4PR0A

Mycobacterium tuberculosis reca glycerol bound low temperature structure iic-n3
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
328
structure length
315
Chain Sequence
QTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Protein RecA, 1st part, 2nd part
total genus 96
structure length 315
sequence length 328
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4pr0A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4pr0A01
2GNOA 4EUNA 1KO4A 3CNLA 2VP2A 2WOJA 4YMTA 3QUSA 1AQUA 3AB3A 3QF4B 3I32A 2GDJA 1Z0FA 5AWFC 3R7WA 4E09A 2GJSA 5GJBA 3ONWA 2DWOA 2BBSA 3U6KA 4ZIRA 1KMHA 2E9SA 3CH5A 4IDQA 4M1KA 2ZVPX 5CK5A 5AJYA 3W34A 1X86B 4I1SA 2DBYA 3LA6A 3EARA 4KBGA 2ZJ5A 3U7FB 4LBZA 2ZXUA 1SKYE 1IONA 4WVFA 1EFTA 4DBLC 1GKYA 5G3ZA 4B73A 1RJ9A 2CXXA 2PX3A 1JPNA 2WKQA 2IYLD 1NL3A 2W00A 2FSHA 3BAFA 4FD2A 1TPZA 1TU3A 3CIOA 5E7IA 1GKUB 1IN7A 2ZAMA 1IJFA 2ZI6A 2WPDA 1OV4A 4L9WA 4QKQA 1N6PA 1ZUIA 2BC9A 1DE0A 2XNSA 2HJVA 3P32A 4CT4B 2Q9BA 1XTIA 3GJXC 5HZKA 4QOSA 5UKDA 4TYNA 3WMGA 1FFHA 2ZTSA 3CB4A 3OZXA 1W2GA 1VG0B 2VO1A 1H8EA 3H1TA 1JJVA 2Y8EA 3MD0A 5GVSA 1II8A 4B44A 2QMEA 1OH8A 2GXAA 1Z0DA 4M4SA 1W1WA 2WOOA 4C0AC 2IYTA 2PLRA 2QG6A 3DDCA 2WMNB 4A92A 5L8VA 1OW3B 221PA 3BGWA 3L8YA 3QPWA 4BFZA 5EP2A 2XGJA 1U2RA 1NN5A 3LLUA 1FQKA 5JLJA 3VX3A 1RYHA 5AUNB 1KO1A 2OV2A 4HDCA 3U7EB 5BN4A 2XB2A 3PUYA 4PR0A 4A15A 1NBMD 3JVUA 1AQYA 2R6CA 1R5NA 1R0XA 1T5LA 4UKDA 4OHWA 2ZE8A 2F3RA 4L4UA 1PV4A 2WBLC 3GCGA 1UDXA 1Z22A 1KI6B 3NG1A 4GP6A 5HE9A 2J45A 4DVGA 3THWB 4B3BA 2FFQA 3LAWA 5J4KA 1UM8A 1LFDB 3L0OA 5LBIA 1ZD8A 3K0EA 4A9AA 4ZI2A 4QGGA 1W7AA 5B58C 5TMPA 2OFOA 3UMRA 1KK3A 1TQDA 1VHLA 1JR3D 1YE8A 1G16A 2JLQA 4C0HA 1XJCA 4JVNA 5FH9A 3ADDA 1S8FA 5FUXA 4Q9KA 4L5BA 4F4CA 2GVZC 1X8KA 4EPWA 1PVOA 1K5DA 3DM9B 1K8RA 3ADKA 3V4RA 1KDRA 4MA4A 1JXMA 3VR3A 1KOFA 4DJTA 1D6JA 3EW9A 3AF2A 4CEIA 5CJPA 1DAEA 2ECKA 3GLIE 3CPEA 3GJ4A 4WAUA 1W36C 2ZE6A 3O8DA 2PLFA 3B85A 3P20A 4QM6A 4Q4JB 1RFLA 1IXSB 4OJQA 1R6BX 1KK1A 2OO7A 3AP1A 2FZLA 3FHTA 1WA5A 3O47A 1LTQA 1QG2A 1F3OA 1DVRA 1TEVA 1C4OA 3QXSA 4YONB 3THXB 1P2VA 2BDTA 4HAZA 4LDJA 2GETA 2GBLA 4Q4LA 2G6BA 3S1AA 4UNPA 5EP3A 2IYRA 3UXMA 1AS2A 1KAGA 4AK9A 5HPYB 2IX3A 2K5UA 1P61B 2OEPA 1T3HA 2AL7A 3C4JA 4C2UA 2ZRJA 3TSOA 4NCHA 1G3RA 3ECCA 3GLHB 2FSFA 2OHFA 4G3XA 5EQTA 2YV5A 1WB9A 1RKBA 3SEAA 3LFUA 1G5TA 3CO5A 3CF2A 2VP5A 4TQ9A 4FWIB 2CLSA 1E2DA 2J9RA 1TEXA 1F5NA 1W4BA 3SNHA 2NQ2C 3THXA 2HUPA 1OHHD 4V0OA 4Y0AA 1UF9A 4JL6A 3TE6A 1EGAA 2CNWD 1E98A 4ZCIA 2AN9A 1E2NA 1E9BA 1JAIA 3Q3JB 1J70A 2HLDA 2JGNA 1CJTC 5FPHA 1IHUA 4EIWA 3NDPA 1HT1E 2BMEA 2GXSA 1QF9A 1AM4D 1E1QA 2FU5C 5AJVB 1FUUA 2LKDA 1Z06A 1AS3A 4DCVA 2P2LA 1LF5A 2F1RA 3Q7PA 2V1UA 3A4NA 1KDPA 1NN3A 2FFHA 4QRHA 1GRNA 1R0WA 4LV6A 5M04A 2A5GA 3TBKA 4PO8A 4BFSA 3CRVA 4C0BA 3LBIA 4P0TA 4G1UC 3FWYA 3CPHA 4NKRA 5JSZA 4TMKA 2IHBA 4GOKA 4EQ6B 1FX0A 1HUQA 4HI0E 4DHEA 2GESA 1CF4A 4EQ6A 4Z8XA 1E9SA 1A5TA 4I99A 1N0WA 2DFTA 3N2IA 3LQQA 4ZV4A 3EPHA 3ZZUA 1E9FA 1SVOA 1NY6A 