4PQYA

Mycobacterium tuberculosis reca glycerol bound low temperature structure iic-n4
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
328
structure length
316
Chain Sequence
b'TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 97
structure length 316
sequence length 328
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4pqyA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4pqyA01
5DN6A 4UNRA 2HLDA 1GDDA 4UNPA 3JZAA 2LWIA 4Q02A 1E9BA 4BFWA 4E09A 2Z4RA 3EPJA 1OFHA 3THYA 3AGPA 1COWD 3FB4A 1I2MA 3SBEA 5JLJA 1P5ZB 2ZRKA 1E2EA 1Y63A 2HJGA 2KWIA 3FPAA 4ILEA 2QP3A 4CDGA 3U4QB 2HJVA 3LDAA 4IDPA 4KBGA 2ZYVX 1C4OA 1G291 3MRSA 1TF5A 4I1OA 2I1QA 2F9MA 1G17A 2NOAA 3CUEF 1W0JA 2CVFA 3AF2A 4QBGB 4LHZA 2EW1A 4Q7MB 2WAYA 1XXHB 5LBIA 3M4YA 3RNLA 3KTAA 5M04A 1F3OA 2CMKA 3EZ7A 3CM0A 3P4XA 2FF7A 3N2EA 1NRJB 2YOGA 4QGGA 4DCNA 4J0QA 3SJBA 2ZE7A 1E2PA 2OBMA 4BZQA 1JR3A 3LV8A 2YINC 3P4YA 1NMZA 3FMPB 4B75A 1FX0B 2GCOB 1D5CA 4GBMA 4RFSA 3MG9A 1JXMA 2XITA 1II9A 3GLIB 4JBWA 3GEIA 4LHXA 3GJ5A 1HV8A 3T15A 4TL6A 4DBLC 4M9XA 5FBLB 2BKUA 3NVAA 2FN4A 4OQMA 4UNNA 4K8OA 4OI2A 4UNSA 2XGJA 4H9GA 4X8MA 2CLSA 1N6LA 2J3EA 1E98A 1ZIPA 3UATA 5CJPA 5AJZA 2JEOA 5JJLA 5BN5A 4II7A 2ZPTX 4DSUA 4Z1MD 2PEZA 3ZVNA 1KK2A 2DWQA 3PVSA 5GJVC 4EPTA 4MRPA 2VF7A 1KAGA 3X1WA 4Y0AA 1XDBA 2J0QA 3QBVA 1DAKA 2JCSA 3SS8A 4A0GA 4IDHA 1Z6AA 2VHQA 3ASZA 1NN3A 4V0KA 2WHXA 2CXXA 2OG2A 5FOVA 5FOXA 4KHZA 5LDDC 4DUGD 3TVDA 2E1RA 1DOAA 4MKHA 1KY3A 4BFVA 3QKRB 2KB0A 4YDHB 4DVGA 4C2UA 4V0MA 1TTTA 3CIOA 4D4JA 4JYBA 4WZBE 4NZYA 1OIVA 4PPNA 1ZD9A 3PEWA 4DT1B 1HT2E 1YZQA 1V43A 2V1UA 2V9PA 5F2EA 1D2NA 3ZJYA 5CIWA 4B48A 1MRNA 4QC2A 2PJRA 2GXSA 2WKRA 2Z83A 2CNWD 721PA 1OXUA 1HE1C 5KUTA 3I73A 4OHZA 1Q21A 2KBFA 3TSOA 2JLZA 1KKLA 3W34A 2XB2A 3LY5A 2RGNA 4KYIB 4PHFA 4GNKA 4ZDKA 1YZUA 2ZUCA 4BASA 3NHAA 2IEYA 2RAPA 4QHTA 4BLPA 1Z0IA 5DN6D 2A9KA 2HLDD 2PMKA 2OFXA 4MUBA 3TIFA 4BECA 4XWOA 1W7AA 2J7KA 2CHGA 2F9LA 3T06B 1K5GA 2XEXA 3A8TA 4HUTA 3I62A 5FOWA 3LW8A 1DARA 2FA9A 2OE2A 4RSGA 1SVSA 2V55B 3NH9A 1R8QA 3TK1A 1UPTA 4LRWA 4DLXA 1U8AA 1YE8A 2GJAA 1GSIA 1SHZA 1W0JD 1YR9A 4L5BA 3U7FB 4Z8XA 4JLMA 3E70C 4KFUA 1J8YF 4EJSC 4PQFA 2QT0A 1FP7A 2G0NA 2KE5A 1KK1A 3AM1A 3PG5A 2JJ8A 2IUSA 1AKEA 2Q6TA 2HF9A 5C46F 1AS2A 4B3XA 3FKSA 1N6PA 2YWFA 3OIYA 2B92A 1IJEA 2IUUA 4A2QA 4CEIA 2Q9AA 2YJTD 3U3JA 3A1UA 4DCVA 1VMAA 1JR3D 2ANCA 4E22A 4D0GA 1PJRA 3QKUA 2GEVA 2ZS8A 1JAIA 2XJ4A 4KI0A 4LHYA 4TQUS 4KVGA 2VTKA 2WWGA 3GD7A 3H86A 2MMGA 1ZU5A 2MSEB 3CNOA 2QE7A 1P7CA 1SVOA 1DAMA 2AN9A 4DLUA 5FR1A 3T34A 2H57A 2GJKA 1ONBA 1H65A 2ZQ5A 4HZIA 2G3YA 5JECA 4L9WA 4NBSA 1QHGA 1HTWA 2AXPA 1S1MA 2VO1A 3AF0A 4IHQA 1NG1A 1KZ7B 1Z0AA 2GXAA 4HAZA 3Q9LA 1JB1A 3IUYA 1NP6A 2IS6A 3FTQA 4YMSA 4C4PA 3U3OA 2G6BA 3DOEA 1N6HA 3OAAA 3ZS9A 2D3WA 3K0CA 3SYKA 3TLXA 4OKSA 2VSFA 3UWKA 1QDEA 1N5KA 1ZM2A 1E2GA 3NC1C 4QGAA 3KQHA 2CL6X 4EPYA 1W5TA 3HR8A 4MUAA 3R9IA 2ZRPA 1NIPA 1T3LA 2PX0A 4D0LB 4PHTA 1KI7A 2H8KA 4P32A 3LBIA 1YKSA 1ZW6A 1MV5A 4RCZA 2QG6A 3GJ0A 3IIMA 1ZUHA 2GZHA 1DELA 2QAGA 2OEPA 2PH1A 3X1ZA 2WOJA 3X1XA 2A2ZA 3BE4A 1L4UA 2B7BA 4NU0A 3BFKA 1EFCA 4IEIA 2P0EA 3D8BA 1M7BA 4DDUA 3BERA 2QPTA 3KJHA 2C8VA 1A2KC 4MQBA 3VR5A 4FN5A 2PLRA 3RVBA 3KKNA 3BORA 4RKEA 3RRZA 5FOTA 1H8HA 1QG4A 5JWOA 4NYMQ 1N0WA 5CDFA 2D7DA 1E9SA 2ZI7A 2HXYA 1E0AA 3ZZTA 3QNUA 4Q7JB 2W0SA 5AUPB 1FMLA 2R6DA 1CJKC 3MWLA 1KMHA 1F2TB 4L8GA 2AFHE 2G0TA 1RFLA 4ZDIA 2YWGA 4I99A 2FFQA 3JVVA 5KNDA 3B8HA 3ZD7A 4LZZA 5G53C 1NBMA 1TF2A 3MLEA 1VPLA 1P2TA 5CK5A 3AVUA 5IF9A 2OSBA 3TNFA 4HEJA 2WPDA 2NQ2C 4F38A 1FTNA 1E6CA 2VL7A 3KXKA 3NEJA 3U44B 1NKTA 3ZVMA 4OHWA 5JJKA 4ON9A 4A8JB 1JJVA 1SKYE 2DFLA 4MITA 4URXR 3GLFA 1HT1E 1XFAA 1KAOA 2ZAOA 3F3YA 4LJ9A 5EP4A 2CJWB 4FCVA 4V03A 2KI5A 3HPRA 2IF2A 4HAVA 2GCNA 4IEEA 4IDQA 4BFSA 2CL0X 4LBYA 5F3WB 2BJVA 3G5UA 4GOXA 3DO6A 1RRFA 4LYFA 3EA0A 2F6RA 3FKSD 5JBQA 3VU9A 2F1RA 1GL9B 1D9ZA 5FL3A 2D2EA 3SI7A 2FOLA 2ZSDA 1VIAA 2J7PA 4BRWA 4WW0A 5KYKA 5J4KA 2V6JA 3TUZC 1IXRC 4B32A 2GEDA 4OQNA 3QEOA 4YDSA 2OILA 3CNNA 1U2RA 5J4LA 3FDIA 4ESHA 4PO9A 2QE7D 4D81A 1DAHA 4JBYA 5E95A 3V4RA 1NVVQ 2QA5A 1G41A 3CWZA 1O3YA 3K0EA 1ZAKA 4C0BA 4WBSA 1GRQA 3L8YA 3AP3A 3BH7A 3S1AB 2G77B 2DPXA 2GK7A 5TY0A 4CEHB 3P32A 1NLFA 4ASUA 1JQJC 2QP9X 1W0KA 3THYB 1W4AA 1GTVA 4Q1DA 3OAAD 4P4SA 4U00A 5LB4A 4NHOA 2QPOA 2ZUDA 5JCZA 4W5HA 1W47A 4AD8A 1GFIA 3CZQA 4D4MA 3BXZA 5AJYA 2FDCA 4DLYA 1T8UA 1KO5A 3KTAB 4JIMA 1E96A 2FSHA 3P26A 2GBLC 4DIEA 5IT5A 4UXIA 4FMBB 3BGWA 1E2QA 3NBFA 3NBXX 3CONA 1OB2A 2IHBA 1SXJD 1TL7C 1ZM4A 4XH9B 1RVDA 3ZZ0A 1XNJA 3B1ZA 3W6NA 3UMSA 2VP2A 4RVCA 3GEHA 2FV8A 4CGZA 1S9DA 3BH0A 4KCGA 3ZDQA 3G0HA 5BYKA 2W6IA 4DIDA 4XTCS 4RFSB 4TMVA 4NYJQ 4Q9JA 1VKJA 2BDTA 3VKWA 1H8HD 4CEJA 1KNQA 1GKUB 4LGMA 3KFVA 2RGAA 1JBKA 4GT1A 1WRBA 3KKPA 4LCBA 3L82B 1UEJA 1UBGA 3R7WA 2QU8A 2GXUA 2YVUA 2QGNA 3QXSA 2BEJA 2D74A 2GXQA 4ZI3A 2ERYA 3RLFA 4EPXA 4PC6A 2HYIC 3I92A 4MYUA 2WJIA 1NBMD 1E79A 4GOKA 4B74A 1G3MA 4U7DA 3HP1A 1P9RA 1OV4A 1CS4C 1Q22A 2QROA 3RS2A 4B3GA 4KLNA 1K8RA 2WPDD 5EE3A 