4PQYA

Mycobacterium tuberculosis reca glycerol bound low temperature structure iic-n4
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
328
structure length
316
Chain Sequence
TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Protein RecA, 1st part, 2nd part
total genus 97
structure length 316
sequence length 328
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4pqyA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4pqyA01
1E9EA 5FUXA 5FH9A 5L3SA 3QBTA 1VYVA 1BMFA 3K9HA 3OIWA 2O8DA 4DLVA 4P4TA 2CE7A 4ZKDA 3REGA 2FNAA 2PH1A 3EIEA 1RVDA 1TQ2A 4Z8YA 2VPPA 4PQYA 1QHXA 2FPKA 2ZE6A 2ZSEA 1Z0AA 3ZIAD 4B71A 4DIDA 1OHHA 2ZSDA 5JBQA 2P6NA 2V6IA 2CEAA 3R9WA 4PPQA 4EPXA 2FFQA 2OO7A 4GMDA 2XOKD 4M21A 1T3HA 1ESNA 1J70A 4OQXA 1KSJA 2BDTA 1BS1A 5BYJA 3UWOA 2GEVA 4TMVA 2NIPA 3Q72A 3ZH9B 5JJLA 2XOKA 1PZNA 3SYLA 1F2TB 1G3RA 3W3AA 4QBIA 2MMGA 3MJRA 2UVQA 3UG7A 1SHZA 4BE7B 5DH9A 4FMBB 2JGNA 4L5BA 4LJAA 1T4GA 3TRFA 3WMGA 2BM0A 2R9VA 3BIFA 2Q21A 4QHTA 1J90A 1OYWA 2GZHA 4PPGA 5G3ZA 4LHXA 1NLFA 3AUYA 1SQ5A 3DM5A 5KOYA 4QKQA 1E2FA 4UXHA 3FWYA 1AQYA 4IDPA 1R8QA 3B9QA 4DC9A 1YHNA 5DN6D 3AVPA 2FG5A 1G4UR 2AXNA 2CNWD 2CCKA 3MUFA 1Q1EA 1Y3AA 1FOEB 3HU1A 3GLHB 1MV5A 4TTPA 1DAFA 3W6OA 2WBLC 3NHAA 3V4FA 4FWTA 4FW9A 1NLZA 5FPTA 3R9IA 3SJCA 1QZXA 1GG2A 1N2CE 2LKDA 2WSMA 1N25A 1YVDA 3GEIA 2QM7A 1BH2A 3A4NA 1OXXK 3KB2A 3QKSB 5CLLA 4B34A 3WYGA 3BK7A 3P20A 4Q00A 4XVQA 2GTPA 2V54A 3RAPR 4KHZA 1ZC3A 5FOXA 2C77A 1MRSA 4Q1BA 4BLPA 2D74A 1CLUA 1WXQA 2AWOA 5FUVA 3WBJA 3KJIA 4DLUA 4LC1A 3K0FA 2WICA 3I1FA 5AR1A 4HUTA 5KNCA 1XD8A 4AG5A 3ZIAA 1W4BA 3A37A 3IEVA 1DEKA 1U8ZA 1NIJA 2JA1A 4LYJA 4D82A 5KDDA 1KDOA 5E7IA 3T1VA 3THXA 2HLDA 3RLFA 1E2KA 1GRQA 1KK3A 2P3SA 4JBWA 1E0JA 4DRZA 1EFRD 3SZRA 2GESA 1FP7A 4V02A 4DWJA 2ZRGA 5J4LA 3ZLJA 4GNKA 5L3QA 2WOOA 1P7CA 4B2IA 1VG9B 1UDWA 2J7PA 2WWIA 3EZ9A 4IVQA 3KUCA 2IYUA 5BYKA 3BC1A 4TZ6A 3W5IA 3KXLA 1Y63A 4KFTA 4PAMA 1DARA 4RKEA 3PV0A 1PLJA 2OAQ1 4KAXA 2EU8A 1E94E 3CNLA 1YR9A 1YZKA 1AN0A 3BORA 2QSYA 3KTAB 2NTYC 2IUUA 2CLSA 4DEYA 4Q4AB 2G3YA 1P2VA 5E95A 4OHYA 1JBKA 1EXMA 2ZSBA 1N5KA 4R71A 3VR4A 1W2HA 3A36A 3VTKA 4DZZA 1WQ1R 1YKSA 2A5JA 2B6HA 5KO2A 4Q4JA 1US8A 4Q01A 1NVVQ 1OKKA 4UKDA 521PA 3WHKA 3AP2A 4Q1FA 2FPMA 1MABB 2PZFA 1UJ2A 3AVQA 1U2RA 3CF6R 1OH8A 3ZZ0A 2ZITA 3ZS9A 1N5LA 2IYZA 3KJGA 5KPJA 5JJIA 2ZYVX 1TTTA 1K5DA 1ZBDA 2BJVA 2O8DB 4TMTA 2H1LA 4LV6A 4EJSC 4ITRC 2QT1A 1Z83A 2C96A 1CJUC 2WV9A 3B1VA 5DSZA 3G0HA 4MRRA 5FUYA 2EWVA 4G0NA 4HZUA 4OI2A 4CZ2A 1E0KA 2W00A 2IXGA 1D8TA 3CF0A 1OV4A 3R7WB 1QHSA 1WRBA 1E2LA 1XJ0A 3KQNA 1Z8FA 4Z1MA 2DBYA 1TUEA 4PO1A 3IGFA 4DDVA 1FPMA 3L43A 5LPNA 3EC2A 1BKDR 2GEUA 3MG9A 4KYIB 4MYTA 4D4KA 4PPNA 1XWIA 3RHFA 1SKYE 2BMJA 4IVRA 3BFKA 2HJGA 1GFIA 1JAIA 2CHQA 4X8HA 1JJVA 1XRJA 1LNZA 5J4VA 5TARA 5BW8A 2ZRHA 3K70B 3QXHA 2ZRDA 1HE8B 3Q7PA 3X1XA 1G7SA 4B33A 1CEEA 1FTSA 2VP2A 2VL7A 2AFHE 1TQ4A 2EYUA 2OILA 1H8HA 2IHYA 2XEXA 3HDTA 3KJEA 1GWNA 4N0DA 3R7WA 4RY2A 2BBSA 5J4HA 2GJ9A 4LBVA 4TYQA 1NLYA 2QL6A 1R4AA 1TADA 2CL0X 3AVXA 1G3IA 1E2QA 4PX9A 4EPTA 4I4LA 2DFKB 5DHFA 1GILA 2ZYTX 3BXZA 4Q9HA 3MWYW 4YMUA 1IN5A 1MKYA 2AX4A 2C9OA 3LQQA 3KQKA 3W5JA 4QJ5A 2ZI3A 3HWSA 3X1ZA 4XVUA 1Q22A 2LKCA 3PEYA 1GRRA 1TL7C 4DDTA 3SBDA 1NIPA 4FMDB 2QU8A 4D4MA 4MRPA 1F60A 1FNMA 2PLRA 1FL9A 1N0VC 1OXTA 1P9WA 3T35A 3VR5A 1CBUA 1IY2A 4UNRA 1GITA 1KI4A 4B3BA 2YC4C 3BBPA 1QVRA 2YZ2A 2OXCA 3K8YA 1XEWY 5FTMA 3GPLA 1X8JA 1G3MA 2H8KA 3HYRA 3Q9LA 5EZ6B 2HYIC 2XGJA 3RS0A 4OK6A 5TVKA 4NCIA 1ZM9A 4G5QA 5HCNA 1P9NA 4NE2A 1II0A 1G20E 4TN1A 5FR1A 2GXQA 4NCKA 4RD0A 3PUYA 5P21A 3PVSA 4R7ZA 4X8LA 3UANA 1E2GA 2HXYA 1A82A 1KSGA 3LO5A 1IXSB 4B75A 4BECA 2VSFA 3TGPA 1NVXQ 4DCTA 1NG1A 4ARZA 3QXCA 2GZDA 2ZJ5A 1OPXA 5CK4A 2DR3A 2J3EA 1IN7A 2WMOB 4BFUA 4JYCA 1EFCA 1E6CA 1E69A 3GJ4A 2IF2A 3CH4B 3OIVA 4B3DA 3WXMA 4AKIA 4B47A 1E2HA 3N5CA 4RZ3A 3LX8A 2ZRJA 4OI1A 3SS8A 3MAAC 4DHEA 5CDFA 3VKGA 1WMSA 2JASA 3O8DA 4ZIRB 1Q21A 1W0KA 3C7KA 1KO7A 5FTJA 4D25A 1DBSA 2QP3A 2QSZA 4JLVA 5DN6A 4HYYA 5JSZA 1GL7A 2O8CB 4NYMQ 5BXQC 3TUIC 4M1WA 1KJZA 4JSYA 2VO1A 3PXGA 2XZOA 4HB3A 2OUKA 3CLVA 4QGAA 2VP9A 4TMXA 1IXRC 3QXJA 1U98A 1KDRA 3GD7A 4KSBA 1RJ9B 4BZQA 4V0KA 2IL1A 3T5DA 4GOKA 2HCBA 3F8TA 4QG7A 1A7JA 3ZVRA 2VP0A 2A30A 4BRUA 4YONB 2GKSA 3FMFA 3NEYA 5LD2B 3IILA 2X1VA 1NF3A 2H17A 2ZJOA 3MSXA 4D81A 4DUGA 1KYIA 3L8YA 3OEEA 4QOSA 2ZRBA 1WP9A 1HYQA 5SZIA 1X1RA 4TLDA 5LBIA 2R6CA 1P72A 3GJ6A 1EX7A 1NY6A 1D2MA 2JLYA 3AVWA 1C1YA 4II7A 1CJMA 1QBKC 2VEDA 2ZI5A 1N6PA 4EFMA 2WJHA 4YLGA 2GCNA 4MH0R 3QI2A 1N6RA 2QE7D 3O8BA 4QFMA 3ONWA 3U4QA 1AGPA 1AIPA 1CJTC 2ERXA 5EXSA 5LB2A 4EJSB 1U90A 2GDJA 3QXXA 2QROA 2FDCA 2VHCA 5LDDC 1ONBA 2GXAA 4DDUA 4JSTA 1G5RA 3L0IB 4QNMA 4TLCA 1G7RA 3RWMB 1NNEA 2FSFA 3UPUA 2BHRA 1BIFA 2TMKA 2Z83A 3FFBA 2GA8A 2SHKA 4F4IA 4LOAA 3K9LA 4J0QA 3RSOA 4FMCF 1VIAA 1DOAA 2GF9A 2JATA 2R6DA 3KKNA 2NPIA 2J59A 2F9LA 2OXRA 4GOXA 4KFUA 3IO5A 1TAGA 2ZSFA 2HF8A 3KL4A 4Q4HB 1IY1A 1HQCA 1U8YA 4O2RA 2EVWX 4PANA 2PZEA 5CYOA 5EUQB 4M22A 5B58C 4Q9KA 3ZVMA 1X3SA 2O8FB 2ZRAA 