4PQYA

Mycobacterium tuberculosis reca glycerol bound low temperature structure iic-n4
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
328
structure length
316
Chain Sequence
TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 97
structure length 316
sequence length 328
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4pqyA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4pqyA01
1YZTA 4DIEA 2KBEA 1HE8B 1HA3A 1FTSA 3DDCA 3QF4B 2FWRA 5FOWA 1CJUC 5E7IA 3DKPA 3R20A 1FUUA 2IXFA 3QKSB 4NYJR 5G3YA 4EUNA 1MABB 4D4KA 4IOLA 1N5LA 1N6OA 1D9XA 4MRNA 1Z0FA 3K70D 4B3XA 2XZPA 2HDNB 2WPDD 2YWHA 4IXNA 1C1YA 3SFVA 5IK2A 3AKDA 2RGNC 1ZYUA 3OZXA 3T1TA 2ZR9A 5LD2C 1JNYA 1S0UA 4AKHA 3TJZA 3AP3A 2OCYC 1XPUA 4M2LA 5ANRB 5FPTA 2F3TA 2IHYA 1JI0A 4DLYA 4ESHA 2YV5A 4AKEA 4W7SA 1E2KA 3RRNA 5JMTA 3U44B 2QZ4A 4XIGS 4LYHA 5JJIA 1WQ1R 1YZKA 4MGZR 5A4JA 3VTKA 3FWYA 5AK0A 3WYFA 2P0EA 2ZSAA 2WWFA 5EP3A 4DHEA 5KSPA 1RRGA 4AG6A 1KDRA 2J3EA 3NEJA 4NTZA 4DLSA 4L15A 5JEEA 4P4TA 2C96A 1OJLA 2RB4A 1R0XA 2ORVA 2WZQA 3S1AA 4TL6A 2EWVA 3VMFA 4QJ3A 1RYHA 4F4IA 4M1YA 3BXZA 1GNQA 3NH9A 4B75A 2J0SA 1N5IA 4Q9IA 3EPKA 2BBTA 3ADDA 1K6MA 5AR1A 2YOGA 3KX2A 1U0HC 2QMUA 3OIWA 1P2SA 4A8JC 2DHRA 2JJ8A 3F0TA 2OLJA 1E9BA 3M0EA 3UMFA 3ZS9A 4B2PA 2A9KA 2IK8A 3HP1A 3LW7A 2ZXUA 3R8FA 1KI2A 1G20E 1MR3F 4TLEA 1OFUX 2V7QD 3DM9B 2BMFA 2ZJ2A 3IQWA 4Q01A 2QTVB 1G6OA 1LW7A 4BEJA 4GPTA 2JLUA 3BJIC 1ZJ6A 3CRMA 1P3JA 2CNWA 4II7A 3W6OA 4KCGA 3TAUA 1S3SA 1EFRA 3DO6A 3WYGA 3UWKA 1JR3D 1KI7A 3CKLA 2ZI9A 3MCAA 4LZZA 1YE8A 5CDFA 1CR1A 3EC1A 4TLAA 3ETLA 4KODA 2BCGY 3B9QA 4DC9A 3OE7D 1BS1A 1J8YF 2G1KA 4JIMA 2C9YA 3SZRA 2OLKA 2FDCA 2BCJQ 3RRZA 3ZGXA 2JJ2A 3H2YA 4ZI3A 4MQBA 2WAYA 4PR0A 4L9WA 4BZXA 2F43B 3VNUA 1QG2A 2A5FA 1N6LA 4LV6A 4P4UA 1KI6A 1HUQA 2C77A 3EZ9A 4TL9A 4DKXA 4D0LB 5FTLA 1FUKA 2FF7A 3U3KA 1SKYE 3LXRA 4L4UA 5BQ5A 4QNMA 2H57A 1OYWA 4MRRA 4JLAA 4TTQA 4V0LA 4US2R 1CLUA 2C03A 5KDLA 1ZINA 3GLHB 3ZZ0A 1CF4A 3KQLA 2BM0A 5LD2B 2QT1A 3THOA 1E4YA 2OHFA 4KAXA 3SN6A 5TMPA 2R65A 4DDUA 1DAEA 1FNMA 4IFEA 1Z63A 1ZNXA 3QKTA 1G8YA 4B6FA 2JJ1A 3GJ5A 3FB4A 3AV0B 4D81A 5JSZA 4BZQA 2G88A 2QL6A 1DAGA 3KXKA 1DS6A 2WV9A 3TUIC 4CZ2A 3U3MA 3H1TA 2ZRKA 4OYHA 4KFRA 4DXAA 5A5GA 2EFDB 4OQXA 2FSHA 2ORIA 2P3SA 3IIJA 5DISB 4TMTA 3VR6A 1YRAA 1PLKA 4C0AC 4WBSA 1HEIA 3GFOA 1G8GA 3SYLA 3IILA 4HYYA 1VECA 2PJZA 2V9PA 3AUXA 1NKTA 4NHOA 3OIVA 5SZKB 1AM4D 5TB5A 3CH5A 3T61A 1KJWA 4RCZA 4IOMA 2EFGA 4MKHA 4URYR 5EP4A 4B3GA 3PEWA 4URUR 2RGEA 1ZMXA 1VG0B 2CL0X 4Q4HB 3WMFA 1FMJA 1M8PA 2IWHA 2VIIA 2IL1A 4UNSA 4WOPA 2IYVA 4XD7D 4ZCLA 1PLLA 4YQFA 1G4AE 2XJ4A 1SKQA 3P20A 4DT1A 4BZPA 1IONA 4FCVA 4V0MA 4A8JB 3FMFA 5GVSA 2MMGA 3THYB 2AN9A 1NVVR 2GHIA 4OK6A 2R2AA 3I32A 4HLCA 4EJSC 2V6JA 5B57C 1ZD9A 4OQNA 3K9HA 1W2GA 1D9ZA 5C46F 2ZRMA 4G01B 3T1VA 3ICEA 2MSCB 2JASA 4C0BA 1MH1A 1TL7C 4LJ4A 1J8MF 5KTYA 3W8NA 2ZRCA 1KMHA 2JIZD 3E1SA 1KO1A 2QRZA 1MV5A 1ZCAA 4LCBA 5FUXA 4JKYA 5H68A 3EPLA 2A7QA 1YZQA 1IXRC 2JDID 4Q4AB 4UJ3A 5M04A 1CP2A 3IIMA 3TSWA 4RD1A 4RFSB 4X8MA 1E2JA 3REGA 1TU3A 4G1UC 3RS0A 2EYQA 2C98A 2Z4SA 3PUYA 4P31A 3X1ZA 2FSIA 1KSFX 2VF8A 4O2RA 2GCNA 2ZI6A 1NL3A 4B2IA 2RGDA 4N1AA 4RD4A 3CM0A 2GA8A 2W6JA 1NIJA 3MUFA 2VTKA 3CF0A 2QE7D 3LAWA 3VR1A 4E07A 3OFND 1H8HA 1LVGA 4IDQA 1XEWY 221PA 2W2XA 2GZAA 2WBLC 4MITA 2FJUA 4RZ3A 4R98A 1T6NA 2GJ9A 1G18A 4JLBA 4LHYA 1G5RA 1P2VA 4EQ6B 4NP6A 2PX0A 2VSFA 1GVNB 1M1YE 1L2TA 2CJWA 4Q66C 1UPTA 2Y8EA 3TW4A 4AD8A 4RJLA 1RW4A 1SVIA 4Q1AA 4NCKA 3K9GA 3C15C 3KDSE 2JLYA 3IBYA 1Q3TA 4LJAA 1HQYE 3EZFA 5JHGB 1E96A 1VTKA 2FZ4A 4G5RA 1NLZA 3KKOA 1XEXB 2ZVQX 3RS5A 4ASUA 2DFNA 5K8UA 4TYYA 2NPIA 4X8LA 2C5LA 4DVGA 4M1TA 3NC1C 2VQSA 3EIQA 3W8RA 1XEFA 5FTJA 421PA 3AKEA 2BM1A 3IO3A 3LBIA 4HB4A 3SFZA 1UBGA 3QPWA 1GRRA 1K5DA 3LNCA 2DY1A 4GZLA 4QFMA 3UK6A 3TR0A 4PZLA 2IW3A 1E9EA 1G3RA 4LBVA 1SHKA 2ZJ8A 3MWJA 2VP0A 4NH0A 3RVBA 4BFWA 2F9MA 1YZLA 4RY2A 4BUJA 4B6EA 3NEYA 3I5YA 2W0SA 2Z43A 4NONA 1AQYA 4Q1BA 1XXHB 5BW8A 1NBMD 1EFTA 3OEHD 5KPJA 2ZJAA 3L0OA 4GMXA 2QP9X 1II8B 2IX3A 4NYJQ 3Q7PA 2F1JA 1X8JA 1HURA 2P6RA 2V3CC 1XTJA 1QHXA 5FTMA 2AD5A 1PV4A 2F6RA 3CNLA 4N3NA 4Q1EA 4WA7A 4EJSB 1W2HA 2CEAA 2D74A 3CR8A 1FP6A 1RE0A 2EFCB 2WTUA 3DEFA 1L7VC 1N0UA 2YWGA 3SJZA 5CITA 4ZV4A 4OL0A 5UKDA 2KSQA 4JJKA 5BXQC 1P4SA 3THXB 2H18A 3U60B 2WJJA 4LDJA 3KFVA 1TU4A 4MA4A 1DE0A 2D06A 1CRPA 1P9RA 4P4SB 3DL0A 3PITA 3TAHA 1Q22A 5CYOA 5BN3A 3GLFB 1XCMA 3I73A 1UBCA 3NHBA 2ZAMA 3TE6A 4Q9LA 3KQHA 3OEED 1IXSB 4HUTA 1AJEA 4M1WA 1MO4A 2GTPA 4OI2A 4ILEA 1O87A 4NKRA 1LF5A 3AB3A 5KSYA 1NMZA 1UKZA 2FV8A 2IS1A 2DR3A 4HB3A 1NY5A 4A4DA 4TL7A 2X19A 1S9HA 4CEJB 1NRJB 3TLXA 4PC3A 1N6IA 4CYMA 1VCMA 5EP2A 5GJWC 4DWJA 4WXPA 4HEJA 1F48A 1GKIA 1BYIA 5DI9A 3QXCA 4JLNA 3ZVMA 1G3IA 1OB2A 1K8RA 1VMAA 3AF1A 1OT3A 3QKUA 121PA 4JL5A 4P0TA 2B92A 4CW7A 2ZRFA 1CU1A 3U7FB 5P21A 1N6PA 2XNDA 1OH7A 1LNZA 2XXAB 2GESA 1E9DA 1RJ9B 2RH5A 2ZS8A 4FW9A 4IDPA 4LC1A 2ERYA 5FI1B 4Q9KA 1OXTA 4DSTA 1F2UA 1JPJA 2P5SA 1Z2AA 2QY9A 4C0KA 4C0SA 3PEYA 1VYUA 1XDBA 2REOA 1ZU5A 3GJXC 4GL2A 