ZA 2W6JA 4BZXA 1VCMA 1Z0JA 1CRPA 4E03A 1ZP6A 3WMFA 4EPVA 1MABB 5KPDA 2JLSA 2FFQA 2WAYA 4HDOB 2IYZA 2JLUA 3KB2A 4Q18A 5JS8A 4ZCLA 2CL6X 3U4QA 2A3RA 1KMHB 3FB4A 2ZRHA 1TEVA 3I92A 4J0QA 3ZS8A 3I5XA 2IS2A 2R6FA 2BJVA 4YDSA 1G1MA 4XWAA 1E9DA 5BN4A 1OIXA 3DVLA 2P65A 4EQ6B 1VCNA 1XJCA 3A4LA 4A6PA 2IX3A 3U61B 2W6JD 3PXGA 3TVDA 4US2R 1OFIA 4MRVA 4OHVA 4I1SA 4JBWA 3JZMA 1IY0A 3SHWA 2UZ3A 2F6RA 2PZGA 3RNLA 2JLRA 3EC1A 3KQLA 4D82A 4BWYA 5F98A 4L9SA 4A0HA 3CWQA 4PC7A 1N0UA 3ETLA 3LH5A 4LC1A 4LY6A 4LBWA 2B92A 4UQOA 3QSYA 4AG6A 4CGZA 3JZAA 3EZFA 2PZFA 4FI3C 4DUGD 2GCOA 3NBXX 4B3FX 2YOFA 4AKHA 1T8TA 1Q1QA 2FN4A 3A4MA 4EFNA 1SVSA 2IYUA 1Q44A 1KZGB 3MUFA 3L8ZA 3REFA 5H68A 1DAIA 4PPGA 3SEAA 1P2TA 1ZCBA 3LBNA 4C0AC 2YKGA 4B6FA 2OBMA 4Y0VA 3K9HA 5HZKA 1LS1A 1XF9A 2HT1A 5AWFC 3IIKA 4AIIA 1XTJA 4OHZA 4A36A 4QNMA 4XVRA 3VKHA 4L16A 4Q9JA 4PQFA 1OFHA 4JLJA 3QIAA 5JFGA 4E09A 2XAUA 3CNLA 2GXSA 3WYAA 1N0VC 2EU8A 3Q85A 4KSCA 2PBRA 4CT4B 4LBYA 1NN3A 3W6OA 3U6BA 3FHCB 1F60A 5AJXA 4F92B 3GLIA 1YU9A 5SZHB 1KO8A 5CJPA 1E98A 2IWRA 1DADA 2X1VA 4IDPA 4HAUA 4IDQA 3WYGA 1ESNA 5SZIA 1KI2A 2Q6TA 5DHAA 3VR2A 3AVXA 2G88A 3PEVA 4LJ8A 1FW6A 3U4QB 1H65A 2VH5R 4KLZA 4XOIA 2FPKA 1PZNA 1ZM9A 3BH0A 2ORVA 5E7MA 2VF7A 2WKRA 4DLYA 1GNPA 1D9XA 3EIHA 2BHRA 4QHSA 4DC9A 2V1UA 2CEAA 2AD1A 2R44A 4GL2A 4AI6A 3E70C 2A5JA 1OFTA 4ZV4A 3PEUA 2XZPA 4Q48A 1P9RA 2K5UA 2ZJAA 4R2IA 1K5GA 4G5SA 4UNPA 4K46A 2OBLA 4A8JA 4P3YA 5LD2B 1P2UA 1XTRA 1ZU5A 2FSGA 2IHYA 3LFUA 2J0QA 3MJRA 4P4UA 4PSVA 2EFHB 1GAJA 5BN5A 2YOHA 1Z2CA 4MRSA 3Q5DA 4JLKA 1BH2A 5J5CA 1AA9A 1P72A 2FSHA 4B76A 4E22A 3ZDQA 4RZXA 4A0RA 3B9QA 2QROA 2GCOB 1SGWA 4ITRC 5C2JB 3SYNA 2YV5A 1E9EA 3CPHA 2GKSA 1U0HC 2IYLD 4HDQB 3VR6A 3D8BA 1KI1A 221PA 4U02A 4OHYA 1SHZA 4TT3D 5C46F 3ZVRA 4QBFA 4KBGA 4NMMA 1U94A 3AGPA 2Z0MA 3AUYA 3CF6R 5J47A 4RY2A 5EXXA 1R0ZA 2V9PA 4Q1FA 2J41A 2ZI7A 2J0VA 1WA5A 1KK3A 4LV5B 2F1JA 4D26A 5EXPA 1FX0A 2C03A 2KB0A 4Z1MA 2WJVA 5GADl 3P27A 3SNHA 2F55A 1VHLA 3MWJA 2C99A 4M53A 1T3HA 4A0FA 1KKMA 5EP1A 5LPNA 3THXA 2AKAB 2P6UA 5TMPA 5FPKA 1V5WA 1M1YE 1Z8FA 4TMXA 3VR3A 4OJKA 1CF4A 4ZI3A 5J4VA 4GMXA 2P2LA 1U9IA 2OCPA 2GZDA 4ZCMA 2YWEA 4OHWA 3GLIB 2HF8A 4HB4A 4CEHA 4ABYA 3B5JA 5TXGA 1J70A 1N6RA 4LUCA 4LSGA 3PEYA 2ZVPX 1JEDA 1SVKA 4EFMA 3B1YA 3NXSA 2W2TA 3NH9A 1EFCA 4NYJQ 2JLYA 3S1AA 2GBLA 1CR1A 1E2JA 1HURA 1QBKC 5FUYA 5JBQA 4IDOA 2B8WA 2XZOA 1C1YA 5JCZA 4QKQA 3AP2A 2YOGA 1KI3A 2OXRA 1P73A 2QAGA 5EE3A 4A8JB 3KZ1E 2ZSAA 5H70A 1HQCA 3CNOA 4HLUA 4MYTA 1CXZA 5DHFA 2CK3A 3IPYA 4MYCA 1N0WA 1YZLA 3B82A 4MYHA 3T1QA 1E9CA 3BFVA 4KYUA 3VR1A 2IUSA 3IBGA 4FCVA 3RLFA 4W7SA 4KAXA 2DWOA 4MUBA 5TY0A 2D7DA 2RB4A 3WXMA 2KSQA 4NL4H 2NIPA 2GJAA 2V6IA 3CNNA 3VMFA 3W5IA 2WJGA 2XNSA 3ASZA 1UBFA 3BXZA 1ZINA 3FKQA 5EP3A 1I2DA 3K0CA 3K8YA 2VSXA 2VHTA 2ZREA 3EW9A 3VKWA 2Y8EA 2GDJA 2YHSA 3CRRA 2GK7A 1HV8A 3X1XA 1KI4A 1U90A 4WBSA 1CULC 4PAMA 2UKDA 1P61B 2QTHA 3QXJA 3GP8A 2A5YB 4GZMA 1HE8B 2OHFA 1DAEA 2PMKA 1FX0B 5HCNA 4KFTA 2ZJZA 1E0SA 2D7CA 2H17A 3GMTA 1MRSA 1OF1A 2NZJA 5C4GB 1TPZA 2J7KA 3C8UA 4CT5A 3THXB 2GCPA 3GQBA 5B57C 1COWA 2JAQA 2OCBA 3PG5A 1XP8A 1G8HA 4XSHA 1NMXA 2QE7D 2IW3A 4PQYA 1N6PA 4JYBA 1W4CA 1XU4A 3QG1A 4ON9A 3R9IA 2QRNA 3A8TA 1RFLA 2ATXA 4FMDB 1AZSC 4PTLA 4D4LA 1GWNA 4CEHB 1G7SA 2VPPA 4YMWA 1CR4A 4US0R 1E9RA 4M9QA 1DO0A 4NCHA 5KNCA 1VG8A 1U81A 1S96A 2IXEA 2RGGA 1YZKA 3OF5A 4PXAA 1UBCA 2NO0A 5KYKA 1CJVC 1COWD 4N0DA 1GRNA 1PUJA 3S1AB 1D6JA 621PA 4OI0A 1XTIA 2ZETA 3TW4A 5AJVB 4RZUA 4I81A 4IW3B 2IWHA 2YC4C 5JJLA 2J59A 4JLNA 1ZIPA 3FHTA 3NVAA 1NSFA 5DYGA 1GIAA 2JJ1A 1W2HA 5DE3A 4Z51A 3CIOA 4PSAA 3MWLA 4HLDA 4TZ0A 4LPKA 1CLUA 2QAGB 2O52A 3SS8A 1TUIA 4BE7B 3ADCA 3THWA 1EXMA 1E1RD 1SKYE 1D8TA 4IFBA 2QA5A 2IL1A 1VHTA 4WZAE 1E2EA 5C1BA 1Z0AA 