1JPJA 3G5UA 4BASA 1G16A 3ZQJA 3BS4A 1K6MA 1NN3A 2AD1A 3DOEA 3EZ6A 3U7GA 2ZUBA 4O0MA 4A2QA 1ODFA 1KNQA 3ZJYA 1G7CA 2NOAA 3MWKA 2W6IA 1ZM2A 2DHRA 1S96A 3QVUA 3QPVA 3Q5DA 4Y0VA 1R0XA 3CZQA 4QM7A 4RD2A 3QVVA 1QHNA 2JAQA 5J4YA 1G6HA 3VNVA 4FMCB 1Z6AA 3QSYA 4M1KA 3C8UA 4Q9LA 4AKHA 3OE7D 2FF7A 4LJ9A 1AKYA 1MO5A 2F43B 1DAIA 4R98A 4EFLA 5EUMA 5EZ5A 3SQXA 4C30A 2YINC 3UK6A 2ZVQX 4D0NA 3NXSA 821PA 4G3XA 4BLOA 2Q9CA 1J8YF 1CIPA 4TMKA 4C0JA 4L16A 3A4MA 3QKSA 2O5VA 3A1TA 3UMRA 5AUOB 2ASEA 4TSFA 2CE2X 2ZS7A 1N6KA 1PV4A 4JVMA 1EFRA 3ZZUA 2V6JA 2EFCB 2P0EA 3UXMA 1N6OA 3PENA 4IOJA 4XOIA 3RYTC 3C14C 3KFVA 4HAYA 4JIMA 4BGDA 3WY9A 3NBFA 2LCFA 2H5EA 1DS6A 3MWJA 3KFXA 4QJ4A 4BLSA 2DPXA 721PA 1FTNA 4C4PA 3CX6A 1HQYE 1P62B 4EPYA 1DG1G 3GLIB 4TMWA 2J5XA 3LBHA 3M6AA 1VCOA 1M2OB 2ZEJA 2YWGA 5TMPA 3HP1A 2YNMA 1E4VA 4MKGA 1DG3A 5EE1A 2LWIA 4PC1A 3I5XA 1J99A 1QHIA 4ZCLA 4EUNA 3AP1A 3BJIC 1JPNA 3CZPA 3FE2A 1Q3HA 3LDAA 4S35A 4M2LA 2B7BA 4PTLA 2J0UA 2NO9A 1JQLB 4TT3D 4I1SA 5F9HA 3AVYA 2ZRCA 2XSZD 4DCUA 1I4DD 4OJQA 2WOJA 1F2TA 4MGIR 4C0LA 3CX7A 1GSIA 3AV0B 5KHOC 4WXRA 4IKEA 1U0HC 1W5SA 2YV5A 3QXSA 5DI9A 2YKGA 4BPBA 2A78A 4U5XA 5DI3B 5AJVB 5FOTA 5FL3A 1W44A 4BFVA 5TV2A 3D7MA 3U3OA 2KWIA 5AJWA 1O3YA 2P65A 3DPUA 3SFVA 2QY9A 2RAPA 2IUTA 3LRPA 4CEIB 3RC3A 1E9BA 4LV8B 1GVNB 4N0EA 2OEPA 2J46A 1G5TA 1NKSA 3T12A 3X1YA 1IONA 4GZLA 5J4KA 421PA 2QGZA 2JJ2A 5AJYA 2AKAB 1UBGA 1IN8A 1DAGA 1K5GA 4LZZA 2ZR7A 1KZ7B 1TX4B 4ASUA 1U9IA 1UM8A 4CEJA 2B8TA 4Q48A 1BO6A 1IAQA 1S9DA 4ZDKA 3HPQA 1E9RA 5FI0B 2UZ3A 3VKWA 5C4GB 4U7DA 2KE5A 1AK2A 4NONA 4EIWA 1S8FA 2D4HA 2ODNA 5JLJA 4F91B 2WJGA 3QE0A 2NO1A 1H8EA 1D2NA 1HA3A 1U8AA 2W0SA 4LYFA 5KUTA 1A1VA 2OG2A 3K70C 1OH7A 2CK3D 2Q3MA 3SEAA 4AYTA 1SGWA 2Q3HA 3W6PA 3AVUA 1S2MA 1YRAA 4FCWA 1ZNYA 3RS3A 2IC5A 3PFIA 4Q1AA 1CXZA 3M1IA 1W0KD 3U44B 1NI3A 5JWHA 3NBYC 4MKIA 1UKZA 3QENA 2O8EA 1OJLA 3W8RA 4WW0A 1Z2AA 4UNNA 3FHOA 4DLTA 1ZM4A 1TF7A 2EFGA 4WZAE 1FUKA 4D2IA 5CB8A 4IXNA 2F9MA 1ZRHA 2OHFA 2WJIA 1XTRA 4TT3A 4B3GA 3HPRA 4QJ3A 1YQTA 2GAOA 4C7OA 1DAEA 4ON9A 1MO4A 2GJSA 3E5HA 5D3MA 2P6RA 3FMIA 1UF9A 4OHWA 2R6GA 2IEZA 2OM2A 2G9NA 4L9SA 4Q02A 1MABA 4FI3C 2CXXA 3VQTA 3LLMA 4Q7MB 3I62A 5GADl 2F3RA 1L7VC 4M9SA 3A1SA 5LB4A 4LYAA 4NKRA 1GNQA 2DWQA 2ZYUX 3PITA 2RGXA 1Q3TA 4M1TA 1DAKA 4RCZA 1Z5ZA 3LAWA 5D3MB 3A4LA 1OXSC 2BIFA 3ICQB 4Q1CA 4CEHB 2OBLA 1VG1A 2K5UA 4MGZR 4AKEA 4E09A 1XTKA 1T3SA 5B64A 4TYPA 2IWRA 3BH0A 4BRWA 1A5TA 2PBRA 1E2EA 2ANCA 4V0OA 4WA7A 4OK5A 2RHMA 3U3MA 1ZM7A 2QAGB 4PC6A 3AVOA 2NO0A 3BWDD 3T1OA 2BEJA 2FX3A 4M1MA 5IK2D 1S9HA 1P9RA 1AA9A 4NYIR 1UBFA 1MO6A 2CCGA 5EE3A 4A6XA 4MITA 5HKKA 4UJ5A 4IOLA 2MSCB 3AKEA 2BBTA 2YWHA 1YE8A 1T8UA 4RD3A 1GTVA 3CONA 4C0SA 5EP3A 1YZGA 4URXR 1R5NA 3JVVA 4JT2A 4RSGA 2AR7A 2DY1A 1KI6A 4KVAA 2IW3A 4TZ0A 2J0QA 2XZPA 4LHZA 1NKTA 1KDTA 2WJYA 3MRSA 1KIMA 5TDHA 3KXIA 3FMPB 4Q7LA 1W0JA 4TTRA 4C0BA 1XXHA 2R6FA 1R2QA 4FD2A 4CT5A 1U99A 4JLNA 3T1QA 3TBKA 1P73A 1KJYA 1OXUA 4Q1DA 3THYA 1P6XA 4N1AA 2R2AA 2HV8A 4NPHA 2A5YB 3K0SA 4AK9A 1NMYA 5F2EA 1Q44A 4WAUA 1XEWX 4F4CA 1SXJC 3B9PA 4P4SA 4TLAA 4WIAA 4LWZA 1U81A 3U6BA 4GL2A 1LS6A 3QOFA 4TYNA 1CR1A 4AIIA 4JBYA 1E99A 1UDXA 4ZDIA 2ZTSA 4A0FA 2JJ1A 2HT6A 1OLOA 1V43A 3ADKA 2QP9X 4HB2A 3GLIE 1LTQA 1COWD 2VLIA 2I3BA 2C9YA 2X77A 4IDHA 5G40A 4A8JB 4ZI3A 4Y0AA 5IDVA 1MO3A 1RRCA 1F6BA 2ATXA 1WA5A 2XB4A 3FVQA 5IK2A 4GRAA 2WTUA 3AF3A 4MKHA 2IYWA 2RKOA 1T8TA 2A2ZA 2ZRIA 4AYXA 5HPYB 4P32A 2ZAMA 4BFXA 2JEOA 1KJWA 1YZNA 4Q1EA 4EAQA 2FSGA 1H8HD 2WAYA 1PJRA 2FEMA 1R0ZA 4EKDA 2ZJAA 3S1AB 1QHGA 3KJHA 3GCGA 4JZKA 1XMIA 1CS4C 4HLQB 2N1BA 2ORWA 5AK0A 3A8TA 1CR4A 1F48A 4GDFA 4NYIQ 3GMTA 4LJ4A 1ZD1A 1NN0A 4NBSA 4EQ6A 1XCPA 1NBME 5FTNA 4CGZA 1T0JB 5JI2E 2JLXA 4TL6A 4E22A 1G7TA 1RE0A 2X8AA 3U44A 4U02A 1ZNXA 4WVFA 4JYBA 4KLNA 1TEXA 3TE6A 4MDEA 4YQFA 3WP1B 1U0LA 2NPFA 4IOKA 5FOWA 2O0KA 4M4SA 1NG9A 4D26A 3W90A 3QG5A 5DI3A 1CJVC 1KO1A 2D2EA 621PA 1RRPA 1XCGB 3BFXA 3OESA 2BJWA 3NWJA 1KY3A 1G18A 3K09C 1KK2A 1XZQA 1E32A 2I1QA 3T06B 3RS4A 3I5YA 1SVSA 1BMFD 4JL8A 1J8MF 1R0YA 1Z6GA 4POAA 3ECCA 1D5CA 2FPLA 2KB0A 3K0EA 2FN4A 3K0AA 4LJ7A 1YRBA 2NGRA 2ZQ5A 2FZ4A 2XNDA 4M9QA 4D0GA 4A6PA 2C5LA 1R8SA 1N5IA 2CVFA 3HU2A 2GBLC 3IBYA 4KSCA 2CL6X 3VU9A 1E9DA 2R65A 3MFYA 4QGGA 2QG6A 3Q3JB 4MUAA 2J1LA 2F1HA 3BD9A 3PG5A 3TMKA 5IF9A 3BE4A 1T9HA 4B35A 2QP4A 4F7WA 3MD0A 2C98A 4C2TA 4YXWA 2GBLA 4BFSA 4DSNA 1CP2A 3FYHA 3HYTA 4BZXA 1KSHA 2QEQA 2YWFA 1KTVA 5EE5B 1GZSA 5HKKD 1GKUB 4YXWD 4YDSA 2QTHA 5JECA 1NJFA 2BMDA 4FCTA 2V7QD 3K53A 3TJZA 1E0SA 4A15A 3KZ1E 3ZS8A 3I8XA 1MH1A 2E1RA 4URVR 3LA6A 5JRJA 1II8B 2Q9BA 2YVUA 1EX6A 3S1AA 4W9MC 3DMDA 3BOSA 3TR5A 1LW7A 3GFPA 1MRNA 4Q4LA 3QBVA 5A0FA 4NYMR 2ZU6A 3RABA 3I72A 1JALA 2GETA 1Z6YA 2IYRA 2P5SA 2WPDD 3NHBA 1Z29A 2AN9A 2IBMA 3CF2A 2BWJA 3RRYA 4A8JC 4JMPA 5EE9A 3SOPA 3AKYA 3L2OB 3TW8B 3QQ5A 2O0JA 4DKXA 1OKKD 4XD7A 2QQEA 3UMSA 4V0ME 4A8JA 1EFTA 3H84A 4JLJA 4OI4A 1ZP6A 4PZYA 1HURA 3EPJA 1RZ3A 1UKYA 4HLUA 1VCIA 3CBQA 3CPEA 3FGNA 1UFQA 221PA 4B44A 4DUGD 4Q9IA 1IHUA 2E87A 3BRWD 1G41A 1Z28A 