4PQYA

Mycobacterium tuberculosis reca glycerol bound low temperature structure iic-n4
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
328
structure length
316
Chain Sequence
TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
molecule keywords Protein RecA, 1st part, 2nd part
molecule tags Hydrolase
source organism Mycobacterium tuberculosis
total genus 97
structure length 316
sequence length 328
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4pqyA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4pqyA01
3ZVRA 5JHGB 4P4UA 1WBBA 2W0SA 5SZKB 5JS8A 2DBYA 3QG1A 1OJLA 4RJLA 2O52A 4KITB 3H4MA 3WBJA 2V6JA 4QFMA 5A0FA 1T3SA 1JQLB 1UBEA 3PUYA 4JL8A 4FI3C 3B82A 1DOAA 3KQLA 3JZAA 2ZM5A 4V0ME 5BQ5A 3ZIAD 4B35A 1VCNA 2XNSA 3EAQA 1E6CA 1XCGB 1F48A 1KMHB 4EQ6B 2KBFA 2G83A 2OCPA 1N6PA 4J0QA 3ZLJA 2VP9A 4AC9A 3QOFA 2FU5C 1U8YA 1DAKA 2O8BA 1N2CE 1YR6A 2FV8A 2BEKA 1YZLA 4XVUA 4MDFA 1QHYA 2GDJA 4JT4A 5FI0B 4OHZA 3K0CC 4URZR 4AI6A 1JXMA 4PX9A 4JL6A 1KO7A 3J81k 4IOMA 2D62A 4FW9A 2ZVQX 3RAPR 1OHHA 3T1VA 1P60A 2CMKA 4P33A 2JJ1D 1YR9A 3C41J 2DWPA 2ZJBA 4OHWA 4Z8YA 4GPTA 4TZ6A 4IXNA 3K70B 4XVQA 5DO9A 3RWOA 3GEEA 5LBIA 4NYMQ 1E9SA 4B6EA 4ZIRB 2OAQ1 2X77A 4CEJB 1U98A 4XWKA 3ZJYA 3KXIA 3AGPA 3C14C 3T12A 3I32A 1TUIA 1KAGA 1CJTC 1FP6A 1GILA 5ELXA 1V43A 1CIPA 1U94A 2A9KA 3LY5A 3PCRB 2QU8A 1ZD9A 5JWOA 3UWKA 1W2GA 4MRPA 4ASUD 2QP4A 2VLIA 1AGRA 1OLOA 5BN3A 2VO1A 4RD6A 4CEHB 5HCIA 3GD7A 5FPHA 3PEVA 1E2EA 3LXXA 3QXCA 1Z6XA 2GKSA 1QVRA 4WW0A 1IJEA 2B8TA 4N3NA 2XEXA 3VKGA 1SVWA 3VQTA 4LJYA 4ZV4A 2IS4A 3KXKA 4KSBA 3PFIA 3U4QA 3V9PA 1Q1EA 5K8UA 4B48A 3DL0A 4MGZR 2VP6A 4NYIR 1FZQA 1N6RA 4E5UA 1II8B 2FWRA 4XTRA 5FOSA 1IN6A 4KVAA 5E7MA 3AVXA 5J40A 2C9OA 2GCNA 2QMEA 5TMPA 1TAGA 2KI5A 2F55A 1C1YA 1PLKA 1R2QA 1Z2AA 2OAP1 2QORA 2REXB 3U3MA 3ZZUA 4BFZA 2B92A 2A5JA 3TBKA 5IT5A 2R6AA 4HB0A 3B7GA 4TTRA 5DHAA 4EIWA 3U7FB 3ZZ0A 2LCFA 4DRZA 2ZJ5A 4DDTA 3AKCA 4DCNA 5HE8A 3AVYA 1TF2A 4RSGA 1BMFD 4PSAA 2G88A 3A6PC 2ZE7A 5KSZA 4DWJA 1ZAKA 4B3BA 1G8YA 2JJ2D 2FG5A 1DAHA 1MO4A 4TL6A 5FPYA 2F7SA 1JR3E 1DS6A 3A1SA 3ZYCA 1OXSC 1UEIA 4EUNA 1WE2A 2QM7A 2ZS9A 1PUJA 2BJWA 4YQFA 4QBHA 5JEEA 1P61B 1A1VA 4XD7A 2FSFA 2X19A 4PO8A 4G5QA 3QQ5A 3RC8A 1DAGA 5DLQC 1WMSA 3GLGA 1FNMA 3SJCA 5DNYB 3TSZA 4R98A 1HYQA 2J0QA 1TPZA 4MGKR 4ARZB 4AYXA 1NBMA 3VR1A 1E1RD 5L3QB 1ZW6A 4JLBA 2ZE5A 4M9SA 4RVCA 2C98A 5IDVA 4FCWA 1ZD1A 1A4RA 4C7OB 1F2TB 1AS3A 3AUXA 1NSTA 3NBYC 1MR3F 4TYNA 5EP1A 1ZNZA 5FFMA 2IYZA 2ZTSA 1BIFA 1E9EA 1U2RA 1XEXA 3QXXA 4M1WA 4F7WA 1DG1G 2AK2A 1CJVC 1AN0A 2EQBA 4AWXA 3U44A 1IQPA 1XFAA 1KO8A 2QGNA 5JI3E 4IDNA 3PUVA 2F43A 4HATA 2EFGA 3LX8A 2R6CA 1OKKA 4YMUA 1HTWA 4A9AA 4A0FA 2AK3A 4S35A 4JL5A 4MKFA 4KFTA 2QSZA 4LGMA 3E2IA 1OH5A 2BBTA 1Z47A 5BW8A 2GCPA 3EZFA 1KI3A 2ZI6A 1RRFA 4JZKA 3WRXC 1W4BA 1YQTA 2QENA 2ZSFA 5GVRA 1UKYA 1IN5A 5LD2C 1W44A 1OFTA 4Q4JB 1S4QA 3ZD7A 3BIFA 5L8VA 3B13B 4DLRA 1UDWA 4QGHA 4IOLA 3CRQA 2NZJA 3DKVA 4IDHA 4XD7D 2SHKA 3OEEA 4PC3A 5DH9A 5AJZA 3VR6A 2ONJA 2PEYA 3NH6A 1Z0AA 4IVPA 1GM5A 1LS6A 2ZANA 2EFCB 3IO3A 2O8EB 3THOA 1GRNA 4ZKDA 2FPMA 1G21E 1W49A 2GF0A 2HXYA 4M1YA 3IIJA 4QOSA 5J4LA 5JHHB 2WV9A 3CR8A 4B47A 3TUZC 2V3CC 5K8IA 1X86B 2N1BA 1CJUC 4NH0A 1SXJD 1LV7A 3OFND 2FGKA 1HQCA 2BMJA 2Q3HA 2BMDA 4TYYA 1WF3A 2RGCA 1W4CA 2AD1A 4TMTA 2XZLA 4RY2A 4AURA 3THYA 4RZUA 1EFTA 3BB3A 3A1VA 1JR6A 2VP5A 3CF0A 4R71A 2VEDA 1FP7A 2WPDA 3I1FA 4XVRA 3WBKA 1N25A 3WMEA 4Q21A 5FR1A 4IEEA 5K8LA 2VP4A 2Q9BA 2RGBA 1ZYUA 1VG8A 4LYAA 5FOTA 4BE7B 3T1OA 4DVGA 1E2KA 2WWIA 3U3KA 1P2TA 2Q21A 4PC2A 3B1ZA 4BLOA 4PAMA 4A0RA 2BV3A 4CGZA 2O8FB 1TUEA 2OBMA 2R62A 4G3XA 2AX4A 1KDPA 3FE2A 3LDAA 2A78A 1E9BA 1XTKA 4TMZA 4ZI3A 2IYQA 1G64A 4GZLA 5KDLA 3W3AA 4TMXA 5C2JB 3WRYC 2ZRPA 2R6GA 3CWZA 2IL1A 2PX0A 1VCOA 3NBFA 1UDXA 5G3ZA 4Q4LA 1HE8B 1HA3A 3HR7A 3SS8A 4DLYA 4DT1A 1U9IA 2QP9X 4OI2A 1MV5A 1NN3A 3Q72A 4PPFA 3OIYA 5FOXA 1YZTA 1H65A 4B71A 4BQSA 1N6IA 5ANRB 1G9XA 3KDSE 4KU4A 2FX3A 3THXB 3B1YA 1KJYA 2BMFA 2FFHA 1XEWX 2NO6A 1Z06A 5F98A 2IYYA 4ZDWA 2PT5A 3EPKA 2CL6X 2OBNA 2H7VA 1N5KA 1NLYA 1P9WA 2QSYA 2RGAA 3QVUA 4TLEA 4Q7MB 5E95A 5FBRB 5JSZB 2HDNB 1KOFA 1ODFA 1JQJC 4Q1BA 5HE9A 4FXPA 4F4JA 2D74A 1R5OA 2Q3FA 4EFLA 4BLPA 3I8SA 1E69A 2CJWA 3CZQA 1L2TA 4LHWA 3I62A 2A30A 3K09A 3BGWA 3X1YA 2ZAOA 4LSGA 3D6TB 1R0ZA 2O8DB 4KFUA 2OEPA 2W6JA 2ZR7A 1XX6A 4RFSA 1Z6TA 3TSWA 3AVUA 4NCKA 1W5SA 3U7GA 3FMPB 2HJGA 3RS4A 3L0IB 2FEMA 3WNBA 5KO2A 5JJLA 3SU8A 3TSOA 5KPJA 3HR8A 3KZ1E 4DEYA 4JLKA 3D31A 2YWGA 4IKEA 1KY3A 4XSHA 4LPSA 3IPXA 1CR0A 3REGA 4B3DA 3U6KA 3MWLA 1ESMA 3AH8A 3BJIC 2IUTA 1HEIA 4TSFA 4JBWA 4A4DA 2H16A 1OIWA 1EK0A 2FSIA 4KJZA 1NVVR 1S3SA 3GLIA 3G5UA 1J70A 4TT3D 1W0JA 5KUTA 2IEZA 2P67A 1W36C 4AG6A 2E9SA 2OM2A 2W83A 1DO2A 1Q21A 3UXMA 1DARA 2QAGA 1AKYA 2F1RA 4U00A 1XNJA 1GDDA 3I4LA 1NG9A 1YHNA 1KI4A 1ZIPA 2QRNA 4LCBA 4Q9IA 3QKSA 5CYPA 5HZKA 3B6EA 1T5LA 3RRZA 3K8YA 1G1MA 5FTJA 4DCUA 1R0XA 3GLFA 4CDGA 2UKDA 5DHFA 3IEVA 3WP1B 1FQJA 3N2IA 4K81B 2J7KA 4DJTA 1S3GA 4A15A 3QXJA 3EIQA 3SDZA 1FFHA 3W6NA 1RRCA 1CR4A 2PZEA 3VTKA 