1XTSA 4YDHB 5CYOA 3VHLB 5FTLA 2C04A 4TQ9A 5C18A 1AGRA 1FP7A 1NSTA 3O47A 4NKRA 4AKGA 4PZLA 5BXQC 4FMCB 4FCTA 4YONB 1Z83A 1OH7A 3VNVA 1II0A 3L82B 5FOWA 4EPYA 1SKQA 5KDDA 1ZVQA 2RGEA 4PSKA 1N6KA 4JVLA 4Q00A 4X8MA 2G9NA 2DB3A 3FDIA 1R6BX 4PPQA 3V9PA 4EJSA 3M4YA 1M74A 4A9AA 1W48A 3QF4A 3BWDD 4URYR 4V0ME 3V4RA 1Q1EA 5JI2E 4ACAA 4QBHA 3HWSA 4TL8A 3TUZC 3Q9LA 5B64A 5JHGB 4G01B 3C7KA 1AS0A 5FI1B 4HAWA 4Q03A 1W47A 1QDEA 1KK1A 2ZRJA 2C2HA 1SVOA 1OHHD 2FSFA 4LJ5A 3UWKA 3U2QA 3CF2A 1G8YA 1GG2A 1VIAA 5FOVA 5SZKB 4XWKA 4JLBA 2A5DA 4BECA 5G40A 1JR3A 2FV8A 2NO7A 3PCRB 2ZAOA 3L0PA 3MSXA 4ACBA 2F43A 4DIDA 3RS7A 4EDHA 3B2EA 1X6VA 2CLCX 4R2HA 2OUKA 2WZQA 3K0AA 5A0FA 1Z0KA 2ZE5A 5B58C 4B3GA 4LJ6A 5EZ6B 5FUXA 1KIMA 4QC2A 4ASUA 1II9A 3LRPA 2C77A 3H1TA 3HDTA 4NP6A 5IHPA 2AHOA 1IXRC 2BM0A 3EPHA 1SQ5A 4FD2A 2W58A 1KI8A 2ZS8A 4BPBA 4NDZA 1FQKA 4QOSA 1JR3D 4TTRA 4LCBA 1CKEA 2N1BA 2JIZA 3L43A 1XPOA 1M8PA 4JKIA 4NYJR 5C4MA 2V4ZA 4M1OA 1HQYE 1QHSA 1F5NA 2ZYVX 1E2NA 4ASUD 3QQ5A 2FWRA 4B35A 4RFSA 2ZRCA 1PLLA 1E0AA 4NYIR 2QTVB 1L8QA 1Q3HA 3THWB 2HDNB 4DCNA 3Q7QA 5B2ZA 1KO4A 3FE2A 4U5XA 5FOUA 2B7BA 2WSSD 4NHOA 2PLRA 4UXJA 2V7QA 1MO3A 4C0BA 1R7RA 4LJYA 2CHVA 2FE4A 3GJ4A 2JIZD 4XVQA 1HY3A 1ZM2A 2B8TA 1Z47A 1GFIA 1Z6TA 3DKVA 3LX8A 1WB9A 1Q12A 3VTKA 1UKYA 3K9LA 2DCUA 1D2NA 1A82A 2XNDA 1VG9B 3SFVA 2FNAA 4EJSB 4O2RA 1IN7A 2QEQA 2CCGA 3FWYA 3QF4B 5AJWA 1OB5A 2NMVA 2PEYA 5EE1A 3ASYA 1FZQA 1Z08A 2ORIA 4HAZA 1B0UA 3VAAA 2W83A 1HT2E 3ZYCA 5FOTA 1GNQA 1HE1C 3FKSA 5FL7A 1G18A 2ZI3A 3T61A 5CDFA 3OIUA 4PC6A 4BZPA 4QGHA 2XNDD 4M0LA 5HPYB 2Z5FA 2W6IA 3QXHA 4Q7JB 2GWHA 3G0HA 4AYXA 4RCZA 1OSNA 1S1CA 1Z6XA 2NOAA 3ZZTA 2ZVQX 2I3BA 5CYPA 4D80A 1G3IA 2F43B 1TMKA 3SJZA 3EZ9A 1U0LA 2ZYTX 3K0AB 2JDIA 3OESA 2OLKA 1XEWX 2IEYA 4DLZA 4LX0A 1KDTA 2FZ4A 1X3SA 4NPHA 2D2FA 4YLGA 1HTWA 3HPRA 3MWYW 5EP4A 2YWFA 1W36C 1CR0A 5CK4A 3HYRA 3LQRA 3KQKA 2MSEB 4IOMA 1OH6A 2OT3B 3X1ZA 4M8NE 2WJHA 1JJ7A 3AVOA 3NHAA 5ANRB 5G3ZA 3IQXA 2FPLA 1ZC3A 2JDID 1OXTA 3WRXC 4IDNA 2HJGA 3GLFA 5EE0A 3SQWA 1XDBA 5DIFA 1MR3F 3N2EA 4RFSB 1KTVA 3DMDA 1W49A 2R62A 4TN1A 4YC7A 1OXUA 1IN6A 4M9XA 4LV8B 1VYTA 4Q4AA 1LVGA 4FCWA 5JEEA 1FUUA 3ND8A 1EX7A 3WP1B 3EPLA 2J0UA 3TNFA 1JEEA 5L3SA 1XNJA 1XPUA 1G3UA 2A5GA 4TSFA 1U99A 4NCJA 2ZI4A 3D31A 3TAUA 2VO1A 4A2WA 3F3YA 1E2QA 2ONKA 4DLUA 5KSPA 2H92A 3UMFA 2FFAA 4PX9A 2ONJA 1W0KA 3G5UA 3SHFA 3LLMA 1TEXA 3GLGE 3Q8XB 1IN5A 4US1R 1E79A 1W46A 1LW7A 4BRUA 3ICEA 4U7DA 5CJ2A 1TQ4A 4G5RA 2BBSA 4GFDA 2AK3A 3AF4A 3OEED 3H4MA 5IK2A 4CEJA 2HJVA 1J8YF 3TMKA 1Z6AA 4TSFD 2IHBA 2XX3A 1E2GA 4UNQA 2EW1A 4KI0A 1W0KD 4BLOA 2C98A 4XVUA 5DI3A 5AUNB 3D7MA 1GKYA 3EA5A 2KJQA 4IVQA 2AXPA 3IQWA 2G1KA 4UJ5A 5BQ5A 4P32A 3W3AA 2JLQA 2XSZA 4DBLC 2XGJA 5KPJA 2JJ2A 4MKGA 2QPTA 4EFLA 2IBMA 1DARA 3CPEA 4DIEA 3UWOA 1G5TA 3CB4A 3FFAA 3TR0A 4XD7A 1R5NA 2JGNA 1YZQA 1N6OA 5K8TA 2H18A 1WCV1 5IRCD 3K0EA 3L8YA 2V8OA 3PITA 4CIDA 4XTCS 2Q21A 1Z63A 1G21E 2XSZD 1W0JA 2QN6A 1OJLA 3EASA 3HU3A 2JA1A 2GESA 2PCJA 3I3SR 3QF7A 2WKQA 1OE0A 4JBXA 2IYQA 3GLFB 1DE0A 2P5TB 4KO8A 4BRWA 3BOSA 4ZCIA 2C9CA 2IF2A 1E0KA 1IAQA 3U3MA 3D6TB 3SN6A 2ODNA 1ZCAA 3E5HA 3AF3A 4Q4AB 2A9KA 2QSZA 3F0TA 4C0KA 4B2PA 3R9XA 3AM1A 4ZPXA 2O0HA 4LZZA 2A2ZA 5L3SB 1YR9A 2FMXA 3NG1A 1U2RA 2VSFA 4LPSA 4KVAA 1GKIA 3EZ6A 2GXUA 3DPUA 2QT1A 2RMKA 4KFSA 3J81k 5DN6A 4QJ3A 4WOPA 4EIWA 3FHOA 5LBIA 2FDCA 1IOZA 1KSFX 4RD4A 4BLPA 1EWRA 1G5RA 1AS3A 3RS3A 1E9FA 4EPRA 4O25A 3GD7A 2BC9A 2PJZA 3W34A 4B3XA 3R7WA 2J3EA 4CEJB 4F4CA 2IS1A 1NVVR 4MDEA 3A36A 4B71A 2ZI6A 1IN8A 1AQYA 4WIAA 1ZUNB 1XTQA 4IJMA 4TL7A 4B75A 3EC2A 5IDVA 5CITA 4MGZR 5DN6D 2Z4SA 1VIYA 3R8FA 5DI3B 5K8IA 2GHIA 3I62A 2I4IA 1N3BA 1NI3A 1E99A 2RHDA 1JPNA 5EUQB 4F7WA 4DDVA 1QVAA 5EE5B 2OE2A 1J7KA 1GUAA 1X8KA 2ZJ2A 1G7CA 