3SE0A 3UG6A 5HE9A 1Z0JA 3PUXA 2ZRPA 2NO7A 2IS4A 1UKEA 2CLDX 3I3SR 2VP4A 1VYUA 4HLUC 1R5OA 4V0MA 3OHMA 3GEEA 4EQ6B 1LY1A 3EZFA 4LHYA 5CDFE 2GXSA 4CIDA 3QEJA 1IJEA 2WVJA 3EASA 4KXFB 4AC9A 4D6PA 3J81k 4PO8A 3GLFA 1E2DA 3ZGXA 3I73A 1FW6A 5JHGB 3THYB 4D0LB 1DTSA 3T1TA 2VP5A 4P33A 2ANBA 4P31A 4G1UC 1GKIA 4M53A 2J0VA 1NBMD 1SVKA 2W83A 3WYAA 1KKLA 1XJQA 4NYJR 1VHLA 4EJSA 3A58B 5GJBA 2FFAA 2D62A 2ZI6A 5SZHB 1GKYA 3WRXC 4B74A 3CB4A 1FMJA 2PT5A 4LI0A 3MCAA 2V7QA 2JLSA 1WE2A 5JMTA 5CIQA 4BZPA 5KDOA 3GJ7A 3K9GA 2DB3A 5D3QA 3EWAA 4PC2A 2ZI7A 3CNOA 3SJAA 1KI6B 3SU8A 3HR8A 4PQRA 1XEFA 4Q7JB 3JZAA 3QKTA 4H1VA 2V8OA 4NP6A 3AF0A 1XP8A 1G5PA 3FKSD 1L8QA 4JL6A 4ERNA 4YMTA 3OFND 3PEUA 2WPDA 2WZQA 1FNNA 2O8FA 1YZUA 2ZR9A 1NSFA 3DKVA 3LNCA 1ZIOA 3CRMA 3SFZA 2FSHA 1U94A 2ZETA 1SVWA 3EW9A 2PL3A 4PAOA 2XX3A 2ZSAA 2G6BA 2JLWA 3BH7A 5TY0A 2A3RA 2QM8A 5FI1B 1XEXA 2B8WA 5C4MA 2PJZA 5KNDA 4IOMA 2XTMA 1ZUNB 3D3QA 2CCJA 3KQUA 4UXIA 1G19A 3CRQA 4XWOA 4G5OA 1OIXA 1XFAA 2QN6A 3F3YA 2QORA 3EARA 3EX7C 4V03A 2W6ID 2ZU0C 1DE0A 4EDHA 2V1UA 2C04A 2FOLA 3RRNA 5EE0A 3CH5A 1HEIA 4DSTA 4DBLC 4V0LA 1NMZA 1QRAA 3AVVA 4HLCA 1R10A 2WKPA 3DDCA 4Z8XA 4A92A 3PIRA 2O8CA 1VIYA 1BYUA 3ETLA 1SXJB 2PLFA 1KI8A 1E0AA 5GJCA 3QEOA 2REXB 1HTWA 5EJEA 1VHTA 1GL9B 2C8VA 3QKRA 2D7DA 5B30A 4H9GA 1G8PA 5JRZA 1E96A 121PA 2VHJA 4CW7A 3P4YA 1TQ6A 4HDQB 1TEVA 2NZJA 2CHVA 5B2ZA 4LPKA 3QF4B 2OLKA 2FE4A 1R6BX 3H1TA 4A82A 3EZ2A 3SJBA 3EXAA 4URUR 5A5GA 4MYUA 2BBOA 5ANRB 3C41J 2A5GA 2O8EB 4QRHA 3K0AB 2V9PA 3DEFA 4NTZA 4OL0A 4A9AA 2VBCA 4LYHA 3EPKA 1T0HB 3EA0A 2BMFA 1D6JA 1KI7A 1RJ9A 1VMAA 4WZ6A 1Z6XA 2Z5FA 4R2HA 3KKQA 2XJ4A 1M74A 2CHGA 2C9CA 4HAWA 2HF9A 4UQOA 5HTKA 5DHAA 1LB1B 4CT4B 4CEHA 3LBNA 2PEYA 2IEYA 1J7KA 4RZUA 3P26A 1UADA 3MMPA 1SKQA 4ZI2A 3ZYCA 2ZE8A 2D06A 1JAHA 1KOFA 2GK7A 2C95A 1XB2A 2ZUDA 5KSOA 1KO5A 3AKCA 2XXAA 1TNDA 2ODEA 3GJ3A 1E79A 2RH5A 1G8HA 4A2WA 1X8KA 2ZI4A 3BFVA 1F2UA 3IBGA 4OYHA 2OT3B 3TUZC 3U61B 3VMFA 1QG4A 1L2TA 2IYXA 1AKEA 1B23P 4PSAA 4EFNA 2P2LA 3LW7A 4W5WA 1OB5A 1E2IA 1E2PA 1TUIA 4ARZB 1GL6A 2ZS9A 3IPXA 3NVAA 1LF5A 2OFOA 5FBRB 1FQKA 1UPTA 2QI9C 4X8OA 5CM8B 1E9AA 1SVLA 3NTUA 4GSYA 3L0PA 2ATVA 5FBWB 3X2SA 3D8BA 3M0EA 1KGDA 4IDQA 3KQHA 2BKUA 1XPOA 4IEIA 2FFBA 1ANKA 4Q4JB 1VKJA 3A1UA 2F6RA 1D9ZA 2CL7X 3ND9A 2ZRLA 2WJJA 4RKFA 1G8YA 1AM4D 3KKPA 4KBFA 1A2BA 4XH9B 2JLVA 1V5WA 4OHXA 3O8CA 1AS3A 3CM0A 4LCBA 2AKYA 2GWHA 5KTYA 3THWA 4PHFA 2QMEA 3NBZC 2VHQA 3R8CA 3GJ0A 2H57A 4DSUA 1W46A 2B21A 1G3QA 3TIFA 2G88A 4OJKA 1Z0DA 1RIFA 2QMUA 1VECA 4UNSA 5E3HA 1EK0A 3HU3A 5HCIA 4ZV4A 2ODBA 5L3RA 5CITA 3C4JA 2ZREA 2QQ0A 1FP6A 4OQMA 3V9PA 4A0HA 3IKJA 1X86B 4LGMA 2J7KA 1Z22A 4LJ8A 4P4SB 2PCJA 1ESMA 4PHHA 3PUZA 4AG6A 2QZ4A 1LV7A 2PZGA 3QF4A 2OCAA 1VDZA 3B7GA 1P4SA 4PHGA 3SHFA 2J0SA 2VA8A 1HT2E 1OW3B 1RYFA 3CIOA 2PX0A 1NVUQ 1KAOA 3IO3A 2G83A 4PPFA 1M8PA 2QPAA 4PXAA 2C2HA 2IS2A 4DXAA 3FOZA 2H92A 1VTKA 1SHKA 3B1YA 1CRQA 1I4TD 1TF5A 5K8TA 1G291 5K8UA 2DWOA 4C0AC 3SHWA 2N46A 5CIWA 2AK3A 2QNRA 2W6JD 3NG1A 3Q7QA 2A5DA 2G77B 5FOSA 5JEDA 4CDGA 3LY5A 3T34A 1W4AA 3IHLA 4FWIB 2ZJZA 2V3CC 3RDPA 1NN1A 2IUSA 3W8NA 1XMSA 1E79D 4G5SA 2GHIA 2AXPA 4NH0A 1WBBA 2NG1A 5G3YA 4OBEA 5HE8A 3MJHA 5DE3A 1KI9A 4Q4AA 5FBVB 1NSTA 3CWZA 2IXFA 4A36A 1E2JA 1Z0IA 3TR0A 5GJWC 2DWPA 4B76A 4ZDWA 1A4RA 3UWKA 5C46F 4IRUB 1JECA 4OHZA 1OF1A 3VR6A 2OFXA 4Q19A 2JIZA 5ELXA 3I8SA 1OXVA 1JR3E 4LPSA 3PQCA 5HZKA 1N0UA 4JJKA 1T5LA 2GJ8A 3IHWA 2QAGA 3LLUA 4TL7A 4Z1MD 3AUXA 2QBYA 4FN5A 1UKVY 4MKFA 2YOHA 3K70D 2Z0MA 3UATA 4Q5IA 4IFEA 1I4LD 2CLCX 3LXRA 1JI0A 3EPHA 4MA4A 5EXPA 2XB2A 2QAGC 3AQ4A 3H4MA 1VCMA 1UBCA 2PEZA 5FOVA 2I1VB 3B85A 2EWWA 5JJKA 3T61A 4PSKA 4IHQA 2WWYA 4LSGA 1OE0A 3K9NA 4US1R 3I32A 2WAXA 2VYFA 2NMVA 3QKRB 4JKIA 1ZCAA 4NCNA 1L4UA 4I99A 1R7RA 2IYQA 3QNUA 4BLTA 2VTKA 4HDOB 3ASYA 4HI0E 1HH4A 2NQ2C 2FA9A 2N42A 1IN4A 2F43A 5H70A 1D9XA 3TSOA 5L8VA 4W5JA 4LRWA 2ZYWX 1JNYA 3FHCB 5CK5A 4QBFA 3IDQA 4PQFA 3P4XA 5CYPA 2GJKA 1ZNWA 3EIHA 1M1YE 3CPJB 4I1OA 2ONKA 1VG0B 4ACAA 4KV9A 1GRNA 4M1OA 1AZTA 1AA3A 3OIYA 2ZJ8A 4A0RA 2IYYA 5FBLB 2ZUCA 2GF0A 3KKOA 1W5TA 2FEOA 1YU9A 3B2EA 3QPUA 3NEJA 1U0JA 2AWNA 5BWMA 2IXEA 5EXXA 5EP2A 1RYHA 5EXTA 3BB3A 4NDZA 1I2DA 2OBNA 5J40A 2ZIAA 1IN6A 2JJ1D 3LD9A 3VU9B 2G0TA 1MOZA 3NC1C 4DT1B 2XITA 4DLXA 1PVOA 3R9XA 4UNQA 4FXPA 2IT1A 4WBSA 3TH5A 5KU1A 3OIUA 3QUSA 4XVRA 1OIVA 1TPZA 4HB0A 2WWWA 1KHTA 5H68A 3TLXA 2DFNA 3W34A 3GJ8A 1TMKA 1GOTA 5FUWA 3WYFA 5AUPB 5L3VA 3EPLA 2BCJQ 2H18A 4BEJA 3THXB 1XDBA 4W7SA 1ZD9A 1ZIPA 2PJRA 3AVTA 4P4UA 3WHLA 1Q0UA 3ZDQA 3I92A 3SN6A 2VP6A 1Q57A 4PHTA 1OH6A 5DYGA 1PLKA 3ZD7A 3VKHA 1F3OA 2KJQA 3H2YA 4BFWA 4AY2A 3PR1A 1ZM3A 4UJ3A 2VF7A 4HAVA 3LH5A 1FMLA 4B6EA 2AK2A 4KJZA 2ZRKA 3MLEA 1GM5A 4PSVA 1XCMA 4JVNA 1YR7A 3SI7A 3I61A 5EP1A 5E7MA 2PT7A 3FPAA 1ETUA 4GP6A 1Z0FA 4ZDJA 2XTNA 3VHLB 2W58A 4B48A 3LX5A 3RRZA 5DYIA 4ESHA 5HR5A 1K8RA 2VRWA 2ZJYA 2OBMA 4IW3B 2V1XA 5JS8A 1B0UA 1CU1A 1A2KC 3ZQ6A 4YMSA 5AUQA 2JCSA 4MDFA 4OQLA 1JR3D 4HATA 4KVGA 1T6NA 4URWR 3TAHA 3DL0A 3AF2A 4JLPA 4LJ6A 4BFTA 3ND8A 1MR3F 3PEWA 