4DUGD 2ZAOA 1G1MA 1Z6XA 4GOJA 5EE9A 3U3JA 4Z1MD 4OQLA 4XJXA 2O8FB 2ZU6A 2JDIA 2ONJA 1LF0A 5J47A 3REFA 4PSAA 2QQEA 2V55B 4YONB 2GILA 1A82A 1G9XA 5LB4A 4XVUA 1W4RA 3FFAA 5F3WB 3U7GA 1KI8A 2BJWA 5KUTA 3KQNA 1OB5A 1KO8A 4F93B 5HKKD 2GXSA 4GRAA 2QENA 1KDTA 4M4SA 2OE2A 1NN0A 1B23P 2FX3A 3N2EA 3OESA 3QPUA 3OFNA 5EE0A 4ON9A 1KSHA 1XMSA 2RCNA 4KU4A 4V03A 2XZOA 1CJMA 4PQRA 1Q1ZA 821PA 3VKHA 1M34E 1M6NA 3U3RA 2RGCA 1E9FA 2REXB 3CRW1 4UJ5A 3RRMA 4YC7A 4QBIA 4C7OA 5DI3B 1NVUQ 5KYKA 2G0TA 3PUXA 4KLNA 1F6BA 2ANBA 2P67A 3PUZA 2XTNA 4HLQB 3QQ5A 1TEVA 3PJRA 3OIUA 4KVAA 5L3VA 3BK7A 3T5GA 1ZIPA 1N5JA 1COWD 4ZPXA 1NG1A 2FNAA 3KKPA 3RC8A 4P32A 5DN6D 1SVKA 4NMMA 2QA5A 4GOKA 3QJYA 1QG4A 1DBSA 1N0WA 1WA5A 2VP5A 2WJGA 4HUQA 5D3MA 1ZVQA 2ZROA 4FN5A 5HE8A 3I3SR 3K0FB 2J5XA 1XJCA 2QI9C 4DEXA 1N6KA 4E5UA 5DO9A 2A30A 4LI0A 2OILA 2OBMA 4D2IA 4OHYA 2GZDA 2HUPA 5CB8A 3IUYA 3WRXC 4DEYA 1XMIA 2ZRIA 2EFHB 2HJGA 1CRQA 5IHPA 3TSOA 5JI3E 2VF7A 4BFTA 2G0NA 3I1FA 1BH2A 3RANA 2FN4A 1R7RA 2BHRA 2PZEA 2D7DA 2VO1A 4TSFA 1GRQA 4G5OA 1E9RA 2QP4A 5F9HA 3MWYW 5DE3A 4TWZA 3CPHA 1XB2A 2AXNA 1MRSA 4OBEA 4V02A 1FQKA 2GCPA 1J99A 4I1VA 4TQUS 5JS7A 1YVDA 3GFPA 1YZNA 2IEYA 4PC2A 5KPDA 4IVQA 1FMLA 4NYMR 1G17A 1NVVQ 3QEOA 1SVSA 3JZMA 4KFUA 5DHAA 3MWLA 5EZ6B 2KE5A 3WHKA 4TYPA 2ZRAA 3SJBA 3DPUA 1GITA 4PZYA 4H1UA 4DLRA 3LFUA 3RDPA 2XGJA 1JQJC 2CCJA 2F3RA 1OIWA 1OW3B 1BIFA 2QBYA 1OKKD 1US8B 1OFIA 3AVQA 3BB3A 3OEEA 2CK3D 1G19A 4D82A 1HH4A 4MH0R 3D6TB 3VR2A 2FH5B 1CR4A 4QGAA 1U98A 4DLVA 4Q7MB 2O8CB 3W5JA 1EFCA 1I4TD 1XCGB 3EAQA 4XWAA 4HZIA 3TKLA 3O8RA 4NDZA 4TT3A 5J5CA 2GCOB 2IA5A 2I3BA 2ZITA 4WZBE 4DSNA 1W46A 3PUWA 4ZDIA 4BASA 1W0JD 2J0QA 3SU8A 4DDWA 4UNQA 2MMCA 1E79D 2OBNA 1G7TA 1D2MA 3THWA 4A92A 3TVTA 2J0UB 2OT3B 1OXUA 2CBZA 1DEKA 3L8YA 3GJ7A 3SJCA 5JJLA 4B3FX 3O8DA 3CX7A 5JLJA 3MLEA 1JPNA 3V00A 1QHHA 2CVFA 4LJ5A 1LFDB 4Q4JA 1DPFA 4EAQA 3NH6A 1OPXA 2JCSA 1WE2A 3KB2A 2PEYA 3IPYA 4MYCA 4F92B 2ZSDA 3A6PC 4TN1A 2BC9A 1DG1G 2ZE8A 5AJXA 3X2SA 4BRUA 4OQMA 3HYTA 4TQ9A 4Z1MA 2C04A 3BWDD 3K9NA 2HCJB 4JBWA 3NG1A 1KKMA 4IXMA 4A0GA 2PT5A 3X1XA 4PC1A 5GJCA 3EWAA 1JR6A 2J9RA 2EU8A 5HKKA 3F8TA 4OK3A 1U81A 1Z47A 1ZUNB 1BOFA 4C2TA 4PHTA 3QY0A 4MYHA 1YZGA 3HR8A 1Z22A 4BLRA 2IYLD 2Z5FA 2ZQ5A 2VHCA 5FOSA 4OI4A 1E6CA 1CTQA 3HU1A 2ERXA 4E22A 4W5HA 2IYTA 2ZANA 1U2RA 4B44A 2R6DA 3K1JA 1E3MA 2G9NA 2FFBA 4PSKA 1QF9A 2AL7A 2J7KA 4A82A 3HU3A 5DLQC 1RFLA 2QGZA 2K5UA 1Q57A 3O8CA 2GBLA 2NMVA 2WWIA 4DCSA 3AP1A 2OV2A 3ZVRA 3ZZTA 2XNSA 1JAHA 3KXIA 1W48A 2ECKA 2OAQ1 4ZCMA 1ELOA 1UBFA 4V0ME 1KI1A 3NBXX 2NIPA 4PQYA 2HF8A 1GNPA 1KI4A 1QVAA 1KO7A 3GQBA 3QF4A 3WRYC 1T4GA 4NBSA 5JECA 3QKSA 2WKRA 1GL7A 1T8UA 5C1BA 1EGAA 1MABA 2JLWA 3QIAA 5A0FA 5F2EA 4M1SA 3NBZC 4JVMA 3LW8A 4ZI2A 1TUIA 2C9CA 3B1VA 3SYNA 1W5SA 4I99A 2CL7X 4RD2A 3LX8A 3AVOA 4IDHA 2XSZD 1XTSA 2ZRLA 2X8AA 4M53A 1TADA 4PANA 3TNFA 1G21E 4C0LA 1LS1A 2QMOA 3HWSA 4PPNA 1W36C 1IQPA 1N0VC 1A4RA 1Q21A 3NWJA 4DLTA 3KTAA 2AK3A 3SBEA 4GDFA 1G7SA 1ZRHA 4IFBA 4Q47A 3MD0A 3U44A 5LDDC 4GBMA 2WIAA 3CF6R 2B7CA 2D3WA 2A78A 3WP0A 4D25A 1X3SA 4IW3B 2BMJA 3B78A 2H5EA 1T8TA 5JRJA 1YKSA 3AF4A 1QHNA 3K8YA 1IAQA 3FKQA 1T3LA 2AHOA 1Z0DA 2J7PA 4IDOA 4DBLC 5CB6A 4MRSA 4DLXA 4JKIA 3A36A 2IYWA 1IXZA 5H8WA 2YVUA 2I1QA 1ONBA 2YOFA 1GG2A 2VA8A 4FIDA 5FPSA 3R9WA 1AN0A 4M0LA 3R9XA 4B32A 3T15A 1XXHE 1YR7A 3ZJYA 1Z0JA 4A0HA 5F98A 1MO3A 5EE5B 3U7HB 4HAYA 4C3ZA 3IQXA 4HI0E 1E2GA 2A5JA 4DSUA 5AJZA 1BMFD 1ZM9A 2IUUA 3DMDA 4LJ9A 2DB3A 3QG1A 4YMSA 5L3RA 1EWQA 4KV9A 4PHFA 1HE1C 3EARA 4TMVA 4RVCA 3I62A 4FD2A 5HZHA 2RGAA 3CW2A 4I1UA 1KZGB 4M9QA 2HLDD 2O0HA 4PC6A 4URXR 1SQ5A 4C0JA 2AKYA 2ZS7A 2TMKA 1XD2A 4BEBA 5JWOA 1VG1A 1W0JA 2YZ2A 3ECCA 3KJIA 3S1AB 1E9SA 3I92A 4OI0A 3GJ8A 1YJ5A 1TQ2A 1IN4A 2RGXA 1PLJA 1W5TA 3GLFE 1WRBA 4Q02A 1U94A 1OFTA 4LPKA 4RD3A 3VU9B 2YYZA 2HYIC 2EW1A 1GFIA 1W44A 2C9OA 1R8QA 3W90A 2G1JA 5DH9A 4Q7JB 4Y0VA 2ZRNA 2XAUA 2QPOA 4LRWA 3A4MA 4BFVA 4C0HA 3BFVA 1J70A 2OG2A 4FWTA 4Q9JA 3QXSA 3CO5A 3MRSA 4L8GA 2IXEA 1XTIA 4OHXA 5HTKA 2H16A 5FR2A 3SYKA 1XF9A 1ZNZA 1W4BA 1NMXA 2LKCA 5AUQA 4LPSA 3VR3A 2PEZA 2VYFA 2OBLA 2WSSD 4KBGA 4RKEA 5E7MA 2O8BA 3MMPA 2CXXA 1XNJA 4NCHA 1W4AA 4ZO4A 2RGNA 5EXSA 5DYIA 1A7JA 3GLHA 4TMWA 2CHVA 4G5QA 2Q3FA 1E69A 3SQWA 1KNQA 3W6NA 4Q1DA 1Z06A 3OHMA 3P32A 2ZM5A 1KO5A 1W36B 2CCGA 4MYUA 4I1OA 1DELA 1Z2CA 3CNNA 1KJYA 3AGQA 2ZRBA 1P60A 4S2EA 4WAUA 4KSBA 1E9AA 3JVUA 4Q1FA 2WWXA 4B47A 1LB1B 2BVNA 1PZNA 4KBFA 3VAAA 3L8ZA 1IOZA 4HDQB 4XSGA 4TYQA 4YXWD 2ZJYA 3A1SA 2OAP1 1ZNWA 2O0JA 1Z6AA 1U90A 2YC2C 4BQSA 1BO6A 1N25A 4Z54A 4JJZA 3AH8A 1ZC4A 4P3YA 4YMTA 1DAMA 4H1VA 1B0UA 5LB2A 4BLOA 4BLTA 4XWKA 2ZR7A 1X1RA 2QM7A 3QPVA 2ZJBA 4HZUA 4KYUA 3GPLA 3GLIA 4NYMQ 1NY6A 2GVZC 1ZBDA 1U8YA 5CM9C 1OLOA 4EPTA 2VP4A 1O3YA 4AC9A 4S35A 5TV2A 2R62A 2RMKA 5J4KA 4ZDKA 5EP1A 3VKGA 1KK3A 2AX4A 2WM9B 5JCZA 2KWIA 4OJKA 5FFMA 2BOVA 3TMKA 4M21A 2ODEA 3WBJA 2BWJA 1ZIOA 1E1QD 1E99A 1C9KA 2WMOB 2HEIA 4LY6A 4M22A 1UAAA 1VIYA 2OEPA 4HAZA 2WPDA 3GMTA 4DDVA 3ADCA 4B3DA 4UKDA 5EZ5A 3SE0A 4DB4A 4PSVA 3LRPA 