5F98A 1A4RA 3SYNA 2FNAA 4KODA 4P31A 4JMPA 3EXAA 3HJNA 4B3CA 1G64A 3PUYA 3CRRA 3G82C 2OLKA 2NMVA 3EPHA 1VYUA 4FI3C 3SNHA 4KBFA 4Q9KA 2QM8A 1XXHE 1FL9A 5B57C 2OXRA 2ZAMA 4JLPA 1X1RA 2VHCA 2CHQA 3NBYC 2NG1A 5LD2B 2ZJYA 3KQKA 2C78A 5DI3A 3U3MA 4NCIA 3W8NA 5TMPA 4PZYA 1XX6A 2DFNA 3PEVA 5L3SA 1XEFA 1NY5A 4OJQA 1SVWA 3LRPA 2O52A 2PZGA 2ZUBA 2R6AA 1N6KA 5EXXA 2ASEA 2HUPA 2ZI3A 1OHHD 2J7PD 4YLGA 1E9AA 1Z0DA 4DLVA 4ZDJA 2EWWA 2WBLC 1N6NA 4D26A 4US1R 5AJVB 1YZNA 2IYTA 3AEZA 3N2IA 1P9NA 3VFDA 1M7GA 2J0SA 1EESA 3KZ1E 3MCAA 3RAPR 1Z5ZA 1KDRA 1T0JB 2ZYTX 1AZSC 4QBFA 4H1VA 4QNMA 1N5IA 2P6NA 3ADBA 2ZRHA 3T35A 3C15C 3B82A 1ZD8A 2IYXA 4TSFA 5TB5A 4IDOA 5KDLA 4A9AA 3SJAA 1KSFX 1Z6XA 4ASUD 1WDTA 1G4AE 1EK0A 1UEIA 1W0KD 2LKCA 3FMOB 1AM4D 2VBCA 1R6BX 1FP6A 3BWDD 3F0TA 3LNCA 4P4TA 3ZH9B 1XZQA 4A1FA 3PIRA 3RWMB 1ZM7A 1ZYUA 3K0AA 2WJVA 4KVAA 2B21A 4IXNA 4FCWA 2B8TA 3ZYCA 1XU4A 1NF3A 4Q19A 4WVFA 2XTMA 2CDNA 5DYIA 3K8YA 3UG7A 1QHHA 1ZC3A 1XF9A 4B3DA 3REFA 2FX3A 4X8OA 5JS7A 4QJ3A 1XCPA 2ODNA 3R8FA 4LYAA 3CRVA 1DO2A 4KV9A 3SC3A 4Q4JA 4EPRA 1DE0A 3AVPA 3GJ3A 4CEIB 1RPZA 2RKOA 3Q7QA 4PAMA 3CO5A 3L0SA 3DPUA 4LBZA 1SXJC 1U8ZA 4HYYA 2MMCA 2YYZA 2W6ID 2QORA 4JLNA 1BKDR 1NY6A 4UXJA 4YMWA 2RMKA 3WYAA 3K09C 2JLRA 1RYFA 1XRJA 5E4FA 4M1TA 2MSCB 3GLHA 2D62A 4WAUA 4RZXA 4OI0A 4IDNA 5CITA 1DPFA 3KDSE 3NXSA 2FSGA 2VLIA 4OHYA 1PUJA 1Z83A 2ZS7A 3VX3A 1TPZA 4Q18A 1FMJA 2IYVA 2YC4C 4IOKA 1TX4B 2GRJA 1E2HA 3HWSA 1PZNA 4C0KA 1UM8A 1YR7A 2Q9BA 4A6PA 3TAHA 1SKQA 3RRMA 4B43A 4OYHA 1IN7A 1E79D 1P4SA 3GFOA 1KIMA 1YR8A 1MO6A 1HE8B 1YZTA 2RGGA 3RS0A 3VNVA 4LK2A 4O25A 3SQWA 4Z54A 2RCNA 3K9LA 3QE0A 121PA 2IYWA 1S8FA 3LO5A 3A4MA 1OJLA 2R6FA 4GFDA 2GILA 5JRZA 4Q1FA 1E94E 1D2EA 1G20E 3QI2A 2RGDA 2QAGB 4KFTA 2VSXA 1R10A 4JL8A 3U2QA 1VHLA 2B8WA 2R9VA 1XCMA 1DBSA 3PV0A 3QG5A 1ESMA 1QRAA 4ZCMA 4XJXA 5EE5B 4HAWA 2QQEA 4EJSA 5AR1A 3FHCB 1GILA 4PC7A 1T5LA 2DYKA 2OV2A 3U7HB 3N70A 1Z6YA 3I72A 4C0JA 4YMTA 3TSWA 4IKEA 5EZ5A 1Q1BA 4PXAA 2RH5A 3W6OA 5JZVA 1E4YA 1KDPA 1HEIA 2QMUA 3LAWA 5C1BA 4IOJA 1K6MA 2PCJA 2V1XA 2GJ9A 2QSYA 4HLQB 1P2SA 3THWA 3QUSA 4QFMA 1E2NA 3CRQA 4M1OA 3LVQE 2HCJB 1KMHB 2VH5R 3EZ9A 2G1KA 4PQYA 2QZ4A 4WXPA 5HTKA 3VHXA 4DKXA 5J4VA 5FBRB 4LI0A 1W36C 2NO1A 5FTNA 1CJVC 4PPFA 4B2LA 3U7GA 4TSFD 1EGAA 2ZITA 1IOZA 4R7ZA 2ZSAA 1TAGA 4CRWB 4US0R 5FL7A 2W0MA 3UK6A 2UKDA 5KO2A 1G18A 1E4VA 2BBTA 1QVAA 2QEQA 4GP7A 2R65A 1AGRA 3WYFA 1RRCA 3JVUA 4TYWA 4QJ5A 5IRCD 2A7QA 3B1XA 4R9UC 1OH7A 4ZDWA 1E9RA 4LUCA 3WXMA 1A1VA 3KKMA 4WOPA 5EUQB 1OKKA 1RRGA 3GLFB 2V3CC 3IO3A 4EDHA 2JLSA 3IQXA 2IXFA 3GJ7A 4NTZA 4DLZA 1X1SA 2ERXA 1N2CE 3PUWA 3SYLA 1EX7A 4MDFA 2XAUA 3VU9B 3MUFA 4IW3B 4NYIR 1XEXA 3EARA 4F4CA 2YOFA 3LH5A 4RY2A 1ZVQA 4TYYA 4FIDA 4TYQA 2WWWA 1TF7A 1G3UA 2G1JA 3AVOA 3K0FA 3V00A 4B6FA 4B47A 5BN3A 2GESA 2HF8A 3AF3A 3NEYA 3KXLA 4O0MA 821PA 2WIBA 4WZ6A 3SQXA 2C77A 3W3AA 3Q7PA 3F5FA 3W3ZB 3RRNA 2DWPA 5EZ6B 3X1DA 1KO8A 2GETA 3SN6A 3U60B 2JLWA 1OXXK 2WAXA 4KFSA 3FE2A 3RS7A 4V0NA 3BD9A 1OFUX 2C04A 2G88A 1TU4A 1K5DA 2ODBA 1G8GA 4NKRA 3SEAA 3LX8A 5EE1A 5JEDA 1E2JA 4B71A 3KL4A 3PUVA 4GP6A 1CRQA 3PUXA 4ZIRA 3I5XA 3EPLA 1Z63A 1P75A 4Q01A 3SE0A 3ZGXA 1R7RA 4A0FA 4N3NA 1ZM3A 4P4SB 3SZRA 3D7MA 2XZOA 2NZJA 4S35A 2GBLA 4QHSA 5JCPA 3WMFA 4BZPA 1EXMA 1Z28A 1CLUA 4JVNA 1XZPA 2BBSA 2CL7X 3LXRA 1FTSA 4M53A 4B2PA 1G8YA 1CJUC 1Z0JA 2D7CA 2YOHA 4LV6A 1Q1ZA 3ETLA 2ZRMA 3A6PC 1WMSA 2QT1A 3HR7A 2QPAA 1Q1QA 3BB3A 2Z43A 3W5JA 2JA1A 1X3SA 2IYSA 3C4JA 421PA 2BIFA 3CPJB 4W7SA 1GRRA 5LB2A 4BQSA 1VYVA 3ONWA 1QHXA 4D0NA 3SHWA 2IS1A 4XSGA 1EFHA 2HEIA 2YWEA 4DCUA 4D4LA 3FYHA 1Q20A 3BJIC 3RS5A 1IY2A 4AYTA 2MSDB 4FMDB 2GA8A 4GSYA 3ZZUA 5KDOA 2ZEJA 4BEJA 4Q9IA 5DNYB 2WKQA 3E5HA 1GITA 4ZPXA 3WRXC 1R5OA 2LKDA 2QNRA 5FOUA 1XJ0A 1MR3F 4CEJB 4M1SA 2REOA 2SHKA 3AVXA 3ZQ6A 4AYWA 3OIVA 1DAFA 1Z08A 4OQLA 3CKLA 3D6TB 4KAXA 3RANA 1NVVR 1OH8A 1KZGB 2FJUA 4AC9A 3T1TA 4IFEA 3R7WB 1YRBA 1GZSA 3MSXA 1I4DD 4N1AA 1M8PA 4X8LA 3Q72A 4Q47A 5BN4A 3CNLA 4EFLA 1U9IC 3UMRA 1II8A 1OSNA 2W00A 3IHWA 5DHFA 4FMDF 4QXAA 4G0NA 1WB9A 1W1WA 4C30A 2ORIA 2OCAA 3B13B 5FL7D 1WP9A 1I4TD 4TL7A 4TN1A 2CLCX 5DSZA 5J4YA 5TXGA 2ZS9A 3AUYA 1ZNWA 2V8OA 3GFTA 2REBA 4LC0A 1UKVY 1T91A 4YMVA 2QGZA 3TR5A 2P2LA 5CYOA 2Y8EA 3N5CA 1DO0A 1JEEA 2H16A 4L9SA 1OKKD 2C96A 1SVIA 3K0SA 3RYTC 2IS4A 3D3QA 5K8TA 1W4BA 5JHHB 2OO7A 3I1FA 3GEEA 3T5DA 5JMTA 1XJQA 3KB1A 4HB4A 5DI3B 3B1VA 5AUQA 3RC3A 2BMFA 4O2RA 1PV4A 5L3SB 2O8FA 2O0JA 2OCYC 2EFDB 3WYGA 1U90A 4P33A 4AG6A 3X1YA 1G5PA 2DFKB 3QKTA 1CR1A 3NTUA 3QKSA 2VP9A 2NTYC 2ZJ8A 3MGCA 1JR3E 2BEKA 4NCKA 4XWAA 4D6PA 5EXPA 4HB2A 5SZIA 2F1IA 2ZJOA 1A2BA 1LF5A 5HR5A 2JAQA 4DLRA 4GMDA 2OAQ1 4OK5A 1X8LA 4OL0A 3THXA 4NYJR 2XNDA 2GWHA 2O8DA 1BYIA 2ZRCA 3SJZA 1LTQA 2GF0A 2GEUA 5H1YA 4TLCA 3K9HA 3DM9B 1FZQA 3L8ZA 4M9ZA 1XMVA 2R8RA 2O0KA 2R6CA 3AVYA 3PR1A 4URZR 4XOIA 1L8QA 1ZC4A 2AX4A 2CVHA 2QMHA 2IYZA 3JZMA 4B2IA 1G3IA 3GCGA 1UKYA 3QSYA 1AZTA 4BLQA 2AD1A 1Z06A 3KQLA 2JJ2A 2Q9CA 1BOFA 4DLTA 5H8WA 2I3BA 2AXNA 5G3ZA 4EJSB 3CBQA 4RD4A 3VR6A 5FH9A 3R9XA 5JJIA 