1YRAA 2O0KA 1HURA 1E94E 5C18A 1TQ4A 4IDQA 3B78A 2CVFA 2YHSA 2CK3D 3GEIA 5SZHB 4JLDA 1NG1A 3REFA 3W34A 4V03A 3W5IA 2H92A 5DN6A 3ZVMA 2Q9CA 1NL3A 2YZ2A 3NIBA 3P1JA 5EXXA 2FA9A 4CT4B 1K5DA 1JPNA 5LB4A 5AJXA 1DADA 1CLUA 2F9MA 2OILA 3R9XA 4ESVA 1EFUA 1LW7A 3QEOA 5CIWA 3LQRA 3H2YA 4V02A 2V9PA 4HLUA 1NP6A 4DUGD 4HZUA 3I92A 1V5WA 3FPAA 3WYGA 1H8HA 3F8TA 2NO7A 1E9DA 5BXQC 4OHYA 2B7BA 1DAMA 1R5BA 2VA8A 1B23P 5EE0A 3ETLA 4QC2A 3VNVA 1RZ3A 1M6NA 2IC5A 2QMUA 3ICQB 1GITA 5CLQA 1T3HA 3G0HA 1XDBA 1SHKA 1CRPA 4US1R 1M2OB 3K9NA 4NYIQ 1E9RA 1CU1A 1X1RA 4GOKA 1ZU4A 4EPYA 4LWZA 1ZCBA 2ASEA 4PZLA 5DE3A 3A1UA 4O3MA 1US8A 1VG0B 3W8NA 4RD4A 4Q7KA 5L3SB 3SBDA 3PVSA 4QJ5A 1IY2A 4DSOA 1XXHB 4DB2A 4C30A 2YINC 1XTQA 4Q1FA 4EJSA 121PA 2D06A 1IHUA 3MCAA 3NVAA 5FTLA 2BIFA 3GJ8A 3NC1C 1O87A 1IJFA 3JVVA 4YMVA 1D8TA 4CVNA 3DPUA 1S1MA 3FMFA 2IK8A 3KTAB 1K6MA 1OFHA 4AK9A 3LX5A 3I5YA 5FR2A 3FOZA 3OIVA 1WBDA 4JVNA 2XXAA 4LJ6A 3EARA 3GJ6A 5JCZA 1X3SA 3QSYA 1XMSA 4YC7A 3QKUA 4UXJA 4IW3B 2ODNA 2ZPTX 4B74A 5EJEA 1F5NA 2WWFA 1PZNA 3KX2A 2AR7A 4L4UA 1GG2A 1J2JA 1A2BA 2PMKA 2H5EA 4Q4HB 5EZ6B 2V7QA 3QKTA 2WBLC 5SZIA 1KDOA 1ZRHA 2G3YA 2ZRNA 5CB6A 3THWA 2O8CA 1XPRA 1NBME 3QF4B 2YYZA 4X8MA 4KSCA 2RHDA 4IRUB 2ZRJA 2EWWA 4G5GA 3KJIA 2P5SA 1P9RA 2REBA 3RS0A 2WWGA 4Q1EA 5G53C 2WOOA 2XZOA 2V6IA 1F6BA 4FIDA 2CLDX 4HAWA 4E22A 1GTVA 1SGWA 1YR8A 2O8BB 3VR4A 4FCTA 4Q02A 2J87A 2P65A 2J0UB 4IVQA 5FL3A 2ZRCA 1ANKA 4NDZA 5P21A 2E87A 3RSOA 2CHVA 2OG2A 4L9SA 1SKQA 2MSCB 1E4YA 4LK2A 3QF7A 3AP1A 5GVSA 3OAAD 3HJNA 1FX0B 4LRWA 1ZUHA 4EFMA 1R8QA 3DMDA 1JR3D 2IWRA 1E0AA 3NG1A 3VFDA 2ZSBA 3TVTA 2WOJA 2QN6A 4BFSA 5GJCA 1XZQA 3H84A 2VPPA 3KJEA 4P3YA 3PJRA 3CNNA 2ZI7A 2Y8EA 3DOFA 4DCVA 5FTNA 3QEJA 3T1TA 3A58B 4TQUS 3AF3A 5DYIA 4LJ4A 3R9WA 4Z1MD 1Z0KA 5FL7A 3IHWA 4PC1A 4O2RA 2WJVA 3RNLA 4QHYA 1KNQA 3O8CA 2AFHE 3QJYA 5DSZA 4HB3A 4JSYA 3TIFA 4GRAA 4A82A 4W5HA 1OFUX 3QI2A 4Q19A 2GXSA 4LJAA 2GEVA 3BFVA 4MGYR 2HF8A 4WZBE 3X2SA 2XTMA 3AKYA 4LV5B 4QKQA 1XD9A 2J0VA 1HH4A 1ZC4A 3EX7C 4A8JA 1Z0FA 1KIMA 2WAYA 4NU0A 1W36B 2Z6VA 4FMCB 1RYFA 4OBEA 4Q1DA 4TTQA 1E0JA 3ZIAA 4BPBA 2XZPA 4PC7A 1SULA 3QPVA 4XTCS 4B33A 1AQYA 3PUZA 5EXPA 3DKPA 3R8CA 4Z51A 1W47A 4HAYA 2C2HA 4M1OA 4D80A 4MYCA 2JIZD 1PVOA 4UXHA 1NRJB 4AYWA 2RGEA 1GNQA 1QHIA 2B21A 1G5TA 2P0EA 3Q5DA 3K53A 2ZRKA 2OO7A 4QBIA 2GK7A 5JRJA 1HT2E 3IQXA 5FTMA 1GUAA 4LDJA 1KSFX 1U90A 3IUYA 3DM9B 2ZJ2A 4YDHB 2WIAA 1KO1A 4UQOA 4Q03A 1P2UA 3A8TA 4KBGA 4UJ3A 4D4JA 4AG5A 2ZYUX 1VG1A 2R8RA 2LKCA 1DVRA 2QL6A 2IS1A 3X1WA 2WTUA 4PQRA 5FH9A 3U4QB 3EPLA 1R4AA 1Z83A 4MUBA 2F1JA 5F9FA 1GL6A 3SBEA 2Z4RA 5IHPA 3CPEA 2EWVA 2PMDA 4D0LB 1YZQA 1LTQA 4GZMA 1N3BA 2BM0A 4F93B 2ZITA 1NNEA 1T5IA 1JEDA 1S0UA 3DM5A 1G8FA 1E2JA 1NMYA 4ASUA 1KNXA 4WA7A 5HPYB 3U60B 4D0GA 3KKPA 1NJGA 2VF7A 3B85A 4D26A 2R6FA 3ADKA 4N1AA 3UATA 1VCMA 4NKRA 4MRVA 3VU9A 2I3BA 1SKYB 2ZETA 2ATXA 1CKEA 5JI2E 4JT2A 1EFRD 1XPUA 4DSUA 3VX3A 1QHGA 2N46A 4NZYA 2ANCA 2GESA 4FWTA 1NN5A 3CW2A 5FOUA 1SZPA 1IXZA 1VMAA 4BFUA 2ZXUA 2X2EA 4P31A 4HUTA 1E2HA 3FMIA 5EP2A 1XD8A 2OCYC 2RGDA 1NN0A 2XSZD 4I4LA 2I1VB 3KJHA 1G8HA 1W1WA 1EX7A 4MITA 2OLKA 3S1AB 4DLXA 5AK0A 1RC8A 2CCKA 2W6ID 3BC1A 4LYFA 4HI0E 4LHXA 4PSVA 2QI9C 4A6XA 4KXFB 1R8SA 3DDCA 4YONB 1R0YA 3T35A 4LYJA 4KV9A 4C4PA 4ESHA 4TLCA 2GTPA 4K46A 3WYFA 2I4IA 4GBMA 4HAVA 2JLXA 3GLGB 3RLFA 2TMKA 3TNFA 4B6FA 1NJFA 4L16A 4BGDA 2BVNA 4FN5A 5JECA 2J1LA 1DG3A 1BMFA 2GAOA 1I4LD 2DWOA 1UJ2A 4TLAA 4MDEA 4OHVA 1Z63A 1CJMA 1J99A 3BBPA 3NBXX 1U0LA 1T91A 2F1IA 2JJ2A 4DLSA 4M2LA 4OQFA 3IILA 2EU8A 2R65A 4BASA 3FHTA 1XJCA 1ZBDA 1Q22A 3AF0A 2ZRAA 1G4UR 3QUSA 3GLHA 2IF2A 2KSQA 3F0TA 1NVVQ 4O2LA 4Z8XA 1XEXB 2BOVA 1E2GA 1E2DA 4HAUA 4LHYA 4P4SB 3LLMA 1Z6GA 3MJHA 1R5NA 5AUOB 4PHGA 3HPQA 4JJZA 1XMIA 3FYHA 2GVZC 2RKOA 1KK0A 2GCOA 2F43B 5TV2A 1HV8A 3K9LA 1T3LA 1YZGA 1CBUA 1A7JA 4ABYA 4UNRA 4A36A 5J47A 4CW7A 1X8LA 2X1VA 3CNLA 1E2NA 1DELA 1E1RA 1ZIOA 4KVGA 2CL0X 1W7AA 3CWQA 4BRUA 4JYCA 1KKMA 2QBYA 3ECCA 2QEQA 3AV0B 2MMGA 1ZM2A 4CF7A 4HLUC 1FTSA 4C0KA 5B58C 4G5OA 3W5JA 1OYYA 5AWFC 4PSKA 4JKYA 3U2QA 4A1FA 4I1OA 4PQYA 4BFVA 3N5CA 1NKSA 3LRPA 4B2IA 1P4SA 3FHCB 5KDDA 4OL0A 4RKEA 1WQ1R 3MWJA 1QF9A 3E1SA 4LBVA 2WAXA 4P0TA 4BZXA 3RWMB 2ODBA 4X8HA 4AYTA 1MO6A 2PCJA 1JB1A 1RW4A 3U7HB 3ZVLA 1ZINA 4Q9JA 4Q7LA 2JEOA 3K9GA 2VYFA 2GZHA 2BBOA 2ZEJA 3VHLB 2B6HA 1XMJA 1E2QA 2GZDA 3IBYA 3VHXA 4OJKA 2XOKD 4KAXA 3K0FA 2ZJOA 3QG5A 4DLTA 4BLQA 1J90A 4IFEA 3U3JA 3EA0A 2QT0A 3KKNA 2WSSD 4MKIA 4EPTA 3THYB 3CRVA 3TAUA 2VHCA 4EJSC 4PPNA 5TDHA 5JCPA 3UIEA 1GVNB 2GJKA 4GNKA 4KODA 2BCGY 3CX6A 5TARA 4C0LA 3O47A 1SVKA 3HU3A 1GAJA 4D4LA 2G6BA 3R7WA 5KPDA 2J7PD 2JASA 4TL9A 4A6PA 4EPRA 5E7JA 2ZRHA 1N5IA 2FGJA 2DY1A 2PLFA 4M1TA 1Z0JA 2ZUDA 3QY0A 1JXOA 2JLQA 3CM0A 4JLVA 4BECA 1MO5A 1EFCA 4HLQB 2F6RA 1SXJA 2EYUA 4OYHA 1Z0DA 3OFNA 4F4IA 5J4YA 2EW1A 1ZP6A 3P27A 1YJ5A 3P4YA 1DBSA 1ZNXA 1SQ5A 5A4JA 3CIOA 2HV8A 5CDFE 1M7BA 1XJ0A 2PL3A 4WVFA 3P32A 1L8QA 1GL9B 3ZGXA 1JI0A 3AF2A 5H8WA 1KY2A 5CITA 4NYJQ 2IYXA 1P2SA 3KJGA 3U5ZB 4Q01A 2AKAB 3A4NA 2CE2X 1QDEA 