3B1WA 4G1UC 3O8DA 2IS4A 2EYQA 3ND9A 3QE0A 1KDOA 4A2PA 1UEJA 1VKJA 4NYMQ 2TMKA 1A1VA 1N5JA 4BQSA 3A1TA 4ZI2A 4B33A 3ZZUA 5CK5A 4HAYA 4C30A 1JQJC 3P4YA 3HR8A 2OAQ1 4ZIRA 1IXZA 1FTNA 3LXXA 2QGZA 3W6PA 3IIMA 3KQNA 3T06B 1YZUA 3BC1A 5CIQA 3TR5A 4B44A 2R6AA 3W5JA 5TARA 1U8YA 1ZUIA 2EWVA 1WE2A 2JCSA 4M21A 4G5OA 3TGPA 1P4SA 5P21A 2QL6A 1UPTA 5K8UA 4CW7A 1NBME 1EG7A 4KU4A 3GJ6A 1KJYA 4MRPA 5EXSA 4TYYA 2D62A 2YWGA 4D4MA 2H16A 1ZAKA 2ZSBA 4M22A 3VKGA 3FMFA 1Q1BA 1LB1B 3UKDA 4OKSA 2QENA 1XZQA 2PCLA 5AK0A 3QEOA 1T3LA 2O8EA 4ZO4A 3A37A 3SR0A 2AD5A 2AFIE 2WHXA 3GEHA 1SXJC 2J1LA 1XCMA 1D5CA 4QFMA 2D4HA 2RGDA 4HATA 1YRBA 4A82A 3U3KA 3IEUA 4NU0A 3R7WB 1RVDA 3I1FA 4LOAA 1DAMA 5LB2A 3VFDA 2IYTA 4D25A 2ZR7A 5EXTA 3A1UA 1EGAA 4NBSA 3RS2A 3RWMB 3TW8B 3K53A 1Z06A 1XRJA 1LF0A 3PJRA 1QF9A 4LBZA 2WICA 4BASA 4DXAA 4IHQA 1K6MA 1VYVA 4Q1BA 1MO6A 1KKLA 2CDNA 5UKDA 3SOPA 2UVQA 1ZNYA 2PT5A 1NY5A 1QHXA 1SULA 1UJ2A 2B7CA 3SJAA 2ATVA 1XB2A 1Z28A 2ZPTX 4PHTA 4RFVA 3WNBA 5BN3A 4PAOA 3ZQ6A 4I1VA 3RRNA 2ZRIA 4OBEA 3KJGA 1Y63A 3I32A 1UADA 3AKYA 3LNCA 2AN9A 1E9AA 3AVQA 3DKPA 2ZRBA 4GBMA 2FGKA 2WV9A 1S3GA 3DM9B 1C4OA 1QZXA 1ZNWA 1HYQA 1I4LD 2IYYA 1CP2A 2G0TA 4LHVA 4W5WA 1WXQA 4ZIRB 2GXQA 2IS6A 2AR7A 1BOFA 1MH1A 5EZ5A 3U7EB 2RGAA 3LW8A 3P4XA 3IHWA 3VNUA 3BAFA 4LJ4A 1T5IA 3HR7A 4WA7A 3DOFA 3NBFA 4XJXA 3I72A 5IF9A 1FMLA 2VSOA 3MJHA 1XEXA 2IYWA 2BWJA 3TSZA 4TMWA 2I1QA 2O8FA 1H8HA 5J40A 1Q0UA 3FTQA 4PHHA 4Q66C 3CX8A 2KWIA 2GXAA 4FXPA 1HH4A 3QEJA 4XTRA 1KGDA 2DY1A 1XFAA 1P6XA 3QOFA 5CM9C 2FPMA 1NL3A 3U3RA 4I99A 3LLUA 4X8LA 4IKEA 2O8EB 4PC3A 1AZTA 1E94E 2FGJA 1NG1A 3QXSA 4ERNA 1H8HD 2ZUBA 2BOVA 2UZIR 2P6NA 2VBCA 4LI0A 2QP9X 1GILA 3NHBA 4WZ6A 5F9HA 2VHCA 3B9PA 2YNMA 1TNDA 1UF9A 1ETUA 2XJ9A 4AURA 1F2UA 5L3VA 3PQCA 4HI0E 4M1KA 4YQFA 1D2EA 5L3QA 2H7VA 4POAA 3CR8A 3SI7A 1AIPA 4DLXA 3UATA 2ZE7A 2VP0A 4YMUA 4F38A 4D0NA 1WDTA 3CBQA 3RRZA 2BCGY 5SZJA 1OLOA 2CVHA 2OAP1 2Z43A 2LKDA 2NPIA 1JQLB 1SZPA 4C7OA 2WJJA 2C8VA 4RSGA 3AUXA 3QXCA 1PLJA 3TUJC 4LGMA 4QGAA 4TYPA 1KJZA 2FEOA 1M6NA 3CH5A 3QXXA 4Z1MD 3EX7C 2G77B 1QHGA 3TQCA 2WPDA 2P6RA 1ZYUA 1UM8A 3HJNA 1T0HB 2OO7A 3TE6A 4N3NA 2ZRNA 4NYMR 4URUR 2WBLC 3U44A 4YMSA 1FQJA 1NVXQ 1P60A 4F93B 4NYIQ 3W6NA 1E2IA 3Q7PA 1Q3TA 3OE7A 1E1QA 1J90A 2CE7A 4BFUA 3KXIA 3KJEA 3NBZC 4HUTA 1TU3A 3B60A 3TIFA 4EPWA 5H8WA 1TQ6A 1XEXB 4DKXA 2WPDD 2O8FB 2OCYC 2CBZA 4IVPA 3C4JA 2ZR0A 1W36D 3QPWA 421PA 1X1SA 3K0FA 4I1OA 3H84A 1ODFA 5AUQA 3THYA 5HE8A 3N70A 3Q3JB 2GCNA 4JBYA 3IGFA 1NNEA 2ZQ5A 2PJRA 3M1IA 1GRQA 1W7AA 4U00A 3PR1A 3BE4A 1SVLA 2F7SA 1XD8A 4OK3A 2QRZA 4DRZA 3U7GA 2JLZA 4PFSA 3CZQA 1M7HA 4UNRA 2E9SA 4PQRA 2WTUA 2CK3D 2BBTA 1RC8A 2ZE8A 3EAQA 3MGCA 3QPUA 1WMSA 3W90A 1U98A 2QMHA 3SDZA 3O8CA 4URVR 5KHOC 1CJTC 1IBRA 5FBWB 1F2UB 4G3XA 2AKYA 3B1XA 5JLJA 2OFWA 4QRHA 5L3QB 1VYUA 1CTQA 2ASEA 1DAFA 3TKLA 2FFBA 1AKYA 4Q5IA 3BS4A 3QENA 1TQDA 5HZHA 4EUNA 3U7FB 1GVNB 1NVUQ 5TV2A 4Q1EA 3ZZ0A 2R9VA 2EVWX 4A92A 2BEKA 4JL8A 2CCJA 3FFBA 3QKSA 1KSGA 4C7OB 2C95A 5HE9A 2V6JA 3TH5A 1E2PA 2ZJOA 1GKUB 1GL9B 2F9MA 2YJTD 4I4LA 4DJTA 5J4HA 2XB4A 4AKEA 4JKYA 1OIVA 4AWXA 1GL7A 2DWQA 3R20A 4NCKA 4QL3A 3N5CA 4V02A 3SU8A 1GL6A 3GPLA 1SVMA 1WRBA 1QHIA 4QM6A 4C2UA 5DNYB 1E2LA 1HUQA 2IYXA 4M2LA 1W36B 3U44B 3NKVA 1KYIA 2G1JA 2DFKB 4C2TA 3QJYA 1DAHA 2Q0HA 4NONA 4A1FA 2ERXA 4MGKR 1Z2AA 3AH8A 1T9HA 3PUZA 4JT4A 5EP2A 3ADBA 2VHQA 3ECCA 1ZMXA 2Q9BA 4Q1CA 3ZQJA 4XWOA 4LHZA 3SBDA 2ZRPA 1L2TA 4CZ2A 1XXHA 3JVUA 3GLHA 3K0FB 2VP5A 2J0SA 3THYB 2XEXA 2XXAA 4JL6A 4G0NA 1T91A 1ZJ6A 4D4KA 1M34E 4Y0AA 5JI3E 2JJ1D 3IPXA 1XTKA 4UJ3A 2GETA 4M1MA 2PEZA 5FL3A 3HU1A 1GZSA 2FU5C 1DPFA 4R9UC 3C5CA 3RRYA 4TTQA 4B3DA 1FTSA 2WWWA 4B32A 2LKCA 1E69A 4V0MA 2QU8A 3KJHA 5KUTA 4LK2A 2HYIC 4BFSA 4DWJA 1OPXA 1WF3A 1HT1E 