1T9HA 2J45A 3K70C 3NG1A 4UQOA 3K0AB 4Q4HB 4BWYA 2ZU6A 1OYWA 2IYLD 1G19A 4Q66C 3WBJA 4AIIA 5JWRA 4BLSA 5GVRA 1E9FA 5BYJA 3I32A 1US8A 4QJ4A 1DEKA 1QHHB 1Q0UA 4JLDA 4BLOA 3O8DA 1CRPA 2AKYA 1SXJA 2R2AA 4U02A 1NLYA 4B34A 3CF2A 2AL7A 5UKDA 1FFHA 1N6RA 2KSQA 3WP1B 4Q4JB 1QF9A 4NCNA 1QHYA 4V0ME 2IXGA 5CIQA 5G41A 4B6EA 3K09A 3OEEA 4L16A 1AN0A 5CB6A 2FMXA 5A0FA 1DS6A 5F9FA 4TMTA 1U0JA 2XXAA 1NIJA 1VECA 1G8FA 1YRAA 2G83A 4URWR 3KXIA 1JEDA 4YONB 1ZUNB 2ZJZA 4ACBA 3QY0A 4RFVA 3ND9A 2GF9A 3FMIA 2PCLA 1J2JA 2XSZA 5C4GB 5IK2A 1W2HA 2WMNB 2QTFA 5DYGA 3GLHB 1CJTC 3EZFA 2NIPA 3VTKA 3O8RA 1XEWY 4FW9A 2FFAA 4Q9LA 5L3QA 3RS3A 4L15A 4ZCLA 1E2FA 1L7VC 3CLVA 1YR6A 3A36A 4LX0A 4M8NE 1XPRA 4M0LA 3UWOA 3LW7A 4DHEA 2EYUA 1KJYA 1SVKA 1N3BA 4F93B 3GFPA 2QM7A 4M1WA 5D3QA 3RC8A 1EFRA 2ZVQX 3E1SA 2FEOA 4BFXA 1AQUA 2J41A 1TADA 4TTQA 1RE0A 1P61B 2ZRGA 2OBLA 5H68A 3FVQA 3GJ6A 2B6HA 1A82A 4TLDA 4HB3A 3UXMA 4BFYA 1E1QA 2XTZA 3PEUA 1IN4A 1XJCA 3CZPA 4MYHA 4C3ZA 4DEXA 2F1HA 2FEMA 2G9NA 3PITA 4K81B 2GNOA 1TUEA 3IKJA 2TMKA 3W9YA 4DB4A 3NWJA 4YQFA 5JSZA 3GJ4A 1XBTA 4RZ3A 1OHHA 3T61A 3FWYA 1P72A 1S0UA 4GZMA 1UADA 4CZ2A 2WOOA 1XPUA 1W44A 1KTVA 1DAEA 3IPXA 1C1YA 2XB4A 1ANKA 1XP8A 4MYTA 5DISB 4G1UC 1CTQA 4KSBA 4CT5A 3B78A 1NSTA 3THOA 1CU1A 3THWB 2J0VA 2XNDD 3IHLA 1M1YE 5SZKB 1E2DA 3DOFA 3AP1A 3TSZA 4F4IA 1NSFA 4NCHA 2OFWA 2W2XA 2UVQA 1G21E 3C7KA 1U99A 2C95A 1LW7A 2OM2A 3GJXC 4LJ5A 4Q21A 5BWMA 1EWQA 2N46A 2FPKA 4LHVA 5B30A 4X8HA 4JBXA 4RD3A 2ZE6A 1WE2A 4HZUA 4YMUA 1XMIA 2GVDC 4KITB 3U7EB 2CLDX 4DDTA 2JJ2D 2QMEA 2AKAB 3H1TA 2RGEA 4JLKA 1FPMA 5HCNA 4IOMA 3PXGA 3EC1A 3AKYA 2VHJA 3PEYA 1FQJA 1HQCA 1QBKC 1G3QA 3L0OA 4QHYA 4I1UA 2D2FA 4W9MC 2EQBA 3LVRE 5DIFA 1RJ9A 2C9YA 3A37A 5CM8B 621PA 5KTYA 1UAAA 3B2EA 2O8EA 1Q1EA 5FTJA 4BE7B 1WF3A 1OFIA 3DZ8A 3C41J 5EQTA 2BBWA 4I81A 4JYCA 4OBEA 2PZEA 2ZSBA 4M1YA 1E0SA 3TVTA 4U5XA 1SXJE 2H17A 5C4MA 4NDZA 4PPGA 2IXEA 4V0OA 1CF4A 2EFEB 2IBMA 2D06A 2VHUA 4JT4A 1XEXB 1D9XA 1DVRA 4RZ2A 2ZRAA 2OUKA 4TMWA 3OEED 1E2KA 3P27A 1D2MA 1FW6A 2IL1A 1PUIA 2FFBA 2ZRFA 3K0FB 3TH5A 2GZAA 1LV7A 1KHTA 3WNBA 4MRVA 1UJ2A 1OXSC 1KOFA 4AYXA 4BFUA 2IEZA 4I1SA 2P67A 2QSZA 4PC3A 4TLEA 3LBNA 2ZRIA 1DADA 4KO8A 2IYUA 1BO6A 2XSZD 1UKEA 5IK2D 2OCBA 4JVSB 1ZD1A 3KX2A 5CDFE 3SFZA 5A4JA 2IF0A 2Z4SA 4ZI2A 3QXCA 3ADCA 4BGDA 4F92B 1ZINA 3LLUA 1IXSB 1E2LA 3FFAA 4ZIRB 3LD9A 4URVR 4C7OA 5DE3A 3QXHA 1JPNA 1W46A 3IDQA 3ZIAA 1RYHA 4JKYA 5J5CA 4ZKEA 1TEXA 1MABA 1GWNA 1NBME 1MO3A 5L3VA 3QPVA 3VX4A 5KNCA 4AKIA 2GTPA 4P0TA 1E2MA 2P5SA 521PA 1EFRD 1LVGA 1ZRHA 3T1QA 2XJ9A 5EJEA 1P2VA 5K8UA 1KO7A 4C0SA 4MGZR 1N6OA 1KGDA 2A3RA 4L4UA 1XPOA 4JZKA 3TW8B 3TAUA 2V4ZA 4TWZA 3SDZA 1CBUA 3BRWD 3GLFE 1QHSA 5B2ZA 1KSHA 4DDWA 1E1QD 3TQCA 3IBYA 1R0XA 2AHOA 1G6HA 3OF5A 4BLTA 4EFMA 1NJGA 3K9GA 4FXPA 2BVNA 4PPQA 1G7CA 1P6XA 1Q57A 4G5RA 5G3YA 2P5TB 2WMOB 2NO7A 1UBCA 3WNCA 2BOVA 1SZPA 3FMFA 1W36D 4OQXA 1U9IA 1ZM9A 1ZNXA 4B3BA 1SGWA 1GP2A 1NN0A 3IEUA 4V02A 1G6OA 4QM6A 4HLCA 4G5QA 1LB1B 4LJ7A 4EPVA 4G5OA 5EE0A 1G8PA 1OB5A 2ZR0A 2WICA 4R98A 1EFTA 2IX3A 5TARA 1JPJA 1II8B 2ZVPX 1JXOA 4MGYR 5KSYA 2YV5A 1LY1A 1OXTA 2GZDA 2O0HA 2ZSFA 1CULC 2C99A 4XIGS 2CE7A 1TQ6A 2YWHA 4O3MA 3VR3A 1RC8A 4DSTA 4MYCA 1NVWQ 1B23P 3LQQA 3EG5A 3IPYA 5GADl 1RW4A 2WM9B 2WVJA 4JVLA 5P21A 2PMDA 4PSAA 3QQ5A 1QHNA 1EX6A 5JI3E 1X8KA 5FFMA 3HYTA 4Q7KA 3UMFA 1ZNZA 4WXRA 4N0EA 3PQCA 2QRZA 4P3YA 4JKIA 4NE2A 1QVRA 1YZGA 2I1VB 1E1RD 4GZLA 5DH9A 2O8FB 2FFHA 5BXQC 2FU5C 3WHLA 4BEBA 1IN5A 2IS2A 4Q1CA 1XB2A 2AWNA 3QKSB 4NMMA 4S2EA 5AUNB 4OHVA 3ICQB 3DKPA 4JJKA 1OF1A 1N0VC 1CEEA 1XWIA 3V4FA 2FWRA 1BH2A 3QF4A 1B0UA 2W6JA 4WIAA 5EP3A 1CP2A 3X2SA 3ASYA 4BLRA 3THXB 4FMCB 3IILA 1S9HA 3R8CA 3TJZA 4DCTA 4HLUC 2O8DB 2W2VA 5FPKA 3WMEA 1Z3IX 2ZI4A 1H8EA 3P20A 4JLOA 4XVRA 4F91B 5K8IA 3MWJA 2ATXA 1NN1A 3MD0A 4BFZA 3EC2A 3WP0A 5AUOB 1DTSA 2QL6A 3OESA 4C0HA 3LWNA 2VRWA 3TUIC 3CX7A 2FGJA 1S4QA 5SZJA 4ABYA 5E3HA 3L2OB 4RJLA 2BC9A 1VG9B 2ZI5A 3QPUA 2C9CA 3EIQA 3PUZA 1VCNA 4JL5A 4PFSA 4TLAA 3SOPA 3O8CA 3WBKA 3A4LA 1X8JA 2F43A 5HE9A 2EU8A 2ECKA 3CX6A 1J8MF 5EE9A 3EA5A 1OYYA 1ZCAA 1N5JA 2VYFA 4JVMA 1U0LA 1US8B 4FMCF 4P4UA 1ZBDA 4Z8YA 4D25A 1GNPA 2QN6A 3U3RA 1Y3AA 1E9CA 4A36A 1WCV1 2KJQA 2YZ2A 1LF0A 1WBDA 1SXJB 3CH5A 4MRNA 3AUXA 4Q00A 1O87A 5AK0A 4EQ6A 1FOEB 4ZCIA 1OIXA 1ODFA 5JFGA 4Q4AA 3RWOA 1T3SA 5EXTA 2VPPA 3KUCA 3CRMA 2GKSA 4MDEA 2BM1A 4HUQA 1UBFA 3Q8XB 4XVUA 4HDQB 1L4YA 4HLDA 4A0HA 4W5JA 2GJSA 5DO9A 3B6EA 1VG0B 5KSZA 5FTMA 2XXAB 4R2HA 4JLVA 3B1YA 1S2MA 2QMOA 4ITRC 1KI9A 2JLYA 1J70A 4EIWA 1NVUQ 4DWJA 3EIEA 3QBTA 4CT4B 4HDCA 4HSEA 1CKEA 4Q5IA 1WXQA 3BB4A 2F55A 2HCBA 5L3QB 4GDFA 4AKHA 5FOSA 3DKVA 2VQSA 4NONA 5HCIA 3B5JA 1WQ1R 5ELXA 4GMXA 1BS1A 4AY2A 2F1JA 1VYTA 2IYRA 3TQFA 3ZS8A 2AFIE 5HKKD 2NO9A 1R2QA 3NKVA 4MKGA 3AGQA 2QBYA 2A30A 4PO1A 2Q21A 3MAAC 2JATA 1NN5A 5J40A 2CCGA 1IN6A 2ATVA 2PT5A 3K9NA 3DVLA 4XTRA 2EFHB 2JDIA 4Q48A 3CW2A 5FPHA 2X1VA 1Z8FA 4CEHA 1GL6A 5KSOA 4YXWA 1OT3A 4HAXA 2H18A 2IYYA 2Q3FA 1YHNA 1SVLA 2F7SA 4QKQA 2BMDA 2DY1A 2O8BA 1CR0A 4DJTA 1GIAA 1E9EA 