1N6NA 4FMDB 5CJ2A 4BLRA 2V1UA 1BYUA 1QBKC 1YE8A 2RMKA 3LV8A 1GFIA 1KO5A 2HCBA 1AK2A 3TH5A 3OEHD 3AUYA 1EX6A 4XWOA 4TZ0A 3Q7QA 1PLJA 3QPWA 1NIJA 1H8ED 4RD2A 221PA 1FNNA 3A4MA 8OHMA 2P6NA 5UKDA 1MRNA 2V1XA 3GJ7A 2IHYA 4IEIA 1DE0A 4WZ6A 3B1WA 2J0SA 4MQBA 4YDSA 2JLWA 4B44A 4NL4H 4B3CA 1IAQA 2J45A 4TMWA 4CZ2A 4DLZA 2OLJA 4URVR 4RD0A 4D4KA 5C46F 3KKMA 3EA5A 1CXZA 1E99A 1Z0IA 5AJYA 1UKZA 2CJWB 3BB4A 1L4YA 4JLPA 1T4GA 1E2IA 5EP3A 3ZQJA 2C99A 3QVVA 4HZIA 1XU4A 1W0KD 5FBVB 4RFSB 5FOVA 5CK5A 1G41A 1P9NA 4K8OA 3SR0A 1BH2A 1AM4D 1S2MA 2JAQA 3H1TA 2FE4A 1R10A 4V0OA 3B9QA 2QQ0A 3RS2A 4PFSA 5DI3A 3ADCA 1T9HA 2C95A 4Q7JB 1EWQA 4PANA 3EPJA 1BS1A 2QP3A 4ZCMA 3LVRE 2CCGA 2MMCA 3H86A 5KNCA 3GLIB 1KI2A 3LBNA 2ZYWX 4A8JC 1LVGA 2ZR9A 1WB9A 2PJRA 3Q3JB 1G16A 3F3YA 2DFLA 3KL4A 2WJYA 3C15C 2HYIC 4U5XA 2CEAA 3X1XA 4Q48A 4TQAA 1Q1ZA 3ASYA 3CONA 1IY1A 1G7SA 2WICA 3IIKA 5J4VA 4W9MC 3K70D 1VYTA 1ZM7A 3QKSB 3HU2A 3K1JA 1NMZA 2C03A 3TR5A 2FH5B 3ZD6A 1UBGA 4M4SA 1NI3A 1XXHE 2JLSA 3Q85A 4G0NA 5KOYA 1KZ7B 4TMKA 4GT1A 2YOFA 1N6OA 3OHMA 3SYKA 2UZ3A 3K0AA 3MAAC 3AP3A 4IFBA 3TGPA 4QBGB 1Y63A 4JMPA 4B32A 1OXVA 2WIBA 2HJVA 5KSYA 2OXCA 1UKVY 4TT3A 2ZRMA 2WWYA 2PT7A 1KI6A 2ZROA 2OESA 3KUDA 4QGFA 4NMMA 2ZS7A 1XB2A 3KKOA 4LC1A 4HUQA 1NVXQ 1KGDA 4DIDA 1VDZA 2QMHA 4LX0A 1KK2A 2FFAA 2A5FA 5JLJA 4OKSA 3HP1A 1F2TA 1XTIA 4EAQA 3IHLA 1U0HC 3QE0A 3B5JA 1GNRA 1UKEA 4HZUB 2AN9A 5EE9A 2GILA 1IN8A 3SI7A 3VR3A 1DPFA 4DCSA 5KSOA 2NTYC 1S9DA 1E32A 3TJZA 4CEIB 4LJ5A 4BZPA 4I81A 3B1XA 1BO6A 2WJHA 4QG7A 1GOTA 5FI1B 1MABB 2IYWA 2WMNB 1BKDR 2C9CA 2I1QA 2QPAA 2QRZA 5FPKA 2JLZA 3E5HA 1P72A 4B75A 3TLXA 2BDTA 4GMDA 4PO9A 3LW7A 2CK3A 1XEWY 1ZUNB 2QY9A 4NCHA 4M1MA 3TK1A 4F38A 2G9NA 3DZDA 5HTKA 5H1YA 2ZAMA 1ZVQA 2YC2C 2QTFA 3PENA 4ERNA 1TTTA 2G0TA 4V0MA 3RVBA 5D3QA 2PJZA 1S9HA 5EP4A 1US8B 1O3YA 3I3SR 4MKGA 4PHTA 1JPJA 3HWSA 5B30A 4C0AC 1OF1A 4DUGA 2BKUA 1VPLA 2GZAA 3LXRA 2YOHA 3CPJB 2GVDC 3MG9A 4EKDA 2A7QA 2PBRA 3VAAA 3DMNA 4EJSB 4FMCF 1OW3B 2AKYA 3BXZA 4G01B 4MRRA 5FTKA 4JLNA 2MSEB 2FPLA 2NPIA 1HE1C 2RGXA 1CR2A 3K0EA 4JVSB 4B2LA 3BERA 1Q3HA 5L3RA 3KQKA 1COWA 2IEYA 2ZYVX 3BFXA 3KQNA 1N6LA 3NH9A 5JFGA 1UFQA 4B2PA 4M21A 4NONA 4ZKEA 2NO1A 5D3MA 1QHXA 1KYIA 2FF7A 2NIPA 2O5VA 3TUJC 4RCZA 2DHRA 2D7DA 3GFTA 3ONWA 1OSNA 3LAWA 1KK1A 3M0EA 1FPMA 4H1UA 2O8CB 3NEYA 4LBYA 4HEJA 3THWB 4MYHA 2AFIE 2ZVPX 3AKDA 2MSDB 3FKQA 2VIIA 3FMOB 1A2KC 1EESA 1Z07A 1F2UA 2ZE8A 4V0LA 4LC0A 1G3UA 1UADA 4LYHA 2ZRDA 2HEIA 4BUJA 3AF1A 3EC2A 4DDVA 3ICEA 3DOEA 4H9GA 2IYLD 5SZJA 3UMSA 3QIAA 3CO5A 4G1UC 1KO4A 5FPTA 1II0A 4HB2A 4TN1A 1G18A 1G19A 3PUWA 2DYKA 2DR3A 5JEDA 2O8FA 4KFRA 1ETUA 3RRNA 5HKKA 2ERXA 1LNZA 4G5RA 3V00A 2WWWA 2AD5A 1KI7A 4MYTA 4Q18A 4IDOA 1K5GA 1UM8A 2C77A 2D7CA 2QPOA 3CBQA 1D2EA 4JBYA 4OK3A 4B73A 1Z2CA 3C8UA 4WAUA 1RKBA 3NWJA 1ESNA 1SVOA 3EIHA 1JECA 4V0NA 3KFVA 2QMOA 4FCVA 4MH0R 1FW6A 3MFYA 1R7RA 1G5PA 1Z08A 3GFOA 3LLUA 1Q44A 5TY0A 1MKYA 1NMXA 4YMTA 5JJIA 1OIVA 3A1WA 1GWNA 4I1UA 3M6AA 3BAFA 1COWD 1DEKA 3DEFA 4GOXA 1II9A 3U3RA 3RRMA 1I4DD 2YOGA 5IK2D 4IOJA 2AXNA 3SEAA 4C3ZA 3SC3A 3N70A 1KDRA 2FFBA 3EZ9A 3C5CA 3AVPA 3IGFA 2NG1A 2X8AA 3L8YA 2JDID 4AIIA 3OAAA 1SKYE 3C4JA 4DB4A 5KTYA 2JJ8A 1RRGA 5TVKA 1JR3A 1F3OA 3Q7PA 1Q1BA 1U81A 4M1SA 2GNOA 1EGAA 4A8JB 2XGJA 2PX3A 1N5LA 2BCJQ 1IONA 2CLCX 4NYJR 3L0PA 1QHHA 4ACAA 2C04A 3KQUA 2YV5A 1IM2A 4RCYA 2VSFA 4Z1MA 1G7TA 1GZSA 1SXJC 2YVUA 4G5SA 1JBKA 1DAEA 2OCAA 2PCLA 1OB5A 5HR5A 2CCJA 3AGQA 2GEDA 4JLMA 5HKKD 1TQDA 5C4GB 3BS4A 2ZSDA 2G77B 1YU9A 3GLGE 5JS7A 1I2MA 5JMTA 4DKXA 2A5GA 1TNDA 2AL7A 4KO8A 4MKHA 2XJ9A 4DSTA 1PJRA 1UEJA 1KKLA 4Q1CA 2ATVA 3HYTA 1XRJA 3B1VA 1E79D 3KFXA 3SHWA 3VMFA 1SXJE 5TXGA 2NQ2C 1ZCAA 2VF8A 3F5FA 3MGCA 5J4HA 1QVAA 3EC1A 3CF6R 4MGIR 5JBQA 1MO3A 2JIZA 1J7KA 3MSXA 4ACBA 4AKGA 1T8UA 3O8DA 2KBEA 5LDDC 2GA8A 3KQHA 1ZM4A 3BH6A 3SQXA 3TRFA 5F2EA 4QJ4A 1ZNWA 1CP2A 1E2PA 1WRBA 4LJ7A 2ZI5A 1KMQA 5B2ZA 4XSGA 3WYAA 4B76A 1G6HA 4E09A 3VU9B 2ONKA 1QHSA 4P4TA 1KI9A 2CL7X 2ZJYA 1DO0A 4NE2A 4UNQA 1M34E 1G3QA 4NCJA 2G1JA 3QKRA 3RYTC 3GP8A 1PUIA 1E98A 1ZJ6A 1E9CA 3LQQA 4DDWA 2PEZA 5JZVA 4I99A 4TQ9A 2GXUA 3ADDA 3UK6A 2HT1A 1WP9A 4O0MA 4C9BA 1AS2A 1CULC 3B60A 2RCNA 3LD9A 3PXGA 3CKLA 4HDCA 5KNDA 4YXWD 3MWYW 1D9ZA 2Z4SA 1YVDA 2WVJA 2OCBA 3C16C 3CRRA 3LA6A 4PHHA 4JSTA 4DLVA 2XTNA 2O0JA 4EPXA 5AR1A 1YKSA 1E4VA 2BC9A 2X2FA 2D4HA 1ZU5A 2GJSA 3CX7A 2W58A 1LY1A 3VR5A 1EFRA 4WXRA 2V55B 1RJ9A 2BEJA 2VSXA 4PQFA 3GPLA 1DAIA 1YZNA 2W2VA 4R2HA 4YMWA 3FTQA 2ZU6A 2VSOA 1P7CA 1OFIA 4A0GA 1CEEA 1X8KA 1E9AA 1RVDA 2XSZA 3X1DA 4QM7A 3OE7D 1LF5A 2W6IA 3GLHB 4L8GA 2NO9A 2JA1A 2WWHA 3IEUA 2J59A 3NHBA 1E1QA 3MLEA 2EFEB 4FMDF 1XTJA 3UG6A 3FGNA 3AB3A 2GCOB 1OT3A 1U9IC 2IYRA 2CLSA 4OQXA 1RFLA 3GJ0A 2JATA 4ZCLA 6Q21A 2GXQA 4NTZA 2FZ4A 1ZD8A 5LB2A 2ZJAA 1OXXK 4U02A 2VBCA 2CHGA 4KYIB 4URYR 2HXSA 2QBYB 4AKIA 4MRNA 1FQKA 4Q9KA 1PV4A 1OYWA 3FVQA 2QGZA 2D3WA 1MOZA 5HCNA 5KNBA 4Q4AA 2XB2A 1ZM9A 2ODWA 1IN7A 3T5GA 5L3VA 2OFWA 1VTKA 3QF4A 2ZUCA 5EE1A 3DO6A 5EZ5A 4GI7A 3KUCA 2GHIA 3BK7A 5H68A 1GSIA 3HU1A 1RIFA 3FHOA 4TL8A 