2OESA 2NQ2C 3OFNA 4GP7A 3FMIA 5G41A 2NZ8A 1NLZA 4FINA 2E1RA 3MAAC 2QP4A 1R5OA 5LB4A 1Z3IX 2WIBA 3ADKA 4EPTA 1Z29A 2QP3A 3OHMA 4Q21A 2VP6A 3LX5A 3KFVA 4TZ6A 1XCPA 1M2OB 2O5VA 3BB1A 3CO5A 4TQUS 5JJIA 3QKSB 1PLKA 2CHQA 4DEYA 1VTKA 2R2AA 2ZI9A 1LY1A 2RHMA 3OFND 4X8OA 3TBKA 4BEBA 3C14C 5B30A 1IY2A 4JLDA 2WWIA 1XJ0A 5FPHA 2VP4A 4A15A 3P26A 1XMIA 3NEJA 1KY2A 2GEDA 4KV9A 2PL3A 2QT0A 2BJWA 4JLOA 4B73A 3K1JA 4OI2A 4HB3A 4BLTA 2ZSDA 4MQBA 2NO6A 4LC0A 4M1YA 1JR3E 2C96A 4BZQA 4ZDIA 1G7TA 4W9MC 1R4AA 1JJVA 2DFNA 1EFRA 1FUKA 3OEHA 5FBRB 4TMZA 3WNDA 1IQPA 3RSOA 4B43A 4AC9A 3HP1A 4R7ZA 4GRAA 4Q4JA 3EZ7A 4S2EA 4FWTA 4ZDJA 3AVPA 1SKYB 2FSIA 2A7QA 4V03A 1T4GA 3W9YA 1Z07A 5FUVA 4KLNA 2OSBA 3GJ7A 1XXHB 2ZITA 2GVDC 5BW8A 3GLHB 2QY9A 5M04A 2WOJA 2XXAB 1L7VC 2ZRFA 1JXOA 1JBKA 3CR7A 1KK0A 3OEHD 1KO7A 2GRJA 4JIMA 3K70C 3O8BA 2ERYA 3BERA 4OQLA 2NGRA 2ZROA 1CJKC 2CJWA 1AS2A 1NVVQ 1P75A 4NZYA 1KDPA 3LA6A 4GZLA 5CB8A 1F3OA 1NLYA 1R8QA 1SXJA 2HCBA 3ZGXA 5BWMA 3A58B 2ORWA 2BEJA 2V7QD 3KX2A 2O8BA 5AJZA 3KFXA 4P4TA
chains in the Genus database with same CATH superfamily
2CFCA 2BRUA 4F9EA 2H51A 2H52A 3IVXA 4HFMA 4JCOA 1RM0A 4Q4LA 4EY3A 4QULA 5FBZA 5A4JA 2PZKA 3ED5A 4C1BA 4DDWA 2VF4X 2X15A 1B2RA 4Y18A 4FZVA 3W5SA 5I3CA 5K3SA 4OPMA 1SXJD 2B98A 3NJ4A 5B36A 3FPJA 1DTEA 1G5IA 2YC2C 4QTYA 3M4XA 4B6QA 3QBVA 3IKMB 5CMLA 3BBPA 2K7ZA 3IBTA 2W7TA 4TLDA 4YDRA 5CFRA 5HKKA 4RTRA 1GM5A 1K8RA 3WRYC 2PTGA 2VF8A 3F2VA 4ZVUA 3N2ZB 3TJZA 4E08A 4YT5A 3X44A 3UK0A 1C29B 1Z5OA 1Z8NA 4NG5A 5H9VA 1ZVKA 2REXB 2QPLA 3RG2A 3ZIAA 3UQYS 1FSPA 1V16A 1PL6A 1M9NA 3ELDA 4FYJA 1ZD1A 4A2QA 3I42A 5KIAA 3O4HA 3G0DA 1LUAA 2Q9CA 2YUIA 5IKXA 1W4BA 2ZSJA 3RH0A 3HI6A 1IXSB 4WACA 1U3TA 4R1OA 4AYTA 4AY2A 1NF2A 5JADA 2GVZC 2VWQA 3EHDA 3NEYA 2H9AA 1JR4A 2NZUG 4HF7A 1F8FA 3IO5A 4HDAA 5CLHA 1DEAA 2REOA 2G63A 3BXXA 4M9RA 3JAWB 3PS9A 3S2FA 3KZMA 1N5LA 5KTKA 5DYNA 5JH7B 3Q3HA 5EUBA 2LXNA 2BONA 3MUEA 3RS0A 4Q34A 4IX9A 1ZD9A 1K3UB 1E4VA 2J5XA 4L8WB 4CV0A 2H07A 1FP2A 1CEQA 3EXEB 5EKDA 4IIUA 4D92A 2A5FA 1SCQA 2I6GA 4P36A 2G6BA 2B0CA 2IU3A 2P5UA 3EF1A 1R0CA 3SYRA 1W2GA 3D5EA 1AOXA 1PFVA 2QLBA 4F4JA 5DCLA 3FWKA 3L40A 1W88A 2GZRA 4JMLA 4PXYA 5F78A 3RD5A 1ODSA 4YJ3A 2XXJA 1T3SA 1VECA 4GXRA 4BFCA 1OXXK 2L19A 3E5NA 1AUVA 2XNKA 3KUXA 5FHRA 1RRKA 1NW9B 2VQSA 4RVFA 1T9KA 1WQ4A 3IUNA 4AS3A 1TJPB 4TKUB 4RMNA 5ALVA 4YCDA 3UG6A 5K8CA 4A3SA 4WECA 2H7YA 1XLTA 3QSGA 5D5PA 1E8NA 1EPUA 2MSCB 2X4DA 4IIBA 3WV4A 1EZ1A 4F3RA 2I2AA 1FNSA 1FSGA 3D3WB 4E5PA 3HUEA 3REGA 4LY9A 1TAGA 3AHIA 3SE7A 3T7SA 1LQUA 3V4PB 2QJOA 2IE8A 4BLRA 2QAIA 1S3SA 4YRTA 5AK5A 4BB0A 2XCTB 1XRLA 2M1ZA 4TZKA 1LV7A 4MVYA 4WBNF 5A6SA 4L8GA 3ND7A 1S8FA 3DQZA 1NQTA 3OQVA 2J3LA 1ZITA 1VQ1A 2GVNA 4GPAA 4PYLA 5CIWA 3L8CA 4AKTA 4RV4A 4AJOA 5FLKA 3CUVA 4UEJA 4JZKA 4WKNA 1ZDMA 1KSJA 2WVGA 4KQHA 4HAIA 1KBQA 2ZJBA 2QQEA 3OZXA 4IDCA 3S99A 5EL0A 4FDVA 1Q19A 1E4YA 3MLBA 3K09C 3S81A 4CHTA 3VR4D 3WYEA 2RKWA 4V39A 5EGSA 1U5CA 1F8GA 5FWNA 5JWRA 2R6CA 1E0JA 1V16B 4MR9A 3UJ9A 1XVTA 4D57A 1PYOA 3RUEA 2IHKA 4HLNA 3FPCA 3ULKA 5CA1A 4HQOA 3FPAA 2XZLA 3KAQA 4K81B 4IWYA 3E05A 1Q22A 1E1LA 3ROKA 5B1EA 1I3NA 2O2GA 4CM9D 2B5VA 1C3LA 2CB9A 4QGGA 4D0GA 2CXSA 2FRDA 1HE5A 1BKDR 1X8LA 1Y80A 2WYUA 4KTVE 1YI8A 3F71A 3C45A 4GT1A 4Y2SA 1T0UA 1P5FA 1Z33A 4LHWA 3ZV7A 2J3IA 4PV7A 3V4LA 4O4JA 2FCRA 4KAAA 4DUZB 1CZHA 3T3EA 4EUHA 5AUPB 5BV8A 2QUHA 3D8HA 1V71A 3KTAA 4I4NA 3BB3A 4JI4B 4ZRNA 1ADFA 3LBHA 4OREX 4ZK6A 3IMCA 1A1SA 2I6FA 5IASA 1K2WA 1K6IA 2DTDA 4KTTE 2AQ8A 1ZIOA 4BUJA 1E8DA 3TFOA 1CCWA 4X41A 2GTPA 1KJNA 1FF9A 3GQVA 1W88B 3U4IA 4RKQA 1W0JD 4B2IA 4YJ3B 1CFZA 2PYDA 3DL2A 3I9JA 1QYDA 5HX7A 4GMDA 1J49A 2FRXA 5K4AA 1I4DD 3PENA 4WFIA 3ICQB 3OSZA 3A1DA 5FBQB 2FQQA 3LCCA 1FBNA 1FNNA 3IP3A 3U40A 5ELMA 