1XXHE 1YZLA 2CJWB 1KI1A 1E4YA 1RKBA 2GNOA 3B78A 3CX8A 2OZEA 4KCGA 4RZXA 1DADA 2QBYB 2Z4RA 4F93B 1E3MA 2IYSA 2ORVA 4M8NE 4GT1A 2AFIE 1OH5A 1S1MA 4TWZA 3JVUA 4L9WA 4DDWA 2MSDB 3OEHD 5FR2A 1ZJ6A 4URZR 1HUQA 2ODWA 3AEZA 1S3SA 1DPFA 4DJTA 1O87A 4DB4A 4K81B 3KKMA 3F5FA 2RGNA 4NCHA 1LF0A 3VAAA 3NBXX 1JJ7A 1NMXA 2GCOA 2IHBA 2XTZA 5GVRA 1VPLA 1JB1A 2VF8A 3REFA 3TVTA 3GLIA 2X2FA 4DEXA 4XTCS 3RS5A 1AGRA 5FBQB 3ZD6A 2RGNC 4GBMA 4IVPA 1AS0A 3DZ8A 5IT5A 2JIZD 4B3XA 2JDID 3DVLA 1SXJD 3H86A 5F9FA 2R44A 3AB3A 1NBMA 1TU4A 4RVCA 3VFDA 5FOUA 2D7CA 2WIAA 3LBIA 1LFDB 2X2EA 3QJYA 4DCNA 1G17A 4PC7A 3WMFA 1EWQA 3FKQA 3LV8A 3UKDA 3GLGE 4XSGA 2EQBA 1I2MA 3WP0A 1QVAA 3UMFA 5L3SB 3O8RA 5H8WA 3C15C 3EA5A 2KBEA 4A2PA 4US0R 2NO6A 2DFTA 4LJYA 3N70A 5BN3A 1N6HA 4MUBA 4GP7A 3SBEA 4DLRA 3FHTA 1XD9A 2UZIR 3G82C 3U7FB 5F3WB 4KO8A 4TMZA 3I4LA 1IXZA 1G1MA 2GEDA 3P1JA 3AP3A 1IJFA 1VYTA 2OV2A 4XSHA 2XZLA 1FUUA 4RFVA 3QKUA 2EFEB 5DGXA 2Q6TA 2YWEA 2XXAB 3C16C 2V4ZA 1ZAKA 2OSBA 4AWXA 3THWB 1Q20A 1KO8A 1G4AE 3CUEF 3B5JA 4V0NA 2GCOB 2F55A 4XD7D 1LVGA 4M0LA 1IOZA 3OZXA 4BFZA 2I4IA 1S3GA 2OCPA 1AS2A 3LFUA 4JT4A 1XTSA 4GZMA 4BLQA 2F1IA 1IY0A 3KXKA 3VR1A 4JL5A 3RWOA 1DELA 3L0SA 3RSLA 3KUDA 2WKRA 4QNRA 4QM6A 3WRYC 2FV8A 3LWNA 3FFAA 1XMJA 2VSOA 1GP2A 5HZHA 1PLLA 4AD8A 3O47A 2VHTA 4ZO4A 2O8BA 4KI0A 4HAZA 1M7HA 3ADBA 4R2IA 4ASUD 4GI7A 4TQAA 5KDLA 3TVDA 3U3RA 4D4LA 2OE2A 3EZ7A 1G6OA 1CR2A 4U00A 4E5UA 4RZ2A 2H7VA 8OHMA 3BB4A 1JXOA 1ZW6A 1XPRA 1Z08A 1E9FA 1KAGA 2JJ8A 1N0WA 2QENA 1OFIA 4JLOA 1OYYA 3EG5A 1M34E 4CVNA 1JEEA 4TQ9A 4DVGA 1XTIA 5DO9A 2BM1A 1WF3A 2Q0HA 3RANA 2WSSA 2P5TB 1XX6A 2JDIA 3GFTA 1VG8A 1SXJA 3L82B 5GVSA 3T15A 1ZU4A 1YJ5A 1ZMXA 1E2MA 2G1JA 4LUCA 4LV5B 4AI6A 1N6IA 1G9XA 4ABYA 3SYKA 1XU4A 2AHOA 3EIQA 1OFHA 2E9SA 1W36B 4JJZA 4LBYA 2Q3FA 3KTAA 2JLZA 5JZVA 4BEBA 3K1JA 3GP8A 2WHXA 2WIBA 1SXJE 3SJZA 2CK3A 3WMEA 1C9KA 1N6NA 3DOFA 5C18A 1ZU5A 4IEEA 2ZPTX 4PFSA 1R0WA 4D80A 4MQBA 1UAAA 1Z3IX 3DO6A 4HZUB 1W36C 4KLZA 1N5JA 1GDDA 2WJVA 3CO5A 3Q8XB 1OT3A 1KI2A 2GILA 3R8FA 2FFHA 1M6NA 5G41A 4C9BA 1Q12A 1KO4A 2IYTA 2ZI9A 3DHWC 4A4DA 2QPTA 1FFHA 3AKDA 1NP6A 4PZLA 1EG7A 4KBGA 1XTQA 4NHOA 2ZM5A 3IIMA 1UEIA 1MT0A 1VCNA 3CW2A 3TW4A 2YOFA 3AM1A 2HXSA 5EQTA 1XXHB 3ADDA 1P61B 2FU5C 1G8FA 2GVZC 1TU3A 4LDJA 4PZZA 2GK6A 5JS7A 5JSZB 3C5HA 1US8B 4FINA 1AJEA 4MRVA 5IHPA 4K46A 4B32A 3OE7A 1HE1C 4K8OA 4OHVA 1YZQA 2GCPA 4XJXA 1CF4A 3A1WA 3NDPA 2WWXA 4UXJA 3KB1A 5C2JB 2FJUA 2MMCA 3QF7A 3PCRB 1P75A 3U3KA 1II8A 1OHHD 2RB4A 1G8GA 3GLFE 1ZC4A 1ZYUA 4RFSB 4GMXA 5CJ2A 2JJ2D 4E03A 1W47A 1KMHA 2YJTD 3B13B 4RD1A 4TSFD 1P3JA 2YYZA 2REBA 2WWFA 1COWA 1KK0A 2D3WA 1GIAA 4JLBA 2JLUA 4BFYA 2IYVA 3GLFB 3FDIA 2HLDD 1DVRA 2ZJ2A 3ASZA 2HEIA 1XEXB 2Z4SA 3B1ZA 3D6TB 3F0TA 3MWLA 4B73A 4E07A 1X8LA 5K8IA 4HZIA 4YMVA 3K09A 4MRNA 1NJGA 3U60B 1PUIA 1S0UA 1JXMA 5AUNB 5L3QB 1HT1E 4IFBA 3X1WA 2GRJA 2IK8A 4IJMA 2QGNA 1H8ED 1QDEA 1ZCBA 2ZR0A 2A9KA 4JKYA 3SNHA 2A7QA 3QY0A 1XD2B 4URYR 5BQ5A 4LHVA 2Q9AA 1CJKC 2Z6VA 5KNBA 4PO9A 4G5RA 2IX3A 5DLQC 2RHDA 2UKDA 4ZKEA 3B8HA 4ACBA 1TQDA 1EGAA 5BN5A 1GAJA 1P2SA 3RRMA 1KKMA 3KQLA 3PJRA 3K0FB 5H1YA 4I1UA 4US2R 3DMNA 4M9ZA 5FTKA 2CNWA 1P5ZB 2WM9B 2X19A 3KDSE 4P0TA 3W3ZB 3CR7A 3RS2A 1Z07A 3GJ5A 4Z54A 3DKPA 1GNRA 3IEUA 4LC0A 4OK3A 3GLHE 4BUJA 1NVVR 1GNPA 3TQFA 1T91A 2HJVA 3E70C 2CDNA 2FH5B 3D31A 4LX0A 5FL7A 1SZPA 3RS7A 3NH6A 4TL9A 4B6FA 3AGQA 1XPUA 4JLAA 3L0OA 4N3NA 3U2QA 5CM9C 2P6UA 5FL7D 5FFMA 3VR2A 3Q85A 3WNBA 1N6LA 3CRVA 1QF9A 5FPKA 3GLHA 1S1CA 1SVIA 4CYMA 3JZMA 4IDOA 2BMEA 4HSEA 5FPHA 3B1XA 2XJ9A 4Q66C 5JEEA 5IRCD 5FTLA 4HAXA 1LS1A 4QGFA 4AKGA 3GLGB 1NRJB 3EC1A 1ZVQA 1CTQA 5CJPA 2RGAA 1ZUHA 3DM9B 2OFWA 3U6KA 3GEHA 3SDZA 4IXMA 1FX0B 5KPDA 3TKLA 4B3FX 2J41A 2OAP1 3TQCA 1E9CA 3AH8A 1FZQA 4M9XA 4YC7A 4QBGB 3KX2A 4G01B 4Q9JA 1RRFA 4A0GA 2QMHA 1Q1QA 4S2EA 2ONJA 3BAFA 2RGEA 1W7AA 2H16A 2ZRMA 2OCYC 3A6PC 3OF5A 4Q21A 5JI3E 2F3TA 2EYQA 2R6AA 5C1BA 1T5IA 2HT1A 1KMQA 3FKSA 3T5GA 1YR6A 3X1DA 4GPTA 4DCSA 1W0JD 1G64A 1OIWA 4LY6A 4WXPA 1WB9A 4I1VA 3FB4A 4HDCA 4XTRA 4DLYA 4OI0A 2AL7A 2BOVA 4JBXA 4RD4A 3WBKA 4JLKA 5UKDA 2DFLA 1SVMA 2PMKA 5GJVC 2W0MA 3LXXA 1L4YA 2J87A 1D2EA 4TTQA 2FWRA 3TUJC 4KITB 2R62A 5JHHB 1DAHA 2PX3A 3P27A 4TQUS 1AZSC 3QPWA 3P32A 1W49A 2VQSA 4Q7KA 4A1FA 2RGCA 4KODA 5LD2C 4BWYA 2J0UB 2BVNA 4OQFA 3NIBA 4IDNA 4YDHB 5KSZA 4C0QC 1FX0A 1ELOA 3THOA 4QHSA 2C99A 1OB2A 3TSWA 3CRW1 1P60A 1XD2A 3FTQA 3B6EA 4DLSA 4M1YA 1WBDA 3W6NA 2F1RA 1BYIA 1J2JA 3LW8A 1NN5A 4HEJA 3LQRA 3SQWA 3SYNA 4MGKR 3EAQA 5CLQA 4RCYA 2ZE7A 3U3JA 1KI3A 4L4UA 5TXGA 2IS1A 3E1SA 4KYUA 4ZCMA 1UBEA 2WWGA 1RPZA 4QL3A 4B2LA 3ZVNA 2J7PD 3NH9A 3VX3A 4QBHA 3IIJA 2J45A 2ZJBA 5EP4A 3LVQE 3TAUA 2XAUA 3EWSA 3HR7A 1RC8A 2HUPA 2O0HA 3L8ZA 1CRPA 4JLMA 4BQSA 2QPOA 4QHYA 1F5NA 2ECKA 2FGJA 4FMDF 2JLRA 1Q1BA 2GAAA 2FGKA 4NYJQ 3PUWA 5JWRA 5AJZA 5JWOA 4RFSA 4ESVA 4F4JA 4B2PA 2CMKA 4XIGS 2OLJA 4PC3A 2EFDB 2O52A 2DYKA 1P2UA 1QHYA 2YC2C 3B82A 3RVBA 2FSIA 3E2IA 4L8GA 5DISB 2G1KA 1Z2CA 2QRNA 1WCV1 3CNNA 4C0KA 1Q1ZA 2WMNB 4H1UA 2QAJA 5K8LA 4Q18A 3U4QB 