3MGCA 1YHNA 1IJFA 3BS4A 3LXXA 1DAIA 2WIBA 4Q4AA 1ZC3A 3I8SA 3K0CC 2R44A 4D6PA 4DJTA 3UXMA 3RRYA 4RFSA 2F55A 3CB4A 2OCAA 3TW8B 4C30A 3FDIA 1JXOA 2V1XA 2OFXA 4BFSA 2RGGA 4BE7B 5KDDA 3K0AB 2ZEJA 4LV8B 1TTTA 2ZE7A 1N6RA 5IF9A 1VCIA 2WWHA 4OJQA 3B1WA 4ACBA 2WAXA 2PLRA 3GJ4A 4DT1B 3Q9LA 2GXUA 4Y0AA 4BFXA 5C18A 4PFSA 2IF2A 3F5FA 4NU0A 5EJEA 2WSMA 1OE0A 4PHGA 2Q9BA 3BC1A 2AK2A 1JBKA 2WOJA 1FX0B 4K81B 1P9WA 2VL7A 2ZS9A 1JAIA 1G8PA 1P2TA 3L0SA 1OHHD 4FMDF 1VYTA 4A2PA 4EQ6A 1U99A 2O5VA 4R71A 3VNVA 4EDHA 4HAWA 4W5JA 2IWRA 4CIDA 2AKAB 1BMFA 4YDHB 1KAOA 2O8EB 4NYIQ 3VR5A 4LJ7A 3RSLA 3GP8A 1KMHB 2ZYWX 3ZD6A 1SXJE 3PVSA 3KQKA 3IDQA 4DRZA 3RABA 4GT1A 1XU4A 3DZ8A 4MGYR 1KHTA 1GM5A 4FMDB 1GTVA 4HAUA 2ODBA 1XZQA 1Z28A 4HSEA 1XEXA 4C2UA 5KDOA 2GJSA 3TR5A 2WJIA 1WMSA 3CZPA 3U6KA 1G64A 3EG5A 3WNDA 2A2ZA 2V7QA 3PQCA 4UNPA 2FSFA 1CR0A 4MGKR 1IN7A 1JXMA 1ZM7A 1VKJA 3B5JA 1F2TB 4RZ2A 1U8ZA 1QBKC 3V9PA 1G8FA 4CVNA 1TMKA 2KBFA 5BWMA 2YHSA 5HCIA 1JR3A 1KTVA 2NTYC 4DZZA 4JS0A 4WVFA 3E70C 2V1UA 3HYRA 5IDVA 2PMDA 3GD7A 2UVQA 4X8HA 2C95A 3PG5A 4JVSB 2FFAA 1Y3AA 2ZI4A 2IXGA 2ZYUX 3OE7A 4XVRA 3NDBB 5B58C 1GWNA 2Z4RA 1Z3IX 4KVGA 5AUNB 1SVWA 1V43A 2L0XA 1JQLB 1XPOA 5FPHA 1FZQA 1CJVC 4HDCA 1L4YA 2YWFA 1L8QA 3E5HA 3IKJA 4O3MA 2VLIA 3Q8XB 4PZZA 4IRUB 3VHLB 4IEEA 3B7GA 1Z07A 5E7JA 2G83A 2CDNA 3K09C 4MDFA 1NJGA 2CHGA 1VDZA 3HDTA 1VYVA 4A0RA 1DADA 3BH6A 3THXA 3ZDQA 2W00A 2OSBA 3QKRA 1P7CA 4LUCA 4QL3A 4D0NA 3N5CA 1E1RD 4B73A 2IT1A 1UM8A 1NLYA 1Z6YA 4LV5B 2IHBA 2FPLA 1D2NA 3HJNA 4LX0A 4YXWA 4EPWA 5HPYB 1ZM2A 1GUAA 4QC2A 2P6UA 3L82B 2J87A 2EWWA 3EPJA 2H1LA 1ZD1A 4B33A 1FTNA 3DOFA 1JALA 2OESA 4MDEA 3N2IA 2XZLA 4B3CA 2X2FA 5FL7D 4LWZA 1AKYA 2Z0MA 4M1OA 2BBWA 5ELXA 3LV8A 4JLJA 3UG6A 1XPRA 1RPZA 2YKGA 1OH8A 1RYFA 4R7ZA 3SQXA 4QGHA 4U02A 1Z8FA 3TSZA 3TIFA 1NVWQ 3P4YA 1LV7A 4RZXA 5CYPA 3BB1A 1PUJA 4RFVA 3CPJB 2C99A 1H65A 1R8SA 3N70A 4LHZA 4MKIA 5CM8B 1HTWA 4XD7A 4F91B 1E1QA 4GI7A 2IC5A 1FP7A 3X1DA 2FGKA 3GLGE 2GETA 1RC8A 3CIOA 2XXAA 2W2TA 1CJKC 1RJ9A 1MO5A 1VCOA 1A5TA 2QMHA 3IBGA 4QXAA 4PAOA 3QOFA 4KSCA 3G0HA 1RRCA 3KB1A 1SXJC 1TQDA 2HJVA 3LQQA 4Q19A 1DG3A 2ZRDA 2VSXA 4QOSA 2B8TA 1G3MA 2W6ID 4IVRA 3PXGA 2O8FA 2UZ3A 2GK7A 1I2DA 4QKQA 4FCTA 1P75A 1R6BX 1ANKA 2QPAA 4A1FA 1G4UR 1CULC 2JIZA 3KXLA 1T0HB 4M9ZA 4XWOA 1ESNA 3G82C 1EFHA 4KITB 2WVJA 721PA 4LYAA 2PH1A 1JEDA 4V0KA 4PHHA 3GJ3A 3QF7A 4QHTA 1II9A 2JLSA 5LPNA 5G3ZA 2QP3A 3Q3JB 4CGZA 1E32A 2IUTA 5C4MA 1XFAA 4CEIB 3UPUA 2AFHE 4FMBB 1ZW6A 2YNMA 5HR5A 3LQRA 3SNHA 2O8DB 1OHHA 1KMQA 2QE7A 3QXXA 2VH5R 2QEQA 3FHCB 3RC3A 2P2LA 1XWIA 2ZRPA 2WJYA 521PA 3LBHA 1LS6A 1W1WA 2F9LA 3NTUA 3IIKA 1WBDA 1OV4A 2XB4A 2IYZA 5DI3A 4PO9A 3UKDA 3I5XA 2LKDA 3T34A 2ODWA 4O0MA 2F1HA 4Q4LA 3EA5A 4JLPA 4X8OA 3IGFA 4ABYA 4YMVA 5B64A 2DCUA 2FPMA 2O52A 4TTRA 4TMZA 2GJ8A 3B9PA 3V4RA 1AS2A 3AEZA 5FOTA 1IJEA 5F9FA 3CH4B 1KK1A 3NVAA 3D3QA 3QBTA 2FE4A 5CJPA 1XTRA 1Q3HA 4UXJA 3A8TA 3OAAD 3VX4A 4UNRA 3K0FA 4TYWA 2GAAA 2LWIA 4C0QC 1M74A 2IS6A 1P9NA 3PIRA 1NF3A 2ZUBA 3SOPA 3EX7C 4KFTA 1XX6A 1GRNA 4LC0A 1Z0KA 4L9SA 4LOAA 4IKEA 1VIAA 3QXHA 5EE3A 4A2WA 5D3QA 4AKGA 2J45A 1OYYA 4LSGA 3DVLA 5FI0B 2C2HA 2FOLA 2G3YA 2ZU0C 4JYBA 5JWRA 5L8VA 2BBOA 4O2LA 3B8HA 1Q1QA 2VP6A 3UATA 5FBRB 2JEOA 1DOAA 5JCPA 4PX9A 2ZETA 2IYSA 1NBMA 3OEHA 3R7WB 1Z0AA 1GAJA 3I61A 4PO1A 4LHVA 1CEEA 3LH5A 4XTRA 5EXPA 2VHJA 4PQFA 2WWGA 2ZI3A 2OFOA 2B7BA 3EC2A 4I81A 5IRCD 4HUQB 2YOHA 3C5CA 3QNUA 1SXJB 5KNDA 1ESMA 2R6GA 2E1RA 2JA1A 4XTCS 4P33A 3ONWA 4LBYA 3LA6A 4GFDA 3ZS8A 3FMIA 2ZVPX 4OKSA 2D2EA 2N46A 5FOVA 4MYTA 1IBRA 2ZYVX 2AFIE 2QAGA 1US8A 1DAHA 3RWMB 4Z51A 3KKMA 1KDOA 1KGDA 2IYQA 1T5LA 3K53A 4Q1CA 3VX3A 3BB4A 1AA9A 2J46A 4G3XA 3D31A 4AWXA 2EYUA 4ACAA 3D7MA 3CUEF 3PFIA 1GL9B 1DTSA 4LBWA 3RLFA 4DIDA 5FBQB 5FL7A 2OXRA 1K5GA 2D4HA 1UFQA 1WB9A 3GJ6A 3X1WA 2EQBA 2A5YB 2GNOA 2N1BA 2X77A 1P72A 2GCOA 1ODFA 3WYAA 3SEAA 2AWNA 4I4LA 3ZZUA 5CDFE 1KOFA 1Z6GA 5AUPB 3IEVA 4CDGA 2AXPA 1S2MA 4B34A 3O8BA 2PT7A 5KNBA 5J4YA 2SHKA 3L0PA 2BBSA 3B2EA 5K8IA 4Q7KA 2I4IA 2FG5A 2H7VA 3FHTA 1R2QA 4BLPA 1AK2A 4E03A 1FL9A 1II0A 5JRZA 1GL6A 4HLUA 3B1ZA 1QHIA 4PO8A 2OCBA 3RHFA 1OXXK 2BIFA 2NZJA 2BEJA 3U2QA 1I2MA 3BFKA 3EW9A 2W6IA 2QTFA 3HR7A 3NBFA 5B30A 2PCJA 4B76A 1NP6A 1KI3A 4GP6A 5L3QA 1E2IA 2W0MA 4TL8A 4HLDA 4MKGA 4DUGA 4B74A 2VBCA 1KI9A 5CIWA 2KB0A 1U0JA 2QUZA 2W2VA 2WWYA 2OUKA 2ZREA 2NGRA 2PLFA 2WJHA 4WZAE 4WW0A 4ZIRA 1NNEA 4NYIR 1VHLA 1ZUHA 2KI5A 2R9VA 3EIHA 5CIQA 4CEHA 1OSNA 3RS3A 3DZDA 4IVPA 1ETUA 4PAMA 5H70A 1W36D 4BFYA 2R6CA 5EQTA 3QXJA 4JLDA 3THWB 1E2QA 4ARZA 1N2CE 1XJQA 4B48A 4D4MA 2PL3A 2VSOA 3ZLJA 3B1YA 4PXAA 2A3RA 1QHSA 4WZ6A 2E87A 1M7GA 1QHHB 1BKDR 1X86B 3BFXA 4Q4JB 5FBLB 1UDWA 1G3UA 5JFGA 3TGPA 3QG5A 3CZQA 3ZIAD 4B3BA 4W9MC 1E2FA 1OIVA 4KHZA 4Q03A 2NO6A 5FUWA 1XD8A 1N6NA 3H84A 1EX6A 3A4LA 3CX8A 1IN6A 2BMEA 2GXQA 1HYQA 5BN5A 4YMWA 1ZP6A 2R8RA 1SHZA 1QDEA 2Q21A 2XEXA 3GLGB 4AYWA 3M6AA 1YU9A 1DVRA 1KYIA 3R8CA 3H0KA 4QHSA 1TQ6A 4A15A 5JJKA 4HB2A 3BORA 2QT0A 2Q0HA 4JLKA 2DWQA 3W34A 4U5XA 1VPLA 1JECA 3KJHA 5L3SB 