4ZCLA 2WMOB 3BE4A 2WIBA 4DDUA 4WZAE 5DO9A 4HATA 4YMWA 4DKXA 1P6XA 1W36D 3CNNA 5TVKA 1E0KA 4JLNA 1RIFA 2NO7A 1RVDA 4CGZA 5FFMA 4KAXA 4HB3A 2IXGA 2WSSA 4HLDA 2VIIA 4IDOA 4FXPA 1P9WA 1P73A 2OUKA 3ASZA 2QP4A 4KV9A 4HDOB 1HQCA 1P75A 2YVUA 4DDWA 5BWMA 1WP9A 4P4SB 3RRNA 4C7OA 3QIAA 5TV2A 5P21A 3UWKA 4Q9HA 1Q20A 1T3SA 1E96A 1CR2A 4FMDF 1KI6A 2WKRA 2ATXA 4HAXA 3KTAB 1GKIA 1Y63A 2CCGA 1XJ0A 4ASUD 4DCTA 1US8A 1AK2A 4B6EA 2O8EB 1IN6A 3BFXA 1GTVA 6Q21A 4KFRA 5IRCD 2QT1A 4JJKA 1ZNXA 3IUYA 3X1XA 2FPKA 2YINC 3DOFA 4OKSA 3I5XA 5HKKD 5F9HA 4L9SA 1WBDA 3CR7A 1VIAA 5GJWC 5G3YA 5E95A 4C0QC 5B57C 4F92B 5J4LA 2VPPA 1WBBA 1G7CA 2RGAA 5FBLB 2G0NA 3KQUA 4DRZA 3AVTA 121PA 4RD3A 1ETUA 2VRWA 4OK5A 5BN3A 3B7GA 2BKUA 1R8QA 1E2KA 1J7KA 1P2UA 4QBFA 4JL5A 4R71A 2EFHB 5IDVA 5EJEA 3I4LA 4Z8YA 3Q7QA 3SJZA 1N6OA 3AH8A 2UZIR 1Q1EA 5L3SB 4O2RA 4RD4A 3IQXA 3MFYA 4A82A 2HDNB 2Q3FA 3K0CA 3AKYA 3M1IA 4B2PA 2F7SA 3NH9A 5DSZA 4AIIA 1S3SA 3AF0A 4PZZA 2NPFA 5JCPA 1NNEA 1HV8A 1D2EA 3GPLA 3LBNA 1ZIPA 1U9IA 5JZVA 4K8OA 2V4ZA 1YR7A 4UXHA 3B78A 3OEHD 2A30A 4ZI3A 1QHIA 4M1SA 1OH7A 1TF5A 1VIYA 1XCMA 5FOWA 3G0HA 3AVQA 1XTQA 2JJ8A 4PAOA 2Z43A 4IW3B 4HZIA 4WZ6A 4P3YA 2J5XA 3T34A 3FE2A 3RANA 4PZYA 1NMZA 2HLDD 2GWHA 2QP3A 2IEYA 3KUDA 4HLUC 4PC1A 2F43A 2ONJA 2CK3A 4RJLA 2R65A 4QBIA 1FTSA 1GNPA 3NXSA 4AWXA 2ZJ2A 5H1YA 1NIPA 3AEZA 2PEYA 5E3HA 3AVXA 2YHSA 4AY2A 5DH9A 3AVUA 5C46F 1ZD9A 2F9MA 3UKDA 1WDTA 2ZETA 2D2FA 5AK0A 4IOKA 3THYB 2JLVA 2QY9A 4NYJR 4TL6A 1IN4A 1A2BA 1G8GA 2N46A 4MYHA 2CDNA 3WYFA 4O0MA 3U5ZB 2QM8A 4BFXA 5EXXA 3PUXA 3SYNA 1A2KC 4DIEA 1YRBA 4KVAA 2OBLA 5CM9C 5GJVC 1HURA 2FSIA 1VTKA 1PLJA 4U00A 1E32A 1U9IC 3K9GA 2BV3A 5AUQA 4HUTA 1YR9A 4JBWA 4IDHA 3VU9B 3M0EA 1N25A 1SXJD 2RGBA 2WSMA 3MWYW 4HB4A 1KO7A 2RAPA 2V54A 2OCAA 2QZ4A 5CK4A 1LV7A 2W0MA 1MO5A 1KDTA 1T0JB 5FTNA 3C5HA 2NO9A 2JJ1D 5HCNA 2OAQ1 1U8YA 2H18A 1XTJA 2WPDD 1M8PA 3A36A 1VPLA 2CNWA 1HH4A 1YZGA 1DO2A 2FJUA 1FMLA 3K53A 4LI0A 2CE2X 4QNRA 3VFDA 1ZVQA 3VMFA 2QI9C 1NVWQ 3QF7A 4JZKA 1XP8A 2P5TB 2GF0A 4LJ9A 2J87A 3RDPA 1E9RA 3CLVA 1AJEA 2BM1A 3TSZA 1YU9A 4G0NA 4Q21A 3KUCA 3R9IA 4F4JA 2RGNC 4MYTA 1KMHB 4Q7MB 4JT2A 4W5JA 3H2YA 2R6AA 4KO8A 2VHJA 5IK2A 2V1XA 2GF9A 3P4YA 2O5VA 3PXGA 4E22A 3L8ZA 3QOFA 2J0SA 3NWJA 3EPLA 4TYYA 3SN6A 2G1JA 4O3MA 4D25A 3UIEA 1S9HA 3PCRB 2B6HA 1E1RD 1OFTA 4GL2A 4KFUA 5CIWA 1YZNA 1LB1B 2O0JA 4JMPA 5KDOA 4B34A 4HZUB 2ANBA 4ZKEA 5JCZA 4GSYA 2P6NA 4FCVA 3TAHA 2E1RA 3GJ7A 1GL9B 5ELXA 1E1RA 3K0AB 4Q5IA 2ZRHA 5LB4A 1AKEA 1S2MA 4KCGA 4TZ0A 1RZ3A 2NO1A 4M2LA 3U60B 2ZPTX 2FPLA 3B60A 2NIPA 4H9GA 4JLOA 3A1WA 3T12A 4DLZA 1XXHE 1YHNA 1WQ1R 2PZEA 2GEUA 4AC9A 3AF4A 3SFVA 2ZU0C 3RSOA 3U3MA 2R6DA 4MYUA 4DT1A 4TTRA 4TN1A 4US0R 1XMVA 2CJWA 2ZR0A 4PX9A 1VMAA 2CJWB 1F2TB 3V00A 3KQLA 1E79D 4A36A 3KQHA 1TTTA 4XVRA 4LV5B 4D4MA 3K9HA 3REGA 4D2IA 4XTRA 4BWYA 3OHMA 2PEZA 4MUAA 4WIAA 1P60A 2J7KA 5KDLA 1MABA 1TQ2A 4IFEA 5FL3A 2AHOA 1SXJA 1ZU5A 8OHMA 4MH0R 4QC2A 4FMDB 3TVTA 421PA 1TQ6A 4ARZB 1XMSA 4D4LA 1NRJB 3TGPA 3H84A 