2XSZA 4XWAA 2AD5A 3RNLA 4RJLA 2QA5A 1W1WA 1XNJA 2ZE5A 1JR3A 2BBWA 1HY3A 2GJAA 2KSQA 1U9IC 4NZYA 2BEKA 1KZGB 2BV3A 5B57C 1AQUA 1NVWQ 2B92A 4B43A 2P67A 3SR0A 2ZANA 1XMVA 1E1RD 2G0NA 1M7GA 2J9RA 4EPVA 1SVOA 2QUZA 2WWHA 3AF1A 2PCLA 1M7BA 3PEVA 4LBZA 2DCUA 2RGDA 5BN4A 4O3MA 1G21E 1XF9A 1Z0KA 4NCJA 1E98A 3OEHA 4HAUA 1E2NA 4X8MA 2O8BB 4JLDA 1RFLA 1FQJA 3VR3A 5DNYB 3C5CA 4TYWA 4LHWA 3V00A 5KYKA 1HV8A 1JR6A 4Q4HA 2IYLD 1RRGA 1YZTA 1JQJC 1W2GA 2XNDD 3IQWA 5SZJA 3ZZTA 1KK1A 5CB6A 1NL3A 1BOFA 4WZBE 4HLDA 2Z43A 3HJNA 3U7EB 4FCVA 1EWRA 6Q21A 2REOA 4DB2A 3CPHA 4W5HA 2D2FA 3IQXA 5AWFC 2QRZA 1KMHB 1P2TA 2GVDC 2KBFA 4CRWB 1UEJA 4KFRA 4OQNA 4NMMA 3TNFA 3GQBA 1CULC 4Q47A 4C2UA 4JS0A 5E7JA 5JCPA 2RGBA 4O25A 3GFOA 1H65A 4Q03A 3GJXC 4TYYA 2QTFA 2BC9A 4I81A 4FIDA 4F38A 2R8RA 4UNPA 5FPYA 5SZKB 3CWQA 2VH5R 2ZS8A 4XWKA 1DAMA 1II9A 4QGHA 5FPSA 4Z51A 1EESA 3A1VA 2MSEB 4B3CA 1ZD8A 4G5GA 4CEJB 2L0XA 2QMOA 3B60A 3OFNA 4CF7A 3N2IA 3U5ZB 2IS6A 2XNSA 1DO0A 3WNCA 5J5CA 5A4JA 2V55B 2QTVB 2IF0A 4ZCIA 1X6VA 2ORIA 1OFTA 1X1SA 4PAQA 1ZUIA 2HCJB 2PMDA 3K0CC 2RCNA 1NY5A 3VHXA 1IQPA 1N3BA 4TL8A 3DZDA 1XBTA 4MYHA 3OAAA 4DSOA 4HUQB 4LBWA 4O2LA 1KDPA 4D4JA 4OKSA 2EW1A 3UIEA 3FMOB 4DLWA 4ZPXA 3K0CA 4C0HA 3BGWA 1KNXA 2VHUA 4EPRA 3QIAA 4QXAA 4TLBA 1QHHA 1Z06A 1ZINA 5DIFA 3QG1A 3IUYA 2ZVPX 1W36D 1Z6TA 2GZAA 3CR8A 1ZNZA 1E1QD 3IIKA 2KI5A 3V4RA 4JVSB 1CR0A 5KSYA 2CVHA 5TB5A 3MGCA 5G53C 5E4FA 1T3LA 2JLQA 2ZROA 1E1RA 2WKQA 3NDBB 1XJCA 4AYWA 4GFDA 3LVRE 2NZ8A 2ZAOA 5F98A 3NC0C 4R9UC 4ZIRA 3OEED 2W2TA 2QT0A 4M1SA 1DO2A 3N2EA 2A5FA 2WSSD 2ERYA 2YHSA 4ILEA 3M4YA 2HDNB 3RC8A 3CKLA 3IPYA 2OESA 1S4QA 1TF2A 1W4CA 4LK2A 3VX4A 4C7OB 4NU0A 3U7HB 3AF4A 2BKEA 4C3ZA 2FMXA 4MGYR 4TLEA 4YMWA 3WNDA 2EFHB 2RGGA 1E9SA 2HYDA 2QE7A 1RW4A 4KU4A 3ICEA 1F2UB 4KFSA 4P3YA 3AGPA 3ZVLA 3TK1A 4NL4H 3BB1A 4MRSA 1G3UA 5M04A 1GUAA 1OSNA 2C78A 3BERA 4MYCA 3TSZA 4HB4A 2RMKA 2W2XA 4CEIA 4RD6A 1W4RA 1YR8A 2ZXUA 1PUJA 1SKYB 1Z63A 4QC2A 1Z47A 2ZRFA 2CBZA 3PUVA 3ADCA 2W2VA 4L15A 2F1JA 4JVLA 2F7SA 3Q5EA 3R20A 5AJXA 2IWHA 2OCBA 1CKEA 1EFUA 1XZPA 1KY2A 2VSXA 3OAAD 1W48A 1C4OA 4F92B 4DIEA 2VIIA 1XTJA 3B1WA 3VNUA 1WDTA 4WOPA 5KSPA 3W9YA 5JCZA 3BH6A 4PR0A 1QHHB 3H0KA 2ZRNA 2YOGA 3CRRA 1KSFX 1SULA 1E1QA 2B7CA 5JFGA 3SC3A 2C03A 2W6JA 2FZLA 1JEDA 2CJWA 1EFHA 1QG2A 4HUQA 4GOJA 1IBRA 4AURA 4DCVA 5J47A 3GLGA 2IA5A 2BCGY 4DT1A 4DLZA 4EPWA 4BLRA 2GXUA 1R5BA 2Y8EA 4LJ5A 1OFUX 3NKVA 1IM2A
chains in the Genus database with same CATH superfamily
1IYZA 4R8LA 3RK1A 2PK3A 1EXDA 3K9HA 2AH5A 2DT5A 1SPXA 1KZHA 2VNSA 2CE7A 3E58A 5FBZA 2FNAA 3S5JA 4ZKDA 4EI7A 1V3VA 4Z8YA 1M5RA 4PQYA 1QHXA 2FPKA 2YZGA 1YGPA 1Z0AA 2JFXA 1VRWA 3GZNB 3QBJA 4U9IS 4B71A 5KYXA 1FDRA 1OHHA 2OENG 5JBQA 2P6NA 1ZGJA 4OOFA 3GA0A 4XOUA 4E30A 4QXOA 2V6IA 4TN5A 5AKJA 2CEAA 3TN7A 4EPXA 3FDFA 1T3HA 4BWFB 1PAUA 2ES4A 2OHGA 4OQXA 4BCDA 2BDTA 4RMJA 2OQ2A 5JCJD 1OX4A 5L51A 1ND5A 4IQ4A 5M7EA 1PZNA 1CERA 2B5WA 3AEYA 3C5WP 3HVJA 5A71A 3SYLA 5CFOA 5IBCA 3MJRA 4BE7B 3AUSA 3OQBA 1RD4A 4Y18A 3U0VA 1T4GA 1Z4MA 4Z7OB 3KZVA 4KO2S 2BLNA 4KIWA 3ICOA 4J29A 1U7ZA 4JBGA 4LHXA 3DPIA 4F72A 1ZISA 1GAXA 1S02A 4UU8A 1VMIA 1AQYA 5JSYA 1YL5A 3VPAA 4BO2A 4RIHA 3HCAA 1WPRA 4ZU6X 4KK3A 1XTTA 3AVPA 2DBRA 3BJMA 3BTVA 3ZHOA 5IARA 4D02A 2IXTA 1OR8A 4IINA 4ZP1A 1KFEB 2JANA 4PR3A 1FOEB 4MR8B 1YB7A 3UPDA 3WO1A 3UUFA 1RBYA 2PSJA 3GLHB 1MV5A 3LWDA 3MINB 1RWOA 2C42A 5FFFA 1OI3A 1ZMBA 5A5VA 4TV9A 2XA9A 1DC4A 3M3PA 4FWTA 1XTBA 2XT9A 1VA5A 3ZUGA 1HBJA 3QY9A 1JHOA 1QZXA 1Y6QA 2OVBA 4WVLA 3I9FA 4CI9A 1JWBB 3NTLA 2FPSA 2WTNA 3GEIA 4TSRA 2DLCX 3TJRA 1OXXK 4Q37A 4DV5B 3P20A 1PR2A 2WG2A 2J3KA 4GXNA 4L73A 2V54A 5BR1A 3LUJA 3PHCA 2GM4A 4U7JA 2QL9A 4YJ3B 2C77A 4Q1BA 4XASA 3STUA 4CN9A 4F85A 3DE5X 3DFIA 1Z12A 3DMTA 4NABA 5BOVA 3AUUA 2FEPA 1ECBA 1TT5B 3G59A 2Y1CA 1LZKA 2BUAA 2C5GA 2C88A 3LGAA 4LC1A 5A6VA 5KNCA 3K20A 3X43A 4AG5A 1UODA 1DDOA 5AD1A 1G2IA 3ZIAA 1W4BA 3LHIA 1DEKA 2PGLA 5KYXB 1NIJA 2XUIA 3DMTC 4L78A 3ZWNA 4F96A 3UHPA 2WUGA 3G0BA 3OWXA 3SXUA 3ZWVA 3UAXA 4AJ2A 2RFLA 3OCZA 1FUEA 1IY9A 1NYRA 2H63A 1EVLA 5JVDB 1E0JA 2NSDA 3A9TA 4HX2A 2YH2A 2LRHA 5TQ2B 2AFVA 3SJUA 3VR6H 4IR7A 1K4MA 3FZYA 4POOA 1MB9A 4G23A 4N5LA 2P62A 3SIPA 1J42A 5L3QA 1P7CA 1R64A 1Y8RB 3A7EA 3CVUA 1KP9A 5IT4A 1VG9B 2J7PA 2Q6KA 3AFNA 1U1EA 3E0QA 2FOIA 3LDGA 2EAUA 2WE8A 2IYUA 1C1XA 1JLMA 3FROA 2XOXA 3K30A 2JGFA 4TZ6A 4QQ8A 4PF1A 3D8HA 3VDQA 4ZVRA 2VK4A 5TLSA 4KFTA 3IQZA 4PAMA 2ZM6B 2XRZA 2AYXA 1PLJA 1JYFA 2JRCA 4Z9BA 1H6BA 3TS1A 3LOPA 1E94E 4LZAA 3JWPA 1TB4A 3BL8A 3E61A 1U02A 3DR3A 5A4KA 2XD4A 2QG9A 4B5KA 2NTYC 3I2FA 4LNUA 1KH1A 1JB9A 1JBKA 1EXMA 1N2BA 2QRVB 2W6NA 2X8WA 4WEOA 2IV3A 3ZH2A 3VR4A 3ZJTA 1Y4DE 4G0UA 3VZPA 4WXEA 4F12A 1X7WB 1D4ZA 1PJQA 2BKVA 1X1TA 2X5JO 1WR8A 2XF8A 1H2EA 2W8BB 3NU1A 4LGCA 3TB4A 5FWXB 1MA3A 1US8A 5HCUA 1PJBA 4UKDA 521PA 3WAJA 1AK1A 2PZFA 1UJ2A 1U2RA 5IUKC 2I4TA 1SBZA 3UT5A 3ZZ0A 1SFRA 4FHFA 3TM5A 4YRMA 2Z2KA 2VDMB 1HDRA 1OTXA 2ZYVX 3COSA 3E05A 4KQ6A 5HS6A 1HT0A 3WL4A 3C3DA 2O8DB 5HFJA 4MLZA 3BHIA 5DBOA 4KR3A 2H1LA 2PKWA 