4GI7A 3B60A 2J0UA 4E5UA 2X8AA 1AIPA 1XTKA 3IGFA 5FI0B 4RD1A 4D82A 3TGPA 2A5JA 2NZ8A 5JSZB 2WKPA 2PL3A 3RABA 2HYDA 3ZLJA 8OHMA 3H84A 2XNSA 3CR7A 3ZVLA 2ZREA 2NPFA 2IUTA 2PZFA 2OAP1 1W36B 3U6BA 1ZIOA 3L43A 3AF1A 1FUUA 2CEAA 2W6JD 3NBZC 3BBPA 2IWHA 3VQTA 2VHTA 4NYMR 4M9SA 4KLZA 1G3RA 5E7JA 2ZI6A 4AURA 3CPEA 4BRUA 1XTIA 2J5XA 4DCSA 1H8ED 3IO5A 4B3FX 3IIKA 3GLHE 4KJZA 4PANA 5L3RA 1D6JA 3K70D 1P9WA 4ACAA 1MO4A 2RGBA 1Q3HA 1TEVA 1YVDA 2V54A 2V7QA 3CF0A 4PC1A 3U5ZB 3VKHA 2OESA 1SULA 1F2UA 3EASA 3QIAA 4HZUB 1KJWA 1OH6A 5IHPA 2QRNA 4A2WA 3K1JA 1Z0FA 1PVOA 1IY0A 1LS1A 2HDNB 2IK8A 2RHDA 3DEFA 1IONA 4M22A 4F4JA 2A5YB 1JI0A 3BFVA 3RDPA 2X19A 2O8CA 3SHFA 1YZLA 3FKQA 4JJZA 2JLXA 2R6GA 4Q7LA 1NG9A 3GMTA 4IVQA 1UF9A 1U8YA 1RJ9B 2H7VA 2QUZA 1U98A 4CF7A 1UDWA 1KKMA 2O8EB 1YZKA 2PX3A 2GJ8A 3KQNA 3GLGA 2ZJAA 3C8UA 3F8TA 3EIHA 2ZM5A 3TMKA 3MJHA 2FG5A 3T1OA 3VMFA 3OE7A 2JIZA 4RD0A 4TL8A 3AVVA 1JAHA 1GG2A 1MH1A 2W2TA 4G01B 2ZANA 1W4CA 1ZUIA 1TQDA 3D31A 1S3GA 2ZI9A 3QENA 3C5HA 4TMKA 1W48A 3LBHA 3SFVA 3O8BA 2J59A 2GDJA 4POAA 1KDTA 3H2YA 5HZKA 2Q3MA 1ESNA 2QENA 3MFYA 4I1VA 3A4NA 2ORWA 2WIAA 3VNUA 1T5IA 2DR3A 3B9QA 5C2JB 2P3SA 1Q3TA 2WJHA 4HATA 5GJCA 4LYHA 4D80A 4M21A 3HDTA 4XVQA 1AS0A 4NCJA 3AKCA 1BIFA 4JS0A 2RGCA 1IBRA 2H5EA 2ONKA 4C7OB 3DMNA 1U94A 2EFCB 3BS4A 1KNXA 3NC0C 4LJ4A 3ZD6A 2RGXA 2FPMA 3I8SA 1KK3A 5JWHA 3M0EA 1Z2CA 1MABB 3LLMA 3BFXA 1YU9A 4UNQA 2FGKA 3BIFA 4R2IA 5AWFC 4OK6A 4QGFA 2XTNA 2GCPA 1KI3A 1VHTA 2VSOA 4TZ6A 5D3MA 1P3JA 3UKDA 2JDID 4NP6A 4QL3A 2DCUA 2OBNA 2P6UA 4IVPA 2C9OA 3HU1A 4PQRA 5DLQC 4MH0R 2C2HA 4TMZA 3VR1A 4YXWD 2XOKA 1GAJA 2BMJA 1P60A 4DLSA 1UKZA 1J7KA 3AF4A 1KYIA 1TQ2A 2L0XA 4DSNA 3E2IA 4KU4A 4LV5B 5E7MA 4DSOA 2Q3HA 1R5NA 4RCYA 2ZRDA 5H70A 4AK9A 1J99A 3O47A 2VP6A 3PCRB 2X2FA 4PX9A 5F9HA 4BZXA 5CK4A 2OT3B 2YKGA 4PZLA 1KSJA 4EKDA 4ZKDA 3I4LA 3NHBA 4HDOB 3AP2A 1N25A 1P73A 4KSCA 1U0HC 2HV8A 3MJRA 1VG8A 3MWYW 1UBEA 2CE2X 2FH5B 5GJBA 2ZU0C 4LDJA 4Q03A 3W5IA 1AA3A 3A1WA 3KKOA 2BHRA 2ZRNA 3QJYA 4WA7A 3U3KA 3C14C 5FUXA 5KDDA 1WBBA 1E69A 4UJ3A 5JEEA 2ZRBA 2PJZA 3AVWA 4LJ8A 4Q1AA 1Z6TA 3B85A 2OCPA 1II0A 1VG1A 3AB3A 3GJ8A 3CX8A 1G9XA 4MRSA 2V7QD 2IHYA 4UJ5A 1XD2A 3TW4A 4RKFA 1E2IA 4EFNA 4FWTA 4IJMA 2VIIA 5CLLA 5B64A 1JNYA 1R4AA 4EAQA 4JSYA 5LPNA 2XZPA 2OFOA 3PJRA 1AA9A 3AVQA 3VR4A 4BFTA 1E9DA 4NL4H 1A5TA 3EZ2A 3A1SA 4ARZA 1MKYA 3BOSA 4PHHA 1F48A 5FI1B 1J90A 2A5FA 1KJZA 1ZNYA 1JJ7A 3Q5DA 3BC1A 3CPHA 3U6KA 3DZDA 4N0DA 1HH4A 2QQ0A 4AWXA 3RSLA 4C2TA 3LFUA 1NMYA 3PFIA 4LC1A 3CRW1 2VP5A 1ZMXA 1GM5A 3RSOA 4XD7A 4PAOA 4C0LA 2CBZA 3GLGE 4G5GA 4TQAA 1OW3B 1TMKA 4B73A 5FBVB 2GHIA 3OE7D 3QEJA 2IC5A 2JIZD 1TQ4A 4IRUB 5KHOC 2DB3A 1E3MA 2BKEA 3GQBA 1N6IA 4HLUA 1DG1G 1NI3A 4O2LA 1MOZA 5SZHB 4JLBA 3VKGA 1G8HA 2O5VA 5B58C 1KDOA 1KI1A 1PLKA 2ZRLA 4C9BA 3QF4B 3IEVA 3M6AA 4PZZA 2WJJA 5BQ5A 5KOYA 3R9WA 4A0RA 4A4DA 1GOTA 2ZR7A 5IDVA 3OHMA 5EUMA 1KI6A 2ZRJA 2JJ1A 4NYIQ 4A8JC 5A5GA 2C98A 2WWYA 1X86B 5C18A 4PO8A 1V5WA 4EUNA 5KU1A 3UPUA 2FPLA 5CYPA 1F5NA 5GJWC 3K70B 4MRRA 3EZ6A 3K53A 3Q5EA 1HA3A 1Z29A 2PT7A 5BW8A 1FNMA 1N0UA 5JS8A 4JSTA 2ZJ2A 2FSFA 1XTJA 4OI4A 4C0QC 5GVSA 1HUQA 2EVWX 2JGNA 1G5TA 4NH0A 4IOLA 4C0AC 1F6BA 6Q21A 4DEYA 1IXZA 1UFQA 1P2UA 1SHKA 1LNZA 4Q1EA 2F43B 4IVRA 2WSSA 2HT6A 4TT3A 3W8RA 1N5LA 3TR0A 1QG2A 3QPWA 1AJEA 1GUAA 2N42A 3KJGA 3AV0B 3PENA 1MO5A 4QG7A 4TQ9A 2J1LA 5JHGB 1ZP6A 4G3XA 3SU8A 1HYQA 3A1VA 2XOKD 1RIFA 1DAIA 4EQ6B 3QOFA 1T0HB 1LFDB 1SQ5A 2FE4A 2BWJA 4FCTA 4Q4AB 4FINA 3U4QA 1P62B 4IXMA 4OQFA 1KK0A 3RS4A 5TVKA 4HUQB 2QTHA 3C5CA 1M2OB 2DHRA 1GNRA 1NMXA 1XMJA 3QG1A 4JL6A 1JALA 3BB1A 5J4HA 1XXHA 4AKGA 5CB8A 3HPQA 1Z47A 4AKEA 3CF6R 4PSVA 1KY2A 3CH4B 4TLBA 4I4LA 3QVUA 4Z51A 4OK3A 2BMEA 1W5SA 2OHFA 3VAAA 2YNMA 3B9PA 4LJYA 2BM0A 4MGIR 4PAQA 3H0KA 5EP2A 1GL7A 1ZCBA 1T3HA 5FUYA 2XZLA 5KPJA 2F3TA 3QXJA 4M1KA 4Q9HA 4DXAA 2ZJ5A 5FUVA 2YHSA 4AG5A 4A2PA 1R0YA 3KFXA 2GVZC 4LPSA 4JLAA 1G7RA 2NO6A 5FTKA 5K8LA 2NPIA 4DLWA 2EYQA 2R62A 1FX0A 1DG3A 1M74A 2GCOA 3H4MA 2QBYB 2GAAA 2ZYUX 3GLIA 1AKYA 2XX3A 3I5YA 3FGNA 1FQKA 4M2LA 4DZZA 4V0LA 1AS3A 1SVMA 3Q85A 1ZU4A 1T4GA 2J9RA 4OHXA 5TDHA 1CR2A 3W6PA 2ZROA 3TUJC 3U61B 5HZHA 1XD8A 2QI9C 1D8TA 4ZV4A 5EXSA 4KFRA 2GAOA 1S3SA 2JASA 4LJ6A 2N1BA 2PEYA 3SBDA 3TE6A 2O8BB 1IM2A 5FPTA 2JLQA 4M4SA 1XCGB 1FNNA 4E03A 2J0UB 2Z0MA 4LHWA 1E1RA 2IA5A 1W2GA 2E9SA 2ZE5A 2FZ4A 1XMSA 3OFNA 4XD7D 3WRYC 3TRFA 1R0ZA 221PA 2WWIA 1BMFA 3I8XA 3FFBA 4GPTA 2RB4A 2ONJA 2EWVA 2ZSEA 3ND8A 4E07A 4BUJA 2Z6VA 4ESVA 1UDXA 3BK7A 4TZ0A 1NL3A 1S96A 2ANBA 3QKRA 5J47A 4B44A 4GRAA 1RRPA 2NO0A 2QTVB 5EP1A 2ORVA 1OLOA 3ICEA 2GK6A 2DWOA 3I61A 1BYUA 1R8SA 3ECCA 3EX7C 1VCOA 4QOSA 2JJ1D 4DT1A 3L0PA 4OJKA 1HQYE 4M9QA 5DI9A 1Z6GA 4PTLA 2BJWA 2Q0HA 3CB4A 4HAYA 1F2UB 5LD2C 1T8TA 5FUWA 3SR0A 5FPYA 1G16A 1XTRA 4UXHA 3EAQA 5JRJA 2F3RA 4FD2A 1U81A 4TTPA 1GKIA 1OPXA 1TNDA 5CJ2A 2RHMA 2VA8A 4HAUA 2WSSD 2WZQA 2X77A 3B1WA 4FWIB 4TT3D 5DHAA 2O8CB 2IW3A 2OLJA 4GOJA 4QM7A 1Z22A 1AGPA 3ADKA 3AKEA 3LQRA 4EPWA 3ADDA 4DDVA 2FSIA 4GL2A 1E0JA 3MMPA 3EWSA 2ZE8A 5FPSA 