2W2XA 2IUSA 2Z43A 1I2DA 3K09C 3L0SA 3TQCA 1R0WA 5G41A 1SVMA 4UKDA 1ZUIA 4IOKA 4TYWA 4Q1AA 4B3XA 4EPVA 1TF5A 3OIWA 4C2TA 4DBLC 4GDFA 3X1ZA 1JAHA 1P75A 1CRQA 3CR7A 1NVWQ 3K0FB 3AVWA 3DVLA 1EFHA 1XD2A 2JCSA 2OZEA 2QROA 5C1BA 4XWAA 5B64A 2GJ9A 4PR0A 3EG5A 3TAHA 1AS0A 3UWOA 1FX0A 3GJ5A 4L15A 2H1LA 2HCJB 3CH4B 3BH0A 4RZ3A 1TMKA 3L8ZA 2P3SA 3M4YA 3P4XA 2CE7A 1E1QD 1RYHA 2WWXA 2YC4C 4IDPA 4HLCA 3FWYA 3UMFA 4ILEA 3V4FA 2QE7D 2ZI9A 4D0NA 2QAGC 5CM8B 2D2FA 3R7WB 2VHJA 1K8RA 1D6JA 2WJGA 2IXFA 1NY6A 4ITRC 1YR7A 3T34A 1VG9B 5CYOA 4B43A 2XNDA 3GMTA 2E1RA 1GL7A 4R7ZA 4RFVA 2Z0MA 1XP8A 1SXJB 2XOKA 3GLIE 1R6BX 1TX4B 3EWAA 5C4MA 2BKEA 2GF9A 2RH5A 4AKEA 2ANBA 4KLNA 1C9KA 3FFBA 3KXLA 4BEBA 2WSSA 3MWKA 2GEUA 2IS2A 2O0HA 1XEFA 2HLDD 5BWMA 5EQTA 4UNPA 4BFWA 2ZE6A 2F3TA 2IUUA 1S1CA 1P3JA 5CLLA 3U44B 4XOIA 4IHQA 2Q9AA 1Q20A 3FKSD 2FZLA 2IT1A 2PZFA 4M0LA 2J7PA 3TUIC 1P5ZB 2VP2A 4I1VA 4M1KA 4LZZA 3WNCA 3GLFE 1MH1A 3SHFA 4US0R 2ZRFA 4JLAA 4C0JA 1IXSB 2BBWA 1N0WA 1NKTA 1Q0UA 3NXSA 4TLBA 4S2EA 2CNWD 2ODEA 1QZXA 1TADA 1VKJA 1DAFA 4TMVA 5KSPA 1UBFA 1TEVA 1TEXA 3PITA 4LBWA 1JJ7A 2DFNA 4C0QC 1GIAA 1E0KA 3QXSA 3SN6A 1OV4A 2W00A 4U7DA 1NVUQ 2QPTA 1WXQA 2C78A 3B2EA 4OK6A 1GKUB 2XB4A 4HB4A 5H70A 1U0JA 2FN4A 3DHWC 2H18A 3LNCA 3MD0A 4OJQA 3OEHA 1LS1A 2ZIAA 5AJWA 2NOAA 4BZQA 2XNDD 5DI3B 2Q6TA 4TYQA 1H8EA 5EE3A 721PA 4AY2A 3I5XA 3EW9A 1GNPA 3GQBA 3L43A 2DPXA 1P62B 1KJZA 2VTKA 5CJPA 1W4AA 4RKFA 4AD8A 3IO5A 4CRWB 1AJEA 1VIAA 2GBLA 4WXPA 4R2IA 5KHOC 1J8YF 2BWJA 3RHFA 3T15A 1KTVA 2JLUA 1E9FA 2W2TA 2OHFA 2V54A 5FBLB 4O25A 5B57C 1OHHD 1E96A 4HDOB 3AVVA 2AHOA 5FUVA 3BH7A 5GJWC 4A0HA 2JGNA 5E3HA 4D81A 4UNNA 1IBRA 2WJJA 1W36D 1FUKA 3AVOA 4MA4A 1G7RA 2IWHA 1W0KA 2AWNA 4UJ5A 1IXRC 4TLDA 4NCIA 3SYLA 2ZRIA 3AM1A 2GJAA 4NCNA 5FUXA 1AZTA 1OE0A 2NZ8A 2XITA 3AEZA 4V0KA 3UG7A 4EQ6A 1KMHA 1AZSC 3O8BA 1FUUA 4JKIA 2YKGA 4XH9B 4NHOA 4WBSA 4RD1A 1QG4A 1NY5A 3ZZTA 3S1AA 3FDIA 1G3IA 2FJUA 3I61A 3CX8A 4C0BA 4PXAA 3HPRA 3K0AB 1KK3A 1N6HA 3KB1A 4ZPXA 5DYGA 3TE6A 2NMVA 1EXMA 3GFPA 3KB2A 4ZI2A 2PZGA 3L0OA 3CPHA 4FINA 4N0DA 4LV8B 2QTVB 4IJMA 2XJ4A 5AUPB 3WNDA 1KI6B 4QBFA 1E2FA 4I1SA 2VRWA 2QG6A 3BD9A 2DCUA 4US2R 4DT1B 3QNUA 4QNRA 4HUQB 2Q3MA 1P6XA 3W6PA 3IPYA 3WXMA 5EXSA 3ZH9B 2IYTA 1FMLA 1A5TA 1T0JB 1TU4A 2FNAA 1ZMXA 4ZIRA 2RHMA 1KJWA 1M7GA 4Q9LA 4CEJA 1U8AA 4B3FX 2ZJ8A 2BMEA 3ASZA 2KB0A 1OPXA 1XMVA 1TU3A 4BFXA 1G3RA 4DLUA 5EXTA 1SHZA 4RD3A 4W7SA 3EXAA 1XF9A 3LBHA 2G0NA 1E2LA 4P4SA 1JJVA 2FOLA 2BJVA 4A2WA 2RGNA 4QGGA 4CEHA 2ZSEA 2HF9A 1CJKC 3NTUA 4II7A 3WMGA 5FOWA 2EYQA 2CDNA 2IA5A 1TL7C 4NP6A 3SNHA 3NHAA 3T1QA 3GJ3A 3UMRA 1KSGA 3OESA 2IXEA 1GKIA 2ZJZA 2GETA 5AJVB 4ZO4A 1L4UA 3AP2A 3DZ8A 1UAAA 3ZS9A 1II8A 3LW8A 3I73A 1UBCA 1Z28A 4JJKA 3LVQE 1P2VA 2LKDA 2IBMA 2FMXA 1B0UA 4EFNA 4JIMA 3MUFA 1KAOA 1L7VC 2ZSAA 4PC6A 2HUPA 3T5DA 3CRMA 3TW8B 2IS6A 2EFHB 2OFOA 2WKPA 2IYUA 5BN5A 2QAGB 5E7IA 1NBMD 1SVSA 2FPKA 1DTSA 1M74A 3P26A 5CIQA 1ZM3A 2J41A 1WDTA 3TKLA 4ZDJA 4PPQA 1JALA 1G20E 5D3MB 5FBWB 1LFDB 4QRHA 4URUR 2V8OA 5GJVC 1NN1A 5GADl 4TTPA 4DZZA 1F60A 2FEOA 2DB3A 3GLFB 4MUAA 5JRZA 1N6KA 3NBZC 5DIFA 3GJ4A 4A2PA 2C9YA 2VHTA 1VECA 2DFTA 3G82C 5G3YA 1F2UB 2NGRA 3FFAA 1VCIA 3A1TA 3BORA 1SVLA 4OHXA 3RABA 3Q9LA 3OZXA 1G7CA 3AKEA 5EUMA 3WMFA 1W48A 1OKKD 1Q1QA 4L9WA 4YLGA 4H1VA 1A82A 2PLRA 5FUWA 4M8NE 4ARZA 4PO1A 2ZI4A 4GP6A 2LWIA 1AGPA 5KYKA 5L3QA 1W46A 4X8LA 2P6UA 4LUCA 1GRQA 3UPUA 2EVWX 1RPZA 5E4FA 2VQSA 1W2HA 5LPNA 4C7OA 4QHTA 1Z3IX 4PHFA 1AKEA 3VX4A 1T8TA 1N0UA 4Y0AA 4WZAE 1XBTA 3SJAA 4BWYA 1ZNYA 1CR1A 2WSMA 3L82B 3PIRA 3OEED 4Q5IA 4QHSA 3RS5A 4B34A 1G17A 4LHZA 2RAPA 2FSHA 1BYIA 3N2EA 2R2AA 5F9HA 2OBLA 3C7KA 2W0MA 4CYMA 1W5TA 1U8ZA 4PZZA 3EASA 1X1SA 4IVRA 4DC9A 2WJIA 3SZRA 5JWHA 5A5GA 3SFVA 2ZRLA 4HLDA 2YJTD 4EPWA 4DIEA 2OT3B 4A92A 2WHXA 3LO5A 4GMXA 2CHQA 3CH5A 4Q4JA 1T0HB 3TVDA 2FFQA 4AKHA 1PLLA 2RB4A 4CT5A 2WPDD 3IDQA 3VKHA 1IY0A 4BLSA 1JAIA 2BBSA 4FD2A 2YNMA 4WIAA 1E2MA 5DGXA 5JWRA 2ZRGA 2O8EA 1QHHB 3SFZA 3CB4A 4POAA 3B8HA 2QA5A 3SJZA 4YMSA 3EZ7A 4ZDIA 5IF9A 5G40A 4F4CA 4M22A 3QBVA 3PEYA 4BEJA 4NYMR 5IK2A 2XXAB 1NIPA 2ORVA 4KHZA 5DI9A 4F92B 4LI0A 2YWEA 3B9PA 4CIDA 4D6PA 1Z8FA 1S8FA 4JVLA 1TF7A 2DFKB 4QXAA 3WY9A 3PEWA 4BLTA 1X6VA 2ZR0A 2NPFA 2JDIA 2A5YB 1Z6YA 1Q3TA 1M8PA 2GWHA 4QJ3A 4URWR 3RSLA 2R6DA 1LF0A 2P5TB 2G1KA 3K0CA 1KZGB 4LJ8A 4Q00A 4M9ZA 3ZDQA 5F3WB 1G5RA 3JVUA 4UNSA 3W9YA 4OI1A 1G3MA 3SOPA 2J5XA 3EZ6A 1S96A 3D8BA 1YRBA 1XJQA 1NLFA 4LV6A 1E0SA 3R9IA 4F91B 1QG2A 4GP7A 4LOAA 1VHLA 1XTSA 2P6RA 1GP2A 3GLHE 5CK4A 3PR1A 4DEXA 4DHEA 1XCPA 4C2UA 5FUYA 4NBSA 2B7CA 4XIGS 4E07A 3ZS8A 1OXUA 2QQEA 1KDTA 2XAUA 4OQNA 4OI0A 2C5LA 3CNOA 2AXPA 2R9VA 4C0HA 4QGAA 4TL7A 3WHLA 4GL2A 3RRYA 1X8JA 2IYVA 4BFTA 2ZYTX 1TQ2A 3RS3A 5BYJA 3PEUA 3QENA 3BFKA 4XJXA 5TB5A 1E79A 2ECKA 4GSYA 1XZPA 2GK6A 1VYUA 3NEJA 4KI0A 2V4ZA 2W6JD 1ELOA 3CLVA 3QKRB 1Z6AA 2FSGA 3BWDD 2QM8A 4DLWA 1FL9A 4JYBA 4LY6A 3THXA 521PA 2IXGA 3I8XA 5CB8A 5JJKA 1D2NA 2Q0HA 2DWQA 3CRW1 3HDTA 4PZYA 5CM9C 4N0EA 3SQWA 4X8OA 3MMPA 1N0VC 2GBLC 5LD2B 4TSFD 2OXRA 4KCGA 4UXIA 