1J8MF 4ER0A 1IJKA 2XIJA 1GQOA 1U28A 1FPMA 4HEHA 4RU1A 3LGAA 5GAJA 2H1FA 5EJ6A 1OZAA 5TQ2A 1TU4A 3DXXA 3LWZA 1EFDN 2VPIA 4JS0A 3L2OB 2Q50A 5AVVA 1QRUA 1CETA 5ESDA 4YR7A 3PT9A 3O0TA 4C4PA 1TYAE 4YRSA 4UTNA 3NDBB 3ME5A 1XP5A 1MC1A 1NWHA 2NG1A 1QH8A 4QD3A 4R3NA 4V38A 1LEHA 1LSJA 3OIFA 2VNHA 3AF0A 3TD6A 3B20A 2OYCA 2FQWA 2JIDA 1V39A 2Q6VA 3DFIA 2FFRA 5A6SB 3EDQA 3NIFB 1P77A 3U19A 2G0NA 1FSSA 3GDHA 3TF5A 1JI0A 2C07A 2FHSA 2HIHA 2RAVA 3B1ZA 4MV4A 1JLHA 4BZWA 1NXWA 4HLQB 1RWOA 3IKJA 3CLVA 5IKOA 3LQ4A 3V97A 3ABQB 1L9KA 4ENSA 1NX6A 3QX8A 1EXVA 4LF6B 4ND8A 3R3HA 3L8DA 2WU0A 1QK3A 1F5SA 3NHJA 3EPPA 4IX1A 1G64A 4N8EA 3F3SA 4JUIA 4QHTA 3D9QX 4QT0A 5EESA 2WDZA 3L7IA 4YP6A 1T43A 3D43A 3KEMA 4GOMD 4QXOA 3KXKA 4TXHA 3VR5A 1J1UA 1V7PC 3TL6A 3KDSE 3Q6IA 4EK9A 5HFAA 2FHPA 3RT7A 1B23P 2V3CC 2WKPA 1O0BA 1OT3A 2Q9AA 2ODBA 1YDMA 3W2GA 5CA1B 1ESCA 3R6DA 5DHRA 3CA8A 4MW0A 1ZD4A 1ISRA 2BFOA 3HJUA 3PUKA 3RS9A 4DSOA 1PSDA 5B5SA 2DXIA 1JSXA 4JJAA 1C9NA 1MJHA 3BSFA 3R7LA 4GU5A 3VX4A 1UC4B 1WSWA 1Z35A 2AOTA 1EFHA 3BRCA 3Q7IA 1OU0A 4GVLA 4LNHA 4NBTA 4O4JB 4WNIA 5DDIP 2D1QA 3KKMA 3MUOA 3OQBA 3LUDA 4BYMA 2VP9A 4EOGA 2XD9A 1UBNA 3Q1KA 3QLVC 1J0EA 3KTAB 4K1XA 3GCDA 5EMJA 1YBMA 1BIFA 1NBMA 5CD1A 4DLLA 1KHHA 2CUZA 1G5QA 1ST2A 3CURA 3JQAA 6AT1A 4EYGA 4GM4A 3W5UA 5GY7A 1E89A 4PN7A 3S2ZA 4CJXA 2CVQA 4ECAA 2GLXA 3BH6A 4TL9A 3R6WA 2HK9A 4YCSA 1ZMRA 3CSSA 4WNCA 1IONA 4YS6A 2J3JA 3EEQA 1EB9A 3W8NA 3MPOA 1A9XA 2FF7A 4QLBA 5CM8B 5EJAA 3CEPB 4DUGA 2O2IA 2FZEA 3OJCA 1VSQA 1ZI6A 2J32A 3CCBA 5JNTA 1L1QA 3R7SA 1UFQA 1JQDA 5TQ2B 1VMAA 2PXAA 4R40A 4A0FA 3BG5A 4KVFA 3BFXA 5K7SA 4C2AA 3OC6A 4XM0A 2HZ7A 5GVRA 4UC0A 4G5QA 4DLSA 5FTNA 4NBNA 1BMQA 1SZCA 1ST3A 4AFNA 4EPXA 1E9BA 4HFJA 3E22A 4M36A 4TS1A 1KO1A 2ZJ5A 4PG7A 5K8JB 2WM9B 4KJXA 1QH8B 5BP7A 1YOVA 4LJKA 1DAOA 3LKVA 5A7HA 5M34A 3CUSA 3WXBA 1U6IA 2QY6A 2XOXA 1RPNA 3N3BC 4AIRA 1NKTA 2HRQA 3G2HA 1ZONA 2C92A 4FEEA 3VOBA 1IHDA 4NZ9A 1CQXA 2PQ0A 4EA6A 1ISJA 3VZDA 4CCWA 5A2QA 1WNFA 3ZCSA 4ND8B 1L8OA 3K9QO 5DBEX 5M3BA 4BKQA 3ZXXA 4DLTA 3KQUA 4WXYB 3TLJA 3C87A 3NT4A 4WE3A 1NJ8A 1U0EA 1GCIA 5FOXA 5K9ZA 4RAOA 3GUCA 4DPMA 1DKPA 2JVIA 3KAPA 4OHOA 5TEWA 1SCBA 5JXJA 4JLAA 3IAM1 3AV3A 5GV8A 3SJUA 1ADGA 5B2FA 1E8MA 4PAQA 3W79A 4IZ6A 1TUBA 4LE2A 2HRDA 4IHJA 5FXMA 4ND6A 1TC1A 3AZPA 1O0CA 4MV3A 1NR7A 4P98A 1Q21A 1KYYA 2X3FA 4RL6A 3U81A 2PUAA 1UDAA 3RKUA 4L4SA 3B13B 3IPAA 4KN6A 5TB5A 3A0RB 4DV3B 5GONF 3U3JA 1EXWA 4F11A 2YQ5A 2JD0A 2AOTB 1YHYA 2CLMB 3BCSA 2HXYA 3MYYA 1BJRE 3O2NA 1ISHA 4WNAB 3AFHA 3R3ZA 3EXAA 3ABOB 3MB8A 2J5QA 3ENNA 4HBZA 3STUA 1T15A 5HOEA 1CE8A 3CRMA 2G4LA 3V33A 3RC8A 1XG5A 1K9SA 2GB4A 5FV7A 1NYRA 2WHYA 1NOJA 2F2TA 5CPFA 4EMSA 1U3CA 4RK1A 4BEWA 2POQX 1ZXLA 3JQAB 1NP6A 4X6YA 4ZHQF 1ZOLA 3CX6A 4QHYA 3LTNC 3C3WA 1L4HA 2EJVA 2FSPA 4JB2A 1KPGA 5FA6A 1NYTA 1PNQA 5E7IA 3HY6A 2ZBRA 5TX7A 3OTWA 5BWNA 2EFCB 1I7DA 3H2YA 1A9XB 2XA2A 1U0JA 4C04A 1AKVA 3B1VA 1I7NA 1XWFA 3KSZO 3PV0A 2A9QA 4KL8S 4CTJA 1PDWA 4ZYTA 3UXEA 3RIEA 5CBPA 1NVWQ 2L17A 4RORA 4B2LA 1KPHA 1RRFA 4KK4A 1RM5A 2F1OA 2V7PA 3E7DA 4BVLA 3AVWA 3AV0B 1Y7HA 4IUDS 4XGKA 2PT6A 4DB4A 4O4LF 3K16A 4HMQA 3IUQA 4G9EA 1CQPA 1P6QA 1NXTA 3A70A 3E22B 4JJEA 4LS3A 3H3JA 3K1AA 3P97A 4N3GA 5FI0B 2J6CA 1U2EA 1JT2A 1TCUA 1YOVB 2LRHA 2QI9F 2WIDA 3EF0A 4JOSA 4L5BA 4PANA 2QMUA 3IV9A 1RQRA 3SIWA 3WHIA 4V1CA 5I3ZA 1P4AA 2CLSA 2E6KA 2HLPA 4IS3A 4GOKA 3IUBA 1WP9A 1F14A 2R7KA 2QN9A 3DHWC 1I6WA 4MS1A 3DO6A 3SVLA 4RPLA 5DRTA 1GQFA 3MTEA 4KDEA 4MW7A 3IKTA 3ER8A 3IESA 4HV4A 5KZMB 3RADC 3BE5A 2PE5A 3QU9A 3WRYA 4ER5A 5L4NA 3M6MD 3I4LA 3SWWA 3JD0A 1VZ3A 1M2HA 4PU0A 3HXMA 1QVVA 4BKMA 3HNRA 5JJKA 3H0KA 3OZCA 3STVA 1KSHA 1G98A 1M7BA 1TUBB 2BDEA 1NAIA 2XE4A 2YZ7A 4IHJB 2BDTA 3DCIA 2ZXFA 5JC8A 1YVDA 2JFOA 4QNRA 4EAQA 