3P1JA 1COWA 4URWR 3U4QB 4G5SA 2ZJZA 1BYUA 4QNRA 1XJ0A 2JJ1D 5DN6A 3ZH9B 1D6JA 1LTQA 4D80A 3SS8A 3M1IA 5EUQB 1MOZA 4EPRA 1H8ED 1G291 3NHAA 4A9AA 3BIFA 5HCNA 5EE1A 1U9IA 4QJ4A 4FMCF 1MRNA 5CLQA 4ZKDA 5KO2A 1J7KA 2ZSEA 3WXMA 3B85A 3EXAA 4ESVA 3QENA 2QAJA 1G8HA 4GSYA 4RD0A 2Q3HA 1KJZA 3AVPA 1T9HA 1UF9A 3A1VA 3LBNA 1T5IA 3SR0A 3WBKA 3C5HA 3IHLA 4BGDA 2ZE5A 1AS0A 4V0NA 1IM2A 3LO5A 1ZM4A 1E0AA 1OF1A 3T1OA 4FMCB 1TF7A 2IF0A 4NE2A 3SC3A 1Z29A 1HV8A 4N0DA 5J40A 4PPFA 3BH7A 4DB2A 5EXXA 1JJ7A 2ZJ5A 3T35A 4DCUA 2GXAA 3BBPA 1DAKA 4FXPA 4FWIB 3FPAA 3K0SA 2F1RA 4C4PA 3MAAC 5SZJA 2FA9A 3U3OA 3TVDA 3AVYA 1UKEA 4Z8XA 3J81k 3AGPA 3KTAB 5IT5A 2CVHA 4URVR 1NN1A 4KYIB 2IYUA 3BE4A 5AUOB 1MT0A 4KLZA 1AZSC 1OKKA 3T06B 4AI6A 1SVOA 4RSGA 4KJZA 2BV3A 2GAOA 1WBBA 1VG8A 1TPZA 3HPRA 2CK3A 4TLCA 2OO7A 4RD6A 2IYRA 1JB1A 5TVKA 3EZ2A 2H92A 3A1TA 4M9SA 2OM2A 2ZPTX 2W83A 1JR3E 3A4NA 4Q9HA 5DSZA 1KY3A 3W3AA 1CR2A 2GKSA 1X8LA 3HU2A 1UBEA 1AS3A 2W6JD 1XTQA 1WF3A 1R0ZA 2ZUDA 1H8HD 1E94E 5C4GB 2ZRJA 2HT6A 1Z6TA 3TK1A 4B2LA 1HQCA 2GF9A 4B71A 3EPHA 2ZSFA 1P5ZB 1E79A 3VU9A 4A36A 2IBMA 3QEJA 4C9BA 4JVLA 3FFBA 1M7HA 4XH9B 4TMKA 3AF3A 2CE7A 1PJRA 2WWWA 3VQTA 2PX3A 2ZI7A 4GP7A 5K8TA 1XMJA 4URZR 3K0EA 5KOYA 2V6IA 1TQ4A 1NMYA 3K70C 2F43A 3LDAA 2IS2A 1Q20A 2N42A 2IUSA 5GVRA 2ANCA 2OCPA 3FE2A 1NN3A 4A2QA 4ASUD 5B2ZA 3B6EA 1G7RA 4CT4B 1EXMA 1XD2B 1X6VA 5FH9A 5FL3A 2QQ0A 1RKBA 2P65A 4GNKA 3LX5A 5LBIA 4IDNA 2D62A 1QHYA 2E9SA 3PEUA 1XRJA 3T5DA 1S1CA 3NDPA 2HV8A 3WMEA 3KUCA 3SHFA 1G16A 4U00A 3ND8A 3Q7QA 2BMDA 2GRJA 4FCWA 1G5TA 2XITA 3FYHA 1MO6A 1UDXA 2NO7A 1EWRA 2F1IA 4IHQA 1CBUA 3MJRA 3DMNA 3ZIAA 2Q9AA 3DKVA 3BOSA 4TTPA 3UMSA 1TF2A 3TQCA 1Y63A 2KJQA 1GKUB 2NZ8A 4BWYA 4MRPA 5FBVB 5GADl 2V54A 1W49A 4AY2A 2O8BB 3W6PA 4UNNA 3AKYA 3W9YA 1D2EA 1P61B 4QJ5A 2G77B 3DHWC 5JZVA 3MSXA 1UKVY 4DSOA 3PUVA 1KI6B 4PAQA 4MRVA 2FZLA 1YR9A 2HYDA 2QU8A 3Q72A 1EFUA 3NIBA 3QVUA 2UZIR 4J0QA 2ZRGA 1GKYA 2DBYA 4LBZA 4NCNA 1NVXQ 1KNXA 3RYTC 2NOAA 1NN5A 1TX4B 1WXQA 4Q4HA 2HXYA 1Z08A 2V4ZA 2Z6VA 1U8AA 2WHXA 4KXFB 3KKQA 2ATXA 1E2NA 4EFNA 1S1MA 3P27A 1FPMA 4M8NE 4A8JA 4K46A 1XZPA 4AYXA 3THYA 2JLVA 2BEKA 1XP8A 1H8EA 2XSZA 5JSZB 3IPXA 3Q85A 3M4YA 1Q44A 1HT2E 1KY2A 3WHLA 2DFKB 3C8UA 1T91A 5J4VA 3CNOA 3SHWA 1G5PA 2MSEB 3B13B 621PA 4YMUA 2RHMA 1E4VA 4LHXA 4JT2A 4RCYA 4ERNA 1Z0IA 2IEZA 2GEDA 3DM5A 3ZD7A 2RGBA 3ZVNA 3KZ1E 4HZUB 3GLIB 1GDDA 4H9GA 1W0KD 4QRHA 4OHWA 1T3SA 1ZM3A 1P62B 2F7SA 3BAFA 4K8OA 5HZKA 1CKEA 3K0AA 4PPGA 2QN6A 1ZU4A 2C8VA 2DPXA 5E4FA 2ZSBA 4BFUA 5KHOC 1Q0UA 1XCPA 3AVVA 5FTKA 3GEHA 3ZYCA 2ORWA 2QROA 2XNDD 2QRNA 2D7CA 1FX0A 5KSOA 3K70B 1WCV1 3U6BA 2NG1A 4TZ0A 4ZDWA 4JT4A 1OXVA 1T3HA 1GILA 3KJGA 3FKSD 3QE0A 1NG9A 2ATVA 1UEIA 4TQAA 2O8EA 3WMGA 1G3QA 1S3GA 4JL8A 1CJTC 3FTQA 4TZ6A 3QBVA 1HT1E 1ZNYA 5DNYB 4NPHA 2AD1A 4Q18A 1RVDA 4NL4H 5DIFA 3A1WA 4A6XA 5BYKA 4L5BA 1W7AA 5KSZA 5GJBA 1DAFA 5JI2E 4EIWA 1FOEB 3ND9A 4FI3C 2J1LA 4O25A 2HLDA 3TBKA 1RRFA 2YC4C 3HPQA 2ZIAA 4MKFA 1X1SA 4F4JA 3TUJC 2QSYA 3R9IA 3NXSA 2ZYTX 3BH0A 2QSZA 1F2TA 3IHWA 3NKVA 1RRPA 4CRWB 1YQTA 1OFHA 2OZEA 3E2IA 6Q21A 1NBME 3MWKA 4QBHA 3W3ZB 2GK6A 5FPYA 4BPBA 2GJKA 2FPKA 5AJWA 2VHQA 1YR6A 1KZ7B 2EVWX 1S4QA 1F5NA 4QBFA 3T1QA 1N3BA 1OH6A 2RAPA 2GF0A 2MSDB 4OI1A 3NBYC 4WXRA 3NC0C 3AVTA 5DGXA 2W58A 1CIPA 2QGNA 2ZE6A 3VHXA 4LGMA 2CJWB 1KO4A 5K8LA 4DCVA 3C16C 4XSHA 1XXHA 3EA0A 5JEDA 2OFWA 1D5CA 1II8A 4JBXA 2ZR0A 4D4LA 5J4LA 3AVWA 1IY0A 5KNCA 2FMXA 2WSSA 1W4CA 4QGFA 1A2BA 2AR7A 2C78A 1QZXA 2CCKA 3JVVA 1KAGA 4D26A 4Q48A 5CJ2A 1GIAA 2GVDC 3A37A 5FUVA 2IS4A 3FMOB 2DYKA 4DLZA 4EJSA 1SXJD 4I1SA 1I4LD 1WDTA 2JLXA 5G40A 2GEUA 5CLLA 1E0KA 4LHWA 3PENA 2FSGA 1RZ3A 2X1VA 2GJAA 2XX3A 3K0CA 4IOJA 4MUAA 1WP9A 1NKSA 1P6XA 2GWHA 2ZJOA 3IEUA 2NO0A 4YDSA 2ONKA 3BRWD 3FOZA 2WKPA 1Q1BA 3LVRE 4P4SA 5CK4A 5AWFC 1VHTA 1M2OB 4TSFD 5JWHA 2IYYA 4DDTA 3GLFA 2YINC 3UG7A 2CLSA 1A2KC 1EK0A 2ZTSA 3B60A 4JSYA 4HAXA 4EPXA 3MJHA 3GEIA 3Q5EA 4EKDA 2FGJA 1EG7A 3TQFA 4CF7A 5JS8A 1QHGA 2FEOA 2PZGA 2WMNB 3MG9A 3MFYA 5JHHB 3QSYA 3ZQ6A 3FMPB 1S96A 4JVNA 2PJRA 2BDTA 3C41J 4JLMA 5SZHB 5TXGA 3U7EB 3I72A 1JEEA 2VHTA 4XOIA 5FOXA 4CEJA 3RSOA 4G5GA 4ITRC 2VEDA 2YWEA 3QKRB 4YLGA 1XBTA 4LJ8A 1AIPA 3FHOA 4JBYA 4JSTA 1NLFA 3GJ0A 3L0IB 2HCBA 2ODNA 4QBGB 3H4MA 4PC7A 1XTKA 2NQ2C 1ZD8A 1G7CA 3PR1A 4AYTA 1YRBA 3C14C 2WJVA 1TUEA 3EZ7A 4F38A 3EIEA 4TLBA 1R10A 3GFTA 4QGGA 1UJ2A 5TDHA 3LLUA 1IY2A 2CLCX 2HT1A 2J41A 2ZUCA 3RS7A 5BN4A 4IEIA 1W0KA 3B82A 2BKEA 4OK5A 1A1VA 2A5GA 4TT3D 1NJFA 2Q9CA 1EESA 3ZVLA 2FFQA 1E2LA 3IO5A 4PTLA 1GSIA 2R6FA 4JLVA 3I4LA 5FUYA 3AF2A 3U5ZB 4AK9A 2OXCA 3V4FA 3A1UA 4LYFA 1SKYB 3TRFA 2BKUA 2LCFA 1CXZA 1T0JB 5FPKA 4CEIA 1KSJA 1DO0A 3PV0A 2O8DA 3CONA 1P2UA 1PUIA 2H17A 3G5UA 1SULA 5EUMA 2PCLA 3FKSA 4KFSA 1KIMA 1E0SA 2O0KA 4QM7A 2ASEA 2QPTA 3CWZA 3PCRB 1OH5A 3FVQA 3K09A 2QTHA 4V0OA 4EFLA 4EPVA 3B1XA 1F2UB 1XD9A 3OF5A 2DFLA 4JMPA 4GZMA 4AG5A 2QAGC 5AJVB 3CPEA 1E98A 4OHVA 2FFHA 1YR8A 1R0YA 3SDZA 1IHUA 4HAVA 4JLOA 4TMXA 1KK0A 2H8KA 1HY3A 3EWSA 1GNRA 3JZAA 3LLMA 4A0FA 2NPFA 5C2JB 