3R20A 2KBEA 4QRHA 4UKDA 4XSHA 3LX5A 3GLGB 3TBKA 2RGNC 2ZETA 3DL0A 2ZIAA 5JI2E 3Q3JB 2IYQA 1CJMA 4LWZA 1KO1A 2HXSA 1AK2A 1IJFA 1OXVA 2E87A 4TYPA 5AJWA 3UIEA 2AK3A 1XEWX 2BV3A 2W83A 3KKQA 4LY6A 4KYUA 1HURA 3FHOA 2X2EA 5AJXA 2K5UA 2PBRA 1IAQA 2AWOA 1AQYA 1XTQA 2CK3A 4PSKA 2VEDA 2VP0A 1JQLB 5HE8A 4K46A 1DAGA 1ZJ6A 4PHGA 1TUIA 1KMQA 4B35A 4KXFB 2A78A 1KI2A 2P6RA 3NIBA 1CIPA 3DMDA 2R44A 4DC9A 1EFUA 3A1TA 3P1JA 4G5SA 4M1MA 2A5GA 2ZXUA 2JLUA 2AK2A 1IN8A 1CXZA 3BAFA 2CCKA 3KB2A 1W49A 2AR7A 4B33A 2WWFA 3OZXA 1VCIA 3LA6A 5KPDA 1G7TA 1NNEA 5HKKA 2IT1A 1A7JA 3NDPA 4MKFA 1VTKA 1OIWA 1YQTA 3ZIAD 4F7WA 2NGRA 4A6XA 2OXCA 2ZYWX 2VF8A 4DB2A 2CCJA 1VDZA 2J46A 3IQWA 3ZVRA 1T6NA 5FR2A 4URUR 3W90A 3GLIE 4D4KA 4MGKR 4RD2A 3MWKA 1Q44A 2YC2C 3OEHA 4LBWA 4QGHA 1RZ3A 5D3MB 1NLZA 1RKBA 3CR8A 4A82A 5KNBA 3AKDA 4PR0A 3WY9A 2OZEA 4TMXA 1C9KA 4ZO4A 1COWA 1MRSA 5ANRB 3RHFA 3VHLB 5CM9C 1EWRA 1KI4A 1IQPA 3V9PA 1NKSA 4CVNA 3IBGA 4H1UA 3T5GA 5HPYB 5L8VA 2AD5A 4URYR 1OFTA 1YJ5A 1S1CA 1R5BA 2D4HA 4LSGA 2FZLA 2LCFA 1R0WA 1SKYB 1OE0A 3KJEA 4Q4HA 1Z07A 3EPKA 3OFND 2HT1A 3REGA 3K0CC 1BMFD 3WMGA 3KUDA 4A92A 4JT2A 4PC2A 4LV8B 3OIUA 2W58A 1ETUA 1FUKA 3DDCA 1PLLA 1I4LD 1MT0A 1CR4A 1HY3A 3M1IA 1JR6A 1LS6A 3T12A 3AH8A 1X6VA 2J87A 3QXXA 4D2IA 3WNDA 1Z2AA 1G5RA 5CLQA 1E32A 1G4UR 2WSMA 2BBOA 3QVVA 4QBIA 4LPKA 1QZXA 1GRNA 2REXB 3DHWC 3HYRA 4W5WA 4B76A 1IY1A 1QHIA 2QAGC 2ZR9A 1NJFA 4NPHA 3HU2A 5FTLA 1IHUA 1KSGA 3GPLA 4QBHA 1M34E 3QF7A 4XWKA 1PLJA 1XD2B 2I4IA 4JLJA 1VCMA 2WTUA 1Q12A 3T1VA 2IWRA 2QAJA 2WJYA 4HI0E 2A5DA 4Y0VA 3WHKA 1XD9A 4WZAE 2DFTA 2C03A 4R71A 4LOAA 3SJCA 3IIJA 2WWHA 3UG6A 4ARZB 1F2TA 2ODWA 2CHVA 4BPBA 1GVNB 1JECA 3NH6A 2PLFA 4Q4LA 3A58B 2WV9A 4Z1MA 2P65A 1E0KA 4TL9A 1GKYA 2EFGA 4RZUA 3UANA 3CWQA 3DM5A 2WWXA 2VP4A 4LYJA 1OH5A 1GNQA 2ZJBA 1I2DA 2H92A 3U44A 4Q1BA 4TTRA 1ELOA 4DUGA 4A15A 4A8JA 2CK3D 5G40A 1EG7A 3BH6A 1KO4A 1WA5A 3KJIA 4ERNA 3ZQJA 2ODEA 2CJWA 4TYNA 3RRYA 2B7CA 3OIWA 2DBYA 5DGXA 3VR2A 1M7HA 4MKIA 2WJGA 3J81k 4DRZA 2BCGY 1F60A 2Z5FA 2QY9A 3TKLA 5FBQB 4OI1A 4CIDA 1KI6B 2BCJQ 2ZTSA 2JLVA 4MA4A 2C5LA 4AI6A 2QP4A 1W4RA 4LBVA 3EW9A 5FBWB 1KI8A 2H1LA 3NDBB 4LJAA 1G7SA 4CW7A 4RD6A 4IFBA 2UZIR 4CYMA 3I3SR 5TV2A 3GP8A 2CNWA 1TU3A 3AVTA 1L2TA 1Z0KA 3B7GA 2V6IA 1NVXQ 1G1MA 3LXXA 1M6NA 4US2R 1VIYA 4HB0A 3FOZA 1XTSA 5KSPA 3EWAA 3FHTA 4QNRA 5E7IA 3C16C 3L0IB 1E99A 3HU3A 4YC7A 3AQ4A 3KQUA 2UZ3A 3S1AA 3OEHD
chains in the Genus database with same CATH superfamily
2CFRA 1GDDA 2LWIA 1E9BA 1RHRA 1Y4SA 5KNBD 1GZDA 3WL7A 4EHIA 3I6QA 4P7BA 3G2LA 1OFHA 3THYA 2HA2A 1A3CA 3SBEA 1WQ4A 3EDYA 1ZA2A 2ZRKA 2F8SA 4ENPA 3VPCA 3W5AA 3K3PA 3FUXA 2FPWA 2YBDA 5C8YB 2HJVA 4IDPA 3QLVC 4YIKA 4RDIA 2IEGA 3EGDA 3MRSA 1TF5A 2P6PA 1XHEA 4IQ8A 2F9MA 1G17A 2V58A 3E8MA 1I3MA 3CLSC 1LNSA 1EXNA 3AF2A 4N9WA 3IEMA 1D07A 2YXDA 3NWPA 3NUZA 2EW1A 4LHZA 3UB3A 4BQNA 1SHJA 3NKFA 4CMAA 4UREA 1XXHB 2FI1A 4KMMA 4KE6A 2W2PA 3FCXA 2V0NA 4PSDA 2J8ZA 5FULA 5JXIA 4B7ZA 1WCXA 4O2BB 1SHUX 1HYGA 3EZGA 3FM9A 4NI5A 4RMIA 3EGEA 4C4SA 1FSSA 3HYLA 1X7XA 3P4XA 3L1KA 1M54A 2OD9A 1NRJB 3N2EA 2YOGA 4JR2A 3HRIA 2GYWA 3HCWA 3ICWA 2PRYA 4DCNA 4E3ZA 1T1IA 1CD5A 1E2PA 2OBMA 2VDOB 4X3PA 2R751 1UMCA 2JAOA 1B73A 4L0MA 3H1PA 2O3QA 5DLPA 5LXTA 3LSTA 3RIHA 4MV4A 4ZWNA 1G8JA 3OP1A 5FYQA 3QUBA 2DUJA 2GCOB 5KI6A 4RFSA 2XVXA 4I5EA 3GLIB 2BPOA 4FYVA 3GEIA 5GIOE 4L02A 5K4GA 1J21A 3K94A 1IJKA 2GHRA 3PE4A 3RUDA 3S29A 1L0BA 4M9XA 1HE5A 2DULA 3CCFA 1NW3A 2QJOA 3A2MA 2D1SA 2FN4A 2JFBA 1FNSA 3QBEA 2SICE 4QYSA 1IOWA 1X1AA 2AS0A 3KQQA 1XQ9A 1KVSA 2YVAA 2IZ0A 3D6AA 4J16A 5JDCA 2IELA 2PFGA 3II6X 1CZNA 1EBBA 4HGPA 4YYZA 1CF2O 1E98A 2Q7DA 3PHGA 1XWWA 3D8SA 1CNMA 1MFPA 1UJCA 2WG0A 3MTDA 2JEOA 5CJPA 5J2UA 5JJLA 5LZ7A 3RC9A 2RBGA 3RTCA 5DVZA 4DQXA 1V2GA 1K6EA 4JP1A 4DSUA 2UXDB 2NVWA 2PEZA 3QVGB 1KK2A 4J6EA 2JZOA 2NN3C 3K30A 4G86A 2ZJ7A 1R1DA 3LKDA 4UASA 5GJVC 4EPTA 1ABBA 2VF7A 1GO2A 1KAGA 4GC9A 5SYNA 3S2SA 2J0QA 2TRSB 1HNXB 4FNOA 4ZHQA 2VHQA 1CUWA 3ASZA 1ZH2A 2WHXA 2CXXA 3KZCA 3EQ8A 1UZMA 3ER6A 3TG8A 3WLFA 3TVDA 2FZ5A 1D4OA 3MUOA 1QQ7A 2G9QA 3DF9A 3PHIA 3ESQA 3JSAA 4MKHA 1BW9B 2BI4A 1KY3A 3KHTA 4ALKA 4PGFA 3QKRB 2PR7A 1P0QA 4XUGB 4JZYA 4E5DA 2QD2A 1H2FA 1UAGA 3TDKA 1XFDA 4QYWA 4DVGA 2GD6A 4D4JA 5DZSA 4JYBA 1T3TA 5IAAA 5EJ2A 5D7NA 3VPAA 4GEKA 5TEWA 4ZGGA 5EZYA 1Q74A 1UWCA 3ILXA 4QQ8A 1FFCA 3A6JA 1HT2E 1YZQA 3FGOA 4P7KA 4R68A 2DPHA 4RAOA 3UV3A 1B3RA 3KPJA 1E58A 1QC5A 3ZJYA 5CIWA 5JAUA 2AC2A 1W8DA 2IGTA 1MRNA 4F3TA 2XQVA 1A8QA 1SD5A 1T1GA 3C45A 5K2MA 3UT0A 4F4HA 4YAIA 4N41A 1OXUA 1Z15A 4RIHA 3JW8A 3BSWA 1WHSB 1VJRA 3I73A 3SBOA 3BWMA 1N8NA 1ZSNA 3F4KA 3UBMA 3EBPA 1UT8A 3GFBA 3KBBA 3W34A 3PQ7A 2FVYA 3LE8A 3COSA 2XWJI 2QMZA 2Z6AA 3T0FA 2QB5A 4GNKA 4O29A 3VI4B 1YZUA 1T9ZA 2WVAA 4LJLA 1KGSA 2RAPA 4X71A 4BASA 1JEOA 2EDAA 4FYIA 5A5EA 4BIMA 2QPLA 4N4AA 4KKXB 2BISA 2DQKA 4WESB 3L0ZA 3KZXA 3W5SA 1EFVB 2HJRA 2G07A 3TIFA 9LDBA 4WX2B 2O20A 5ER6A 2Q7XA 3FYDA 5TMBA 1TM5E 3IR6A 1V11A 3CLTC 4TM7A 4BU0A 4JOSA 1DNPA 3IQHX 1KXZA 5FOWA 4DQVA 4JI4B 1L7RA 4WFJA 3OCVA 