1WEHA 2VKTA 4Z9XA 5H83A 2HQSA 5CTAA 5E0OA 3UMGA 3HA7A 3GCWA 4MULA 3JQGA 1U5BA 2VT3A 4AKSA 3IR7A 1GTG1 5KWVA 1P7WA 1O5IA 3VDNB 5JAZA 5AW0A 2I4RA 2UXDB 3FPGA 2RHBA 2WEKA 2ZAGA 4HZUA 4CZ2A 4YP6A 3BMQB 1PWYE 2W00A 1GPMA 5FI3A 3CF0A 5HSGA 2FSPA 1IZZA 4CKYA 3L8DA 1WRBA 5FQNA 1E2LA 1Z8FA 2DBYA 5EKDA 2IH2A 4PO1A 3AHEA 1FPMA 1J2RA 3PICA 2FW7A 1E7RA 1BKDR 4KX3A 4MJ3A 4GMHA 1B0PA 3R5FA 5B58T 3VR6D 3KELA 2UUAB 4LVCA 1SUDA 1WXGA 1XWIA 1RAAA 3E3OA 4FHGA 2D0DA 4O8ZA 2ZIFA 1N36B 1Y5RA 1TAUA 2BEVB 1LPPA 2BMJA 3JRNA 4MO2A 1C7IA 1ECPA 5AVVA 4LGYA 4DR1B 1V2GA 2G1UA 1KIFA 2HJGA 4X8HA 3TI7A 5LFAA 1U0EA 1JJAA 2J31A 2J3JA 3EGEA 2OO5C 1Y1PA 3HUEA 4DZTA 3Q0EA 3QXHA 4C6RA 1HE8B 1WPGA 3Q7PA 2XUHA 2QN1A 2RBEA 3ASVA 4CLOB 5HKOA 4DR5B 4Q34A 4UC0A 1J23A 1FMCA 1JUDA 1T0BA 2WP8J 1P44A 1TQ4A 2ERCA 2XEXA 2IHYA 4TTVA 5DIZA 3RJTA 5AVQA 4RY2A 4WRRA 1PVDA 3COWA 1JTVA 3DAPA 5J4HA 4A27A 4EEKA 2P4UA 5E6UB 1JHUA 1Z26A 3N9IA 2NNWB 3TPZA 2VWPA 2CL0X 1UAYA 1G3IA 1J9ZA 1E2QA 1CUSA 4PX9A 5L3ZA 4CM9D 1EFAA 4Q3AA 2VK2A 3I6MA 2AOUB 3RADC 1E6WA 4CLRA 1U6IA 4YAIA 3LXUX 4JI5B 3P2JA 4PO3X 3WK8A 4REMA 2C9OA 2JBHA 1RAHA 3IKVA 2Z5GA 2FMIA 2FZWA 5DNUA 4OLHA 3X1ZA 3W9BA 4XVUA 5I4IA 4QVIA 2QM3A 1Q22A 3DMPA 3MAGA 3QYJA 4BBAA 1Z4JA 2LKCA 3BGDA 1DBVO 1T2DA 4CXMA 2M6SA 3IAS6 5HXAA 1NRXA 3NNSA 1GRRA 2HHCA 4WJZA 1ZOLA 5BV0A 1VKRA 2ZVJA 3THSA 3K6SB 1F60A 2LDYA 4ZQGA 1FNMA 4K87A 1GZ3A 5TF4A 2RD2A 1FL9A 1HE3A 1N0VC 5K0SA 4HPJB 3KKLA 3T35A 4XM0A 1M2GA 4BNVA 4KUEA 3ACBA 4B4VA 1JIXA 4QDTA 1NUHA 3JASB 1XCJA 3PZRA 1O95C 4X84A 3IUNA 3GO4A 3IT1A 4B3BA 2YC4C 4YJKA 2W98A 2HU5A 1VFPA 4XYLA 2OXCA 3D4OA 3IURA 3NCTA 4LVUA 4GX5A 3CH7A 1SBCA 1WXWA 3FPCA 5ALGA 1N78A 2NZ2A 3HYRA 4ENPA 2H8KA 3WG9A 1YQEA 5AK3A 3ZV6A 4EW2A 2H0QA 3IALA 4ZVVA 3LK7A 5TVKA 1ZHFA 4JELA 2HFJA 1ECGA 5HCNA 1P9NA 2IYOA 3KQTA 3LRXA 4ZI7A 1QMPA 3EBPA 3OOSA 3G9XA 2PU5A 4NCKA 4RD0A 4R05A 4WFQA 4R7ZA 4X8LA 4C6SA 1JHVA 4K9NA 3F6BX 4TV8B 1KSGA 4EMUA 1LNSA 1QLJA 2XE8A 3IELA 2VSFA 4TLMB 2PZLA 1P33A 3TGPA 3HJRA 4ARZA 3QXCA 1PQWA 4RMNA 2YWRA 2ZJ5A 5IBPA 2FFJA 3TIGA 2TMDA 5EA2A 4E6PA 3WGIA 4J90A 4BFUA 3HYSA 1IFXA 4G56A 4JYCA 4R5HA 1E6CA 3DEHA 3GJ4A 2H4JA 3OIVA 4Q16A 4R8RA 4YQYA 4B3DA 2FZ5A 3W8FA 3NALA 4OI1A 4HGNA 3DC7A 3PA8A 3F6SA 2JASA 5DW0A 4HRAA 2XADA 3BD8A 5FWYB 3AEKA 3P2YA 16PKA 4YFVA 1XZFA 4NFYA 1F14A 1DBSA 2QSZA 2AG1A 4JLVA 1NP7A 3IH5A 1GL7A 2ZT8A 3PI7A 1OILA 4NYMQ 5JASA 2GCGA 3BIOA 5BXQC 1D3AA 3GJQA 4M1WA 5LP6C 4GI3A 1UBNA 3WJ2A 2H7XA 3E3NA 4BWVA 2XZOA 4RZSA 4QGAA 1X77A 1CUUA 1FYVA 4EFDA 3F7OA 2QTMA 5EJGA 3QA9A 4RIFA 5G0VA 3TJMA 3N2ZB 3G9ZA 3TSCA 4K6MA 1K5HA 1KDRA 1NYQA 1ITZA 3GD7A 4KSBA 2C8JA 5LA6A 4A5OA 1LA2A 2KLBA 5IJ9B 2E21A 1NXVA 1KPHA 2HCBA 2P2GA 2D4AA 2VRNA 1GCGA 1P39A 3IJRA 3IMCA 5TF0A 3F8TA 4W8OA 2V7UA 2ZDGA 3D3WA 1M0TA 4ZRMA 5IKOA 4YONB 1E3SA 2GKSA 3OQ6A 2VTDA 2Z8YM 1Y82A 1REQA 2ZJOA 1PR0A 3AKZA 4FUQA 5LMCA 1OX5A 1SUWA 1WP9A 1M6VA 4TLDA 5LBIA 2O7RA 2J09A 4MYSA 3D3KA 4C5BA 2JLYA 1QCDA 1C1YA 4HG2A 4LOKA 1CJMA 2NAFA 3DO8A 1PWHA 1YJAA 3ETHA 4EFMA 3KR9A 3WLTA 5DSTA 2WJHA 4Y2JA 3QI2A 1N6RA 1M8GA 5AHKA 2CXUA 4KPUA 3BWBA 4P81A 4ZAFA 3B2NA 1AGPA 1PTJC 5EXSA 1V9CA 3BQNB 3VRHA 2A0WA 3AMVA 4ETNA 5CA0F 2IVZA 4D3SA 3QXXA 5AW4A 1PGNA 2XCUA 3PQ2A 1TLTA 3AZQA 2Q46A 2JAPA 1IJKA 1NNEA 1G7RA 3ZCRA 5MGNA 2FSFA 3ZOKA 3DQQA 3HG7A 1AKRA 3CVWA 4LFAB 3UFXA 4NU5A 3UPUA 1A9TA 4X3PA 2BHRA 1YDEA 2TMKA 4UD2A 1VC2A 3BCRA 5LA6F 1P1JA 4LOAA 3Q87B 5G0WA 1B42A 5HVNA 1PYGA 5CH5A 4BIMA 4XGIA 4FMCF 1VIAA 1DOAA 2X1HA 2VZ0A 4YASA 3HKEB 2NYVA 5FCDA 4KZKA 1FNCA 2JATA 2RCYA 5CM2Z 3I0NA 3NFRA 2ZIXB 3SM3A 1XU9A 1FFGA 2J59A 2F9LA 4E2WA 3H04A 1DKMA 4DCJA 3IO5A 4NH4A 1MIOB 1TAGA 4IIJA 4Q4HB 3KL4A 3ZK8A 5KYWA 3U4AA 1U8YA 4BVLA 4UTNA 2YKQA 4U39A 4CLXA 5CYOA 4JGBA 3O0TA 5B58C 1BFDA 4Q9KA 1X3SA 4IMRA 4RS4A 3BMCA 1KRXA 3G5UA 3VH2A 5B4UA 4FJ0A 4HNTA 1NN3A 1C9MA 2R7MA 3DOEA 4O4LF 4WASA 4YIHA 1XNRB 2L42A 3WOHA 1Z5UA 2BISA 2CF5A 5F7OA 3EW7A 1V4BA 3MWKA 3HSYA 2W6IA 1ZM2A 2DHRA 1LTKA 2EGHA 1XTVA 5AJTA 1QQ7A 4MKZA 4QM7A 2WR8A 1WWKA 3OBIA 4RD2A 2MYPA 1O89A 3NTXA 2VXOA 3Q40A 1SXHA 2OLEA 3ANYB 4TUYB 2H1IA 1PW7A 4HQRA 2IY8A 1M76A 4DF3A 2G06A 3DULA 4O4HF 3QSYA 5EIOA 2G8LA 3OE7D 1ENYA 3BRWA 1QV7A 1MO5A 2F43B 2VHEA 4TLLB 1U7WA 4QFBA 3GUZA 3WLFA 3ZWKA 5EUMA 4JI1B 4L7QA 4OIFA 5D87A 1G2OA 3CLSD 2FZVA 1NMEA 1EJBA 2AJLI 2C82A 4I50F 4TTTS 4M83A 4BNMA 3ZE2B 3F97A 4G3XA 5JYEA 3CCFA 2OCXA 4C0JA 4YRPA 3FMGA 1EDBA 1SG0A 4PY2A 4IJQA 2CE2X 1I10A 1T26A 3FM9A 3MMNA 1PV4A 3WL7A 1EFRA 2I2WA 2I3ZA 3ROMA 3PENA 3QLJA 5J2UA 5HIIA 4KGDA 3RYTC 4H17A 1LDYA 2YIMA 3QVGB 4TXLA 4YIKA 2GS9A 4HN9A 4L08A 3QUBA 4IV5A 4IIBA 3ZG6A 4J03A 721PA 4RY9A 1FTNA 1I7NA 1KYWA 2I6UA 3K1YA 1P62B 1ZXBA 4EPYA 1QH8B 1UMDA 5TS2A 1UPBA 1I3LA 3K9FC 4NCAA 1M2OB 2VDWA 3CV3A 3O93A 1K08A 4AY2A 2HDOA 3FY4A 4YRIA 1E4VA 2GEBA 3NM4A 1QJCA 4H4DA 5EE1A 3AEUA 3H8WA 1J99A 3G17A 3FNGA 3BJIC 3CZ9A 1JPNA 2Q5OA 2VYNA 1R8JA 1Q3HA 3LDAA 3N74A 4IG4A 1JT2A 4LN1A 3RF6A 3K73O 2J0UA 2N0SA 5F9HA 3MJTA 1SH7A 2ZRCA 2QHXA 3FUXA 2PLWA 1MJFA 3BHMA 4OJQA 1J5XA 1F2TA 5KHOC 1GSIA 