4EELA 3V4FA 1GDHA 1ISGA 1RQGA 3U6KA 3MJFA 3PWSA 1MT3A 3RT9A 3OAAA 1QLJA 1U1DA 3LP6A 5DXFA 4E4TA 3OOJA 3S7ZA 3PEFA 2WVJA 4MIYA 4BNFA 4MINA 1H05A 1SG0A 1JEJA 3TEMA 4XCXA 5LMNB 1L4YA 1CE8B 2GJ4A 5EFZA 1YZTA 2DGDA 3T4UA 3NHRA 1H8ED 1YWGO 2R8RA 3L06A 1UWKA 4WKCA 1JFSA 1X1RA 1SHKA 4KO3S 2GF9A 3AHFA 4YIKA 1U3UA 1FYEA 2OXTA 1YRHA 2J8ZA 3QVMA 2H7XA 2NYUA 5EHXA 3K0SA 1CY6A 2XCOA 4OQMA 3I01A 3I6BA 1E63A 1Q0SA 1Z0DA 4ZXPA 3S29A 5E6RA 2MYPA 4GYYA 2AZ4A 3FGNA 4Q7KA 4QUAA 4MIOA 1MVOA 2FX3A 1PG0A 4GAEA 1G17A 2EKLA 3VJRA 1P33A 2EATA 1ZM7A 4L4XA 3IQEA 4ND2A 3SX4A 3K70B 3ZWNA 3QJ5A 3M83A 5BSTA 4ZDKA 3PNPA 4P7JA 3DP9A 3UZUA 3HEAA 4DDTA 2OEPA 5CBPB 3EBPA 5A0VA 2HHCA 3AGQA 4IGAA 4Y0NA 1Y3AA 5HF9A 1C0IA 4YB8A 2H63A 1D7OA 1LXCA 2D8AA 3RFFA 3U9SA 4ND1A 1BROA 3HA2A 3MRTA 5EJIA 4ENTA 2QORA 3EVFA 1RZVA 3O21A 1W4LA 1Z4PX 3B2NA 2WVAA 2NO4A 1N6LA 2PYZA 3K1AB 4OH7A 5FIUA 2QN7A 5FKJA 3FWPA 1RW4A 3COSA 4YNBA 4V1CB 3WWPA 4GM1A 5DHPA 3NVMB 2HWXA 1EKXA 1KS2A 1T9BA 4FUTA 1HOTA 2X0JA 2EFDB 4Q47A 2AXNA 2OUIA 1AK2A 1J0BA 1NLFA 4G0VA 1GNSA 3KB6A 2D0DA 4MO9A 4MS1B 4B3HA 3NDPA 2Z57A 1VLMA 2PLNA 1GEEA 4YRMA 2HX1A 5DNUA 1FP6A 4IIJA 5LU9A 4RTPA 3DMHA 3K09A 3UAVA 3D0OA 2CHEA 1IYZA 1PT6A 1E3WA 1WAMA 2F9LA 2HSGA 2ZU6A 2WZCA 1OZ0A 3PTLA 3VU0A 2BEWA 2YVUA 3KKZA 1Z2PX 3NC0C 4B3CA 5LOVF 5CVUA 1NMZA 2I5PO 4R0NA 4ZVPA 3L04A 3PC6A 2FOXA 2QL5A 2EKQA 3OBIA 2JFQA 1MJ5A 3E48A 1DKRA 1E3JA 2ODTX 4FFPA 2CMFA 4UM5A 4G36A 2XUFA 3ZN2A 1N8KA 1DIRA 3CQ9A 4GD3Q 1I2CA 3ZI4A 1KAHA 2RK4A 1EDBA 4INJA 5HUHA 1P18A 2CHGA 4I50A 5C1PA 2XGSA 2FEPA 2JAPA 2PQMA 5KYYA 2I1VB 3LQQA 1NIPA 2VAWA 5ES4B 3QOYA 2QRJA 4WK4B 3PRKE 1H9AA 1ODLA 8MHTA 3E5RA 2LCQA 1SXPA 4K6HA 5JSZA 2YV2A 4WGFA 1Y89A 2P30A 1QX3A 1JE0A 1SXGA 4BKOA 3DULA 5HJ5A 4JDPA 3D6HA 4LOHA 2QR5A 4WZAA 3WDKA 4CEIA 2ZT7A 2BMJA 4FHFA 2ZATA 1I2MA 1UK9A 4BFTA 2AG8A 1ONOA 4YCBA 1KYTA 1RI2A 3URMA 3UC9A 1M34A 2YY6A 2MSDB 1VG1A 5E6RB 3O2JA 1M5UA 2ZYIA 1PGOA 1N4DA 1R12A 3CNHA 2GD1O 2BT4A 3INGA 4KIFA 4EEZA 2BMEA 4FGLA 2Z3VA 4HNRA 4YROA 3JTMA 3L77A 1UK6A 3O7MA 4IZIA 4M0FA 1T1RA 2ZI5A 1CEEA 2ANBA 4UUMA 3E3NA 3L0ZA 4BVFA 4FOSA 1X1TA 4Z2AA 3RREA 3K1ZA 1UUFA 5F1PA 4YDQA 3B2QA 4BUCA 4PZYA 2I4TA 4YMTA 4JLPA 1Q1NA 2GAFA 5C32A 2QGNA 5K3BA 2XMDA 1V41E 2AOWA 3IR6A 4CIVA 5KNDD 3RIGA 3A4NA 1YR8A 4MX8A 4LGVA 1SCKA 3PQ4A 1JRLA 4YO8A 1C7RA 3GGSA 4W99A 4OAOA 3BIOA 4MARA 1T5LA 1NJSA 4G4SP 2C9YA 5LMCA 3SIPA 3UUEA 3QYJA 1TDJA 3ENWA 3EYWA 4RW0A 3RYIA 4BRSA 3OF3A 2XDQA 4MK4A 1W2WB 3OZUA 3UJ7A 3WY9A 2JI8A 5KC8A 5E8RA 5CCXA 2VYNA 3G6WA 4IIJB 4A2CA 4Y6QA 4A73A 5KDOA 1CS0A 1E3WB 2DWUA 1CDDA 1UDBA 2BEWB 1CJUC 2D0PB 4RV9A 3A3PA 3QZUA 2N0SA 4R0VA 1S02A 1KI6A 2VEDA 4TYNA 4OQFA 4GC9A 1G8GA 1T8RA 1Y4DE 1GPUA 2PTHA 4TWZA 2XPCA 3UHJA 1A8HA 1ZN7A 1EEXB 4A6XA 1X80A 1WMEA 4GI1A 4JITA 4ER3A 4UXHA 1ZXBA 3IQGX 3IUYA 4I50B 4AQYB 2OOKA 3FTPA 4G9BA 1PKEA 5KYYB 3T5CA 4ZVNA 1NP3A 1BS1A 1K9VF 1ZH2A 4L9WA 4KQMA 1VA5A 3A9SA 3H5TA 4NBUA 3KV1A 4LE0A 1AJEA 5JSZB 4P0PB 4Z3OA 5KX5A 4HWTA 4CWAA 1TIPA 2GHTA 4P1ZA 5IBRA 4WZAB 5IEJA 1NLMA 3CONA 3Q72A 2CZQA 4OK6A 4CEIB 3BEDA 2PMWB 2NQTA 3CM0A 1GOTA 4TMYA 4DSNA 1DBQA 4QUHA 2V54A 1DELA 2C4MA 3EIUA 4R4JA 5J1SB 2LDYA 2B4RO 4HADA 1IK6A 1M34B 4GR9A 4OB6A 3VYTB 3NC4A 4EGSA 2DHRA 4GPTA 1ZUHA 4COKA 3AVVA 3TQOA 4REOA 2IY8A 1P0IA 3LHSA 1W5AA 4Y6RA 1EX1A 4GQIA 3L6OO 4GOXA 3WHKA 7GPBA 4D3ZA 4OAPA 4Q0MA 1GSIA 2ZUDA 2PA3A 3JQ9C 3PNKA 4QYWA 2QQ5A 1ZOIA 2FI1A 1OQAA 2WD9A 2WWHA 1SXQA 3FUUA 1TA4A 5ALDA 2QG6A 3QBTA 4LTMA 1NJ2A 5KU1A 3WBKA 1O2DA 2RJNA 2GZAA 4OQNA 4W5JA 2HIAA 4QQRA 3HE3A 4XB1A 3EB9A 4DLVA 2JKYA 3PUIA 1DZ3A 1Y1RA 3UK6A 4G2NA 1VB3A 2CLOB 4CDGA 3U44A 2HPHA 3NHSA 3GW8A 4TL6A 4B9AA 2B30A 1M2FA 2DPXA 3E18A 3D3QA 5IPFA 5CG2A 1J97A 3GMSA 2H0RA 3NBYC 3K1YA 5A3VA 1SXJE 