13PKA 3IOYA 4GM1A 1PYGA 3UMMA 1XVIA 1MQAA 4DLXA 1PL6A 3IJEB 1CQIB 1GSIA 1SHZA 1YR9A 2V6GA 2ZAGA 5J43A 4JLMA 2D6FA 1V8PA 2C2WA 4MUGA 3UQYS 2O7SA 1DMSA 4M7OA 2KE5A 4ISBA 1RAFA 3JQFA 3AFMA 3FI0A 5HUQA 4X6LA 4Z4QA 1AKEA 2WV7A 5ISMA 4DCOA 2HF9A 1L1QA 1JFFA 1XVTA 4ZMBA 1W25A 1RLTA 2HF2A 3RIMA 3OIYA 1P0PA 4CIBA 3MBIA 4A2QA 3C6XA 4N3AA 4RNCA 2IHNA 3EDMA 4NBUA 3U3JA 1VMAA 1NDHA 3HC7A 2A0UA 1Y1RA 2GFHA 2DXIA 3QKUA 1XZBA 2WNSA 4KI0A 5KVSA 1RP1A 2XCQA 1C50A 2BGKA 1NLUA 3H86A 3KRTA 4MXDA 4QYIA 3W1EA 1OC2A 3B6KA 4ZK2A 5BSFA 3RVNA 1DAMA 2AN9A 5KTNA 1WAMA 2J0EA 5FR1A 4JK3A 5U4QA 1HFKA 2PWAA 5TGZA 4AXXA 3V2GA 3RJ9A 3IPRA 3N3BC 5AM0A 3S2YA 1J2UA 2W37A 3PT9A 1YD7A 1L6IA 2G3YA 2XWPA 4EA6A 4L9WA 4BMOB 1OBVA 2AXPA 2VO1A 4GOMD 3AF0A 4HNHA 4OFBA 3GX1A 4IHQA 5FBHA 2OZPA 4FFOA 2FDXA 2YHIA 5K8JB 1FUYB 1R9MA 1SKUA 2HX1A 2BL4A 2KLBA 3DOEA 1N6HA 3OAAA 4YS6A 3ZS9A 4MVJD 2D3WA 3K0CA 2O2DA 4INAA 3TLXA 1BJRE 4D0RA 5AVTA 2VSFA 1OBOA 4Y9SA 3UWKA 4S04A 2FSSA 3ROPA 3CW9A 1VLQA 3WGNA 1YDHA 5BMVF 4FHCA 3C2QA 3NC1C 2JGDA 1BEEA 4EEXA 1UT6A 2PTGA 5K0NA 1QV7A 3R9IA 1ILWA 4KPUA 4KQHA 1T3LA 1JEAA 1Q0QA 3KELA 3IOBA 1H9CA 1LLCA 1VFPA 4D0LB 1A50B 3H2BA 1FC0A 2H8KA 2A9JA 2FPPB 3FSEA 4X7BA 1KC1A 3LCVB 2W6OA 1I2CA 1YKSA 5KEIA 1ZW6A 2XI4A 4GF5A 1JZQA 1DELA 2WM2A 2WOJA 2HREA 5GONF 4BNHA 3E6AA 4LMAA 1L4UA 3HHEA 4MPPA 2P0YA 2B7BA 3UV6A 1E7RA 5DHQA 4NU0A 2BFEA 3OBIA 2I7XA 5HFAA 2JEZA 1F6DA 2PZ8A 2C59A 2QPTA 2FEAA 3WGIA 3D5QA 1I1QB 2IITA 3VR5A 5BYAA 1D03A 1Q7GA 4EG7A 4JI7B 3MM4A 2PLRA 3C3PA 2JFFA 4WI1A 3VR0A 2FSPA 1UJBA 4BRZA 1HDYA 1C3JA 1D2AA 3BORA 2RHRA 4RKEA 3IR7A 4TKMA 3LK7A 4FD3A 4MW6A 2AN3A 4P81A 4RTMA 1QG4A 4ZCRA 3PLAE 2PZBA 5JQGA 2WR8A 1KY5A 5K45A 3UCXA 1W94A 3NKLA 1N7HA 1M0SA 5JCJD 2HXYA 1E0AA 3NJRA 4YV1A 3EPPA 1CPYA 2Y1GA 4Q7JB 4UULA 2ZBVA 3D2CA 1OTYA 3HBMA 5J1SB 1C7IA 1CJKC 4U9IS 2PKCA 2QVLA 4ZDIA 4QGBA 3OFKA 3RTBA 2DWCA 1PL8A 4B7XA 3MYRA 4N40A 2H08A 2I8AA 1I3KA 2FFQA 2V9CA 2HJSA 3M6WA 1J07A 4LZZA 3BHMA 4HLNA 3UJPA 4RGVA 4YUVA 4ICIA 3OEYA 4MJLA 3V97A 1SZDA 1GNTA 1NNSA 2C2MA 4KXLA 4KWEA 5CK5A 3M5DA 5CT9A 3HCEA 4GQIA 5HJEA 4F38A 4HEJA 1AOXA 4NIMA 2DTDA 5CH8A 5K7SA 1E6CA 1DLIA 2BRUA 3NEJA 2PSEA 4LMBA 4BKQA 1GV1A 4OHWA 4G89A 1UOPA 2JBAA 3R0XA 3O8LA 4ZT7A 4NENB 4YEDA 5FKJA 4URXR 2E5FA 3OKFA 1XFAA 1KAOA 1ZFNA 4XI9A 4KQEA 1IXYA 3E9QA 5KYUB 1L4BA 4D3ZA 2KI5A 3G17A 5J5VA 3C4QA 4Z0HO 2VNIA 7YASA 1T9GR 2VATA 5JARA 4YMHA 3S2FA 1JA0A 2Q9UA 1V35A 2WFAA 2QYSA 3MBKA 3NBUA 4MS4B 2BJVA 1OBFO 3G5UA 4GOXA 3M49A 4CMIB 3DO6A 3W2IA 4C07A 1UDAA 1U5AA 4LYFA 2Q1TA 4L27A 1P2BA 2F6RA 2GWRA 3A9VA 4S0XA 2YKQA 3BM5A 2CUZA 1D9ZA 5FL3A 3WJAA 4EYSA 3QEKA 5COQA 2R6ZA 2QRPA 3A11A 1C8KA 2ZSDA 5LC1A 4HC4A 3ZR4B 5KYKA 1NE7A 3JWGA 1DQSA 4G56A 1TTHA 4IFIA 2PNFA 3IBSA 2FX5A 3CNNA 1U2RA 4H77A 5DXAA 1K08A 4Y2QA 3UNXA 4ER0A 4WLNA 4PO9A 2F8MA 2QE7D 3SMVA 4D81A 2EC5A 2DTEA 4IEFB 1NXXA 4MYDA 3QPBA 5LP6F 2CFOA 1G41A 2DBQA 1BFDA 2J85A 2P9QA 3F78A 2NO5A 4YJ3F 1VE9A 1ADYA 2G77B 5D1NA 2DPXA 2C0QA 3QLVA 2PD6A 1V71A 3FD8A 2NUPB 5TY0A 2GCGA 3U80A 4CEHB 2WWVD 4ZYLA 4N03A 1R6AA 2FJ0A 1VIVA 4HDKA 4B7CA 1W0KA 5A02A 1W4AA 1W52X 1JEYA 3GGGA 3HYNA 1WTCA 5JPCA 1GTVA 4Q3AA 1I36A 2VXCA 2YQZA 3LX6A 3G2OA 3ZXIA 5KTKA 4P4SA 5LB4A 4C06A 3U17A 1I32A 1NYTA 1FDUA 3BDIA 3EY4A 3M5CA 3MMZA 3GVIA 2PUGA 1ODIA 2H1CA 1GU1A 1T4CB 4AD8A 1A4XA 1M33A 2RARA 5EMKA 4D4MA 4EMBA 4YMGA 1FFSA 1TKBA 5AJYA 5EMLA 1W36C 4LF4B 4ND2A 1ICEA 3SHOA 4ZJUA 3H17A 4Q3OA 2CBXA 1L1FA 1O95C 3RFTA 3ANLA 2FSHA 3A3KA 1DOZA 4I4TF 3P26A 4ZO8A 2NV2B 4GVPA 3BYZA 4XE5A 4I55A 4N8SA 1H94A 2GFQA 3NBXX 5IM4A 3C1AA 1SXJD 3D43A 4M36A 4H3HB 2HU2A 1FUIA 4XH9B 4NC9A 4BKUA 2CUKA 2QJFA 2VTBB 1XNJA 3UT6A 1LPSA 4F72A 2HDOA 3B1ZA 5AHWA 4JC5A 1GPWB 3D7SA 4G0UA 4WHMA 3X0DA 3EYWA 2C7RA 1QRUA 2DP4E 4CGZA 4IIUA 3BH0A 4KCGA 5BYKA 1KH2A 1NWHA 4DSAA 2W6IA 3NT4A 2VXBA 3RYHA 3DLHA 3ROTA 4DIDA 1B0AA 2MINB 2YWDA 4PHCA 3SQOA 2BFMA 1EP3B 4R8VA 2BDTA 1X7YA 3VKWA 3VZRA 2MSLA 3I76A 3K1AB 3L7CA 2FW0A 3D7NA 4E4RA 3FNQA 4NS4A 1F12A 3CZ9A 3ZCQA 1TKCA 1U1FA 3PNMA 5TPZD 2AOWA 3TM5A 1L6RA 5AD1A 1JBKA 1U2GC 3ELWA 3LC1O 1WU7A 3KHKA 4M83A 1WRBA 3KKPA 2M6LA 1GUDA 2HSWA 5JU6A 5C5DA 2DT5A 1UEJA 1C9EA 2QU8A 2JANA 4P4NA 2QGNA 2B2NA 4GI2A 1TUBA 2BEJA 3PF9A 5GZ6A 1PT9A 3DVAA 5BN5B 5AM4A 2HYIC 3NETA 1CE8A 2HHJA 3ESAA 3Q2IA 3QV1A 4GOKA 4B74A 3RAGA 3L0BA 5LXTF 1SR8A 4M8IA 3RKUA 4KLNA 2WG1A 2WPDD 5EE3A 1A4RA 1HXHA 5E9WA 3ROKA 3SJ7A 1V8BA 2QI9F 5D2CA 1JU3A 4RAQA 2O5RA 3BSFA 3VC7A 1MBZA 1RWPA 5HQTA 2OLKA 4KZPA 4RQAA 1U7PA 2X0JA 1EE1A 1EP2B 3HG7A 1SCBA 4WNAB 5EHIA 4ANFA 4V0RA 3K6SB 8GPBA 5BW6B 4P86A 2WU4A 3TW0A 5KYYA 4ZQCB 1CRLA 2VHCA 4A23A 3RVKA 7MDHA 2NG1A 1AKTA 2I4NA 4LTMA 4Z9BA 3VH2A 1UXGA 4RF3A 1TJNA 2RIPA 3C3MA 4WASA 5IH3A 2JCXA 3U0BA 3HVHA 4HR7A 5IDQA 5J2UF 2DFNA 3IAHA 1NY5A 2XKAA 1PV1A 3OVMA 4M7PA 4RF4A 1MX3A 2O07A 4NG4A 4XYLA 2RHCA 4UFNA 5AKZA 4ZYWA 1BS2A 3AZPA 2Y1XA 3H5LA 2ZI3A 1Y1TA 3MA0A 1E9AA 3QM1A 2I2CA 2EWWA 2XXBA 5EJ5A 1F9EA 4UHFA 1RI2A 1HT0A 1WZEA 3JV7A 4US1R 3NTXA 1YZNA 4QYTA 4ZHQF 3PQ6A 4K6HA 3N2IA 1P9NA 2J0SA 