3COYA 3G88A 1LRLA 1QZTA 2QSUA 2YXBA 1U0HC 4M88A 4QDUA 4G9GA 4ZD6A 1XVTA 1U2TA 2A5LA 5LZ8A 3T7KA 4IV0A 4CMEC 2Q3BA 4BPBA 2JFYA 5DI3B 2I6GA 4JB2A 2QN3A 3HC7A 3KSDO 3JYOA 1QGUB 2KWIA 3QV2A 1SVUA 2QLNA 1RLIA 3DPUA 3GRUA 4MP6A 3SFVA 4CMEA 2PUVA 3H5RA 1F0KA 2IUTA 4DCOA 2WWRA 5IUNC 2JHFA 2R8PA 5IWAB 5U9CA 2FG7C 1GVNB 4LV8B 3OCCA 3NBAA 4N0EA 2XVZA 2PSSA 4Y2GA 1E3DA 3ZY6A 2J9FB 4KP7A 1YCDA 2X9LA 4GZLA 3PUHA 1X7HA 4B6SA 3I2KA 4ZMBA 1I9GA 1VJRA 1QKIA 3ADPA 5HUQA 2B9VA 4DS3A 2AKAB 2FCRA 3NAGA 2HWUA 2CLFB 1DAGA 3DEKA 4LZZA 2ZR7A 1KZ7B 1TX4B 2CLEB 1K98A 1UM8A 4K6KA 1EVIA 3OLYA 4FGLA 3PNOA 4Q48A 1RR6A 1YRLA 3LFHA 4NI5A 4ZDKA 4ZO7A 2ZPUA 4E12A 1GZVA 1E9RA 4S1PA 5FI0B 3HE3A 3KSUA 5EPOA 2UZ3A 4QUIA 3USZA 2VT2A 2V0GA 3NHUA 1T9CA 1UOEA 1A8IA 1NQ5A 2GQ0A 1O0BA 3E7DA 3ECSA 1HDYA 4JKOA 4NONA 1S8FA 4OB6A 4YACA 3SZ3A 4ZFNA 4F91B 4F1KA 1WSWA 2NO1A 4QYIA 5EESA 3L0YA 1D2NA 3IXQA 1TUGA 1K7EB 3EN0A 3HV2A 2FP4A 1Q83A 1OH7A 4D45A 1Y33E 3SEAA 4AYTA 1Y4SA 4PAWA 3QFSA 2FZEA 2YVQA 1VE7A 1HFJA 3MLAA 1YRAA 4QEKA 4B09A 4EJ6A 1KHHA 1RCUA 4HKTA 3D4BA 5CMLA 1U1FA 5K0JA 1NI3A 2AOWA 2ESRA 4EUHA 4MKIA 2YASA 1GR0A 1P8AA 2RE8A 3BRSA 4LZOA 2XMSA 3S68A 2D1QA 2O8EA 1MPXA 3FFTA 4GH5A 4FB5A 3W8RA 2C0CA 2PTHA 3MWDB 4WW0A 5DOZA 4F1WA 2MIIA 2VDVE 3GP3A 1ZM4A 1BXKA 1TF7A 3OZAA 3PS9A 5CB8A 2UDPA 3IV9A 3RAFC 1M8FA 2I76A 4BUCA 1PGOA 3F78A 5BT9A 2JIMA 5KTOA 2WJIA 1XTRA 4O4IB 3A9CA 4P3OA 4WLFA 3DEJA 3O82A 2GAOA 5FEUA 4KO4S 1EGHA 4JLSA 1M1YA 2DM6A 3E5HA 3PPXA 6ABPA 1SELA 1U5AA 5ESXA 2R3SA 3SM9A 1T2EA 5DULA 5DHPA 2VF5X 3N0VA 1HNNA 1UJ4A 4NDNE 1D1SA 1I51A 1MABA 2CXXA 3H5IA 3LLMA 3O73A 1FU7A 1SCAA 2WI8A 3AI1A 3H4TA 5BNZA 5GADl 4LZNA 4Q3OA 2H8GA 3AJAA 3UPTA 3H42B 1T25A 3UF0A 1GNQA 1K7YA 1U7UA 2DWQA 2FR8C 3PITA 4JOBA 3ZHSA 3I01A 1DAKA 4M1TA 2PR7A 4KIJA 1F8FA 1BHSA 1Q7BA 3A4LA 4Z2AA 4IPTA 3P9PA 3RE1A 4AZVA 4JI7B 3AL0C 5EQFA 1ID1A 1VZ2A 1Z2NX 1GY8A 5IDYA 2ZUWA 1DIBA 3JVDA 3PJDA 1XTKA 3EAGA 3DT9A 4TYPA 5ALRA 1NONA 2HHAA 1JHRA 1HEUA 2RK6A 1X39A 3B48A 2OR3A 3S2GA 3U3MA 2XWQA 4BGUA 3CVVA 2BLLA 1PQYA 1RWNA 2DAPA 4M1EA 3QVOA 4PC6A 4QTXA 9LDTA 2PIDA 3PKZA 2NO0A 1UKBA 2PU7A 4J2OA 1E1CA 4EUSA 2BEJA 2FX3A 1AZWA 1Q14A 5IK2D 3LQ2A 1P9RA 3DBLA 1T5TA 3O84A 4FFBA 5D8DA 1UBFA 3KYCB 5EE3A 1N75A 5JZBA 4QOFA 4LW8A 4F8JA 1EWVA 1SM4A 3H1AA 4RVGA 3MOIA 4UJ5A 2R7NA 3NZEA 1K66A 4UU7A 2L69A 5ARBA 3N59A 4KE8A 3G85A 1CX9B 1GPH1 2BBTA 2WTMA 2YWHA 3KBOA 5BN1A 3HY4A 4PS1A 1JHPA 1MQ8B 1SPBS 1YZGA 2ZWOA 3O6VA 2FMFA 2X4LA 4MV6A 5LQCA 2AMYA 1KRWA 4YP0A 2AR7A 2OV1A 3JCZA 2QRUA 3X1MA 4TZ0A 2J0QA 2PD3A 2XZPA 1Y7HA 1YIOA 1WZUA 5A1TA 2SBTA 3EC7A 3OH8A 4URHA 1GADO 1K7FB 1ONOA 1KIMA 2VT6A 3LSYA 3MRSA 4B2YA 4DIKA 4QUKA 5LQKA 3LOUA 4HYTA 4CKEB 1ZFNA 4HV4A 4OFBA 4H2DA 2W4MA 3AOGA 5C1DA 4LI3X 3K71B 3DKIA 1KYTA 4JLNA 5P8WA 4KZPA 4BQEA 2HTFA 5K6TA 4KNYA 1L8AA 1OXUA 1PEKE 2ID9A 2PT9A 1P6XA 3DLTA 2R2AA 4PNPA 4Q1DA 5L40A 2A5YB 3EY9A 3ZBPA 5F2EA 4WAUA 4F4CA 3KHSA 3BTUA 4DJDC 3VZRA 4FK8A 2MR5A 2X6RA 2XQVA 4LWZA 2HNKA 1ZH8A 2QV7A 1PL0A 3A10A 1CR1A 2QRKA 3ZE0B 2QR2A 3IQIX 1E99A 3HKBB 4ND3A 4UM9B 4AL4A 7MDHA 2FUCA 1ODSA 2G5PA 1GN8A 2HAEA 3RAEC 3Q6NA 1E77A 1IM8A 3I0MA 3C3WA 3ET5A 1TA9A 2HDHA 2ZTSA 3NTOA 1OLOA 4A0FA 2AEEA 3PE4A 4RDHA 4WBXC 4FKZA 4B7CA 4H3KB 5ICMA 1CQPA 2CJYA 3FETA 3G5LA 4G24A 4NNOA 4ALMA 5CDSA 5G40A 2CLHB 5AVZA 1HG0A 3A3PA 1MO3A 1KZ6A 2BF7A 4FNMA 3LIPA 4S1WA 3EJ6A 4FLEA 4BO4A 5K3OA 3LHSA 4GRAA 2WTUA 2DX7A 3GUHA 1NDHA 3EZGA 2AI3A 4FGJA 2LR0A 2CC2A 2ZAMA 4UUBA 1JSZA 1KJWA 1RCTE 2ADFA 4Y7DA 3W4IA 1WVGA 3K9QO 1KZ1A 5CBPA 1KYXA 3AJRA 1HC7A 4LC9A 3AYZB 5K0TA 1D7AA 3C7AA 4WCFC 1MP0A 1S3FA 2QWXA 3SX2A 2V4UA 4CUKA 3HVRA 3ZWYA 1R0ZA 5I5EA 2FWNA 1H0RA 2QT9A 2X2PA 3ORHA 3UK1A 3GCGA 3PF8A 2P9CA 2HIHA 4A73A 2Y1XA 1NLMA 1NR7A 2XT6A 1LK7A 1CR4A 1RZRA 1F48A 3ZTYA 3CHYA 1KE1A 4LJ4A 3KLBA 4H4EA 1HFWA 4L6IA 1A9XA 3KZKA 1NBME 2PGXA 3HCCA 4N6OA 5FTNA 4OUKX 4CGZA 2BGJA 3G1UA 4J0IA 5JI2E 4CNQA 1ZK1A 3IHKA 2X8AA 3ZYZA 4P93A 2DFDA 2TYSB 1ZNXA 4JYBA 1G0NA 5CA0B 5G4LA 4BO1A 3BA1A 2O2GA 3TE6A 4MDEA 4M3NA 3HNOA 1HYEA 1U0LA 3W05A 5JYBA 4DIFA 4IOKA 1EM6A 2K87A 3ELDA 5TQVA 2LDXA 3GJSA 2O7SA 4GPD1 1CJVC 1KO1A 4OQEA 3QE4A 3N8DA 1N1DA 3BFXA 1F9AA 1L0BA 3IP3A 2H2AA 3NWJA 4IIDA 1EZ1A 1F8GA 1KK2A 2WU4A 3K09C 1SCBA 1P0IA 3DGFC 3CG0A 1E32A 1Z18A 2I1QA 5E38A 1HM5A 2WINI 1DLJA 1HLGA 2Z3VA 2OQVA 3TWOA 1WABA 3OMWA 5EN4A 1U28A 3WO0A 3ZE7A 4EVSA 2FPGB 2FPLA 2KB0A 2FN4A 3RVPA 1YRBA 2NGRA 5TJHA 4DIBA 2JC3A 4EI2A 4ZAVA 2XNDA 2P9HA 1HDIA 3G8CA 5T8KA 4U8GA 2M1ZA 4HMQA 4OPMA 4QUAA 4IF4A 1UPUA 2CVFA 3HU2A 3SKVA 1EQUA 3IBYA 5D7NA 3WGKA 3NDJA 3WGUA 2GPYA 4FYPA 3VU9A 2O5RA 1K27A 3MFYA 3NGXA 1D2CA 4YREA 1HI9A 4MUMA 4NJMB 4UVGA 3SG0A 1ARZA 1Z39A 1YRWA 3Q3HA 3VSAA 4GVLA 2J1LA 2DG2A 2F1HA 1XRNA 2YRWA 2NU8A 3U1BA 5FLEX 3BE4A 2J9XB 4F7WA 4HFMA 5AK4A 1OD6A 4LF4B 2YQ5A 4JU8A 2XH8A 2QMYA 3E3LA 5CP8A 3QE3A 3UT5B 3Q7IA 5GIPE 3GNQA 4I5DA 2I55A 1CLEA 1FFXB 2XCTB 3WGQA 1FC0A 1NJFA 2BMDA 1ULBA 2CL5A 5E9WA 2V7QD 3INGA 3K53A 4NSNA 1Y9AA 4FNAA 3OZTA 4L0MA 1MH1A 1NMQA 5J1TB 5BXYA 5GP1A 1II8B 1BDHA 