1IM2A 3UMSA 1EESA 4ZDJA 1NVUQ 2QTFA 3KJHA 4UJ3A 2QEQA 5EP4A 2H5EA 5FBWB 2IL1A 1U99A 3X1ZA 3SQXA 3HWSA 4PC6A 4CDGA 1G8PA 4LJ4A 1W0KA 4DLWA 1N5LA 4LWZA 2IYQA 3RWMB 3EWAA 5JRZA 4URZR 4LGMA 1XTSA 5FPTA 4DZZA 3THYA 1Z0KA 2ERXA 3BRWD 3QXHA 5BYKA 2QQEA 1K6MA 2EWVA 4WXRA 1EX6A 1P5ZB 1X8JA 4ITRC 2QP9X 4OQLA 1M1YE 1YR8A 1E94E 3D31A 1G9XA 3IPYA 1CEEA 1EWRA 1W49A 2IYUA 4RCYA 2UKDA 3U3KA 5B30A 3MWJA 5JEEA 3DZDA 4Q00A 5AR1A 3WYGA 521PA 4ACBA 2ZRCA 1ZUNB 4ESHA 2AKYA 2GHIA 2ORIA 1N6HA 2QROA 2H16A 1ZYUA 5FR1A 5GJCA 1NVXQ 1E2PA 2JJ1A 1EWQA 1IXZA 4RSGA 1J99A 1QHGA 3VX4A 4HLUA 3PJRA 4LSGA 1GZSA 2Q9AA 5TXGA 4F38A 3SFZA 2ZJZA 4MKHA 4PXAA 4GRAA 1XEWY 1FW6A 3CX7A 2ZYTX 5LPNA 4YMVA 1Z47A 2AXPA 4WW0A 2ODNA 1VCIA 1OIVA 4Q1CA 4F93B 2D62A 1QG4A 2IXFA 3EIQA 4Z1MA 2KJQA 3AM1A 2A3RA 2Q0HA 3G5UA 3KFVA 3DOEA 3NC1C 5KUTA 4A1FA 3KKMA 3ZDQA 5JECA 3NBFA 5G53C 1FX0B 1KSHA 1AGPA 3RS5A 4BZXA 3KL4A 3U7GA 4TYQA 1GOTA 4V03A 3ADCA 4C0JA 4Q66C 2MSDB 3E70C 2QT0A 4L16A 4PSVA 1FUKA 1VG8A 4NCKA 3W8RA 4LCBA 2QQ0A 1Q44A 1IY1A 2DFNA 1II9A 2RGEA 3QKSB 3BERA 3FHCB 4BLOA 1G8HA 3UWOA 4GPTA 2VH5R 4BRUA 3MGCA 4QHSA 2JLYA 3IGFA 4OQMA 2ZSDA 4D80A 1OFIA 4A2WA 1NN1A 2WWIA 2XOKD 1H8HD 1N0VC 4FI3C 4CF7A 2OE2A 1M7BA 1IN5A 1GRRA 2G77B 1YZLA 4TL9A 1AA3A 3OF5A 3Q8XB 1ANKA 2B7CA 5KSZA 2J0UB 5HCIA 4HAYA 4M22A 3KKNA 4QBGB 3QEJA 3HYRA 3IBYA 1GL6A 2DPXA 1AGRA 3LO5A 1JAHA 1O3YA 2A5FA 1MRNA 3CRQA 3GLFE 2ZIAA 3M4YA 1KI9A 3AVVA 3ADBA 2YC4C 1S1CA 2ZRMA 4LHVA 4EJSC 2OCYC 2XJ4A 4Q1EA 1XMIA 2BMDA 4R9UC 4POAA 4LV8B 1XU4A 3OIUA 3BIFA 4ZIRB 1JQLB 4BFUA 1XMJA 1Z29A 1CBUA 3AKCA 4MRRA 2XXAA 4WOPA 4IEEA 1X1SA 1DBSA 2B7BA 1D2MA 3A8TA 1V43A 3HU1A 2J3EA 4FMCF 4KLNA 4N3NA 1E4VA 3RVBA 5CB6A 1N0UA 2X19A 3EXAA 2YOFA 4DWJA 4PC3A 1CXZA 4HAWA 3JVVA 3FB4A 3SYLA 3CW2A 3GEHA 2ZSBA 1HEIA 3SJBA 4DLVA 3HR8A 2VP4A 4Q4HA 1OLOA 2WTUA 4AKGA 1KI1A 4XWAA 5JJIA 1RC8A 1Z0JA 5FTMA 1U98A 4IVRA 1C9KA 5J5CA 2GJAA 1G3QA 2OG2A 4II7A 2XXAB 1PJRA 2PT7A 2QTVB 1CULC 4B47A 1Q1ZA 3WRYC 3IEUA 3TNFA 4ZCMA 2KE5A 1BMFD 3AUXA 3LXXA 3ZIAA 2CL6X 2GJ9A 2WWXA 5FL7A 2O8FA 1A82A 4S35A 4EJSA 2GCPA 3IEVA 3F3YA 3NEJA 5F3WB 1P4SA 2KBEA 5KPJA 2HV8A 5FBQB 4PQFA 1FZQA 2NZ8A 4QXAA 2ZRNA 2ZUDA 4US1R 1JEDA 2GZAA 2Z4RA 1KJWA 4KXFB 3EA5A 3KB1A 4KJZA 5KHOC 5CYPA 1SVIA 2H17A 2J7PA 3MG9A 5CM8B 2WJGA 1TUIA 1OJLA 2ZEJA 2R8RA 5H68A 3TRFA 3LW8A 3U6BA 2AWNA 2OZEA 1UDWA 2TMKA 3RRZA 1GIAA 2Z83A 4EFNA 2CCJA 2QUZA 4BFWA 3QKUA 1FTNA 3CH4B 1XPUA 2ZI4A 2RGGA 2H1LA 4QGAA 1G291 3U7HB 3FFAA 2ZR9A 5DN6A 3QKTA 1EFHA 4IRUB 1AN0A 3QEOA 4TMWA 5AUOB 3O8CA 1DAHA 1D9XA 1KY3A 1XD8A 2QA5A 2X2FA 3GEEA 4TTPA 1E9EA 1N6KA 3ASYA 1JALA 2JATA 4GT1A 2XSZA 5AUPB 2UZ3A 4Z54A 1K5GA 1Z2AA 2GJKA 4W9MC 1NIJA 2HT1A 3IDQA 4JLJA 5DI3A 3U4QB 1NMXA 3K9LA 2BMFA 1ZCBA 2PT5A 3X1WA 5KNBA 1UBFA 1L2TA 2W6JA 1J8YF 2GXQA 1NLFA 3W6OA 3ZD6A 1R2QA 4Q1AA 1P2TA 2VP6A 2DHRA 3LRPA 4LHZA 4YDSA 1R5OA 2ZYVX 3GJ5A 2GJ8A 4LK2A 1ZC3A 1Q1BA 5KSOA 2AD1A 3T5GA 1OYYA 2X1VA 1N2CE 2Q6TA 3AF3A 3K70D 1TF7A 2WJYA 4DLTA 3B1XA 2GZDA 