1FRZA 3LC1O 3NHWA 3RYIB 2XDQB 1AKMA 2O8VA 4EJ6A 4J0IA 1FBTA 3IQIX 4GGMX 2OL4A 3G8YA 3DL0A 2XUQA 3MGKA 4G5YA 5FTKA 5A9RA 2NVUA 5JMWA 1JIJA 3KQVA 1Q2XA 4L5AA 2IOHA 3FAZA 1CS0B 2OBBA 4KQWA 4GLFA 4BNDA 3FJYA 4DCVA 1CDOA 2VXYA 2X5JO 2WP0A 3ANSA 3PNMA 1DQPA 3U1VA 3UA4A 4YRNA 3TOVA 1KI6B 3GJ0A 4R84A 4IYRA 5JRZA 5L40A 2H4ZA 4KFRA 5BSMA 3R3UA 5KJ6A 3GN1A 5HKKD 1NN0A 4ZT4A 1U2ZA 3T7KA 1X80B 2F3PA 4LQCA 3AJDA 5CFQA 3GJ3A 3R6TA 3ZIAD 3BJZA 1UFVA 3N0TA 4NOJA 3QKWA 4JNKA 3OPQA 4DNXA 3AFMA 2XB2A 5AQ1A 3UFBA 1UJ5A 3D6VA 3T35A 4I8IA 3OQPA 4I2VA 3QUCA 1FK8A 4LYJA 4Q3BA 5KJFA 2QBYA 2GZHA 4JYMA 1W1WA 2Y1LA 5KX5B 4DR4B 1SU8A 3VH2A 1MPXA 2GBLC 4DTIA 1WCIA 9ABPA 4KVGA 1VHJA 4N12A 1II8A 4L4RA 1UDWA 3SC6A 4O4IA 1JMKC 4RJLA 3ZE7A 1TJYA 2HHLA 4HVLA 1C7QA 1VE7A 3H5IA 4J0JA 1Q0QA 3L84A 4IOKA 2OZPA 4MLDA 4JQZA 4F8JA 4F2WA 2AHRA 1ZCJA 4I2NA 2EZ9A 5FF9A 4MPDA 3TIVA 1NJ1A 3LK7A 2X6TA 1KH1A 4E7OA 3PT5A 1DUSA 2ZYDA 3FLAA 4KSBA 1FDVA 4Q3CA 3GLFE 2PR7A 1NMEA 3BWEA 3DB2A 1FXWA 3SLGA 1VZ2A 3O82A 3I05A 1XZIA 3SICE 2C9MA 5KO2A 5TVKA 4BFYA 3M33A 4FI3F 3FOFC 4IMRA 1G3QA 3EPJA 1DC4A 2AFVA 4GNKA 4B3IA 2XYVA 3OD5A 5AHXA 5IUKC 3OZFA 4BVJA 1YQ9A 2D00A 2W8ZA 1BDJA 4EGJA 1NRXA 5CH3A 1MT0A 2ZS9A 3DWGA 5ER9A 4BN0A 3IAHA 2AE2A 2X42A 5LYJA 1Y1SA 1DAGA 1V6AA 1GLVA 2ZAMA 1MRNA 2IYSA 4HDCA 2NACA 1WM1A 4U6NA 2P1ZA 1ODCA 1YBAA 3MCVA 2LW7A 2X8JA 4XAQA 5KSYA 3I37X 1RI5A 3HB7A 2IOYA 2HZBA 2ZCUA 6LDHA 4HB2A 2FEMA 3OIVA 4FOOA 4AZWA 4YYZA 1UBGA 1VPLA 4IMJB 5IAKA 3M5PA 5HF6A 1DAPA 2NVUB 1E2KA 1OKKA 3SYLA 1DAKA 1I30A 3A6FA 4JL5A 1QOZA 2AA3A 4HQNA 4UHJA 4BNDB 4WN9A 2OV4A 2WMOB 3HO8A 1G0OA 2F3TA 4D46A 2ZTSA 3AJEA 3T6KA 3OZ7A 4BO5A 4C5AA 4D2IA 3AF6A 4ZCTA 1R6XA 3GB9A 3W5AA 4KI7A 3B6EA 4C43A 3LCJA 1W59A 3LUFA 5CR9A 4EYOA 3U3OA 4D9NA 3GBSA 4XEUA 4PC2A 5DULA 1W4AA 4AJHA 4DVGA 4E2YA 1EFAA 2XBLA 3E53A 3USCS 3I39X 4ZOLF 4FT4A 4MKZA 1PCXA 3SKVA 3LDAA 2YINC 3OTGA 3W7AA 5EQTA 1NOKA 4D8YA 5C9ZA 4OX9Y 2ALJA 1BMFD 1GEGA 2HCTA 1RYEA 2R6GA 1V96A 1PAUA 5KOIA 3EG5A 3NPAA 2W2NA 1LX7A 2QBYB 1KMHA 1IU9A 1A5ZA 4FSDA 4UNNA 3NWBA 1PR2A 2H1CA 2APJA 1WCIB 2WJZB 1E61A 1YJ8A 2Z5LA 1II8B 4JJFA 2OFOA 2IPLA 4O4IB 2VHZA 3WNVA 1T8SA 4MUAA 1VPDA 1WCXA 1R5BA 5LYYA 5LR6A 3JYOA 5JXHA 1G4UR 1X38A 1EA7A 5DH9A 3L05A 5F33A 3ND5A 4RLHA 3BSWA 4ZCQA 2XHEA 4H7KA 4UOQA 5EINA 5GTDA 5DSZA 2ECOA 1W6RA 1JH9A 3EG9A 1QK4A 2D7JA 3FW1A 3RR2A 2HU8A 4UAUA 2GJKA 1GGJA 3OHPA 3QWFA 1GUYA 3DNPA 4KFUA 5L8VA 4BV8A 3EQ2A 3MD0A 4MRRA 2PFGA 4GI7A 5H1YA 1SN7A 3RS8A 3SAJA 3TLCA 3N0RA 1KI7A 2EV9A 3AKEA 2FPXA 2H08A 3RV3A 2WEKA 3OJEA 1C7FA 2IK8A 1PV2A 4B9EA 2NT3A 4BGIA 4D9FA 4DSUA 5LYJB 1Q0PA 2X2FA 2AX4A 3G82C 3JW8A 2PMDA 1QRTA 1IJEA 5AVOA 1K88A 4CV3A 4NCIA 5JRJA 3T1TA 3A27A 1CR2A 1OA0A 1GRRA 3LG2A 3TM5A 1KY4A 1Z22A 2IEAA 5E3HA 5MN6A 1ULUA 4BEVA 2X8JB 4JUBA 1AM4D 2HLDA 2RHCA 5H0IA 1XZPA 2JEOA 4HQFA 3TCNA 4GNRA 3OCJA 4BDSA 1ZRHA 2VBIA 1ZOSA 1RVV1 2D2EA 2G9UA 4U5QA 4FN4A 2Q7DA 3ZK8A 3RVBA 4LYAA 4F21A 2GASA 5JNRA 3EARA 3K9GA 4HZIA 4CI0B 1QO9A 1TTPB 5EHGA 3V2UA 1V26A 3H9QA 2PSFA 4DF3A 1C14A 5TT1A 4ARCA 2AYZA 4MV5A 4WN9B 5AW1A 1P4JA 1G4HA 1VCIA 4E6PA 3UT6A 3NORA 2ODAA 5I9MA 4PHFA 1DCMA 3GPIA 2ZJFA 3DBIA 3V9AA 1GQRA 1KTIA 3DEJA 1TZKA 2E1PA 1RBMA 1WXDA 5HFNA 3CNEA 2O7RA 1QB8A 2CXXA 3GEBA 3K1TA 1CU1A 3KOUA 4BZXA 5K6RA 1CRPA 1VCMA 1PZEA 3HBLA 4GHWA 4E03A 2RC5A 4Z0TA 3WMFA 5JD4A 1QV7A 4WHMA 5THKA 2FFQA 4LCJA 4EKYA 2WAYA 2J6IA 4D5EA 5AYVA 1N2CA 3MEQA 2LIPA 5AXBA 4Q18A 4UCXA 4KN8A 3WKAA 2A3RA 1KMHB 1AKUA 2ZRHA 1OFVA 1TEVA 3I92A 2NX2A 3IT2A 3OJWA 4FGSA 4N3AA 1TZJA 4ZD6A 5DTMA 3ZS8A 1E9DA 3VNSA 2EW8A 3AHGA 1OIXA 2QW0X 1N2ZA 3A4LA 4A6PA 4ND7A 4CIYA 6ABPA 3TIXB 1HEUA 3E1GA 3GF4A 4GECA 1ATZA 3TVDA 1OFIA 1SY7A 3ZWBA 4MRVA 2RI1A 2JVKA 5HBGA 1EP9A 4RK7A 3RVLA 4I1SA 4QASA 