5JSZA 1AQUA 5FPSA 4CEIA 1KHTA 2QNRA 3HYRA 2WM9B 3PG5A 4QM6A 2WZQA 1MABA 4DXAA 4HAXA 4B3GA 1W0JD 2BHRA 4LJ9A 4QL3A 3H0KA 3CF2A 2H57A 3QXHA 4JS0A 1JNYA 3IKJA 4BFYA 4C0SA 1BOFA 1CF4A 2KWIA 2O8DA 2C96A 1XWIA 1RJ9B 1RE0A 4W5JA 3OIUA 4L5BA 3IIMA 2Z5FA 2OE2A 2YWFA 1VHTA 2QT1A 4Q9HA 3ZQ6A 4Y0VA 2HYDA 4PPGA 4D2IA 2WKRA 2IW3A 2D2EA 5GJBA 2HT6A 3UKDA 4W5WA 4BRWA 1G4AE 3PUXA 2VP0A 1IOZA 1IN4A 1D5CA 2OUKA 1CTQA 3BB1A 3W6OA 1G291 1J8MF 3RANA 1MRSA 1UPTA 4E03A 4DCTA 2B8WA 1OH8A 4OI4A 2FDCA 4LHVA 1M1YE 4YXWA 4D4MA 2K5UA 4P32A 4KFSA 1HUQA 4Q66C 3A36A 1UF9A 4JBXA 5FBQB 4EDHA 1XPOA 5CDFA 3NDBB 4PAQA 4WOPA 3U7EB 3K70C 1U99A 2F3RA 5DN6D 2JLYA 3RDPA 2UVQA 1RRPA 421PA 3O8RA 2ZS8A 4MYUA 2A5DA 3CUEF 4KLZA 2PH1A 2N42A 2OV2A 3VR2A 2ZI3A 3GEHA 4DSNA 4OQMA 2REOA 3E70C 5BN4A 3BRWD 2Z83A 2ORIA 4JLOA 4ZDKA 5KU1A 4TWZA 2OFXA 2F9LA 4ON9A 4RZ2A 3SJBA 4TYPA 4Q4AB 4ZCIA 3GJXC 3OE7A 1OIXA 3JZMA 2H17A 3K0SA 5K8TA 2GRJA 2RGNC 2JLVA 1H8HD 2YWHA 2KE5A 2GXAA 3Q8XB 1VYVA 4LBZA 1KSHA 2A3RA 4GFDA 2JLRA 1HT1E 4NPHA 3RC3A 4JVMA 2ZUBA 4OK5A 3IBGA 3L2OB 4RZXA 2CBZA 3LBIA 3NC0C 2IX3A 1EG7A 2WKQA 3MRSA 4FMBB 1ONBA 3T06B 1OB2A 1G8PA 1Z5ZA 2EFDB 4Q47A 3TR0A 4M9QA 3AVTA 3EZ2A 1XTRA 1XD2B 3A4LA 1HY3A 3QPUA 3ZVNA 1NF3A 4KYUA 1E3MA 3D7MA 2J46A 2VH5R 2C8VA 3AVQA 4M53A 1FOEB 2IHBA 3V4RA 1QHNA 3BOSA 1N5JA 2XX3A 2CVHA 5BYKA 3BE4A 3AF4A 2QAJA 1OH7A 2ORWA 4PAOA 1Z29A 3I72A 4R9UC 3K9HA 2ZQ5A 2AWOA 4MRSA 2UZIR 1TQ6A 1Q12A 4URXR 3IQWA 1HQYE 2VHUA 1M7HA 3VNUA 1AA3A 1QRAA 3VKWA 3W8RA 1EWRA 3A37A 3TW4A 2J3EA 2IF0A 2XTZA 1P73A 1AA9A 1YZKA 3LWNA 1D2MA 2V7QD 5AUNB 3QBTA 1OXTA 4HDQB 1KI8A 5DISB 4M9XA 3U61B 5L3SA 4HYYA 3EWSA 1XXHA 3ADBA 1SVIA 5M04A 2A2ZA 2WMOB 3P20A 3W3ZB 1WA5A 1KI1A 2QE7A 1YZUA 3T61A 1W4RA 2NO0A 3D3QA 1Y3AA 3SE0A 3AQ4A 1NSFA 3KTAA 1JEEA 2BM1A 4HSEA 3M1IA 3U3OA 821PA 1XCMA 1WCV1 3ND8A 3EPHA 4GOJA 4Z54A 1G6OA 2J9RA 3WP0A 1FTNA 2H8KA 5J5CA 3ND9A 2F1HA 4A2QA 1ZC3A 1T6NA 1Z22A 2VL7A 4OQLA 5KDOA 3LH5A 1GRRA 4JLJA 3U6BA 1LB1B 4DDUA 4IXMA 3CZPA 4Q4HA 2ZRBA 1G8GA 2ZREA 2L0XA 2KJQA 3Q5EA 1OH6A 2IYSA 2GJ8A 621PA 3EIEA 2HLDA 2P2LA 2QZ4A 3RS7A 1GKYA 2JJ1A 5J4KA 1MT0A 1VIYA 5EUQB 1NLZA 3FKSA 1D9XA 1CS4C 4QNMA 3LFUA 1AIPA 3R20A 2ERYA 2OSBA 3KKQA 3PV0A 5FL7D 3SYNA 3WHKA 4D25A 1Q57A 2GAAA 1I4TD 4D82A 2J0UA 1KSJA 3OF5A 3NDPA 1FMJA 3NKVA 4HAZA 5EE5B 4PTLA 3C5HA 3R8FA 3W90A 2QTHA 2ZU0C 3GCGA 4FWIB 4LPKA 2R44A 5IRCD 3TMKA 2CNWA 2CXXA 2QUZA 5AUQA 4KBFA 5HZHA 1C4OA 2RGGA 3PQCA 3FB4A 3TQFA 2VHQA 3MJRA 3UANA
chains in the Genus database with same CATH superfamily
3HQ4O 3Q40A 3RTDA 3RVJA 3S7TA 3ZVRA 1VE9A 1G8JA 3FYTA 1HOXA 2YNMC 2W0SA 3HDVA 5SZKB 1LZLA 3UFXB 2C7QA 1OJLA 4EKGA 4GSKA 1LSJA 4DLKA 1UQTA 1T3SA 1BAPA 4GPIB 1S3FA 4JJ8A 3W5DA 2DEUA 4AUMA 2WABA 3KQLA 4UMVA 2GM5A 3ZIAD 3HVKA 2OHGA 2QW8A 1SZCA 1E6CA 2XNSA 3BGSA 4RHXA 1FBNA 4JAVC 1UM9B 3ZWBA 1XCGB 5F4BA 1F48A 2PUTA 9LDTA 2KBFA 2HMAA 4J0QA 4GMGA 4BNNA 2VP9A 1G5IA 3ZLJA 3M4JA 1RTKA 3L7CA 4J3JA 1YQXA 2KLBA 3P9YA 3MQFA 4WLOA 5IULC 1GGJA 4GEKA 2FV8A 5KYVA 2JB9A 3HKEA 4CMBA 3EPPA 3MTDA 3UGQA 5D8DA 1QHYA 1QO9A 3QLUC 1F4PA 2HN9A 3PI7A 5AVOA 2H7YA 2I7XA 3NRBA 2FPIB 1JJBA 2WWVD 5FULA 3T1VA 1SUIA 2L82A 1AN9A 3PXUA 4X3OA 2B0CA 2PR2A 1KU6A 5CD1A 2Q4RA 2RGYA 4JWTA 2ZJBA 4Z8YA 3QGMA 4GPTA 4TZ6A 4E4RA 5HUQA 4IDFA 3PE4A 4BMXA 3RWOA 3HSYA 5DLYA 5LBIA 3NONA 5ALXA 4ZWNA 4P08A 5CVVA 1JF8A 2XKAA 3E9MA 4XWKA 3LVBA 2G8LA 2QD3A 2AQ8A 1AO3A 1TJ4A 3C14C 3I32A 1QGUB 2B3TA 3RC7A 1ENPA 1TUIA 4DR1B 1KAGA 1CJTC 2P1DA 3NI2A 4GVLA 1Y8RA 1V43A 1REQB 1CUSA 3KG2A 1XA3A 3FHJA 1U2ZA 1U94A 2ABWA 1LK5A 2QU8A 3PCRB 4JI1B 3UWKA 1FFGA 3ANMA 2VLIA 5DXFA 1OLOA 3TQQA 2MCFA 2A9RA 3DFKA 4M87A 2YN4A 3G2QA 1FVHA 1L4FA 1E2EA 3LXXA 3OT5A 3QXCA 4R5HA 5JDIA 1XU9A 5H82A 3LM8A 4X91A 5HF6A 3I2GA 1IJEA 2B8TA 4IF6A 2XEXA 1GPBA 4XIIA 3OQMA 2R7NA 1KIFA 1R9MA 3VQTA 5BNWA 1XZCA 3ANXA 4LJYA 4ZV4A 2D00A 4PS1A 3HI6A 5HJ2A 3V9PA 2NT4A 1Q1EA 1NRWA 4E6PA 1FDOA 4B48A 4Z4HA 1PTJA 4NYIR 2FFJA 1I7DA 4E5UA 2CLOB 2H9AA 2JIMA 1II8B 2PGXA 3VOSA 4BV8A 4K6KA 3WLSA 5CA0B 5CDYA 3KUXA 3UT0A 5BVHA 2VYVA 2XV1A 4O5OA 5E7MA 5J40A 1K3UB 4ZVKA 4QEZA 2QMEA 3FTDA 2D1FA 4QAJA 4GOND 4ZOAA 1S2IA 4B46A 2IEGA 1Z2AA 2OAP1 3RTBA 3U3MA 4C20A 2FWJA 2X22A 1QE5A 3CU5A 5JG7A 4UUQA 3P71T 2GPWA 3RWBA 4X45A 5BN5B 2XF2A 4WZBB 1GNVA 1CNMA 3T0GA 4AP9A 5JAOA 1TUBA 3F97A 1TF2A 3G5LA 4B5LA 3RSZA 2W4QA 3TNJA 2VH1A 2M6LA 1EUDA 2VHZA 5KSZA 3TTSA 3V8PA 1ZAKA 2ZDHA 5FI5A 4DWJA 2Q0SA 4CTOA 2G9RA 1OC2A 2JJ2D 3OFJA 4EF5A 5A4DA 2LXNA 2F7SA 5DW3A 4H7DA 1A8SA 4F2GA 3GP5A 4WKOA 4DM4A 5C8YB 4PR3A 1WE2A 3KSMA 2UZ1A 5JFOA 5LNK1 5J1TB 3DTVD 4A5SA 3ZU2A 5JEEA 3T3IA 1A1VA 1N2XA 4NBUA 3VISA 4CNBA 3A3NA 1AXGA 3ZK9A 1HYEA 4B40A 5BUZA 1TMOA 1ADGA 1Y1RA 4PO8A 2JAOA 2X19A 3QQ5A 4G5QA 5L3ZA 5DTRA 3FWZA 2X0KA 1DAGA 3CZ5A 1GGVA 1WMSA 3GLGA 4EW2A 4ZAGA 5DNYB 2FPXA 3IBSA 4UHCA 3WOHA 3WWZA 3DD5A 4R98A 5LBTA 4MPTA 3ABOB 2GCEA 1HYQA 4UBLA 1TPZA 4MGKR 2EQAA 4OA8A 4S12A 4G84A 2VJMA 3HM2A 4LRSB 4DPLA 3K73O 4JLBA 4ZCRA 2ZE5A 4M9SA 3N58A 5IDVA 3V4PB 1SELA 3GDWA 2RI6A 3MJFA 2WAAA 3ZV7A 3CVVA 2PKCA 