4XTCS 4V0ME 2IK8A 3GJ8A 2CVHA 1SVMA 2C77A 1BIFA 4DIDA 2QGNA 2AK2A 4RZXA 4URXR 2BKEA 3QPUA 3T35A 2XTMA 4M53A 4XD7D 5BN5A 3AUYA 2OT3B 3FKQA 3MJRA 2W6IA 3N70A 4QG7A 4TLEA 4M9XA 1E9DA 1WRBA 2PCJA 3C16C 4LRWA 2QN6A 5SZKB 4NCIA 4Q9LA 1P72A 1RJ9B 1G7TA 1CLUA 1NJFA 1R0ZA 3RS2A 1ZAKA 4HUQA 5JSZB 4JLPA 5JMTA 3SZRA 3A6PC 2CBZA 1G4UR 2W6ID 5C2JB 1NLZA 4V0LA 1P9NA 3EIHA 4NYIQ 1GUAA 3FTQA 1MRSA 2BJVA 3UG7A 3AKEA 4M0LA 4TT3A 2QPAA 1AA9A 1KI2A 1CTQA 4XSHA 1VCNA 1NF3A 3VKHA 2MSCB 2W0SA 5JS8A 5DNYB 1ZIOA 5J4YA 2C9YA 1KYIA 1SULA 2A5YB 2RMKA 3QPVA 3Q9LA 4W7SA 5EE9A 1G21E 5IHPA 4KYIB 2G0TA 5JEDA 1RYFA 4DLYA 3H86A 2FH5B 3QF4A 1B23P 2WM9B 4HUQB 4N0DA 2ZQ5A 4NCNA 1OXTA 1Z28A 2HXSA 4TL7A 5CDFA 2MMGA 1QHSA 2NG1A 3TIFA 1N6RA 3TQCA 4KVGA 2PZGA 4HAUA 1EXMA 3IHLA 4HZUA 3OE7A 3IQWA 1E3MA 3LBHA 4C0SA 2IWHA 4Q02A 5JS7A 4NH0A 3NC0C 4LYHA 2RGNA 5GADl 2BIFA 4A8JA 2XZLA 1R7RA 3NIBA 3GJ0A 3TK1A 1QZXA 3PIRA 4JS0A 4NYMR 1Y3AA 4MGZR 4M1OA 3T5DA 2XB4A 1ONBA 1E2EA 4OI1A 4B32A 1GRQA 4EJSB 1OB5A 3N5CA 3THWA 1KIMA 3ZZ0A 4LHXA 2V8OA 5FUWA 1NVVR 1KSJA 3LY5A 1S9DA 1EFUA 3CF6R 4Q4HB 2IWRA 3SI7A 2PMKA 2D06A 2X77A 5EXPA 5B2ZA 3WMEA 4B76A 3K70C 2V6IA 1XXHB 1VCMA 2VQSA 3P26A 4W5HA 2Q9CA 1W2HA 2WJJA 2JLSA 4UNQA 1W5SA 5SZHB 2VTKA 5TY0A 3K8YA 3TVDA 4LOAA 5KOYA 4DLUA 4AKHA 4UNRA 1QVAA 1GNRA 3I8XA 4RZ2A 2CLDX 4URUR 3TW4A 2WAXA 3RC3A 2GKSA 1KI8A 5KU1A 1R8SA 4LJ6A 3B8HA 4BE7B 3PV0A 4A6PA 5BYJA 5E7MA 3CNOA 1AKYA 1CJKC 2CE7A 4B71A 1T8UA 3NEYA 5A0FA 4IEIA 3T1QA 4XOIA 1TX4B 2ZYWX 3B13B 4ARZA 4BEJA 3CR8A 1Z83A 5EE5B 1KHTA 2IT1A 4FCTA 1NY5A 4BFTA 3W6PA 1W0JD 3AGQA 1II0A 3KFXA 5JWOA 3FPAA 3Q5EA 3VU9A 3I73A 1E1QD 3WP0A 4UJ5A 3T1OA 1OXSC 5DHAA 2ODEA 5EUMA 4EPRA 4KI0A 2XX3A 3T15A 3FFBA 4BLTA 3PFIA 3VR1A 1MO4A 1JQJC 2OCBA 3NTUA 4FW9A 1E2GA 3ZYCA 3L0IB 1OH6A 1QRAA 3ZVLA 4PPFA 3FMFA 1UKZA 3ND8A 2J1LA 2IYXA 1AS0A 1CR0A 4GMXA 3FMOB 1NSTA 1P3JA 5L3SA 1E4YA 2JIZA 2P0EA 1BH2A 4TL8A 1T5IA 4P32A 2HYIC 2BBWA 3GD7A 4M1YA 3W3ZB 2JJ2D 1W4RA 5E4FA 4E5UA 1SVWA 2EFGA 1SXJE 2EFEB 1RE0A 2QBYB 2XEXA 1D8TA 2V9PA 1G41A 4NPHA 1P2SA 3AV0B 3B9PA 2BWJA 2C04A 4HLQB 4J0QA 5K8LA 4PO9A 4LYJA 3BXZA 2ZI9A 4AURA 4LUCA 4MITA 4B48A 1P9RA 1EX7A 1IBRA 2SHKA 1E0JA 4GFDA 2VP0A 1YJ5A 4HAVA 1XFAA 4PC7A 2YWHA 2WWFA 2JLUA 3R20A 4YMUA 3FYHA 1CRQA 2QORA 1CRPA 3R8CA 3HPQA 4TLDA 2HF8A 5D3QA 1G6OA 1FP7A 3SC3A 4V0NA 3QE0A 1C1YA 1ELOA 4JBXA 1DAIA 1GDDA 4XH9B 3GJ6A 1RRGA 4D0NA 1D5CA 4AI6A 5J40A 3P4XA 4CYMA 3AGPA 1DADA 4ZKDA 2XZPA 3TQFA 2RB4A 2OFXA 2G9NA 4UQOA 1E2MA 3FMPB 4TQAA 4X8HA 3EPJA 1GAJA 1ZRHA 2HXYA 1EFCA 1H8HA 5LB2A 5HE8A 3WNCA 4HSEA 2ZRAA 2JLRA 1ZCAA 1GFIA 4A2QA 3BBPA 1XD2A 1UBEA 4FN5A 4BECA 4DDTA 2FZ4A 1UEIA 1OSNA 2WV9A 2CVFA 3BC1A 3GLFB 1DAGA 4TWZA 1Z6TA 3R7WB 5LD2B 1KO5A 4JVSB 4MUBA 4I1VA 2RGDA 1E9CA 2WJVA 2AR7A 3U3OA 4AKIA 3U44A 1J90A 4DB4A 4ON9A 3ETLA 4NZYA 3W5JA 2C96A 2D4HA 2MMCA 4BRWA 4CT5A 3GJ3A 5LDDC 1Q3TA 1XNJA 2ZSFA 4AG5A 3NBZC 3RWOA 1M34E 3GLGB 4ACAA 4M1MA 5F9FA 3GLIB 2ANCA 3LX8A 1R10A 1EFRA 1G17A 1COWA 3NHAA 