1NSTA 3I8XA 2XOKD 3CRVA 4GMDA 5GJVC 4F7WA 1TF5A 3ZQJA 1NI3A 5AJYA 1FQJA 1Z83A 4LJYA 3U61B 4W5WA 2CE2X 3ASZA 2JLRA 5EXTA 2Q6TA 2REBA 4US1R 4Q5IA 4B43A 3CX6A 1E0JA 2NO9A 4NZYA 3CR7A 4RKFA 2ZI5A 3W5IA 3RS4A 1XMVA 4RZUA 4PPQA 1X8KA 4D0GA 1TNDA 3LVQE 1KSGA 1PVOA 1J2JA 2R6AA 2B6HA 2Z83A 4F4CA 4EPYA 2QNRA 1YZUA 2PZFA 1KKLA 4C7OB 1S8FA 2ZRHA 3R7WA 3ASYA 4HLUC 4HATA 8OHMA 1N5KA 5H1YA 3Q5DA 1TEXA 3GCGA 1CS4C 1TAGA 2CHQA 2QG6A 1V5WA 3AM1A 2HXSA 4Q00A 1SXJA 3TH5A 5G41A 4QM6A 4AURA 2DWOA 2XJ9A 1E2DA 2XTZA 1F3OA 3CLVA 2FU5C 2Q3MA 1R0WA 2VRWA 4ZCIA 1QVRA 3O47A 2PBRA 4HDOB 1C4OA 1XEWX 5D3MB 3KQUA 1DARA 3KUDA 1IN5A 4M9XA 4XVQA 2EFEB 5FR1A 1AQUA 5JBQA 1E2EA 3ADKA 5FTNA 4IJMA 3F3YA 5IK2D 2JAQA 1E2HA 2B8WA 1R5OA 2J59A 1E1RA 1KK2A 2P5TB 3AUYA 1QRAA 1UKYA 3PEVA 2CLDX 4ZDJA 1G6HA 3BERA 5DHFA 2VPPA 2UKDA 3ICQB 2X2EA 4BFZA 5BYJA 2QM8A 4G0NA 1NIPA 4DLWA 1M7BA 2I1VB 4TLDA 5KU1A 3RNLA 1GZSA 3WP1B 1F60A 1Q12A 3EASA 2VP9A 3CBQA 4R9UC 3C4JA 1DO2A 2J7PD 2O8CA 3LD9A 4TYNA 4Z8YA 3LY5A 2D2FA 4EFMA 4AIIA 1NSFA 1U0LA 5E95A 2HF9A 4WIAA 3QVVA 2GBLC 4OQFA 5TY0A 3UWOA 4N0EA 2JATA 3L43A 4DLUA 4JL6A 4US0R 4ZKEA 3SJAA 4KI0A 2XTMA 3AQ4A 3DOEA 2JLQA 4IOKA 5FOUA 1D8TA 5CK5A 3AKCA 4R2HA 3X1YA 2J0UA 1VG9B 1ZUIA 2RHDA 3AVXA 1G41A 2QMEA 1N6HA 2XB2A 2QAGB 3KJEA 3CWQA 3SBDA 4BRWA 2IYXA 2WKQA 4DCNA 2VP2A 4DCTA 1E2PA 1SVMA 3GLHE 4D4JA 3WNBA 4LYJA 4UQOA 1R5NA 2QBYB 4Q21A 1AKEA 1ZAKA 1J90A 3AF0A 4E09A 1IN8A 5TARA 1S9DA 3KKNA 4JYCA 1R4AA 3T12A 3UIEA 4M1MA 3QUSA 1AGPA 1L4UA 2V8OA 2CL6X 3CRQA 1I4DD 3H86A 2B21A 1U9IC 3SI7A 3A58B 4UXHA 2AWOA 3K9LA 2GEVA 1R5BA 3LWNA 1IY1A 4JZKA 2QORA 3C7KA 2GDJA 1RIFA 1FNNA 3L2OB 1FW6A 2DFTA 4AKIA 1SVLA 2CNWD 4QHYA 2JLZA 1EFRD 3RWOA 1E9CA 2J0VA 3VKWA 2WOOA 5J4HA 4LJ6A 3D8BA 3WY9A 1KDPA 1OIXA 3GLIE 3CRRA 5HE9A 3RAPR 4M1KA 1AGRA 3BGWA 2JJ2D 3WNCA 1OXSC 4R2IA 3AVUA 1EX7A 2BJVA 3GLGA 4B35A 4UXIA 5L3QB 1SGWA 2A5DA 2JGNA 1GP2A 4L16A 1MKYA 3VR4A 3RS2A 4BLSA 2DWPA 2P6NA 3OIYA 3P26A 4Q7LA 1W47A 4BECA 4QG7A 4ZIRB 1SZPA 4U7DA 4FINA 4OHZA 4CEHB 2PMKA 4A6PA 1VCNA 5L3SA 2XOKA 3U4QA 5DYGA 3ADBA 3KFXA 3UANA 4ARZB 1P73A 1ZCBA 4BLQA 4MUBA 1JJVA 3VFDA 4HB0A 3FGNA 2VHUA 3GEEA 3OAAA 5FBWB 4NCJA 3EZ6A 4LK2A 1GOTA 2RKOA 4GOXA 5E3HA 5G53C 3AP2A 3CF2A 1AZTA 3TUZC 2G6BA 4CT5A 2WICA 3KL4A 3P4XA 3QI2A 1Q1EA 1UADA 1E2MA 1FFHA 1UEJA 1LY1A 4POAA 4NCIA 3UMRA 4MGIR 4KO8A 5SZIA 2CMKA 2GZHA 1AA3A 1Z5ZA 2FEMA 3BD9A 2NO1A 2YJTD
chains in the Genus database with same CATH superfamily
1S02A 3R6LA 4CMCA 1JF8A 1JIKA 3QLUC 3UK0A 3DDCA 3D2CA 3WFJA 4R8VA 3WLRA 3DKPA 3ILYA 4FFOA 4UARA 1CNFA 2W6OA 1MABB 1JDZA 3LDFA 2LD4A 4YP7A 3FOWA 1LSUA 1IYZA 3QKWA 1N6OA 1A8IA 1Z0FA 1M1XB 5F5LA 3ZBPA 2HDNB 2WPDD 4LF8B 3PEEA 3SFVA 4EUKA 3AKDA 2A0FA 2FYTA 2ZR9A 2A4KA 1S0UA 4AKHA 2W93A 1K88A 5FWAA 1XPUA 1VL0A 3PNBA 5ANRB 2PUJA 2F3TA 4K03A 1MVNA 1TFRA 3RWBA 3AR6A 1D03A 1FUIA 2XIQA 4ID9A 4R1SA 4YA6A 4A27A 3PQ8A 2IDMA 3PD1A 4AKEA 4AZWA 4W7SA 3C8DA 1RWPA 2JIDA 3PPXA 3GLUA 3U44B 2I65A 2O4UX 1WQ1R 1L4LA 1TM2A 4JP1A 1EJBA 1KJNA 3S7ZA 5LL6P 2P0EA 1UZAA 4I50A 5KSPA 3FNQA 3CF4A 3I9NA 4CL3A 4LRXA 2DJIA 4OYLA 1VMIA 2QS9A 4M55A 1E89A 2HMYB 3E9ZA 3KTDA 1TTPB 4P4TA 2GWRA 1OJLA 1R0XA 2ZJ7A 2XF2A 4RNDB 5AT1A 1B6GA 2HPAA 4MCJA 3VMFA 4YJ2B 5HQJA 4N9WA 2AG5A 1GNQA 2Q1SA 4EHIA 4B79A 2HMTA 1Z4PX 1QYXA 2PS3A 1UMDA 3ANNA 3BA6A 2AZTA 3FYUB 1T9GS 3PRYA 3FDJA 4M1QA 3ZIUA 2PZ8A 2IP1A 2WSYB 4RVUA 2J0SA 1C7ZA 1G2IA 4L8VA 5BMVF 1T1RA 4OYRA 1COZA 5GAJA 5TE9A 3Q98A 3QMPA 3VR5D 5F1PA 1C3OB 4PGMA 5AR1A 1TMGE 2CUZA 1T43A 2YOGA 3OFVA 3PVZA 4H77A 3BFJA 3FPFA 2ETVA 1TC2A 3OURA 1EDOA 1JSRA 4KO2S 1FTQA 3AHIA 1R9JA 3N28A 2DHRA 3F0TA 1GGKA 2WHPB 4H60A 2PYZA 3N7UA 2AFIA 3M0EA 4LVUA 3JQBC 3UMFA 1KEKA 4UTXA 3IEMA 3LW7A 3G5MA 3GVXA 2NUAA 5BMVB 2V0GA 4MS1B 1TOAA 4O0LA 1N3YA 3GEBA 4BMYA 1QIKA 1OFUX 2WG0A 4I3HA 1K63A 2BMFA 4LISA 3IQWA 2D6FA 4CKEA 2GEFA 4IDCA 2QTVB 1G6OA 3EH2A 3M6MD 4IUDS 3RT1A 1T9AA 3BJIC 1ZJ6A 4Y2SA 1P3JA 3RFCA 5CM2Z 5CVTA 4F21A 4II7A 4Y1FA 3VNSA 4ERXA 2ZUFA 4EG3A 2GM5A 1S3SA 3AR7A 4G4GA 4JEUA 5T6MA 3UWKA 4FOTA 5E6UB 2H65A 1NJ6A 5C1IA 3SX2A 4POOA 3MCAA 3OM8A 3KR9A 5BWNA 3L8DA 2RK4A 4RHXA 4TLAA 3ETLA 2GAFA 4PGAA 1XIVA 2CYAA 2Q9UA 3B9QA 3VH2A 3O21A 1GV0A 1J8YF 2G1KA 2VG8A 4HC4A 1EUCB 1M73E 1I51A 3N7AA 4RHUA 2FDCA 1RAFA 3C3KA 3ZGXA 1NUPA 4YALA 1AHPA 3WZMA 4AFNA 5IYZA 2WAYA 4PR0A 4FYKA 1NXTA 2F43B 2HIAA 4V39A 3VNUA 1HDGO 2R48A 1JA0A 1GTMA 1XTUA 4QU0A 3ZBTA 4TL9A 5T41A 3SNKA 4FUQA 1FUKA 2O57A 2YBEA 4TKLA 1JMKC 2V7XA 1L4GA 4B46A 2C8LA 3D8SA 3QHAA 5EINA 1V8OA 2H57A 1C29B 3TAXA 2E0IA 5BVGB 3SJ7A 3VXKA 2L69A 3KQLA 4P0QB 1T2EA 4YRKA 2OHFA 4QDTA 2GRAA 2YMQA 4E5NA 5J1SB 2R65A 4J94A 4ZVTA 3OM0A 1FNMA 5ALOA 3IYLW 4ALMA 3JWHA 1VFPA 1AZLA 1GQRA 2Y27A 3CZ4A 3O8NA 3HMQA 3OKFA 4UPVA 1Z63A 4B6FA 3ZKWA 1UBKS 4Q93A 3T7JA 3I39X 2YMMA 3TMAA 1U2ZA 2W4IA 2YQ4A 3AV0B 2WRZA 4DY6A 2C2GA 4Y2GA 3QUQA 2WFAA 3JX9A 4RPIA 2QL6A 4CZ2A 5K9ZA 3R7FA 1GUYA 4RAOA 4OYHA 3DZCA 1PV2A 1NBAA 1LBEA 3VTZA 3UAXA 5A5GA 4JJFA 1EEHA 5DCUA 3U37A 2Q46A 5DISB 1EUYA 4E5KA 4TKUA 1MPXA 2HDHA 