3B3FA 4HGNA 4AZTA 1JHRA 1N36B 3QBJA 4ZZIA 2Q62A 5KSWB 3I2JA 5C80A 1AS3A 3AUXA 1GSAA 1NSTA 3NBYC 5DYTA 5FHQA 3ZXUB 3A0RB 5FD8A 4QYIB 3OFSA 2OC9A 2ZTSA 4QUDA 4RVGA 3HDHA 4UUNA 4UMEA 4M1WA 1O96B 1Z38A 1NRXA 1HE3A 1DG1G 3C5WP 2V7BA 3JQFC 5EC8A 4AWXA 2R68A 2WF9A 1L1FA 4DCGA 4IDNA 3KQOA 1UJBA 3PUVA 2YJ3A 1RWQA 2B5WA 1TI7A 1ZOIA 1HTWA 4UATA 5TQ0B 4UZSA 4JL5A 1VKNA 3FSJX 1M8JA 1QHEA 1I6KA 1NYTA 4A27A 3TM5A 4YCSA 5JDCC 3UWMA 2DETA 1QOZA 3WLJA 2NXEA 3AL0C 3P9KA 1H2WA 4I6GA 1NBAA 3EZFA 5KJEA 1RXIA 3LUGA 1UJCA 4C4TA 1IVSA 1NW8A 1M1XB 4QUBA 3LQ1A 1KR5A 1M34A 3GMDA 3S70A 1S8NA 2I4TA 4NENB 3L07A 3JYOA 3MMSA 2QENA 1V9SA 2EG5A 1UKYA 1X1QA 2FB9A 3AHDA 1JG1A 2AR0A 2UZ0A 3HBNA 3OCXA 1IN5A 5HIAA 4N6GA 1OFTA 1S4QA 3WNVA 2O06A 2HRBA 2IXDA 5IYZA 1YBMA 1ZH4A 4FQ7A 4XD7D 3M89A 1ZK1A 3OEEA 4PC3A 5DTMA 3VR6A 1G2QA 2B98A 4M54A 3WKAA 3C8DA 3M4XA 1R1DA 3PDIB 4FFMA 3QVGA 3THOA 1GRNA 4QDUA 1T4BA 1G21E 4OFZA 3ND7A 1W49A 1Y3BE 4X95A 2GF0A 1W6RA 1TMYA 5J4LA 2HPHA 3CR8A 2VPXA 2VT7A 3D0KA 5K8IA 1IUKA 3ANLA 2BR4A 1K9VF 1X86B 3QI7A 1MDBA 4IWXA 3PUIA 4NH0A 5L4SA 1LUAA 1KRHA 2V7PA 1IOVA 1SXJD 1LV7A 4D56A 2IXBA 1SUDA 1HQCA 4AXXA 2G63A 3T1YB 1QIHA 1HYHA 4TYYA 1WF3A 4NS1A 4C29A 1A5ZA 2X2OA 5HRAA 2YBDA 3M3HA 4RY2A 1MJHA 1Y1QA 4AURA 3B1FA 4L78A 3DMGA 1M6HA 3A1VA 1KVUA 1QIJA 4RHFA 2D0IA 4AY4A 3N2KB 4WJKB 4JR1A 1EFPB 2VDWB 2W2PA 4RA6A 4G1VA 4I9UA 5GM2A 4JBHA 4EBFA 4REQB 1U2DA 4MA5A 3JU3A 3LUJA 4KE8A 2O8VA 2Y93A 2C4TA 3IV9A 5KX5B 3A9VA 4WVLA 5K8LA 3MOGA 1KZYC 1L6RA 2Q9BA 3ZH2A 5G4KA 4BYGA 3TQOA 3WKEA 1ZYUA 1RVV1 1VXRA 1JILA 9ATCA 1YDEA 3U3KA 3VVCA 1CQWA 3ZKWB 3QEMA 1E60A 4WOBA 4EG6A 1VDMA 4IQ0A 1XVLA 1L4BA 4GX2A 3GD5A 3GFRA 2JGRA 1OFVA 4J2TA 3KEGA 5ALDA 4BLOA 3ZDAA 4CGZA 4OBWA 1OX6A 2R62A 4MQ5A 3SZGA 2AX4A 1IL0A 3F2IA 3FE2A 3CLSD 3LLSA 4YRTA 2JI8A 3H0CA 3Q7TA 3P9PA 2C2ZA 4BMZA 3HXLA 3ZJVA 4DR6B 4D6YA 3H83A 3W3AA 4TMXA 4WUTA 5C2JB 2RIRA 2ZRPA 1ZICA 2R6GA 2IL1A 1OZFA 3C45A 3CWZA 2OO5A 2XY4A 3JV7A 1UDXA 2GLUA 2WG0A 5DK6A 4GRDA 3PQ4A 4MS4B 4DLYA 2JAUA 4GKJB 2QNBA 1U9IA 1Y9ZA 5DFAA 3IJRA 1MV5A 1NN3A 3D3KA 2J0EA 3PFCA 3VO1A 4GOOD 5FOXA 3MWEB 1E61A 2FW7A 4NU5A 2E48A 1FLAA 5ANRB 2F17A 1E8DA 1CZOA 1WLYA 3PVCA 1GQ2A 2BMFA 4ZI7F 1IZ7A 4DJ5X 1Z06A 3LMKA 5F98A 3LC7O 3O7WA 4QUEA 1EM8B 1XZHA 2H1OA 2BH9A 3GU3A 2Q5HA 3DBHB 2HCRA 2CL6X 3I6BA 3DE5X 4WOJA 5FYDA 1CUCA 4WLNA 2RSLA 1N5KA 4XYBA 1L5MA 2AEJA 5LQAA 4DCJA 2CDAA 5KNCD 2HDNB 4YHBA 5T67A 3G23A 5EKDA 1XR3A 4Q1BA 4FXPA 1JXQA 2VXCA 1JHXA 2D74A 4Q82A 2E0IA 4YV2A 1UXIA 2OV3A 4L0DA 1I0LA 1NONA 3H9GA 2AN1A 4OX9B 1MJGM 3PDWA 1MZVA 1AQLA 1VSBA 2XB6A 2V98A 5K3SA 4R8RA 5AW2A 1R0ZA 1XLVA 3O0TA 5JBIA 2C58A 4UHFA 4DQXA 3ZE9A 5ESWA 4E46A 2CNDA 2YIMA 1UC5B 2Y1WA 1GUDA 3OC0A 5BXYA 3KOWA 3U7GA 4M8LA 6GPBA 2MSLA 3RS4A 2RHBA 1A5SB 2CB9A 1MF7A 2Q2OA 3HV2A 1JEOA 2AV6A 4IJWA 4UM8B 3R9KA 4OXXA 3WC4A 3SU8A 3BRCA 5KPJA 3HR8A 1HXHA 3E5MA 5H80A 1DFIA 4XSHA 3D6FA 3ISTA 1B42A 1Y5MA 1V71A 2PGIA 3NDRA 3SJ7A 4B3DA 4O4HF 3AH8A 3UMYA 3D8HA 5C7YA 4JBWA 4QU8A 5KTSA 1HLDA 2ETXA 1CC1S 1Q95A 2OR3A 1UZNA 2FSIA 5HILA 3F3KA 1QRUA 3GLIA 2XR1A 2FG6C 2WIKA 3GNLA 4HH4A 4IIVA 2E4WA 3LHFA 3OU2A 1W0JA 1XI2A 3IE1A 1HFEL 4R8MA 3M34A 4N76A 3E61A 2WVAA 3D4LA 3X1MA 1AKYA 1T13A 1OLXA 1WPXA 2IPLA 5BN1A 1YHNA 3WZ2A 2YIJA 2B6NA 2PBFA 3HNRA 1JSXA 3A26A 1OZGA 1T8SA 4AG3A 1KVQA 1TT7A 2JGDA 4YH1A 3RC9A 3WLHA 2BL4A 3MGAA 3LT0A 1Z36A 3DT8A 1T5LA 4RDXA 4DV2B 3K8YA 1G1MA 2VZ0A 4GLBA 4XVCA 4DCUA 4RTLA 4X1YA 1E89A 5FI3A 3VR3D 1XDWA 3WP1B 4UW9A 1IG0A 1PFWA 1J2TA 1ONNA 5DOVA 1GQYA 3OQJA 1EE1A 5KTMA 3EVZA 1K3FA 5I4KA 3SDZA 1CX9B 1CR4A 2PZEA 2WILA 4MUEA 3VTKA 1I1HA 4KPYA 1SU6A 4J9UE 5E3IA 1GCUA 3I9LA 4KN8A 1TQ4A 2BLNA 4RM2A 3B78A 1O0BA 4EG5A 2CVFA 3I9KA 1H2YA 4CR8A 2II6A 5IT0A 4IUDS 5NULA 1NG1A 2B9VA 3N74A 3QVTA 4E15A 4D5EA 5JSHA 1Y4SA 2FDXA 1XZMA 3FPGA 3I05A 3OWXA 4LRTB 4N8EA 5JPDA 1Y3FE 5EXXA 1X39A 1MC5A 2J07A 1K5DA 5AJXA 1DADA 2VS1A 1UIRA 2X4LA 3WLPA 4NCXA 4BNTA 2PWZA 1LW7A 1N1EA 3A27A 3LQRA 5CIWA 2WFZA 3DXXA 3I92A 3UJ6A 3FPAA 3ZDBA 1TPYA 4J8PA 3ZQ4A 3F8TA 2IHUA 1E9DA 3H3JA 3QPBA 4ZVUA 5BXQC 4QZVA 1T6YA 5LYJB 4L9AA 1DAMA 1E2BA 1B23P 5EE0A 3ETLA 2HK9A 4E0BA 2XYHA 3OJFA 2QDKA 2QMUA 1DTWB 2APJA 4ZC1A 5CLQA 1ORRA 3OZDA 3LX4A 3G0HA 1XDBA 3Q6NA 1CUGA 1EVEA 4FKBA 1M2OB 1Z6ZA 3O4IA 1H3NA 2E55A 2J9GA 1CU1A 2JCVA 2AJ8A 4UEWA 3N0TA 3OKPA 2O4UX 3QA9A 4GOKA 1LTKA 1UAYA 1ZU4A 1A9PA 1U8CB 1ZD3A 2Y0DA 2WFMA 3FROA 4BBAA 3U48A 3BA1A 1DC8A 5B2EA 3ROXA 3W05A 5EJ6A 4YACA 4O3MA 1T9BA 3VOTA 4IX1A 1C2YA 2A86A 1FFCA 4KE7A 4IPTA 3R7LA 3W8NA 1FZTA 2AXQA 3OIGA 3V8BA 3FPFA 3ZHUA 3SBDA 5L3SB 2Y2UA 3RFTA 1IY2A 2FN9A 3K1YA 3R0XA 4DSOA 5FFNA 5LYYA 4CUZA 1MC8A 4DB2A 1YO6A 4JYZA 121PA 3PD0A 3MCAA 5CX1B 3KJXA 4NAHA 2HK7A 3VH4A 2C54A 3QHAA 2BIFA 3MCZA 1RI4A 3NC1C 1O87A 3PXBA 2AEMA 4I2VA 3FPSA 4YRCA 4YMVA 2YFHA 2WUFA 3KTAB 3HB9A 5IP5A 1R37A 2HIAA 5HQJA 2VAPA 3LX5A 1WB6A 1WG8A 2DZDA 3P2OA 1JLMA 5BW6B 1OXKB 5KTPA 3FOZA 1WBDA 4JVNA 4ZGGA 4D6XA 5ICGA 4V0QA 3EARA 3I8OA 5DKFA 5DTJA 2NU9B 5DM60 2VTBA 4LVNA 3QSYA 4IUBS 4YCMA 3KR1A 2H9YA 3AYZB 1D2CA 1XZDA 