4RD6A 4X8OA 1UPTA 3EWSA 3RS0A 4AD8A 3I61A 3BJIC 1MO6A 1ZUHA 5FOTA 1U94A 3QQ5A 2RHMA 2OILA 4NHOA 4C0KA 4RCZA 1ZNZA 1Z0IA 3CRMA 5TARA 1KJYA 2JCSA 1CR4A 4RD0A 3IIMA 2Q21A 4Q1DA 5FPKA 1EFRD 2DWPA 3BFKA 4IOMA 4MGYR 3FGNA 4RKFA 5CIQA 4A8JB 4XWKA 2IF2A 4JLBA 5FI1B 3OAAD 2WZQA 4NDZA 4BLPA 2O8CA 4PPQA 1YR6A 2BEJA 2J7PD 3VHXA 5DISB 4PHFA 5K8UA 3F5FA 4PQYA 5DI9A 4LHYA 1DAKA 2C99A 2QMHA 4UXJA 5BQ5A 3I62A 1G20E 3GP8A 4O2LA 3SYKA 4A0HA 3CUEF 4Q1BA 1OH5A 3K0SA 2MSEB 2F1JA 2WICA 2OSBA 2NPIA 2WAYA 1UBGA 3RS3A 1BKDR 1U90A 3RNLA 4OJKA 3DEFA 1KI3A 4NCJA 3C41J 4HDQB 4BUJA 3ZD7A 1VYVA 2CHGA 1X8LA 3KXIA 5JWRA 4KLZA 4EAQA 3EC2A 1DEKA 4F7WA 5JJKA 2P6RA 2YJTD 1JR3E 4LYAA 5CITA 3NBYC 3IILA 1SQ5A 3ZS8A 1DOAA 1KNQA 3RRMA 1Z0AA 3LV8A 4IKEA 1G3IA 5SZJA 1Z63A 3LVRE 2V7QD 4BFVA 3AQ4A 4Z51A 1KY2A 4JJZA 4DUGD 2FV8A 4B3GA 1NSFA 4FMBB 1SVLA 2NZJA 5A5GA 3QENA 4Y0VA 5C4GB 3PUVA 4LYFA 1CR1A 2KBFA 2F43B 4YXWD 5DI3B 5K8IA 4MRVA 2LCFA 1Q0UA 4FCWA 1UADA 3RYTC 2ZRLA 2QAGA 3DKVA 2C5LA 3R9XA 4DUGA 3U3RA 1O87A 1ESNA 1MR3F 1KJZA 2IEZA 3AVPA 2CK3D 2WWHA 5KNDA 3ZQJA 2P5SA 3EZ6A 4RY2A 2JLXA 2PH1A 3L43A 4PQRA 3FOZA 1S3GA 2D3WA 2QE7A 5JRJA 2BMJA 1G8FA 1YRAA 3E2IA 1T91A 3SHWA 3QKSA 3PQCA 5JI2E 5F2EA 3MMPA 3B82A 3B1VA 3GLHE 2P3SA 4C0LA 1SXJC 3CPJB 5DN6D 4NU0A 5D3MB 1QHNA 4JYBA 5HZHA 4EDHA 4AYTA 2C2HA 2ZU6A 3LDAA 2OESA 3B1WA 1SHKA 2OXCA 1CS4C 4YC7A 3REFA 1AIPA 2O8BB 2ZRKA 3TUJC 1ZM9A 4JLAA 2QAJA 1MH1A 3PG5A 4LPSA 1FQJA 4RD1A 3W8NA 1NG1A 1JXOA 3HDTA 1NLYA 1R4AA 2ZUBA 3CONA 4KFTA 4Q48A 2EYQA 3SQWA 4QJ4A 4OQXA 1NVVQ 4FWTA 5DYGA 2BHRA 4B3CA 3FHOA 3VNUA 4LPKA 3T61A 4DSUA 4P4TA 2JDID 3SHFA 1XDBA 2D2EA 1M6NA 5EXTA 3MCAA 1W46A 3HR7A 5L3VA 3ZLJA 2WWGA 1KKMA 1TUEA 2YOHA 1WMSA 1CIPA 1HTWA 4G5OA 5FPSA 4I1UA 2O52A 5FBRB 1U0JA 1KSGA 4UNSA 5J4VA 1W5TA 1OT3A 1XCPA 4Q7LA 5DYIA 1E2JA 1G19A 1XWIA 3OESA 2JIZD 4LY6A 2ZR7A 5DE3A 4JLDA 3GFPA 5HTKA 1KTVA 2J0UA 2QRZA 3TSWA 3UMFA 2GRJA 2ZAOA 5C18A 5EUQB 2YZ2A 1N5IA 2ATVA 2R2AA 1PLLA 3KXKA 3F8TA 3WMFA 4D81A 1ODFA 1QHHA 1G18A 3AP2A 4JIMA 4TMTA 2AX4A 4JLKA 1OKKA 3UK6A 3MWKA 2OLJA 5G41A 3QKRB 1XTKA 2WJIA 3FMIA 4A2PA 4DT1B 2ZRFA 5L3RA 4JBYA 3OIWA 4PSAA 2IA5A 4EPVA 4YQFA 3DPUA 1W36B 3T06B 5KPDA 3KJGA 3W6NA 3L0PA 1ZM3A 3RAPR 3RLFA 1G7RA 1QHYA 3GQBA 3EASA 2QGZA 1DS6A 3TR0A 2VF7A 3K0AA 4OHVA 2YOGA 5HKKA 1ZM4A 2QM7A 4G5SA 4ZPXA 1BS1A 3GLGA 3I5YA 3ICEA 1KSFX 3C5CA 1SHZA 4Q9JA 1FNNA 3E5HA 2OAP1 2QPTA 3OEEA 2BM0A 2OCPA 1XB2A 2ZI5A 3EC1A 3I72A 5K8TA 1RPZA 3BH7A 1KZ7B 1E6CA 2N1BA 2ZUCA 4MGIR 2NGRA 3BORA 4WZBE 1YZQA 2REXB 2W2TA 1LNZA 2XAUA 2QRNA 4HEJA 3WHKA 1DARA 4TTQA 1XEXA 4XVUA 1TF2A 4U7DA 1T4GA 1Q22A 1WCV1 2FMXA 1VYTA 4ILEA 4BGDA 1GNQA 4C7OB 1F2TA 4PHHA 2B8TA 1SVSA 3NKVA 1KO8A 2ODWA 2ZRIA 1XF9A 3DKPA 4OQFA 4Q4AA 5IF9A 1FNMA 1TMKA 2H8KA 4ERNA 2R62A 2ZJ8A 1Z07A 4F91B 3MJHA 2I4IA 5JJLA 1QHXA 4G5RA 1XPRA 4MGKR 3DM5A 1Z5ZA 1U8ZA 3WRXC 1ZU4A 5C4MA 3OEHA 5JI3E 2ZE7A 4M9QA 1S4QA 4EFMA 1XRJA 3VAAA 3B2EA 4CIDA 2BOVA 4LX0A 1KGDA 4D82A 3VKWA 2W83A 4FIDA 3CRRA 3IO5A 3KB2A 