4M7RA 3ER6A 4UREA 1EX6A 2FJPA 9LDBA 2REQA 2B98A 4G5YA 5F78A 3ZV5A 3TR5A 4BYGA 3GFPA 3L0ZA 2F3QA 3ROFA 4KIGA 5A0FA 1U0RA 2CLIB 3DE4X 1DAPA 1Z6YA 2BGUA 4DR4B 2OZPA 3F9IA 2PUEA 3ORRA 1FNBA 2CD9A 3S5UA 4WZBB 2WUWE 2ID8A 1G66A 1SUSA 2X15A 3ED5A 3PIIA 5EEGA 3ROEA 1QH1A 2DPYA 2VJBA 4N01A 5I48A 5JZ9A 3GEGA 3AKYA 5DNEA 3SOPA 4AZ3B 2G17A 1LLFA 4GDMA 1YK0A 3B3GA 2NLOA 4RA6A 2O0JA 4XYEA 1GQRA 3AK4A 4XD7A 5FKJA 1ZESA 4NG5A 4IGIA 3UMSA 3D8TA 2JGEA 4K9PA 1PK7A 2QTGA 2FW1A 2DQZA 4HLUA 1UKYA 5HGJA 4F2GA 1RAEA 2Y2VA 2QX6A 1MQSA 3SC2B 4FDAA 4MUNA 3DV2A 3GVCA 1GLNA 2E87A 4JDPA 3SSOA 3P71T 3ZD9A 5JCOC 3UG6A 5HE9A 3MA0A 3C3YA 2IS4A 3ZX5A 1WL8A 4YEDA 4J94A 4UAGA 3I3SR 4WK4B 3RUIA 3GEEA 4NJEA 3ZU4A 4LHYA 5CDFE 3BKWA 5JCOA 4ETIA 5JJCA 1M34B 5JR3A 1KFCB 5T64A 1YFKA 4EH1A 2I4OA 1FYEA 4D6PA 1Q6YA 1W29A 5FB3A 3LY9A 1MGOA 3GLFA 2VHWA 3ZGXA 2YFQA 1R0RE 3I73A 3RRXA 1FW6A 2R60A 5KX5F 4GM1A 4BU1A 2QTVA 4IO1A 5LWHA 4PCUA 2HSZA 4AU1A 2HV9A 4ZMRA 4P31A 5BY2A 4G1UC 5ALZA 5JNTA 4M53A 1XZCA 1ONNA 1RC1A 4EF6A 4BLVA 1DQYA 2W83A 4OA5A 1VHLA 3GP5A 2GOYA 1NHWA 3FSEA 9GPBA 1ZKMA 4J16C 3HDHA 5KQLA 3ZUPA 3DWFA 4IZ6A 3T9EA 4II3A 3GNTA 4YYEA 3MCAA 1GNVA 2V7QA 4BO5A 4D79A 2JFHA 4M0MA 4R68A 5DX8A 3HUFA 3TINA 1U3CA 3K9GA 4BFLA 3ISJA 3UOWA 4CNBA 2NACA 2ZI7A 3ZQKA 1KI6B 3M4XA 1ZD5A 4G5HA 4A16A 2P3LA 4C6TA 2Y4NA 3MPOA 1BXGA 5E1MA 3UHOA 3OIDA 2C8LA 3QKTA 1M6HA 4MV0A 4NP6A 4MR8A 3V6LA 4BNKA 1Z6QA 3AF0A 4JL6A 1L8QA 3PWKA 4YMTA 3AJ8A 3KOXA 4TMFA 2F4VB 4UDNA 3D7LA 4EECA 1PV1A 4EB3A 2O8FA 1YZUA 3NWBA 5KC9A 2X2OA 3HYLA 4I66A 2PV7A 3LNCA 1ZIOA 2WIFA 2D1RA 4ND8B 4GOLD 4TV8A 2QX9A 4MMXB 4TSKA 3ZCVA 4TPKA 4E5DA 4L4YA 1GPUA 1G9TA 1RYEA 1SVWA 1DV2A 4PAOA 3IRVA 5BVHA 4RTOA 4IZOA 2VAMA 2ZIXA 4Y2VA 4Y2XA 2Q62A 3TCXB 2QVZX 4HNSA 2GBPA 1ZUNB 1I3KA 2P69A 2V5VA 5KHLB 4XWOA 3PC2A 4G5OA 1OIXA 1AUXA 4LDNA 4DM3A 1QGED 4I1YA 1Y48E 1E20A 2DWUA 3A3NA 4L3WA 1KVRA 3H2HA 3EX7C 4HXFB 4ZT2A 2GEFA 2V1UA 1FZTA 2FOLA 3RRNA 2A9FA 1IEQA 4I55F 1I3NA 2C4TA 1IMOA 2GEJA 1FPQA 2I7XA 2LPMA 1R0SA 3FPSA 4HLCA 4A92A 3U3DA 1YAJA 1VIYA 3ML1A 3M2PA 3Q11A 2J0EA 4GM4A 3KOOA 1OU4A 2ZK7A 1JBQA 2Q27A 2ZSKA 2V7TA 3ILXA 3QKRA 4UHCA 5A4JA 1G8PA 3F8WA 3ZTTA 1Q7CA 1NBHA 1UKCA 1E96A 3QPBA 4JT8A 121PA 5ES3A 3D8SA 1QP4A 3L06A 3D6AA 5LVAA 1H5NA 4HDQB 1TEVA 3P97A 2CXRA 2NZJA 4RY8A 2XCQA 1WDWB 4MYDA 1AMOA 5HRCA 3WB1A 5JNRA 5ETJA 3OOHA 4CR7A 3SJBA 3ZHZA 1MU0A 4AJPA 1K4YA 2IY7A 3G6WA 4IZHA 4BX3A 4XB6B 4MYUA 5A5GA 2YZMA 2BBOA 5ANRB 3S70A 4NATA 3C41J 4HGZA 3A05A 2B8EA 4MR7A 3EQ2A 4WK0B 4CI0B 4J9VA 2XDYA 3K0AB 3D7NA 3DEFA 4IIUA 4MEJA 4NTZA 4KE7A 1LCIA 1TKBA 2HTEA 4OL0A 1SCKA 1W94A 4AMYA 4BVAA 2BPOA 2B2CA 2H5IA 3BHJA 2CNBA 3VSEA 1RHMA 2BMFA 1D6JA 2QTLA 1RJ9A 3V7NA 4DBZA 4HN2A 4IP0A 4R2HA 1U3WA 3QA3E 4DDMA 4RV5A 1M5UA 3OX4A 2G08A 4ER6A 5HTKA 5DHAA 1LB1B 1XPJA 5C8ZA 3LBNA 2PEYA 4I9NA 2ZQZA 1T2VA 4ZEWA 1J7KA 5E6SB 3RVJA 5TPWA 4MUYA 4YJDA 1ISJA 4PG6A 1S01A 5JSUA 1HDCA 4YUAA 1JAHA 1C81A 2DPLA 4PXAA 1V5EA 1EGMB 3BRCA 5D3KA 1U63A 2D00A 3RB8A 4EITA 3AY0A 1WEKA 3A6DA 5K0ZA 4ZT5A 2OCKA 3QHPA 1RWPA 2OB1A 1FYFA 1K6XA 2IE0A 3RRBA 1DQNA 2W7TA 5B36A 4QUGA 2ENUA 4OYHA 2OECA 3FG9A 3TUZC 1PL6A 1CT9A 4DC0A 1DL5A 3DDNA 1FYXA 1GUZA 1AKEA 1TIPA 1WHTA 4ZV9A 3PYXA 4A0SA 4XUGB 2G36A 1TUIA 5JROA 4ARZB 3U48A 1LF5A 2H65A 2QI9C 2AZMA 5CM8B 1E9AA 5HDQA 3G6KA 2FPRA 2DKNA 3IOBA 1PWXA 3I12A 3IVCA 1OAKA 2VR1A 3A9VA 3KBBA 2WP0A 4Y2QA 5JAMA 4NNJA 2NADA 4ICIA 3CKYA 3ZWQA 5C8YB 1IDOA 2IZ0A 3MJEA 3GUUA 2W9XA 1SHLA 2H2FA 2Z56A 4OV6B 1V16A 3RKUA 4ZYYA 4NBWA 2YV4A 1D9ZA 2CL7X 3VDMA 1GZ4A 1G8YA 1AM4D 4XH9B 4F4HA 5AW3A 1Q2UA 3A6KA 4RL4A 3F5QA 3DZKA 2R5FA 3KOYA 4M38A 1ZK0A 3BGIA 5DHQA 1IG3A 2X9NA 5JLAA 1E89A 2VK8A 4QUHA 2QMEA 2AMVA 1JDVA 1WUKS 1Q0TA 2VHQA 3RWOA 3A2KA 3U56A 2QYOA 4GNRA 5C7IO 2ST1A 4IBOA 2Q0QA 2R1ZA 4G4SO 2DVMA 2HIAA 2EL9A 3E1KA 3TIFA 4OLJA 4NZZA 3EB9A 4MR7B 3V4OA 5F77A 4LSZA 2MDTA 3RKRA 1E5TA 2JZNA 3HU3A 4C4RA 4ZV4A 3ZEIA 4RH1A 4IFTA 4JQOA 2ZG6A 3RSZA 4OQMA 3V9PA 3IVGA 2YFHA 3NWOA 3IDAA 1NJ1A 4LGMA 4P4SB 4B45A 2PCJA 1ESMA 1RQRA 1WV1A 1DINA 3OOJA 4HP8A 1LV7A 3ANXA 4UUAA 3M2TA 5CDUA 2YMPA 3GXBA 4TRJA 4HFJA 1WKCA 1E3LA 1KRHA 1NVUQ 2PX0A 1BQ3A 3EDCA 3OZDA 3PXBA 3BCSA 2C2HA 2ZB8A 3EMVA 3KXPA 4DXAA 1VTKA 1I4TD 1TF5A 1U5CA 3CVYA 3IPLA 1OI7A 5KNDD 2CZGA 4RS3A 4TKVB 2WU3A 2Q5HA 2N46A 3H9QA 3NPAA 1NQAO 1FU8A 4TRMA 4Q1VA 5H80A 5IN4A 1NM5A 3QHQA 1J0BA 5FOSA 4CDGA 4Z7QB 3JQ8B 2NWQA 1W4AA 4Y6RA 3GQVA 1L3CA 4UUQA 3AR7A 4F0JA 3K5PA 3V4VB 3D3JA 1E79D 3W8NA 3HUDA 3KP1A 2GBCA 2X9GA 3N2KA 5H02A 2D5IA 1WZEA 2AXPA 2CMGA 1YWGO 1L3IA 3LWBA 4NAHA 3AUJB 2EHDA 1SU6A 2FRXA 1AVTA 2IE8A 2KHZA 4S1NA 2BHNA 2VNHA 4X00A 3S44A 4TTIA 1BMDA 1XNHA 3C8HA 2XCSB 3KV1A 5KYUA 3W04A 5I5GA 1L4MA 1Z0IA 4I4IA 4UHFA 4ZV7A 3TR0A 2DUUA 3ZLVA 1O8BA 2QZZA 2QTZA 1OF1A 3VR6A 2OFXA 4Q19A 9ABPA 1XK6A 3CG4A 1S8AA 2FX5A 3GIWA 1X1EA 4PG5A 1EA5A 2QNBA 2OGZA 9ATCA 4GPAA 1VSUA 2NPOA 3ABSB 1T5LA 2MINB 3BXXA 2QAGA 1XWFA 3G0IA 3IHWA 3NAZA 3QEKA 4TL7A 4EO4A 4Z1MD 1T10A 4ITVA 4MKFA 2YOHA 4RKRA 1UC8A 3NRBA 1XZNA 2DTEA 3P2KA 3QPDA 3KU1A