2GN8A 4N7RA 1OVGA 3AEKA 5LD2B 1ZN9A 3IIEA 2H5EA 3CTMA 5IDXA 1YS7A 3OY7A 2WU8A 3QKTA 5ERXA 1KDOA 5DP1A 2G3YA 1ZGZA 2ZZMA 2C2OA 1XPRA 4TKUA 2YYZA 4KKVA 5IHXA 2G28A 3ANYB 4OJNA 2DHQA 2ECQA 2JAXA 2WF8A 3O4GA 3KJIA 4CT0A 1P9RA 3HJFA 2K87A 3Q1KA 2Q5QA 5LQMA 1N9GA 5G53C 2BTOA 2EBHX 2HPZA 1DQRA 3I6ZA 3UY4A 3VR6H 3WL8A 3ORHA 4CLDA 4ENTA 4I1IA 1CVIA 4PIVA 1G55A 4L0QA 5BSHA 1JFRA 2BSQA 1SGWA 4MO9A 3E9RA 2CXHA 1JBEA 2A0UA 5CA0F 2J0UB 5FL3A 4MR8B 2ZRCA 1ANKA 3RBAA 2WJWA 5P21A 2FPGB 2Y71A 4B83A 2BT4A 3IQGX 1SRRA 2OBFA 1YAJA 4KAJA 1O08A 2P77A 2CHVA 2OG2A 3HXPA 3RSOA 3EGXA 4YHHB 5G0UA 4Z4QA 4L3OA 1SKQA 4MVXA 2PTGA 3IEXA 4LK2A 4WOKA 1MW9X 5CVTA 1HYGA 1R0SA 2BW0A 3D7NA 2FFRA 3NM4A 3OAAD 5MGNA 1SXPA 3D3WA 3P5BA 4IUYA 4LRWA 4N3CA 2QJFA 4BO6A 1ZUHA 2A6PA 1IDN1 4BJ6A 4KC0A 3TSAA 2QRVA 1NJ5A 1WR8A 1S7CA 1ZCZA 1T1RA 2I6UA 2ZSBA 3GLQA 4M36A 4ZOLB 2WOJA 2XUIA 3QUTA 4GPEA 4Y2QA 2D0OB 2VSYA 4BO4A 4YUXA 3H84A 3A6HA 2A9VA 4PTZA 4JI8B 4UQPA 4AIRA 3PJRA 1G5QA 1RM5A 4P3YA 3GPDG 2ZI7A 1TRHA 2Y8EA 3OD5A 1KEWA 2FHPA 1RTTA 3A58B 4ND3A 4PAWA 1U9JA 2O2SA 1Z82A 2IODA 3AF3A 4TQUS 3R9WA 2A84A 4W5QA 3IHWA 5C8YF 1DKRA 4KWEA 3O8CA 2GARA 3PC7A 4HB3A 1MXHA 3MRTA 3QV1A 3S29A 4YUYA 4RULA 3B89A 3TIFA 2CHEA 4GRAA 2OCDA 2OCIA 4Q19A 3LT2A 3QI2A 3QYPA 4URHA 4CR7A 2PTHA 4XWWA 2OZKA 2G72A 4LJAA 4U5QA 4V38A 4LEIA 2GO7A 5CXUA 3BFVA 3G89A 2HF8A 4LDRA 4MGYR 1FSZA 5BT8A 1DKQA 1IHXA 3HNOA 1QIIA 4JKOA 5CW2A 2BMAA 1TYCA 3NAGA 3EX7C 2C94A 3DXYA 1E1LA 1K8XB 1C0EA 2AFIB 2J9YB 2WAYA 1W36B 3LJKA 3MB5A 3RK1A 1T1IA 2J3MA 1E0JA 3MCVA 1O9GA 2J8ZA 2XGOA 1EZ1A 3DO8A 4PC7A 4TTQA 3V33A 1DJMA 1YDFA 5IJZA 2WMYA 3P9QA 1IOWA 4B33A 5I3CA 3P9IA 3EEFA 5EXPA 5K0NA 3V7UA 5JO9A 4BRSA 3HFRA 4PZ9A 2P5YA 4D80A 4KQ6A 4MYCA 3VYUB 2JIZD 5BQFA 5KTRA 1KTIA 1LRKA 1WKBA 3ZLTA 1SQ0A 1R6VA 3B12A 3P94A 2ZFUA 4UXHA 3HL0A 4AYWA 4JU9A 3D4IA 3LPCA 2OCGA 1QHIA 1X1BA 4PGFA 5F2KA 3FUUA 5LFAA 1V11A 3N59A 1FK8A 4F1KA 3DBRB 4A03A 3K53A 3DBLA 4WN9B 5CNKA 5CRIA 5IJAA 3ZGYA 3TNYA 4F12A 1T9AA 5JRJA 1HT2E 1MX1A 2GK7A 5FTMA 5E7QA 4LDJA 1XFDA 1S6YA 1U90A 2PSDA 1YMUA 2Q5OA 2XQVA 2Z9DA 2QRJA 1KYZA 4YDHB 4DMRA 4GLOA 2QMYA 1H4SA 1M8FA 2CXTA 3A8TA 5KWIA 2K7FA 4AG5A 3A9UA 3D6JA 5AHOA 2PV0A 2J85A 3F9CA 1DVRA 4TVKA 1Z17A 1T5OA 10MHA 3WJ1A 4CN9A 4F46A 3W4IA 3DE2X 2ARKA 2WK1A 4MVJM 3FYCA 3KETA 2F1JA 4TTAA 1ZR2A 4L85A 1SFRA 4NV1A 3V9AA 5IHPA 2VHXA 3D43A 4J94A 3E84A 1YKFA 2GNAA 4HDRB 2B25A 4EHDA 4MJXA 1YZQA 3DOCA 1L9KA 2NU8B 3PKJA 2UYHA 2BM0A 3H04A 4M0FA 1E2JA 1XLTA 2M98A 3JR7A 2IYFA 5AW9A 3RFCA 3IPAA 1Y9AA 2P9GA 5I01A 3B85A 2AB0A 1I7QB 1PQUA 4F1JA 2WFLA 4MPPA 4JOBA 2F8TA 3K2IA 2RJ3A 1VCMA 1RR6A 2O23A 4YYEA 1YS2X 1SKYB 2ZETA 1WMDA 3HFSA 3EDQA 4FZ5A 5KEIA 4ESEA 5JJCA 5KYUB 3VR5D 1CVLA 4B4VA 1EFRD 1PSWA 1Z8HA 6ADHA 2NZ2A 3VX3A 3HWX1 4LF5B 4NZYA 1L7MA 1LPMA 1U5AA 2EIHA 3GFQA 5HOQA 2BUAA 3CW2A 2FE1A 3CEPB 4L1KA 4INPA 3HUUA 1U5BA 1GTSA 4P31A 2QI9F 2GDZA 4HUTA 2P6OA 4NZNA 5C0OE 3X2EA 4DR3B 3FMIA 5IJWA 2OCYC 2JH9A 3IDFA 1C0KA 4MITA 1DB3A 1EX7A 1Z5GA 2C57A 3D3EA 4HN2A 4DLXA 5K45A 2CCKA 5EJ5A 2VC2B 1PR5A 3D4NA 1R8SA 2FPOA 3KLPX 3E9YA 1R0YA 1ZONA 3WSWA 1D4OA 2P9BA 3I6MA 3N05A 3T35A 4LYJA 4YAIA 5KX5F 2A8YA 3F6EX 4H0NA 4YT5A 2DKFA 2Y1KA 2XCOA 4TLCA 3INGA 3QE4A 2C3PA 4GBMA 3AI2A 4HAVA 4OXKA 2JLXA 3TNFA 3B9RA 1X80B 2CLHB 3PHBE 3PNKA 1CZLA 1NJFA 4I55A 1Z9BA 4RPHA 4KQ1A 1AZLA 3LPMA 4WMLA 5BSMA 4IO1A 2GAOA 3R6LA 2QW0X 2IOYA 1I4LD 4JJIA 5AJTA 2SICE 3U4AA 1Z25A 1FTGA 2HZ7A 3AM4A 3AW9A 4U7GA 4WKBA 4MDEA 5IC4A 1Q7GA 2ON6A 1U0LA 3DYIA 3IXQA 2F1IA 4WLFA 2Y0PA 3N39C 3EA4A 2VDQB 4M2LA 4EX7A 1QQBA 1XJCA 4HYEA 1Q22A 4K9RA 5JXWA 1RU3A 5AOAA 4KR6A 2C1EA 3UMBA 3QUSA 3KWJA 3ESDA 3GLHA 4RTNA 3PUKA 1Z33A 1E2GA 1EVIA 1W19A 1Z6GA 4OP1A 4PHGA 3FETA 3LKDA 3ZBQA 4QIHA 1PT8A 3FYHA 4OA5A 4O1MA 2C0QA 2F43B 2M6SA 1SUCA 4TLLB 2YDYA 5TEVA 3GRPA 1NU6A 1ZZEA 3F4LA 1QFJA 3V4SA 1T3LA 1YZGA 5IF3A 1CBUA 4A36A 1I80A 2O3UA 1UK8A 2QVZX 3OLVA 1ZVJA 5JCJA 3BXGA 4YN3A 3OX2A 2ADOA 1X9IA 4H1TA 1JMVA 4FYKA 1FMTA 1Q50A 4MWOA 4HEQA 3CWQA 2GX6A 3HDGA 2FOIA 1XRLA 3LZCA 4BMCA 2OD9A 1PNTA 2I3GA 4N0PA 3KD3A 4ZVMA 3NAMA 4JT9A 1ZM2A 4BGUA 2BH2A 5HJEA 4ZYYA 4BO7A 5B58C 2QX4A 5KC9A 3HB7A 1P4HA 4K9LA 1P1FA 3U2QA 3ROKA 3ER6A 5HHTA 2UYOA 4I1OA 4PQYA 1SAYA 1T3ZA 1V7ZA 3MHTA 1NR1A 5THQA 4U2BA 2AFHB 2V58A 5D6OA 5KDDA 4PY2A 1WQ1R 2B82A 1QF9A 1ZH6A 3E1SA 5JVDB 1YJ8A 1QH1A 3CUTA 4KN6A 4LVCA 2ODBA 4YJGB 1UBOS 1JIKA 1QU3A 2IPOA 3FSGA 3TLAA 4JP8A 4B4WA 2LDYA 1Z0UA 5BMOA 1RW4A 3LWZA 5DCYA 5GIPE 2R3SA 2AQIA 3AHGA 3BXEA 3CG0A 2Q50A 2VYFA 3LUKA 2C61A 1R50A 2BBOA 2ZEJA 4LY3A 3TZLA 3UV3A 2B6HA 4OUDB 1UPAA 2VQFB 1MEEA 5K3CA 1E2QA 2YQ4A 4COOA 3CLHA 1G8SA 2Z08A 4KAXA 3OF3A 3HBFA 2DQZA 4UTNA 4B3MB 1I8TA 3KAQA 3QG5A 2FKAA 4NJEB 4DLTA 1DHTA 2Q3BA 5DM70 4WV3A 3R0VA 2WU1A 3KKNA 3THYB 1YR2A 2VHCA 3OPYB 1CQXA 2IDMA 2WU0A 2DUMA 4F4UA 1Q2UA 1MIOA 1UPCA 3KV1A 1SCIA 4C0WA 1GVNB 8MHTA 4GNKA 3QU5A 3UJBA 3STTA 1MN6A 4KODA 1NBEA 4C0LA 4EEXA 1KMNA 4RZHA 3O47A 1SUFA 2FCRA 5FP0A 4ZVSA 3HU3A 1EXVA 2DBZA 1GAJA 3LT4A 4D4LA 1M1YA 5KPDA 2PUGA 2J7PD 1NZFA 2OV8A 2V6BA 