1YRAA 4MINA 4NV3A 4WBSA 1UFKA 1QP4A 4HNGA 1MX9A 4HYYA 3T38A 4AP9A 1NKTA 4NHOA 3FBGA 3OIVA 5DYYA 3GT0A 2V8BA 1TFUA 2FMKA 5TB5A 2IEBA 4UFOA 2ADOA 4I66A 2EFGA 2GZMA 4RCZA 3HNPA 2TMDA 4URUR 4F5WA 4RBNA 2RGEA 3GZTB 4RVDA 4GPZA 2BLLA 2RBEA 3IULA 2IL1A 4AAYA 2J9GA 3VR4H 1PLLA 3L1VA 4FDAA 2C2ZA 4GZ5A 2JGLA 2AVNA 2WUEA 3GPIA 3P20A 2COEA 3K9WA 3AB7A 4RSRA 3OJEA 4GLBA 2MMGA 5LQKA 3THYB 2DT5A 2AN9A 5K3AA 1Z5NA 2BGLA 2R2AA 3PQ5A 2JARA 1BWSA 2V6JA 1G60A 4KDRA 4JZYA 2MHCA 1L7BA 2XDQB 1Z34A 2R1ZA 2VUUA 3K9HA 3O90A 1W2GA 4RFLA 4YB8A 5DOZA 4AVYA 1FMTA 3M6IA 1PEAA 2ZZKA 2JAHA 2OBYA 1ENOA 4QDUA 2HWUA 1E64A 2MSCB 3D81A 2GYUA 3X1JA 4EO9A 2JASA 1JHYA 1MH1A 2QTZA 4L4XA 3PRKE 4BB9A 2CNOA 2HREA 1KMHA 3J7TA 1K97A 2P4HX 4BDSA 4P0PB 2FMIA 3VI4B 4JKYA 2Q5LA 5CHEA 2A7QA 4UJ3A 1XHLA 3WK4A 5M04A 3PC6A 1CP2A 2VYCA 3IIMA 2NU9B 1OVGA 1NZFA 2JBAA 1OYVA 1E2JA 1P7VA 4X8MA 4DG9A 1PZEA 1QR2A 4G1UC 4HGOA 2I8AA 1XP5A 4P31A 3MPOA 2FSIA 1RMYA 1KSFX 2WD7B 3MWEA 3OX3A 4HBGA 5AIBA 1Z73A 4WLOA 1Y8RA 2RGDA 3LY8A 1R0RE 4H4EA 4N1AA 4HEA6 1V1JA 2GA8A 1DKRA 3FNRA 3KZNA 1EGQA 3CF0A 2XYPA 3VR1A 1LVGA 5F23A 3HCBA 4JBHA 2FY8A 3AUKA 5EG5A 2GZAA 2WBLC 4O6VA 1X39A 4NFHA 4R98A 4YLEA 1G5RA 5IJ0A 5KREA 1P2VA 3LPDA 1Z88A 2X0NA 3EMVA 3OO0A 4U2EA 2ZTUA 1IBMB 2IPLA 2CJWA 1UPTA 2Y8EA 4AD8A 2IGBA 4ARAA 1Q0ZA 4CLRB 2HO4A 4WCFB 4PG6A 4UVHA 3NIDB 3LUPA 4Q1AA 4DMLA 2NSHA 1OX5A 4IG9A 4B3RB 2YFKA 2JLYA 4KR6A 4KO1S 2BH2A 1SOVA 3ME5A 5EHGA 3UWDA 3UH1A 4DNQA 3IRUA 4IV0A 4MVJG 4QUKA 4EI7A 4G5RA 1NLZA 2HSZA 3Q3EA 3KKOA 5CRIA 3T7TA 1GPYA 1V4BA 2F3QA 2DFNA 2VWPA 4IHKA 4TRNA 5FI5A 2C5LA 4D9MA 3FVRA 4M1TA 3F8SA 3NC1C 4HAIA 2HA7A 3A2KA 1L3CA 3KSRA 1UFOA 2AEJA 3QP9A 4PINA 4C14A 3IXLA 5A06A 4KPYA 5B1EA 1GRRA 1K5DA 3K35A 1FTYA 2VDPB 3GD5A 4TXMA 2QXUA 5HBGA 4QFMA 5D87A 3UK6A 2O2HA 3NORA 2G9QA 3CSSA 2VT2A 4LBVA 1F9AA 4TTAA 3KAJA 1RJDA 5DXJA 5HP4A 1L5YA 1ONSA 4R1QA 1GGEA 2VXOA 4RY2A 4B6EA 1M0WA 4Z7NB 3KLMX 2P11A 5DWVA 4KAJA 2Z43A 2GPWA 5IJWA 4OQPA 4YUVA 1OCEA 1UJNA 4HL6A 4D9HA 1J9GA 1EB8A 3CCFA 4HXYA 2QP9X 2B4KA 3Q7TA 3GMSA 4TV8F 3X44A 5G0TA 4AO6A 3CN7A 1TCCA 4FR5A 4PZUA 3FW1A 1GARA 3E9RA 4NYJQ 4REMA 4MS3A 3HG7A 3WGUA 3Q7PA 4AY4A 2HA0A 1X7ZA 4Q3EA 4QGBA 2RGRA 3B3GA 1HURA 1XTJA 1KPGA 4F3TA 2AD5A 5BXYA 1PV4A 5CIYA 4Q1EA 1JE1A 2AOTB 1W2HA 1TEZA 2D74A 3CR8A 3DMPA 3IP6A 1ZFNA 2VJMB 4M7PA 4P1ZA 4QREA 5HIJA 4BVJA 2YZ7A 4B3IA 2PRSA 1L7VC 5JUWA 4B75A 2P30A 3M70A 5E2AA 5C37A 2UYQA 1ZVJA 3SJZA 3PFGA 1LDNA 4MKXA 4OQEA 4ZV4A 5LYJF 1P4SA 4FI3F 4BO8A 1G1AA 2H18A 3THXB 3JQFC 2XZTA 4JR1A 5BUCA 4KOAA 1Z17A 3B6KA 4MA4A 2G5TA 3FTNA 4MW2A 1K86A 1ZCZA 2D06A 2YXLA 3QUBA 1P9RA 4ENRA 1AQ6A 2BUAA 3DKKA 1UIMA 2V5VA 1FFXA 4CM8B 3DBHB 2ZJ0A 3D6NB 3FOBA 3FYSA 3HR4A 3HVKA 2Y68A 4HH0A 4C4YA 5LOVA 3UC9A 4JP3A 3IEIA 1IXSB 1AMUA 4MV6A 4YRTA 1MO4A 3O93A 2QDKA 1LF5A 3VV3A 3PPYA 4KQCA 4RO0A 3TQTA 5KSYA 2WK1A 3E15A 1UKZA 4HB3A 4LA4A 3LOPA 4PN3A 2X58A 1NY5A 4EYKA 1Q16A 1EKXA 4CEJB 3H65A 1L7OA 2YMPA 1N6IA 1NMQA 3SE7A 3QK7A 5IAJA 4HEJA 1FFCA 3V7FA 2B1GA 3WRVA 4DG8A 1AH2A 2M6KA 2R6R1 3UT0A 3H9EO 4QDXA 5KAMA 1K8RA 3QKUA 1BWRA 2CVQA 3V4PB 3GRPA 3S7TA 3FTEA 1P5FA 2VTBB 4CW7A 4DWVA 2UVPA 1CU1A 1RQRA 2QUIA 2PL9A 1N6PA 4IIGA 2NVUA 1RZUA 4CLOB 1UJ4A 3AEKA 4UTPA 1VHJA 4PG5A 1RJ9B 2RH5A 3P9SA 3AV3A 4IDPA 3HBFA 3T3GA 2VS1A 4Q9KA 1OXTA 1L8OA 5ILGA 2BF7A 4C0KA 4JAVC 2VK8A 2VQFB 1YF3A 1LK7A 4EYOA 2REOA 3JRXA 1EYZA 3QLVA 1L7MA 4A6DA 4BJ1A 3NAGA 4GL2A 4ANFA 2OGUA 2ZAOA 1PT8A 1V5FA 4HGNA 3WIOA 3INNA 2JFFA 1CUAA 2YVKA 3HABA 5EE9A 4L4RA 4DLNA 3G2KA 2ZU6A 2ONJA 4KREA 1LF0A 3FOCA 3GEPA 1QCZA 3REFA 4PSAA 4XCQA 4XVUA 1G9XA 3VOTA 3BG5A 4IIXA 2IYNA 4AT1A 1W4RA 4RPKA 1YS9A 4S1PA 4GM0A 4Z53A 3OJ0A 2ZK7A 2EP7A 3KQNA 3NQ41 2XD9A 1OB5A 3UWSA 1IUOA 2INGX 3UAZA 5EMMA 2GXSA 3SSMA 3DP9A 2B69A 2V96A 3BAZA 3RC1A 1KDTA 5MFPA 1R6XA 5JFTA 1GTSA 1OC4A 2G1PA 1ZRMA 3QOXA 5CEEA 1C9DB 4MWGA 3SZ3A 4HWSA 1RYYA 3SHQA 3QPUA 5EKDA 2B94A 3OFNA 2WJ4A 3DVRX 3UQYS 4E5YA 5EE0A 4EGFA 5BQFA 3DCIA 3CLSD 3CJRA 4NV1A 4X91A 1D4ZA 4HYTA 4V03A 1Y9ZA 2XZOA 1Q0LA 4BQNA 2EDCA 5ALGA 1E77A 5AESA 2LV8A 3VKHA 5CCBA 4MO2A 1YVRA 1EMDA 1X13A 2KQUA 3G85A 3U3RA 4KPUB 2QW8A 4N12A 5JJBA 1V26A 2WA2A 3RRMA 2NXNA 2WF8A 4JYMA 4LTNA 3K0KA 3UJHA 5LQJA 2YWDA 3JSXA 4NJEA 2CV0A 5A04A 3N0XA 1F6WA 3UZUA 4ZEMA 4KDFA 1F6BA 2ANBA 5ICFA 1ARZA 2XTNA 3HZHA 4I6JA 2JCVA 3ZQ4A 5ER6A 4BS9A 4C06A 2XEDA 1YUBA 1OWNA 4KVAA 5EIBC 5EMNA 5L3VA 1CK4A 3BK7A 1ZIPA 1N5JA 4IIJA 3EUEA 5F5XA 2XCQA 2OZVA 4Z4HA 1AKQA 3GAFA 4GOKA 3OZDA 3N8KA 1QG4A 4NJMA 4UVDA 1DBSA 1WA5A 2BFCB 2OORC 4HUQA 5K6AC 1T25A 2JGDB 4FN5A 4GX2A 4YGXB 3I3SR 3RTEA 4Q3BA 1N6KA 2JHAA 2A30A 3STTA 1HDXA 2OBMA 3CLHA 1WV0A 4XQ9A 2RHCA 4EABA 4OHYA 1IB6A 1XRLA 4L74A 3NAZA 2W2LA 3IUYA 2ZAIA 4DEYA 1H5UA 1RLTA 2QSJA 2HJGA 2JIBA 3B1JA 3C6XA 1E1CB 5E4TA 3IJ5A 1TQHA 2R6ZA 3NT4A 3TSOA 5IHPA 2G0NA 3ZZMA 2PZEA 2D7DA 4AW9A 2HWWA 3A9SA 1O4VA 4TSFA 5F78A 1P29A 1E9RA 1ENZA 4LN1A 5AOAA 4NCAA 3QTLA 1VL6A 1S3FA 1BDJA 3GDWA 3P45A 2V7VA 1Q74A 1XB2A 4OA8A 1PKXA 1M6HA 1MRSA 1V3VA 2AVDA 3ND7A 3AJEA 4L2IB 2ZUTA 