3LQRA 4GOXA 4IOLA 3QVVA 4OI4A 1DAMA 2CL0X 4M8NE 3Q5DA 1E0AA 1AZTA 4AYWA 5IT5A 1E2HA 4XVQA 5JWHA 5A4JA 4D6PA 3RS7A 5F98A 1DTSA 3KKQA 1GSIA 3UATA 1ZP6A 3KQKA 3CF0A 4IXNA 2IS1A 4RFSB 4NYIR 2ZRBA 2Z6VA 3SE0A 2B92A 4BEBA 5KSPA 2LKCA 1J2JA 2A9KA 3R8FA 3WBJA 1XEWX 1IJEA 3DZ8A 2PZFA 2GBLC 2QBYA 4TMVA 2QMOA 3PR1A 3EAQA 3ZS9A 2F1IA 3NHBA 1X1RA 3AF1A 3IPXA 1B0UA 2VP9A 3WNDA 1FP6A 2ZYUX 1E2LA 1XPOA 4OI2A 1L7VC 2O0HA 2ZSEA 2PCLA 1G5RA 2CMKA 2RKOA 3QG1A 1Z6AA 5EE1A 1Q1QA 4S2EA 2H92A 5FUVA 2I1VB 3CBQA 3D6TB 2F6RA 4Q19A 4I81A 4B6FA 1A4RA 2HEIA 4Q18A 1Z6XA 2ONKA 4DEYA 2XTNA 1G3MA 1DELA 2ZI3A 3LX5A 4H1UA 3K0FB 4QJ5A 3LH5A 5D3MA 1ZBDA 4P4UA 1SVKA 2R6GA 2ZRPA 1GILA 2V7QA 2ZS9A 4IHQA 4V02A 3NVAA 3RS4A 2J46A 1HYQA 3OFNA 5AJZA 4DLSA 1LF0A 1JPJA 1F2UA 2EVWX 2AWOA 4TLBA 1UKYA 3JZMA 2REOA 4R2HA 4PTLA 2A5JA 3V9PA 5KNCA 2ZVQX 3EPKA 1SXJB 4QM7A 2IYYA 2OFWA 2C9CA 2XTZA 1UEJA 2QU8A 2GK7A 1QVRA 1TU4A 3PEUA 3ZGXA 1CJUC 4NL4H 1OFUX 4LBWA 4DCSA 3DMDA 3K0FA 3QI2A 3VR5A 4GOJA 4IOJA 3E1SA 1D2NA 3RHFA 2GILA 4MKGA 2PJRA 4RKEA 4NBSA 2IUUA 3MAAC 4RVCA 2QPOA 4Q47A 2XOKA 3OEED 4URWR 1G64A 3A58B 3IBGA 1Q3HA 1ZINA 1JBKA 1KZGB 3P27A 4W5WA 3IIJA 2FDCA 2NO0A 2YWEA 3QVUA 2IS2A 3KKOA 4B74A 4JSYA 4QGFA 1OXVA 3AVYA 2BCGY 2JA1A 3AVOA 3L2OB 2A2ZA 4E03A 4B3XA 4PAQA 3CWQA 4KU4A 4BFYA 4K81B 3AKDA 1SZPA 3HU3A 4TLCA 4JSTA 4UNNA 4AG6A 3A37A 5FUYA 3U2QA 4N0EA 4KFSA 5FPYA 3ND9A 1WXQA 2HF9A 3C7KA 2PL3A 3PVSA 2V55B 2V3CC 4X8LA 3HPRA 2BJWA 4PZLA 2J41A 4FINA 3BOSA 4KSBA 4TQUS 2VLIA 2VSOA 3KJEA 3SJAA 4C4PA 3QBVA 1OF1A 3QY0A 2BEKA 1F6BA 4D4KA 4EKDA 2N42A 1E99A 1LS6A 1U8AA 5IK2D 1E9AA 2X2EA 3U3JA 1M7HA 2UVQA 3I8SA 3FVQA 2QNRA 2NTYC 2KB0A 1VDZA 3SU8A 1NP6A 1IN8A 1L4YA 1JEEA 4OK3A 2GVDC 4DSNA 3SOPA 4A6XA 3HP1A 3RABA 5FOVA 3HYTA 2QMUA 4BLSA 1Z3IX 2JASA 2VA8A 4BLRA 721PA 1TQ4A 3WYAA 4CZ2A 5AJWA 1I4TD 2EFCB 4Q7JB 4XSGA 1ESMA 3BD9A 1G8YA 3GEIA 3TMKA 2BCJQ 4B3DA 2FX3A 2GEDA 2O8EA 1NBMA 3SR0A 3BFVA 4Q4JA 5CLLA 2XNDA 3CM0A 4JKYA 3I1FA 4V0KA 4AKEA 2IS6A 2I3BA 5CLQA 1BMFA 4MKIA 3MWLA 4YLGA 4CEHB 4PAMA 1GG2A 4C2TA 1N3BA 4PFSA 1XX6A 3FKSA 4HB2A 3H0KA 4XWOA 3K0CC 5KYKA 4BZQA 4XJXA 3TKLA 2ZS8A 2EFDB 3ZJYA 1RRCA 2CLCX 1PUIA 1II8B 3UG6A 3GLHA 1OIWA 2J0VA 3QXXA 4TMXA 1IQPA 3NH6A 3I92A 2IC5A 4Q03A 1MABB 3FKSD 1QBKC 1CJVC 3C14C 4MYCA 1M7GA 2HT6A 2F9LA 5DIFA 3IKJA 4DEXA 2EU8A 2IYWA 1LW7A 4D4JA 2E87A 1SKYB 1ZD1A 3V4FA 1G3UA 3GFTA 2DY1A 4JVLA 1LVGA 1X3SA 2C03A 4QJ3A 3O8BA 3KQNA 4A0RA 2X8AA 3A1VA 1CKEA 2H57A 3IHWA 5EZ6B 3EZFA 4XD7A 4L15A 4LJ5A 2QAGB 1MOZA 1GITA 3QXJA 3TH5A 3KKPA 1KDOA 1IY0A 3KZ1E 3N2EA 2YWFA 1OPXA 1VECA 4WXPA 4KHZA 4DCUA 4BZPA 1LY1A 4X8MA 5TB5A 621PA 2IHYA 3W90A 3DL0A 3VKGA 1H65A 1TADA 1W0KD 4DSOA 2FFBA 1RW4A 4RZUA 3BB4A 1W48A 3QSYA 1DAFA 1OFHA 1FOEB 1S1MA 4LC0A 1GP2A 2CEAA 4R7ZA 3TR5A 4ESVA 4AYXA 4MDEA 2EW1A 2RHDA 3UANA 4KITB 5CB8A 3UPUA 2L0XA 1VCOA 3CRW1 4IVPA 3NDBB 1G4AE 3ZVNA 1U81A 1FL9A 4PC2A 2FWRA 3R9WA 2WJHA 4C3ZA 1UAAA 3TLXA 3A1TA 2C95A 4YXWA 5KTYA 4ABYA 2GEVA 1UKEA 1GM5A 2IYVA 