5F1YA 3UH1A 5K2OA 1DRUA 1R74A 3HCFA 1KS9A 4OQQA 4Y0NA 3ZE6A 4M1TA 2ZUDA 4QELA 2EBUA 2JLQA 1QOPB 3NATA 3CM0A 3AK4A 1J0CA 3MWFA 3PFFA 1SG9A 4WE3A 1EFCA 3PHIA 2F6RA 3NCHA 2EYUA 2IW1A 1U9YA 4G5HA 4EUKA 4DG9A 5CBPB 5J4YA 1Z6PA 1ZP6A 2CDBA 1ZNXA 2JF0A 2WD9A 1M6EX 3JW8A 3WYDA 2QIPA 3OCVA 1KU0A 2SKCA 4PCVA 1Y4ZA 1KFCB 3FPHA 4KN5A 1GPYA 4YROA 3ZGXA 2EDAA 3E53A 3FNQA 1X1CA 1JI0A 3LY7A 5E1OA 5FEMA 1E20A 1CY2A 1KY2A 2C5FA 4BO5A 5CITA 4W5TA 2VQ3A 2AKAB 5B3JA 2GPBA 2CE2X 4TSKA 5EWJB 4FMDB 3UCXA 1F8FA 1HSOA 3UAOA 2XNKA 1YE8A 1Z4QA 2HBRA 3LV8A 3OQBA 4GI1A 4P53A 4YDQA 2NU6A 1CUZA 1W8DA 2ZWAA 3FLEA 3WV4A 1AK2A 1UJ6A 2DP4E 5IWCA 3UXYA 4JXZA 3AUYA 1EX6A 1JKJB 2GVNA 1E4OA 2B34A 2ZBQA 4UUMA 2A59A 1RXUA 1NUPA 4HWOA 5EYPA 2FEKA 1DWUA 1FNNA 2QVLA 4I46A 3OJEA 2P6NA 4XFDA 5IKXA 4ZVRA 3F73A 2V1XA 2Z56A 2J0SA 4FSXA 3UAXA 5LYJF 2JLWA 3BVPA 2R5WA 1AT1A 4HX9A 3VVBA 1C8VB 1YS6A 4DLZA 3CF4G 4D4KA 3EZXA 1NE7A 5C46F 4C2BA 2GYVA 2W2OA 4P7FA 1CEYA 1Z0IA 3CLRD 3BB4A 4FHDA 4QODA 1K6XA 2W6MA 4OAQA 3MK31 4D96A 4JLPA 1T4GA 3G2MA 1MTOA 4CFSA 2BGUA 3NJ4A 3WXBA 3QVVA 5D84A 1E7YA 3ZQJA 2DWUA 3S81A 2ZIVB 4IJ6A 2AJBA 5CK5A 3W5BA 5C32A 1E5DA 1CUIA 3E7PA 4K8OA 4DA0A 5K7SA 1U6IA 1XJWA 2FE4A 2XB8A 4M0MA 1HORA 2PMFA 1J1UA 4RGYA 5DI3A 4G0UA 3VXKA 1U2GC 3WLKX 3ZDXB 5AYVA 4DGQA 4ML3A 4TTTS 4PN7A 3IXMA 3VDNB 3ADCA 1TW2A 4EATA 1W9HA 4X1IB 1RWMA 4XB1A 3K16A 5IH7A 3JRNA 3DZIA 3WL5A 3H86A 1EA7A 2Q0XA 4HVLA 5T57A 3LBNA 1N3YA 4J4TA 4A8JC 1LVGA 2ZR9A 4LXTA 1C30A 2BHLA 4Q6WA 1WVMA 5CB0A 1N1GA 2VUSA 4QDJA 3WQRA 1NHWA 2DFLA 3FCCA 4NBWA 3C15C 1X87A 2CEAA 3LK7A 2HX1A 2P0YA 1I32A 1Q1ZA 3ASYA 3O4JA 5TQJA 5JE8A 1TTHA 1M54A 2R8ZA 3FDZA 3UB4A 1VYTA 4Q39A 3QKSB 3A05A 3LKBA 2YY7A 2I6XA 2XVYA 3PYMA 4WN3A 1PR3A 1ECBA 5K3FA 4JJAA 3HXQA 3FZQA 5MFPA 5EMNA 4V2UA 2JW5A 1UBGA 2CKMA 4X24A 1RHMA 1NI3A 1J9EA 1SUSA 1XXHE 2JLSA 2P9CA 2PANA 2WYUA 3BQNB 3JQDA 4G0NA 4GGOA 3RF6A 4EUHA 3KZKA 2ZPUA 2YOFA 3SYKA 5JNSA 1XUOA 1NXSA 3WDKA 1EUCB 4LJRA 3LGXA 1JHOA 5IWAB 2AMVA 1RP7A 3KS9A 4PSDA 2WM3A 3W5AA 3O2JA 4JMPA 4BKQA 4KQKA 1EJBA 1U02A 2QSUA 2XADA 1PX2A 2ZRMA 5B12A 5B7NA 3M6MD 2ZYRA 4QGFA 3IOEA 2ZS7A 3RIXA 1XB2A 1ABEA 4TS4A 2B99A 3T5TA 2H6EA 4LC9A 1NVXQ 3JSXA 4YRRA 1LDYA 1KRXA 2CF6A 5AVTA 5F2OA 4ETIA 1UKBA 3FIUA 1PV1A 5JLJA 5BOSA 2E4ZA 4OH1A 2HF7A 3MUNA 3HP1A 4N7MA 3RVMA 1RAEA 4TVBA 1RM4A 1XTIA 3H42B 4I4CA 4MHTA 2XRMA 3ESAA 4ZOLF 1IBMB 1GNRA 2P9ZA 5EE9A 4IM7A 3V1MA 5L51A 1Z7EA 1XRSB 2AOWA 5A05A 5KSOA 2YMLA 3EC7A 5TF4A 4CEIB 2Q1WA 1D1SA 4I81A 3K4PA 5IX8A 4MAAA 3TI7A 1IE3A 2P1ZA 4XOUA 2I1QA 2QRZA 1ILWA 1MU0A 3NRJA 3TPFA 5EHZA 5FPKA 3ICVA 3KZMA 4B75A 3QITA 3TLXA 2COKA 4PO9A 5TQ0A 4B09A 4BQNA 3NHUA 1ZUNB 2QY9A 4PX3A 4Q37A 3DEHA 5BRNA 1YFKA 4F38A 1V25A 2ZAMA 3R5XA 1A9RA 3AT1A 2CNKA 2J5KA 3E22A 4Z9XA 5EVCA 3S0JA 4D2IA 1FC0A 2VKTA 2ZPAA 4JD5A 1ISHA 3PENA 3O92A 4A73A 3ND5A 4ERNA 1DJNA 4EF4A 1TTTA 4C6TB 2UVDA 1ZCFA 4NBKA 1JL3A 1M1NA 2PJZA 3F5DA 2FN3A 5DWDA 1N7IA 4G0XA 5B4VA 2CLFB 3HWSA 3FPKA 3PEEA 4IJVA 4U2EA 3BTVA 4C0AC 1Y5LA 5DWVA 1VRCA 1XA4A 3KKEA 3LXRA 4M1QA 3S28A 2PZBA 2G8NA 2W5UA 3VAAA 4MVJI 4EJSB 3DMNA 2JHGA 4G01B 4QREA 3M3DA 5FTKA 1XKLA 4DW8A 2FPLA 4D9BA 1CLEA 3EQ8A 1OAKA 2ZSKA 1HE1C 1DXHA 4WUVA 2P11A 1D2AA 3MWDA 2C88A 3ROPA 4EH1A 2L2QA 4B2LA 3BERA 3KQYA 5AK6A 3WLAA 2IEYA 2ZYVX 4ZVOA 3EIUA 1Z4MA 1FYEA 3MPOA 1RPNA 2ZJFA 4G8DA 4X1KA 4A26A 4LQLA 3NDIA 3DT6A 2B83A 1WMBA 1GG5A 1JZSA 2YV3A 1CDZA 5D3MA 3GARA 1A9XB 2FF7A 1IEXA 2AOVA 4H7KA 4E12A 3R6WA 3OD1A 3GFTA 1ZGGA 1OSNA 3EGOA 1G60A 2J5BA 5EQDA 5DLDA 3M0EA 4OXNA 1QF6A 2H4WA 1FPMA 5CB4F 1Y4AE 4UARA 5LNK6 4EFKA 2O8CB 3K4HA 2VT3A 3THWB 4PZPA 4IYRA 1Y1KE 4N47A 2EC5A 2VIIA 2P68A 3FMOB 1XHLA 2VDWA 1SHTX 3G8BA 1EESA 3PFKA 5LXTB 1BD3A 2ZE8A 1DV1A 1CK4A 2E4UA 4WINA 4U7TB 1G3UA 3AHJA 1DNPA 2NNLD 1TM3E 4W1PA 3EC2A 2PD3A 5DJ5A 3U3XA 3C7TA 3TTXA 4DDVA 2NW6A 4G0YA 3IBCA 3DOEA 3UMSA 3TRIA 4FK8A 5F12A 3RSHA 4G1UC 4ZALA 3UMVA 1T2EA 5FPTA 2R4UA 3A3PA 3FPCA 1U31A 3PUWA 1PGOA 1LXCA 2DR3A 3KO8A 5DNEA 3DVSX 3Q11A 3WB9A 5JEDA 4KFRA 5LUAA 3RRNA 4HNUA 2G7ZA 2HFJA 1FRVA 2O2YA 4FFOA 5AHRA 4IV0A 1XTUA 2WWWA 4R8VA 4JB2A 2XE7A 2GASA 2QPOA 1B8UA 3P2IA 4KPGA 4OK3A 1D4FA 3AZOA 3CBQA 3HBMA 4XGKA 2XF8A 4B73A 4EA6A 3NWJA 1I4EB 3H19A 3ON5A 4ZAXA 2X3YA 2I0FA 2J9XB 2JAHA 5JS1A 1B4DA 1XKQA 4FCVA 1ZRSA 4F5WA 1VLQA 2OKCA 2I54A 2TSYB 2YNMD 2R97A 3MJTA 1FW6A 5IXSA 1I4OA 4RYLA 1F6WA 5J2TA 4QBKA 3GT0A 4IGEA 1FQOA 1H0HA 1ZEJA 3URMA 4I1UA 4QARA 2NZXA 1COWD 1GPDG 1DEKA 2A1IA 3EK2A 4QUIA 2O59A 5AK5A 4MQEB 4OH7A 2HNKA 3RRMA 4AN4A 4EY5A 2PUVA 3DCJA 4IOJA 1N57A 1EM8A 3ZXIA 2HO4A 3W1VA 4PFQA 3AVPA 3IGFA 5CT9A 3M49A 2B8JA 1L6IA 1AGXA 2X8AA 5JD5A 2J33A 2G04A 4XE5A 1SB8A 1Z0ZA 2JDID 4UCFA 3CZMA 2QXYA 1RI5A 4FGWA 2Q5EA 3DDOA 3JWHA 5K01A 1EI9A 5AW4A 2FPPA 1ADYA 1JR3A 3L7OA 2XRFA 3T0FA 2QJWA 4C7KA 1FYFA 1OTXA 1JHQA 3PIDA 1XRNA 3KEFA 2G5GX 2NU7A 2PZLA 4YALA 3TTVA 3FPBA 3WGKA 4GGPA 3W9BA 7GPBA 5HNKA 1FXSA 1IONA 1SD5A 2CLCX 1DCMA 4X63A 4KMSA 4KIWA 1QHHA 1WZUA 5FPQA 1BN7A 3RS9A 3SIPA 3L02A 4LKOA 2G9UA 2JPDA 2BF7A 2VSFA 4NC9A 4Z1MA 5KYWA 1W8IA