4I1VA 4TQUS 2VOEA 4OHCA 2ZSUA 3LWBA 4KI7A 4DR2B 3DP7A 2OA0A 3G1WA 1I9CA 3G1UA 2CLOB 4FW8A 4PC2A 4Y1RA 5BUQA 4IVQA 5CDUA 2VXYA 1J0DA 1FDRA 3KQPA 1NQXA 3OIFA 1SVSA 2BSXA 3MWLA 4IZHA 1BNCA 2NZYA 1BMQA 3VRHA 3HKBA 3NM4A 2ZRAA 3T9AA 3DPUA 1HYBA 2BTQA 3H05A 3LPLA 4ZQIA 4NAUA 1RYEA 4RY8A 1P44A 2DFDA 2FF5A 1CQJA 1MB2A 2ZCVA 4WKPA 1ZH0A 4TRJA 5FWDA 5H4GA 2JFXA 4JGGA 2R97A 1T8RA 3LFUA 2V98A 3HZZA 3L1KA 1E58A 4LGYA 2PK3A 4MRAA 4EKIA 1Z12A 2J5KA 1BIFA 4U4AA 4ER3A 3RYCB 1OKKD 1H42A 3SKXA 1CB7A 2D0DA 3CLKA 3BXFA 1LRKA 2BSQA 1GFZA 3OEEA 4E88A 2EJCA 4KGXA 5KKAA 2I03A 2CDCA 3GFGA 4MH0R 2ZIUB 4ZRDA 3VR2A 2VI5A 2WJ6A 1VBMA 2FH5B 3SM9A 2YICA 4CN8A 2OCGA 2PS1A 3KQYA 3QHQA 4DLVA 3DHEA 2CN1A 3QIVA 3R77A 3W5JA 2Z9DA 1EFCA 1DQPA 2O8CB 1I4TD 1HE5A 4PBRA 4KRFA 2Y0PA 4XRGA 2XMZA 3O8RA 2NVBA 4FHCA 1EA7A 4QEKA 3ZXIA 2VZ9A 4UE3S 2IA5A 2B6NA 2RHBA 1Q83A 4NE7A 4ROSA 3JALB 5TPWA 4ZDIA 1CYEA 1W94A 5AKYA 2YV3A 4OUDB 1E79D 1JRLA 1G7TA 2Z9BA 2XGMA 3QWFA 3S6JA 3ETCA 2J0UB 1WJGA 3L7MA 4DBLE 1U6IA 2BT4A 2CBZA 2EAUA 3GJ7A 1VGRA 2EHDA 4B3FX 2H8GA 3UEOA 4G8BA 5AHXA 3UA3A 4BQRA 1IQUA 4Q3AA 1XVTA 1QTIA 1DPFA 3K8OE 3DVQX 3NH6A 1LQUA 3F5MA 4GRDA 1OPXA 2PEYA 3IPYA 2FEPA 3KR0A 2I76A 1GPH1 1SC4A 1U9YA 3RUCA 2PAFA 4D02A 5C8XA 3A6PC 1HG0A 3UB3A 1I7SB 1DG1G 1IZ8A 4BYGA 4NU5A 1FP1D 4BRUA 5I4CA 1BHQ1 4RAQA 4CV1A 4Z1MA 2PUTA 3DONA 4MW4A 3K9NA 5D3KA 5FDFA 2HCJB 4JBWA 3I5UA 4OGGA 3NG1A 4IXMA 4A0GA 1WP4A 3D3WA 4NZZA 2AIRA 3X1XA 3ZHSA 1HNNA 3X1MA 1W9HA 2BZ1A 2J9RA 4FGLA 4HQKA 3FIJA 2Q7DA 5D01A 3S68A 2ZIXB 4CU2A 4KTTE 1L5MA 1Z47A 4C2TA 1Y3CE 3IP9A 2VBIA 3ITDA 3QY0A 1RLJA 2P3LA 1Z22A 1OLUA 1KBQA 4P3PA 3QY9A 2BGMA 2PM8A 4JC8A 2XRMA 3HU1A 4K9PA 1YZYA 4PYKA 5EJGA 4EGJA 4W5HA 2PUEA 1G6KA 2QWXA 1OREA 1U2RA 3G8BA 4NOMA 2O48X 1ZGZA 4E6PA 3OT1B 4E3WA 3BTOA 1UH5A 2EERA 3SXPA 4CFZA 3IVGA 1C9JA 2J7KA 3X1KA 1NOKA 3HU3A 3NBKA 2NMVA 3NWPA 1Q57A 4RL4A 2GBLA 3U9SA 4BNVA 1JDSA 1B6TA 1U63A 4IJUA 5DBOA 2XNSA 1EQUA 1IZ7A 3ZZTA 1X2EA 4DPKA 2YV2A 2ECKA 2OAQ1 1IOLA 3WZLA 4CKYA 4YMHA 2GFIA 1KI1A 3TG2A 2XRFA 3MLAA 1U2PA 4R8KA 4UQPA 4PQYA 1IM5A 1O0SA 1BE8A 4UHKA 1QVAA 2P5YA 3SEZA 2LXNA 3FNIA 4UBKA 4NBSA 3H83A 1PL7A 2E3JA 2HCRA 4JNCA 2J5QA 2JLWA 5A0FA 3AHHA 5CUQA 4INZA 2DP4E 3NBZC 4MV1A 3A27A 2OGWA 4Z9FA 2C9CA 4EGSA 3H9CA 4CV3A 3K96A 3CFYA 4II2A 5CAEB 5ESWA 5LP6A 3OY2A 1HR0B 4DLAA 4R2WA 5LA6F 4ER7A 3O7MA 3O95A 1N4DA 4Z0PA 1DUVG 1XZDA 3VO8A 4BQPA 1J09A 2W48A 1NQAO 3NBAA 4BNZA 1L1RA 1T9ZA 3TNFA 1QQBA 1G21E 3C70A 1QRSA 4P84A 3FNEA 1HPLA 1Q14A 4OL9A 3A4TA 3D8UA 3HUEA 1KC3A 2OGSA 1RM4A 1P1KA 1NOJA 1XMXA 3PDIA 3K32A 2PH3A 4KIGA 3KELA 2GHTA 3QGMA 4OMUA 4JGIA 3STWA 1O94D 1EBBA 1WPRA 4R3WA 2BGJA 1BGXT 2AK3A 3MIZA 4MMYB 1ZRHA 3AY7A 3QLJA 1WSWA 3IIIA 5LA6B 1XZNA 2OLEA 1AF7A 2P9HA 5CDTA 1O57A 2DJ5A 2VDNB 1L0BA 2ZIWB 3CEAA 3WP0A 1U2GC 3GARA 1SHUX 1WMBA 2A1TR 2BR3A 2PU7A 3NIGB 5JCXA 2RGUA 1Y7PA 2D7JA 4LEIA 4GXTA 2BMJA 2Y99A 2G9UA 5I47A 2H5EA 3I0NA 4BNDB 2J3KA 2E5LB 3D3JA 1XA3A 2JCGA 2PH7A 5IAGA 4H7DA 4N6OA 3RYFA 4IDBA 4YP6A 3WLKX 2J7PA 1IPFA 3F78A 2LCIA 3EXG2 5BPHA 5EGNA 2VDKB 1ONBA 1TIBA 3E8MA 1FMFA 4FIDA 4CR6A 4EKEA 2ZWIA 1EVKA 2RARA 3D6JA 3T15A 4HP8A 1T3GA 4A0HA 3U7HB 2A4MA 4J4BA 2H59A 3B8EA 3NO4A 4UEKA 2YJ6A 1GT6A 1LNSA 2XA1A 2R7NA 3DYIA 3PXDA 4A2CA 1BMFD 4B6GA 2ZUEA 2P7HA 4QXMA 1Y34E 3DMDA 3NTVA 4GI2A 4U3JB 3R5HA 1SXGA 3QBDA 4EJ0A 3A06A 1B00A 3GEMA 1X80A 2BI4A 1FS6A 1R66A 3HHPA 2ZWPA 4QAQA 1EWQA 2F2TA 1PGOA 1WVMA 4U8HA 4UM7A 4Y8VA 3DWIA 1VPDA 3ZWBA 3H8WA 2RGAA 4I1UA 4F2HA 1KZGB 1R4NA 2HLDD 5E1BA 2WYVA 2C82A 1J2EA 4J4HA 5CT4A 5F77A 4UU7A 4NIMA 3FYTA 5JOQA 1SU6A 1VG1A 4DJAA 4HTFA 1R88A 2YZ2A 3PRJA 3M82A 5TVGA 3S1AB 4R7TA 1YJ5A 2RGXA 4OBBA 2RAVA 1GR0A 1W5TA 2HMVA 2HSEA 4R16A 5IEJA 1WRBA 2YWCA 2YZMA 1MLDA 5A0VA 1UXJA 4Q02A 2PSHA 2CMGA 2A9FA 3FH0A 4O2BA 2XCSB 1L4MA 2XOEA 4RD3A 4DF3A 1O2DA 1LVUA 3GO4A 2HNAA 5DH9A 4Q7JB 2XPCA 2FUCA 5EIHA 1F0KA 2F3UA 2H4ZA 4MARA 2DUJA 4LF6B 4IWNA 3CO5A 2X14A 1L5WA 3L0YA 3KP1A 1SIBE 3D4BA 3MD9A 4FU0A 5J9FA 2XUJA 5FR2A 4KVFA 3SYKA 4D99A 2O3SA 2O20A 1UC9A 3MWGA 1XF1A 1OI2A 2X1MA 4LJLA 5AUQA 5D1HA 3VR3A 3IEXA 4WFQA 2O8BA 4D98A 3DZBA 4QYXA 2CXXA 4NCHA 1W4AA 4BAUA 4GICA 1JDUA 3I42A 5DYIA 3NHMA 1UPBA 3GLHA 3OCCA 3JPYA 4TMWA 2NQ8A 4WADA 1A9XB 5TS3A 2FKNA 2Q3FA 4AICA 5TIIA 1NC1A 1MHTA 2X7JA 2DY0A 5AK6A 4DHWA 3T5CA 2XUIA 2FUKA 1VZ3A 3OG9A 4ZAVA 3QNMA 3OPVA 2ZM5A 2GPBA 3GMDA 3VSAA 4WKCA 1IRXA 4FSXA 3CLTD 1NVTA 1H2ZA 2WWXA 4FGWA 1LB1B 4Q1FA 3DOUA 4B47A 4E5DA 4BX0A 2QXTA 3WLSA 2HKIA 4KBFA 1X9HA 1MG5A 1Y80A 3VAAA 1IOZA 1QORA 5CP8A 3PTLA 1CRZA 2ZJYA 3A1SA 3DBLA 2QX8A 2BP7B 1Z6AA 6REQB 2H5JA 3I9V1 5B36A 1QYCA 2WHEA 1BO6A 1N25A 2YC2C 3NONA 4BQSA 1LI4A 3AH8A 1ZC4A 2GBIA 3AL3A 1Z5UA 3H3FA 1N5OX 4N49A 4BLOA 2P0AA 4BLTA 5F21A 3H2ZA 4QGSA 1V16B 3E22A 3HKEA 4OXXA 3I58A 2D5LA 3PQDA 3G3EA 4HDKA 5DNEA 2VTDA 1E3WB 2ZJBA 3T94A 4J91A 3GPLA 1D2RA 3GLIA 4Z4QA 1NY6A 3DBVO 1U8YA 3IUNA 1OLOA 3KYCB 3TKAA 2DSNA 3HKDA 4HPJB 4S35A 3KWMA 5B2EA 1R0KA 1ABEA 2RMKA 3L93A 1PGJA 4OVKA 3BREA 2RI0A 3L1UA 4Z1OA 4JN6B 1KK3A 5J2TF 