1WWKA 4HDNA 4PSCA 1LZKA 1EESA 1B1AA 5IKEA 2LDBA 1H93A 3OG9A 2PS3A 1AZSC 1R5JA 1YR1A 4H1VA 2WIGA 4MQUA 1H2AS 1NUSA 4PE5B 2P6NA 3ADBA 1J06A 1WM1A 2IBSA 2ZRHA 1V45E 4OOFA 5KKNB 1ZX1A 1WZIA 3IXLA 4JI6B 2HJWA 2IYXA 4TSFA 4YMIA 1BCRB 3I09A 2IEAA 5KDLA 3SJAA 1JDJA 4M89A 5AXDA 1ZISA 1WDTA 1CUZA 3S7ZA 3OHSX 1A95A 5EZYF 1OWMA 1TYZA 5KYNA 4IS3A 3ANYB 5EMMA 1BJKA 3LNCA 2C2KA 1EDDA 3LYAA 4N47A 1FP6A 4YASA 3ZH9B 4PIPA 3RGWS 3IYLW 4AP6A 1XZQA 3W4KA 3DFMA 1VHQA 3K0AA 4CM1A 2JPDA 2WFLA 4FCWA 4CF7A 1BG6A 3MC1A 2RONA 5B7PA 4WVFA 3ZI4A 4WKPA 1SN7A 2CDNA 1XF9A 3OQPA 3IMKA 3REFA 1NQAO 5JS7A 4XJTA 1I4EB 3I5UA 5DHUA 1BMDA 1N2CA 3CY6A 3SC4A 3WFJA 3WXBA 3BL8A 5COAA 3WB9A 2CJYA 4YQZA 2HSJA 1OI4A 3BMQA 4NV3A 4QOGA 4KV9A 1DAOA 1K63A 4Q4JA 1KEPA 3BGIA 1GTL1 3GJ3A 5A7HA 4CEIB 3U4MA 2KS6A 4DIMA 1YMVA 1PUXA 1QAMA 3CO5A 4FILA 3ZV4A 1QIEA 1UAYA 1SXJC 5FQOA 4ETNA 4S1OA 1C81A 1JNXX 1OFVA 3KQMA 4HEQA 2MMCA 4HYYA 5A5DA 5ITWA 4BVKA 1Z2NX 3SPXA 4ZAGA 3ENKA 1S2NA 3HJTA 4JLNA 3JWEA 3NXKA 1V7QA 1SOVA 1WG8A 2RGWA 2Y3IA 4EEKA 3AR7A 3WYAA 4PZ0A 3AILA 3BJMA 1BU8A 3V42A 2H11A 1HQDA 4RZXA 4IDNA 4NOLA 1CUEA 3NXSA 1PEAA 4FYKA 2FPIA 4H7KA 1VE5A 1GZVA 3PFHA 3T0GA 5IANA 3UHAA 3A9UA 3UOAB 1TQHA 3KQPA 4UFPA 4IOKA 3PFCA 3R5JA 4C0KA 5EJ8A 8ATCA 4J7CA 1PZNA 5DW0A 2H4ZA 4R3WA 3IP1A 3AIKA 1JKIA 1GTJ1 2FXIA 5ETJA 3ZY2A 3BKWA 2I4LA 3TAHA 4HNGA 4B43A 1IN7A 1E79D 1KIMA 4ND3A 3RS0A 3L5OA 3MINA 1TVEA 3WO1A 2NU8A 1VSQA 1ZS9A 4F8EA 4QYXA 1XR3A 3V46A 2RCNA 4LXIA 4FP9A 4EUFA 4Y3UA 3B2QA 4Z53A 4PZCA 2R6FA 5JRZA 3NS7A 4P82A 1E94E 1QX4A 3FG9A 3QI2A 2V45A 4RM3A 4EY7A 4M8LA 1SELA 1LWOA 3TIGA 4ND4A 4KFTA 2Q1UA 3EE6A 4GG1A 5E38A 2FQXA 2CV1A 2UDPA 1X70A 2R9VA 3NIFB 2QN9A 2Z9DA 4IJVA 5DT9A 2P3OA 4CL2A 4K6MA 3QG5A 2IQ5A 4WMLA 1MIOB 3FCAA 3ZDRA 1R9GA 1IVYA 2XUIA 3BRCA 4JCCA 4O4IA 4BQIA 2QQEA 5AR1A 1MTOA 3OZBA 1GILA 3FZQA 2WWTA 3RTAA 3ZV7A 3LQ4A 2FQWA 4DV3B 2GO7A 1YZYA 1DWQA 3EGCA 4Y1RB 1NULA 1F0YA 1MX9A 4V38A 4C0JA 3TSWA 4X1YB 3F6EX 4AT1A 4NZZA 5EZ5A 1Q1BA 2G25A 5JZVA 2QD3A 1GCGA 5DGIA 1DWUA 1HEIA 2QMUA 2PBLA 3F6PA 2HPZA 4IOJA 3P71T 1L5SA 1SKAA 2O57A 2XDQA 2R8BA 3GHHA 1CZKA 1E2NA 1CF9A 1SK8A 2G1PA 1HDZA 2QTWB 1E3WA 4RELA 3RAEC 1MZVA 2VH5R 1G0NA 4PQYA 2G1KA 2QZ4A 3BXOA 4WXPA 3PLNA 3ZX5A 5FBRB 2H54A 1UMBA 1CJVC 2O8NA 5FTNA 5JISA 4B2LA 4B6JA 1EGAA 1GGFA 3IELA 4CHTA 2BELA 2ZSAA 1TAGA 4AKSA 1YJAA 2XTAA 2H7CA 2W0MA 3OPVA 3WNQA 2UKDA 2XMDA 1KQOA 4EG1A 1E3IA 2QEQA 2Y77A 3CQ9A 3TVTA 1JQBA 1YK0A 2R65A 1QJCA 1ZK4A 3ORYA 1J5PA 4OXKA 4AJHA 1DBVO 2PSHA 4QLOA 1FYEA 4EMSA 5KU7A 1QG0A 5IRCD 4R9UC 3R3SA 2Z09A 4ZDWA 4FBMA 1E9RA 3G0OA 5D51S 1A1VA 3KKMA 1DG9A 5JQGF 1OKKA 1N2BA 1RRGA 1I30A 2MYTA 1NR1A 2ABWA 4N6OA 4P36A 1N9GB 3B51X 4FNAA 5H4HA 4JI3B 1ZK3A 4ZCQA 3TE7A 3TSAA 3ISJA 2OFPA 4ZT4A 1DEHA 4CN8A 3WGOA 2WT8A 4PTZA 4KDRA 3KXPA 1Z18A 3GZJA 1AUVA 1V4BA 3IAS1 1U0RA 1Y4DE 1CETA 4V1CA 5BOVA 3VU9B 2OCGA 4MDFA 1AHNA 1J00A 1XEXA 3RT1A 3EN0A 1SBQA 4ARBA 1ZVQA 2VN8A 3C24A 3WZLA 4UAVA 1TK9A 1ZOOA 2WWWA 3HDVA 5IBRA 4H3VA 1GLGA 3B1JA 2GESA 1CDEA 3NEYA 3SY8A 5JY6A 821PA 2VZ0A 1W96A 3SQXA 1KP2A 5NLLA 2YZ7A 4MWEA 1L4FA 3Q7PA 3SDSA 1V7ZA 2I6GA 3RRNA 3X1DA 5EZ6B 1KO8A 3K0HA 3GUUA 2WAXA 3OMLA 1QV6A 4V0NA 1BVRA 3H5AA 1TU4A 4YJHB 1DKOA 3CUYA 5I8PA 3ANTA 4F7DA 1CY4A 3LX8A 5JEDA 3KL4A 2ZIUB 5G0TA 1CRQA 1Z63A 4DVJA 1NDQA 1P75A 3S68A 3WA7A 4W1QA 1AH2A 1U2QA 2ZB8A 1R7RA 3BMCA 3O2QB 1QFJA 4N6NA 1O95A 2NNLD 3DV0B 2DFDA 3OU7A 1EUCB 4U7PB 4X64B 4C6SA 1R4NA 2XDYA 4NS1A 1I51A 4ZVQA 3ZWNA 4EA9A 5JCPA 3FJOA 2PMFA 1PL7A 1PDOA 1Z28A 3AYZB 1XZPA 2CL7X 2GFIA 4P9NA 3H4IA 3EHEA 3SEZA 1Y5NA 2V6FA 4LV6A 4LF7B 2P7HA 4AS2A 3H13A 4JD5A 1KWGA 5CVEA 5M7EA 2AKEA 3DZBA 1WMSA 2QT1A 1AQJA 2JCGA 1CY7A 3HKCB 4OMUA 4JU8A 3TW8A 3BB3A 2Z43A 4P7GA 2CHEA 4QODA 5B3LA 2B1JA 3BXPA 3HA5A 2GNAA 2W48A 3PDIA 4W7SA 1GRRA 2DGDA 3SLGA 1QHEA 2QAIA 3MGAA 5DSTA 3ONWA 1MD9A 4MLDA 4D0NA 3UGTA 2OHGA 1BVUA 2HEIA 2EW2A 2YWEA 5CTJA 5CBKA 4D4LA 1W8IA 4PCLA 5B12A 1YBMA 3UBTA 1Q20A 5FFNA 4E6PA 1B26A 3WC4A 3N53A 4QATA 3WHPA 2MSDB 3KSMA 4C87A 5DYYA 5FV4A 3Q15C 4RULA 3D54D 2ZEJA 4BEJA 5FUBA 1U2GA 2R4UA 3UJ6A 2I7VA 3L3BA 3LM8A 4JLSA 2Y05A 2WHPB 3DJYA 3QZUA 2E85A 2Z8YA 2H4JA 3RYFB 4WUTA 2P8SA 3JWPA 1V95A 1MR3F 4TKVB 2RHOA 5AFSA 1FYXA 1BCSB 1VIMA 4I1RA 4P84A 2EZ4A 1DAFA 5EPUA 4YV7A 1Z08A 1X7DA 3CKLA 3CN9A 4XVCA 2G72A 3G0DA 1CV2A 3ZDFA 1XZ8A 2K87A 1WW8A 1TO6A 3HI6A 3R7WB 4I55F 3NHKA 4ILKA 4EECA 4WRRA 2PYDA 4RJJA 1XC7A 2JAWA 3IHWA 3M83A 1Z4OA 1GZUA 3ASVA 3GOHA 2MSNA 4QXAA 1N2XA 1W1WA 2B2XA 5CB4A 5FL7D 3NM6B 5FLEX 4AJ2A 1F4PA 3ONEA 4BO7A 2CLCX 3ZCVA 5DSZA 5IBQA 5K3AA 3LWBA 2NP6A 3EF3A 2REBA 2A0YA 2I3DA 5KQLA 3N58A 1IHOA 1ZD5A 3TTUA 4B6PA 2CD7A 2FCRA 3N5CA 2RH9B 1D2RA 4XIIA 4XQ9A 1OTXA 3OOJA 3RV4A 3DBHA 3KWLA 4UTXA 2LZ0A 2H06A 2NW6A 3OMXA 5TIIA 2WD9A 2Z9CA 1I10A 4JASB 2XBMA 3GEEA 4Q7EA 3T5DA 1DTWA 1NASA 4HB4A 5IBCA 4MW1A 5KVAA 3KLBA 2BMFA 3B3QA 2TMDA 2YRWA 4AG6A 3G8DA 5BMVB 3QKTA 1MOQA 4LZWA 4JUFA 1JR3E 2BEKA 2DHEA 5K0CA 3MHTA 1AQIA 2ZJOA 1GN8A 1AXGA 1Y8QA 1A2BA 1LF5A 3HDHA 5ITVA 4BJ6A 2Z95A 4D7AA 