1YVDA 4LBVA 4MQBA 4F4IA 2ZRGA 2PBRA 3F0TA 2F55A 1CP2A 4LJ7A 3LW7A 2VHTA 3THOA 3I3SR 1SGWA 4M9SA 3ZVRA 3CWZA 2VEDA 5JBQA 3BWDD 2C9OA 4M1TA 4B35A 4LJYA 4IVQA 1JI0A 3PENA 5E7JA 1M74A 3X2SA 1U0HC 2AK3A 2QE7D 4NMMA 1Z08A 4OQNA 1NG9A 4WBSA 3VQTA 2VHCA 4DCNA 1BO6A 3EZ9A 2ZS7A 2OLKA 5G40A 2FNAA 1YZKA 1WF3A 4NYJQ 1TNDA 2FG5A 5FOSA 1MKYA 4GI7A 5KDDA 3GMTA 4ZO4A 4G5GA 1V5WA 2RGCA 2VSFA 3LLMA 821PA 3VNVA 3MLEA 3P1JA 4E07A 2RH5A 2IYZA 3W3AA 3KTAA 2W2XA 3ZVMA 2ORWA 1L4UA 2W58A 2G3YA 2J59A 2IS4A 4OK6A 5SZIA 3Q85A 1IXRC 1KNXA 1VYUA 2NO6A 5H70A 4OI0A 2PMDA 1ZNWA 4DB2A 1XXHA 3ZZTA 4PSKA 1VG1A 4RD2A 2VHUA 3LVQE 4M21A 1RRPA 4PPNA 2B8WA 4GZMA 4P4SA 2QTHA 4NTZA 1FMJA 1DG1G 2V6JA 3L82B 4P33A 4OHZA 3PEYA 2WSSD 2FSGA 1JR3A 2ERYA 2RGXA 1IOZA 4GBMA 1NKTA 4QHTA 1XTRA 5HR5A 1N6IA 1I2DA 4OYHA 3J81k 3OIYA 4HB0A 3AVWA 1G1MA 3KX2A 3B6EA 5FTLA 4LZZA 1XD2B 2OBMA 3VR2A 4TT3D 4MRPA 4NP6A 3T1VA 2RCNA 2HCBA 2GA8A 5FBVB 3KDSE 3SBEA 4CVNA 2FEOA 3SJCA 1G7SA 4PANA 4JLMA 4RFVA 2EYUA 4XIGS 4GZLA 3H4MA 2R6FA 4MKFA 2DWQA 3TJZA 3WP1B 5C1BA 2ZM5A 3U44B 3G82C 3BS4A 2QENA 3K9NA 2A5DA 2BVNA 3EA0A 3TAUA 1OKKD 1TAGA 1XZPA 3LD9A 1JR6A 3ICQB 2EWWA 2O8CB 5CDFE 4B43A 2QL6A 3DO6A 1UJ2A 4URVR 3VTKA 2VYFA 3PUWA 1BYUA 1Q57A 1GL7A 2ZROA 2G1KA 2IXEA 4BLQA 1HE8B 1PZNA 3WHLA 3D8BA 4LHWA 3L0SA 4OL0A 1NBME 1ZM7A 1TL7C 4KODA 4P31A 2KWIA 3BH0A 4DC9A 1Z8FA 2C78A 1CU1A 1KK0A 1F48A 2DFKB 2R44A 3KJIA 4FMCB 5BW8A 4H1VA 2D7DA 1U0LA 5LD2C 2P6UA 5GVRA 4BPBA 4I1OA 2P67A 4BASA 2DCUA 4QFMA 2IYSA 3EG5A 3RRYA 2F3TA 4MRSA 1YZTA 4BQSA 3TUZC 3W5IA 2GAOA 4D26A 1XEFA 2XSZD 3KXLA 1YKSA 1JJ7A 4GMDA 1EK0A 3B1ZA 2ORVA 3C15C 3B9QA 1IY2A 4U02A 3QBTA 4URYR 3QG5A 3K1JA 2G88A 5JFGA 4PPGA 4KBFA 4C9BA 4A4DA 3GLGE 3ZIAD 2FFAA 1I4DD 1R5BA 4O25A 4TLAA 4PHGA 5AJXA 4A0GA 4DDVA 4L8GA 1MO3A 1N6NA 3LNCA 3BK7A 4M1WA 1OE0A 2ZANA 4DLRA 4JLVA 4JT4A 2A78A 2AFHE 1ZJ6A 1W0JA 2FGJA 3WNBA 1KAOA 1ZW6A 2JJ2A 4CW7A 3M6AA 4EPXA 2OM2A 4MDFA 4EPYA 1E0SA 3AP3A 2C98A 1QDEA 1ZMXA 2FE4A 4GNKA 4HYYA 4NONA 2YKGA 2W6JD 1GVNB 2C8VA 2PX0A 1Q21A 3FDIA 3JZAA 5DHFA 4CEHA 2O8DB 5EE0A 1P62B 1XD9A 2ZSAA 4A8JC 2O8DA 3CX8A 1UFQA 1OYWA 2GCOB 1KMQA 4GP7A 1BYIA 4C30A 5CYOA 2GCNA 1VKJA 1T8TA 3T1TA 2ZITA 3U4QA 3C8UA 1W44A 3B1YA 3ZH9B 2QSYA 1S96A 3MSXA 4Z1MD 2ZJOA 2KSQA 4JL8A 1P7CA 2JDIA 1A1VA 3U61B 1GWNA 4EFLA 4JYCA 3K70B 1W4AA 3RSLA 3PITA 3LWNA 3OFND 4NE2A 4QBHA 3GLIA 4ZDKA 5H8WA 2ZI7A 1E2IA 2FN4A 2Q3MA 4IDNA 2I1QA 4R2IA 1DG3A 2ZE5A 2D7CA 3RC8A 4U5XA 1PLKA 4ZDWA 4DSTA 3HU2A 1NN0A 2J0QA 2FF7A 1G5PA 4PHTA 2CHQA 1EG7A 3DHWC 1X6VA 1YZUA 2W2VA 4D0GA 1KK2A 1MV5A 2IF0A 1T0HB 1F60A 2A7QA 5ANRB 5KSYA 3TW8B 1OB2A 4JVMA 2ZREA 3SBDA 4ASUA 3ZQ6A 2CHVA 1OHHA 3NBXX 1XBTA 4B75A 4B33A 1KI4A 2FPMA 3IO3A 2GAAA 2WWYA 3X1YA 5L3QB 3PEWA 1W4CA 3A4LA 2REBA 5FOXA 3CZPA 2ZJAA 3WBKA 2IW3A 1RRFA 2Z0MA 2DFLA 5EP1A 1YQTA 2KI5A 4K46A 3LXRA 3A4MA 3VHLB 4DXAA 4G01B 1H8ED 4I4LA 4UXIA 5FTJA 2F1HA 5DGXA 4RZ3A 4LC1A 1Z6YA 4QL3A 3D3QA 4B3FX 1COWD 5DLQC 2QAGC 2G83A 2O0KA 4IJMA 1Z6GA 2XJ9A 