3OECA 1EAYA 3HUFA 3HWWA 1JH8A 4WZAB 1JHDA 1KVRA 3TMKA 1LGYA 3GNSA 1ZOLA 4QULA 4P3OA 2BWJA 3NVKI 2PRJA 2HEIA 1UMKA 4TN5A 1Y1PA 1N2ZA 2GBGA 3HB7A 3EEBA 1UINA 1GPAA 4MIOA 2X8JB 3HFGA 4ZOEA 4B3DA 4UKDA 5EZ5A 3SE0A 4JGBA 4A16A 2P7IA 2UZ4A 4DB4A 5J2TB 1C8LA 4ND3A 3TDMA 2CLFB 1LBTA 5AW6A 1FLDA 3SIRA 2PYDA 3DF9A 1W34A 4MEJA 1DAIA 3JAKA 5BRAA 1ZC3A 3K0CC 4O2AA 2CB0A 1GZ3A 3AZQA 1C0KA 3W2FA 4Y30A 1OD6A 3UPDA 4BBJA 4D6PA 3RKSA 1M3SA 3BIJA 3TQIA 2F55A 1WCIA 2JI7A 3TW8B 2P9QA 3DO5A 3ET4A 1N8TA 4LVOA 2RK3A 3FWNA 2YIDA 3O4RA 2QJTA 3N1UA 3PNLA 4OHRA 4DIKA 4WD3A 4Z7JA 2ZE7A 4I46A 4GI1A 4MICA 2R66A 1UQUA 2ZYRA 3SIPA 2WAXA 1QTRA 3EZGA 1QH1B 1M5UA 2GXUA 5D86A 4XYLA 3GNQA 1CP3A 4J7CA 4Y0AA 3ROXA 1L3BA 4BU0A 4AS2A 1SAYA 2PKEA 3ZWPA 4AU1A 1O95A 2RHJA 2SKCA 1JBKA 2WOJA 3V7UA 4NQZA 4Q19A 5AQ1A 2YNMD 2O6HA 2KHZA 3GN1A 3VNVA 2O5VA 3E6AA 5DWQA 4EDHA 4B80A 1P91A 2Q6VA 4HAWA 5KTTA 3HVRA 3L7IA 4RK7A 2AKAB 4YDHB 3R3HA 1KAOA 3JVEA 2O8EB 3P2EA 2HMWA 4DQVA 2AEMA 4I5GA 3H1GA 3K92A 3I2JA 3GP8A 5DASA 3G0BA 4EY3A 3NTQA 2JJMA 5A03A 1FYEA 2B8EA 2R1VA 3EYAA 4DRZA 3R7SA 2EW8A 4X1KB 3HBLA 5EZYF 5GINE 1NP7A 1GM5A 4RXUA 4OOFA 4MWEA 3DTVB 5LCXA 1HDIA 1HEUA 1TKCA 2QLMA 4BZWA 4RVNA 4EGAA 2GJSA 1U3UA 3CVUA 4XIYA 1RKVA 1TM3E 2D2IA 4FKMA 1YIOA 5GIOE 1A1SA 3EG5A 1FJ2A 3LQYA 4WFIA 3PQCA 3WNDA 2CLMB 2OHJA 4ZVSA 1CR0A 1UT6A 2PL1A 1JXMA 3F4BA 4MGKR 4UAVA 1JKJA 3VZBA 3LX6A 5K5EA 3K6SB 1F2TB 5EZYB 5B1IA 3AEXA 3H2HA 3KVOA 1QBKC 3UAOA 2X4IA 3Q3VA 4CVNA 4C22A 1VIDA 2J9YB 3JQEA 2Q5IA 3DV0B 5BOSB 6LDHA 1JR3A 4N0MA 1N9ZA 2NTYC 3C4VA 4GVPA 4IO1A 2WY2D 3V8VA 5IDVA 2H1FA 1MH9A 3JQAA 2Q50A 4IL5A 1DV1A 4MEBA 3PG5A 1XU9A 3OE7A 4JVSB 2AXEA 1UC8A 2IXGA 4KACA 1R74A 4BNLA 1XKQA 2Z4RA 1SCUB 4LZLA 2CYBA 4G0ZA 4CKBB 4MQFA 3R75A 4DR5B 5TT1A 4C5BA 2QRVA 1L4YA 2PUWA 1ZR4A 3IKJA 3UF0A 1QJCA 3OPYB 1ABBA 2VLIA 1G8MA 5ES4B 3VISA 3VHLB 3PIIA 1ZGJA 4IEEA 2R47A 5L53A 2DR0A 4BY9E 4CETA 5E7JA 1IAVA 3SZOA 1Q0SA 2BHSA 2P4QA 1QONA 3ILSA 2CHGA 1WHSA 2VAPA 3KLBA 2A35A 2QR5A 3BIWA 4A0RA 1RQGA 1SBQA 1AF4A 2R7KA 1H4TA 2FPOA 3DQPA 1HFKA 4PYRA 4LUCA 4QL3A 2EIHA 1I3OA 2NTEA 1X8XA 3N5CA 1E1RD 2B4QA 2O23A 3OCJA 4B73A 5B6PA 1QUFA 2JJYA 1CEYA 2FPLA 3AFIA 3HJNA 3TIIA 1XHFA 4YXWA 2FPIA 2FWMX 3D7RA 4EPWA 2WIJA 2BGGA 1GUAA 4ZEOA 3WWEA 4MVYA 2EWWA 3EPJA 5T4BA 1OZ0A 3V8PA 1C2TA 3AJ9A 1U0TA 4ZEXA 1JALA 2G7MC 3T0IA 4M0KA 1I33A 4OX9Y 5ESXA 1BXRB 3Q3GE 2Z3ZA 3ELUA 1SCDA 1GO2A 1GLVA 1VCHA 2XA2A 3TRIA 2WJ3A 1AURA 3UJPA 1AKYA 2V0CA 5JNLA 4HEQA 5SY4A 5KYVA 3HRKA 5GQSA 2Q49A 3UTDA 3BF7A 1RWBA 3LV8A 2CSUA 2EEZA 4G67A 5CNMA 3RD5A 1RPZA 2GHQA 2P78A 1Y48E 2J67A 4UEWA 1JFSA 1WTAA 4U02A 3SQXA 3V7WA 1BCSA 1XDDA 4YASA 2F8TA 1EVYA 3TIFA 5BSHA 3P4YA 2O8VA 5KSWB 10MHA 1YIAA 1Y8ZA 4OSEA 2CKMA 3BB1A 3KEOA 5CYPA 3CPJB 4F9TA 5AK4A 8ABPA 4P53A 1R8SA 3TBFA 1LLDA 1JHZA 1UBUS 2D0PB 4FLFA 3U48A 2GCGA 2QB5A 4ALJA 2HAEA 3C1AA 4X65B 1B6SA 3GNTA 3K6KA 4BE9A 1VCOA 2Q99A 4RH0A 5TEWA 4W5OA 1I7NA 2JFGA 3EXHB 3LPNA 4UEQA 5JBIA 4PAOA 5DNUA 4LOJA 3R76A 4I4NA 2C5BA 3ZY4A 1SXJC 2Z2XA 4JELA 2JZOA 3ONDA 4Q05A 1BGWA 1EFAA 4A3SA 1W5EA 3WLAA 3OKPA 2VSXA 1UP6A 5FUBA 2X0DA 4B6SA 2W6ID 1G3MA 1JVBA 1JP7A 1QB8A 1JFTA 2UZ3A 2ERCA 1I2DA 4ZCPA 5JVDA 5D5PA 4FNAA 1R6BX 2JRCA 4QUIA 5BN4B 4UHHA 3RF7A 1RHMA 1RYDA 4ND8A 2QPAA 4XEHA 3TZ6A 4DMFA 1T0HB 1K0UA 4ZQCB 2RI1A 1XDZA 1GUDA 4B6JA 5K01A 2WVJA 1QGDA 4HDNA 2BZ0A 4AMVA 4XPIA 4C2AA 4QUDA 5ALNA 1UKBA 2F8MA 3GT7A 4HWRA 1RXIA 3ORQA 3HGQA 3QF7A 1AK1A 5LPNA 1V1RB 3RH0A 4PG7A 3L6RA 1PJCA 2OAEA 1GCGA 5LP1A 3QUCA 2YVQA 1GCOA 4G24A 4CTKA 3J7AC 2R79A 3P2OA 2CXUA 3MMNA 4R9RA 1B73A 2H7YA 4DADA 2I2XB 5E0KB 3TQQA 3UPUA 3EEFA 4FMBB 1U02A 1U7ZA 3UNXA 3SNHA 1UOQA 3QXXA 1AGYA 5J43A 2VNAA 3RC3A 2UXBB 2FX2A 1LS6A 2F9LA 3WYBA 1WBDA 2X4DA 5FWYA 3ORYA 4C1NA 1DUSA 3AL0C 3T9DA 2I3ZA 3DNFA 3JD0A 2I34A 3DFZA 4GUAA 4PONA 5DBGA 1YI0A 1GQ2A 4CF3A 1JFFB 3IELA 3KOMA 1JLMA 3OOYA 3H1EA 1VE9A 4KR2A 1JPVA 2DCUA 2FPMA 2O52A 4IWXA 1NQWA 3IUMA 3VH4A 2O2JA 4CBVA 1A5BB 4D9GA 3BGIA 5B53A 5LKRA 3V4RA 8MHTA 1WULS 4INOA 5FOTA 3WXBA 3D3QA 4Y2QA 4EJ2A 4LVNA 4D79A 3HSKA 1WHTA 5IP5A 1RBZA 5CJPA 2ZUWA 5TMDA 4MS4B 3PD0A 3EXFA 4UNRA 3K0FA 4FCCA 2Z04A 2B1IA 2GAAA 2LWIA 5K0CA 1W88A 1IH8A 4DMCA 4C0QC 1M74A 1TI7A 3H8JA 4IJVA 2XRZA 1P9NA 3FZEA 3WGQA 1NF3A 3AG6A 1XN1A 1KWKA 4GI5A 3EX7C 2CLKB 1Z0KA 4FHZA 3LC7O 4MUNA 3SQMA 1RLIA 1QOZA 5IBCA 4FLEA 3ESXA 1J1IA 4M9CA 3QXHA 3I9JA 1O89A 1H9CA 1PG2A 3MWFA 1U3CA 3KO8A 1IHOA 4LSGA 4YPOA 3E3MA 4YQYA 5E4JA 2C2HA 5AFSA 5IFKA 2FOLA 2G3YA 2ZU0C 4JYBA 1ZNQO 3RU2A 3B8HA 4HMOA 4OIFA 2L17A 1DOAA 1VBFA 1Z2OX 4HDSB 1NBMA 4FHDA 3ELYA 3HCRA 1GAJA 1VLVA 5CEFA 4PO1A 3P0HA 4N5NA 1R4MA 3LH5A 2VDUE 2NPFA 3VJMA 1Q95A 1BCRA 2EP8A 2ISCA 3FPEA 4PQFA 2OBBA 2OFOA 1VSQA 2GSWA 5IRCD 1SWVA 3QEMB 3V7NA 3B5IA 2YOHA 1ESMA 2WUDA 3OP1A 5BSRA 2G07A 1P3DA 4NXNB 1TCVA 2NU8B 2IYOA 3UAVA 3OWXA 1GZ4A 1UOPA 2J6BA 2VYVD 4B40A 5JV5A 3FCUB 3EF1A 3ONWA 3ZS8A 4HX2A 1Y3DE 1SPXA 1VFNA 4MWDA 4WHMA 1OZAA 2ZVPX 3PGLA 4OKSA 1DWQA 1ZKDA 2D2EA 4ZO7A 2ZYVX 3HB9A 2BEUA 3EMDA 5JC8A 1C5KA 3VPXA 1YGPA 3C3C