4WBXC 1TMGE 1GPKA 3NOXA 1IY0A 3SHWA 1FFEA 2AFIA 2J9GA 4RBNA 2Q5JA 8ATCA 2JLRA 2O2SA 2Q5FA 3EG9B 4L8FA 3JQAD 5A02A 3M4JA 5CBKA 2XT9A 1XAGA 1VE1A 4OA5A 1ULAA 3FUXA 5DIZA 1QRRA 3EOAI 3A6HA 5GWXA 4A8HA 4YUXA 3ETLA 4OFXA 3LH5A 4DR3B 3IRVA 1W96A 2V7EA 4L7VA 2OCLA 1Z2EA 3UCEA 1XTZA 5K0LA 3SM9A 1BX0A 4CGZA 3JZAA 4MA0A 3TLGA 1R18A 5EZQA 4DUGD 2HD4A 3C8MA 1E7RA 1H5QA 3EC7A 3ZX4A 2ZZMA 4Q3NA 2X9VA 1N5OX 2OVBA 1G55A 2HKIA 5I5EA 4YRIA 3WGQA 2Q2OA 4EFNA 5KWJA 4W1PA 1KZGB 3REFA 1F06A 1H4QA 4OP1A 4DL9A 3FA2A 1XTVA 1LC3A 1ZS9A 3NT2A 5A71A 1HI9A 2C57A 4MW6A 1TYCA 3B6ZA 4EO9A 3U48A 4C0AC 5CW2A 5IHXA 4AY5A 4Y0VA 4ED9A 3F7NA 4EG8A 5L6LB 1RXYA 1HDOA 3H87A 3QU2A 1LS1A 1XF9A 2NZXA 4YCJA 5AWFC 3MQ2A 1SKAA 2HT1A 1YS9A 2SCUA 5GINE 4KIJA 3M49A 4XRGA 2RC6A 5IDYA 2R8XA 3UMMA 2O54A 3VKHA 2VJLA 2LR0A 3QPBA 1SWVA 4HH0A 4N54A 5AOAA 1RR6A 4DQXA 2R4QA 3K6SA 3THYA 2W6PA 1HK7A 4CF5A 1WCYA 4O5AA 1VLHA 1U1GA 3GU3A 5ALZA 3W06A 4E5KA 5IKMA 3TXXA 1DX6A 1OROA 3VH3A 4JXXA 1YL6A 4MWGA 1DWOA 3W6OA 2OFPA 5AJXA 4YV7A 4N76A 3SHOA 3KZCA 3Q12A 2HCRA 5SZHB 1Y1LA 4OAQA 1E98A 3WE7A 1DADA 3OZDA 4HAUA 4KDFA 3WYGA 3IYLW 3F6SA 1L4LA 1QIFA 1N2CB 1Z38A 1C2YA 1DC5A 4NFYA 3VR2A 3AVXA 4LJ8A 1FW6A 2VHYA 2GBGA 3G9XA 1SG6A 5KWSA 3BWCA 4F04A 4BATA 4CDRA 4L5CA 4ARVA 4DLYA 2VF7A 2WKRA 1TI7A 3EGVA 4DC9A 1T8YA 2XZDA 4X7MA 4UTXA 4YAGA 4H15A 4KSYA 4NNPA 4HQRA 1W93A 1SBNE 2X58A 4Q48A 3H2BA 1IWPB 2ZJAA 4QX6A 4R2IA 1P6UA 1AB6A 1ODIA 3FI9A 5DASA 4Q7QA 2AFIB 1HDIA 1SK9A 1HL7A 2HO4A 5IZ4A 4CTOA 2R8EA 2FFJA 1XTRA 1ZU5A 4CTNA 4LDPA 1LI5A 3CINA 3LFUA 3VU1A 5CXUA 1F9EA 3G9QA 3JQ9A 3MJRA 5J63A 4AXXA 4CG0A 4OU4A 4DY4A 2I1LA 4MAAA 1DSSG 4YT4A 1SC4A 4MRSA 4ZVOA 4ZMRA 2IZ6A 2OBXA 5J5CA 1EHYA 2FSHA 2PH7A 1M0TA 3ZDQA 3HKCA 4CCSA 1RWXA 4U1RA 4WJZA 3GOHA 3TLGB 5JASA 1YAHA 4ISBA 2QROA 3HNOA 4LGYA 1XO1A 1E9EA 2E21A 2GKSA 1DEXA 1U0HC 4R8LA 3VR6A 5JJCA 2AH5A 1KI1A 3CVWA 4C22A 1Z36A 2WTNA 3TSCA 3PJGA 2Z9CA 4KBGA 4NMMA 1G5HA 2V9ZA 5J47A 4HH1A 2BGWA 1Q50A 4OJTA 2XODA 3VR4H 4WLEA 4LV5B 1KK3A 3ROXA 4D26A 4YX9A 2SCUB 3JQQA 2C03A 3WNQA 4E3WA 4ZT2A 1B43A 3DE2X 4Z1MA 5LA6F 5H7XA 2F55A 4LVUA 1TVMA 3I6QA 1VHLA 2JRLA 2XKBA 1TTQB 1P1CA 2O2JA 3C1UA 5DWQA 5LPNA 5M29A 1ADBA 3K6SB 2WB2A 2P6UA 5TMPA 3LVBA 3TZBA 5FPKA 2GT1A 1V5WA 1M1YE 3ICOA 2WYWA 4RF2A 3PQEA 4XOUA 4MKRA 4BMDA 3CZRA 1J56A 1SELA 3DE5X 2ZSIA 2P2LA 2OCPA 4HS4A 1UC8A 4ZCMA 1C0LA 3AB8A 1R1DA 1O03A 1XZDA 1UMDA 4ABYA 1OPRA 2I65A 3B5JA 4Q16A 4FE4A 2P9ZA 4QU9A 4NG4A 4LFBB 1N6RA 1X9GA 4LUCA 1JHUA 2JVJA 2Q07A 5IC5A 2HLHA 5BSWA 3PEYA 1RQLA 2BCEA 2R7MA 1JEDA 5DNCA 3K6JA 4E2FA 3NXSA 2Z6AA 1CUIA 4AS1A 2VJOA 2CFIA 3JQRA 5THQA 2GBLA 3HJRA 1HURA 1E2JA 1QBKC 5FUYA 5I4KA 1IHXA 3BD7A 3I0ZA 3MJTA 5JBQA 1MZPA 2L42A 2X0DA 3LXUX 1W1UA 3BULA 1YUNA 3AP2A 3STXA 1XROA 1YB4A 1T3ZA 2E5WA 4QKQA 1ENOA 3O90A 1ZL0A 4LCEA 3C1AA 4IJ6A 5EE3A 5EKSA 1NUHA 3HO1A 5JTUA 1RKUA 2ZSAA 3R5XA 2OXEA 1HQCA 3CNOA 3F98A 5DHFA 2CK3A 3CU5A 3IPYA 4MYCA 4YEDA 1N0WA 1KR2A 2IXTA 1M8KA 4GH5A 5K2MA 3IT1A 1YZLA 3B82A 2UDPA 4YP5A 3G88A 1E9CA 3BFVA 4IJKA 5K0BA 2IUSA 3IBGA 4JDUA 4BNLA 2BN4A 3LT2A 3HKCB 1V47A 4FR5A 4Y2TA 3WXMA 5EIWA 4D96A 3ID6C 4MYDA 2X0EA 4EL0A 3ASZA 4AQDA 3ROTA 5CIYA 1I2DA 2O05A 2AJ8A 3PE3A 5CH8A 3K8YA 3AETA 2P40A 3TTSA 3TCXB 3TZLA 4G4SO 2YHSA 1NQVA 1B8OA 4LW8A 1HV8A 4ND3A 4RHYA 4WXMA 3IMEA 5FYQA 4ARSA 3A11A 5K0EA 5G1PA 1CULC 5B12A 4PAMA 5KQRA 1HF3A 3N8DA 4FFRA 1L5NA 3T94A 1P61B 2QTHA 2HI0A 2VJDA 5G1NA 2A5YB 4NWIA 1HE8B 2HB6A 5DNWA 1BCRA 3F6CA 1R8YA 2BE9A 5AKYA 2WTEA 5HCNA 3VO1A 2XQFA 1O77A 5EERA 3NEAA 1O0SA 1FC0A 1K6XA 1ORTA 1XZHA 2G8NA 2NZJA 2OORC 5AJTA 3SSAA 1N2EA 3GQBA 1COWA 2JAQA 1RKXA 2OCBA 2WYVA 5C0OE 3RVDA 3N2KA 3T3PB 3ZH2A 3ZJUA 3OTQA 3NLLA 1NMXA 1RKQA 1RWQA 3NIGB 1XDGA 3SHVA 3N6VA 3QMWA 1M1UA 1ECB