2EIXA 3H9CA 1SG0A 4MRMA 4OK5A 4D44A 2DWUA 1TCCA 1LJLA 4D98A 4GKKB 2FJPA 2XNDA 4G2NA 1QQTA 4OJMX 2DPLA 4QOIA 3ZWXA 4EGSA 5I7HA 3PCTA 5DM2A 1ULHA 2WJPA 1IDN1 1NF9A 1OILA 2M2IA 5H1YA 5C1PA 3DM9B 3F9RA 4HRXA 4M9ZA 2O54A 4IX1A 3FZYA 4NZPA 2XOXA 5EG5A 2AFIB 3ZYZA 2RKWA 3AVYA 1PQYA 2QMHA 2CVHA 4Y2UA 2IYZA 1U28C 3OURA 1C0IA 3GCGA 3OA0A 1O94D 1FLNA 3FDJA 3IKLA 4FGKA 4E5KA 1AZTA 1Z4IA 4BLQA 1JG6A 5AVUA 1STOA 2Q9CA 5GPBA 5BXYA 5ALEA 3B8EA 3HE3A 4HDMB 4ZZ3A 4YJFB 5JVDF 4AY4A 1T1RA 3CBQA 4EJSB 1GL3A 1XCOA 5JJIA 2HSGA 3NP9A 4AJOA 3ZE1B 5KIAA 1T9HA 3R9XA 2PLAA 4IIFA 3LY7A 3OJWA 5J2TB 2IIQA 1MA0A 4BWYA 4EKEA 2G7ZA 2QRJA 1OYWA 4Q66C 2WSLA 3I58A 1X2BA 1Q83A 1ZH6A 3RC7A 4RX1A 5GVRA 4BLSA 4RTOA 4RH3A 5EYPA 3KVNA 1YS6A 2PKWA 2VBFA 4QJ4A 1EBFA 4QAJA 4WEOA 2FE1A 4BLOA 4JJEA 3DB2A 1QLWA 1SXJA 4I50A 1J20A 1J9ZA 2ZLBA 4TKUA 3RQIA 2VG8A 4CCYB 1C2YA 2Q41A 3CF2A 5UKDA 4Z9XA 1N6RA 1DT3A 1JHMA 1KVRA 4IMPA 3EMKA 3OZCA 1E7QA 2FP4A 5C8ZA 1PK8A 4IO0A 5F9FA 1DV1A 3HXLA 3TBHA 3TLMA 1JYFA 3NFRA 4ZZ2A 1YCFA 4AXBA 4O4HB 3T7JA 1YRAA 2G83A 4URWR 4XFKA 3ZCPA 4OY3A 1NPDA 5JJBA 1E3DA 4R5HA 3ENQA 2Z2XA 2JHPA 3BF8A 3JD1A 3OLYA 1ZKDA 5C4GB 4YX9A 1JQEA 1QIIA 3JZIA 4DLLA 5LA6B 4E2ZA 3FZNA 2WG2A 2ZUVA 1SFRA 4ZVVA 1XEWY 1NOKA 2AOXA 3MNFA 1VJTA 4DYDA 5L3QA 1DC8A 1M5TA 4R84A 4L15A 3JZFA 4LXHA 3ZBPA 4DS3A 4UCWA 4YCCA 1MVOA 2EZ8A 4LX0A 4XIFA 3CX4A 3ABRB 4MUMA 1H3EA 4M0LA 2R6JA 3LW7A 1ADCA 3UWOA 4DHEA 4GSKA 5AIBA 3ZHUA 4F93B 3WDSA 5D3QA 1BN7A 1KU0A 3LGSA 1T2AA 3GCDA 1O0CA 4Z1OA 1AQUA 2DECA 1FFBA 2J41A 1TADA 5BWOA 1RE0A 2JFQA 3GQVA 4G5HA 1RI5A 1P61B 2BFCB 3ZX4A 1XHLA 1HPLA 2MU1A 2PVSA 4GSLA 4AN0A 3LOPA 1S01A 1EINA 1YB7A 3LT0A 4U6SA 5A3VA 1PNVA 1VMKA 2X8BA 1XTTA 3BRWA 4JMLA 3SS9X 3ND5A 4X63A 3BIOA 3JQ7B 4QUBA 2J5BA 4PFKA 2VRCA 4HWSA 2XRFA 3TQHA 4DEXA 1P7PA 1Z8NA 2G9NA 4TKZA 2GN0A 2TMKA 3AZOA 2BM8A 2O2XA 2WTAA 4DB4A 2P9CA 4D0SA 3OZUA 3CEPB 1O5OA 2A88A 2VDQB 3U13A 3VSCA 4RZ3A 4X1KA 1A5BB 1S0UA 2YTZA 4D6YA 3ZU5A 4A8HA 4I4CA 5KJ6A 1K7CA 1SMKA 1UADA 1PJQA 2CLLB 2C1ZA 1EXVA 4A73A 3O0TA 1Z68A 3MK31 4XR4A 1GFZA 3GEMA 1C1YA 1ANKA 4MYTA 3KR2A 4JI8B 5DISB 4GC5A 1M67A 4CT5A 2QQ5A 3B78A 2D13A 2XYHA 4JCOA 2Q2QA 4I4TB 2YIJA 3IHLA 1M1YE 1YB1A 5DHAA 4E3WA 4DGQA 3M34A 5ITSA 5HKOA 4IF4A 5B3AA 1EH5A 1TECE 4F4IA 7MHTA 5JJ5A 2ODTX 3WIDA 5JAZA 2E82A 3TRIA 2ODAA 1RQ2A 3B36A 1LW7A 4GLJA 1L4MA 5F5NA 1ONPA 5KWIA 4MDHA 2N46A 4RKQA 2FPKA 3DE4X 4LHVA 5I7FA 2ZKLA 1BGXT 1W88A 4O4IF 5LQJA 4HZUA 3WL3A 1KPGA 4YMUA 3U7EB 4E88A 1PFYA 2QMEA 2IJGX 4QTXA 2AKAB 4GPD1 4TWBA 3L6EA 4KNYA 1H2BA 1MHPA 4P8RA 1WUKS 1ORVA 3CYFA 4IOMA 5HCNA 4EYGA 1U5BA 3AKYA 1SU4A 4Y6RA 2WT9A 3DMTC 2X1LA 3E1GA 5SICE 3GRYA 3UUEA 4FVTA 4DQKA 4QHYA 3L4KA 1OWPA 3LIPA 3HLKA 4RW0A 3WL5A 3O2NA 4OFZA 2OO3A 2C9DA 2EQBA 3PGLA 4AJ9A 3ABIA 1UAAA 5TJ9A 5FLYA 5HDBB 3B2EA 3GO4A 3N76A 4BE7B 5AVYA 3K2EA 1OFIA 3RFCA 1G5IA 2Q8NA 5I9IA 3EULA 4F60A 1XJWA 3QFRA 2BBWA 4OBEA 2PZEA 3PB3A 3MFQA 1Y1KE 3T7EA 3CNQS 4U5XA 1K2VN 1Z4QA 4NDZA 4P0QB 5IJ9A 3O8QB 1A76A 1K7SN 1KF0A 2IBMA 4DANA 1SD1A 2PMEA 5GZ1A 1UXIA 1V1MB 2GBGA 3R3HA 4RZ2A 2IGBA 1FSFA 2QJWA 4EATA 3VPXA 1F0PA 3NTOA 3OEED 1S7GA 7REQB 1E2KA 1M2EA 1D2MA 4CLRB 5IJWA 5EWJB 1GPLA 1TU0A 3LBYA 1CFJA 3X1KA 1C3LA 1LV7A 3C6ZA 3WNBA 1BWPA 3S70A 4BL5A 4ZCTA 3D3WA 1OXSC 1KOFA 5FEMA 5KOJB 1UKAA 2O3UA 2P67A 4F21A 4OA5A 3T1NA 5IK2D 2OCBA 4JVSB 3KX2A 5U9CA 3DZIA 1Z34A 3R7LA 3SFZA 3NRJA 4IWNA 4RTQA 2J3QA 4R01A 2YJ3A 3GEBA 4BC1A 5JC1A 3A27A 3LLUA 4KMOA 1IXSB 1E2LA 1P5RA 3KTDA 1JH8A 4ZIRB 3SOOA 1SCAA 3M4ZA 4IGAA 3IAAA 3VH4A 3B52X 4WXMA 2WTMA 3ZKWB 2VQFB 1T8PA 4L8VA 1RM3A 4JKYA 3ZU3A 2ZUEA 1M0WA 5J5CA 1TEXA 1GWNA 1NBME 3A6LA 4JBIA 1T9CA 3T6KA 2P5SA 4TYMA 5FQNA 2XJ9A 2QUHA 1P2VA 1T3GA 3VZDA 1KO7A 3ZWKA 3NM5A 1SCJA 4UU8A 4DV1B 2F3SA 1MB0A 4AQDA 1QQAA 4L4UA 3PDUA 4KQ6A 2EARA 4EJ0A 2GD1O 1QYXA 1ORWA 2X15A 3G5TA 4YJKA 4XOUA 4MV7A 1XCBA 3QGMA 4HH1A 5B2ZA 2WHQA 4DDWA 2J9XB 3O3MB 2E0IA 3UJ8A 1E1QD 3DUFB 1Q3KA 3IBYA 3KXDA 1PCXA 2ZUWA 3QEAZ 3GJRA 4D8YA 2MOKA 3ZXYA 1RXVA 2AHOA 1HM5A 4KOEC 1VCHA 4DBVO 1NJGA 3C97A 5A04A 4L0CA 3IS3A 3FPCA 4JX8A 3P4UA 4LRTB 2OMKA 1P6XA 3R3XA 4NBKA 2OXFA 3ESDA 4FT4A 3OQIB 3MJCA 1IOLA 5CU7A 3EIXA 4P34A 5G3YA 4MWZA 1D7AA 5FLXA 4GZ5A 2GK3A 1BXGB 3E7PA 4BMSA 4DR5B 3JAKA 1U0FA 4E1AA 4F71A 1ZI8A 3DTVB 3E8SA 3O4RA 2JKYA 2H48A 3KALA 4Y6SA 4LKRA 4DAOA 1FDWA 5EHXA 1K89A 3Q5GA 2C2BA 1TLFA 4G5QA 4X9XA 3ZWCA 4KKVA 3OETA 3R24A 2Y1FA 1EWTA 3HVRA 3JWHA 4HTFB 5EE0A 1CY2A 4OLFA 1N5DA 4CQJA 4B3TB 1EFTA 1JHUA 1YZ3A 5BN4B 2EV9A 1NNI1 1KJ9A 2ZVPX 3V6MA 1QGZA 1K9SA 3OOHA 1A8SA 1C2TA 2QUBA 3DE1X 3QHQA 2O0HA 4HFRA 3QFSA 2ZSFA 5JFOA 2C99A 5MN5A 1Q17A 5HQ3B 1X77A 2PGJA 1LZLA 3OTIA 5IW8A 4O3MA 2YWHA 4MO2A 1LUAA 2AQ8A 4BAUA 5CFNA 2JD2A 4NULA 4PAGA 4QDUA 5AM2A 2JW5A 2WIFA 5D8DA 3LQQA 3VO2A 1FPQA 1JMYA 3ZGZA 3WSWA 1D4AA 2GYYA 1GQOA 1M2HA 1NXWA 3D6FA 3L7JA 3Q7EA 4JVLA 4L6AA 4ER6A 4I1IA 3WGQA 3UMFA 4OXYA 1ZNZA 3AM3A 3O90A 1U2SA 2VDWA 5G4LA 1A69A 5EJ7A 1UJ5A 3ENZA 4RZQA 5CEJA 3OLCX 4P3YA 4L28A 4I5GA 4RHTA 3BXXA 4W6ZA 2OTCA 3W5VA 5HRUA 3KVRA