2FOLA 2IUTA 2XNDD 4TMZA 1HY3A 2YNMA 2AFIE 1OXUA 1UBCA 1XCGB 5L3QA 3PUZA 2VHQA 3IIKA 2HYDA 3OE7D 4JKIA 4M9ZA 4CEJB 4CRWB 5JHHB 2VF8A 4CEIB 4CEJA 4GDFA 2XITA 3SDZA 1QHHB 4B2IA 1E2QA 2VBCA 2NMVA 3BB1A 2XZOA 1PUJA 4YDHB 4EPTA 5EXSA 1G6HA 2IBMA 5B64A 1N5JA 5KO2A 1OIXA 4LJAA 1XJQA 1DPFA 5EE3A 3Q72A 1OXXK 1T3LA 3BB3A 1W47A 1L8QA 4Q1FA 2NOAA 1KI7A 3QNUA 2D74A 4Q4AB 2QSZA 1LS1A 1NKSA 1T9HA 2OBNA 5J47A 3W9YA 4YMSA 2WIAA 4IDPA 4Q01A 1J8MF 1XZQA 1D9ZA 1KKLA 2GZHA 5BXQC 1JECA 1HA3A 1VG9B 4US2R 4HLCA 2HCJB 1Z2CA 1E79A 4NYMQ 1US8B 4Q9IA 3K09A 3A1UA 2PJZA 4RFSA 2ZJBA 3OAAA 4KSCA 5J4HA 3GLFA 4IXMA 1R0YA 1FPMA 1IAQA 4OHXA 1Q12A 1XEXB 2HJGA 4R98A 5FL7D 3DVLA 5EZ5A 2JLWA 4TSFA 4QHYA 2O8BA 1ZM2A 1N5KA 2YYZA 2WWWA 3O8RA 4OHYA 1SKQA 4KYUA 1T6NA 1F2UB 4OBEA 1NI3A 1JNYA 3CKLA 2DYKA 2O8FB 2B21A 2LWIA 1HQYE 3PEVA 3QXCA 4Q7KA 4QNMA 4N1AA 2JEOA 3MRSA 4TSFD 5FTKA 4V0MA 3WXMA 4DLXA 2YC2C 1CJMA 3A1SA 3GFOA 1A7JA 3CX6A 4A0FA 3EIEA 4MRNA 2JLZA 1MT0A 2GXUA 3WY9A 1AZSC 1E69A 2GCOA 2GK6A 2R9VA 3B5JA 4G5QA 2DB3A 1ZNYA 3MUFA 2OXRA 4LBYA 5FOUA 4LJ8A 2JAQA 3TUIC 2ZRDA 1JB1A 4QGHA 3VR4A 1N6LA 2ZJYA 3OIVA 2AD5A 5CJ2A 4D0LB 1VHTA 4TYPA 1I2MA 2AKAB 3BH6A 2FGKA 3CZQA 1DO0A 2H7VA 3K09C 2FA9A 2FEMA 1I4LD 1WE2A 3SS8A 2GTPA 2IUSA 2WHXA 3EZ2A 1E2FA 4PO1A 4TYWA 1HT2E 2EQBA 3VR6A 2BBOA 3EX7C 2VSXA 2CCKA 1UKVY 5FR2A 3QJYA 2WVJA 3S1AB 3QKRA 2CL7X 1S0UA 4ZDIA 2Q3HA 4TZ6A 1NJGA 2BBTA 1NMYA 3D7MA 2YWGA 3EZ7A 2Z4SA 2P65A 1HE1C 4IFBA 3DMNA 2VL7A 2Z5FA 1M2OB 5TDHA 3HJNA 2DR3A 5FI0B 2AXNA 3X1DA 1BOFA 2ASEA 2ODBA 1ZC4A 5JHGB 4B2LA 4WA7A 2WKPA
chains in the Genus database with same CATH superfamily
2AUMA 3L6EA 4PYIA 1KO4A 3EMDA 3R7DA 3DONA 3ZZMA 2Z98A 4HNUA 5IH7A 2JIMA 4JP1A 5LBUA 2I78A 2Z2KA 2BI7A 1RCTE 3JAWB 1RXVA 3CLUD 4G89A 2HJWA 3OPVA 2PV7A 2FR1A 5GJBA 4ME6A 2YDXA 1YR1A 3JARA 3I2HA 4JEUA 3AZQA 1CHNA 2YYYA 1L9KA 3CH5A 4IDQA 1OFUA 3GT4A 1OLXB 3ZI0A 5KCZA 2A8YA 3WWDA 2OVBA 4Y98A 4UHEA 3LA6A 5C8VA 2ZJ5A 3JWJA 4B5LA 3K5IA 4LBZA 1E66A 2RC6A 3H1PA 2MWMA 3TXYA 1SKYE 1IONA 2Z5VA 3BE6A 4J0KA 1YO6A 1EFTA 1KY4A 3VV2A 1U02A 4DV0B 2I4RA 1JPNA 3AHJA 2IJGX 3G6KA 2W00A 2C82A 2BRUA 2FSHA 3MGBA 4O4IB 4F6RA 1JIVA 1KVTA 5JISA 1IXKA 1DIBA 2C7VA 3H13A 3FETA 3H2KA 1WXDA 1IN7A 2ZAMA 1IJFA 2LIPA 3B1FA 3ZU4A 2NTVA 4LKOA 1N6PA 2VPYA 3DZFA 1B6RA 2HJVA 2FLKA 1D1PA 2Q62A 1T0UA 2Q9BA 1XTIA 1CP3A 2XW6A 2VH2A 3LCUA 4G86A 2XLCA 5IS2A 4QOSA 1L5RA 2YJGA 3LLSA 4ZVMA 3OQBA 3WMGA 5U4QA 1XHLA 3CB4A 5CCBA 3IUMA 1P7YA 1KZ1A 2VO1A 4AL4A 4ATNA 3W7BA 2BSAA 4ZOLF 3V42A 3ANSA 1II8A 8GPBA 1RRMA 4J1TC 4ETNA 2WAAA 1GUBA 4KQWA 5A4KA 3PQ5A 4JI4B 2QG6A 5C7OO 1MB9A 2WMNB 4U1RA 1PTJA 4A92A 5ERGB 4D9JA 4MW4A 5L8VA 2IYFA 4JUDX 2JW5A 1OW3B 4R6XA 5EJAA 4DTCA 1E5LA 2O23A 5G1OA 3L8YA 4P7BA 3N0XA 1EGMB 5EP2A 3V7FA 1IHDA 1U2RA 1Z62A 4D0SA 3RUIA 4ZQCB 4UE2A 3MAGA 2CYBA 1I01A 3BGOS 3LLUA 3LWDA 4RJKA 4E4RA 5JLJA 5KNDH 4DPKA 3U7EB 3FCOA 5BN4A 4BO3A 2XB2A 1GDTA 2ZDHA 1NBMD 2G76A 3OKPA 3KZXA 2IE8A 4GD3Q 3O5AA 3D4NA 3EGVA 1Y7PA 2E2WA 3JQAD 7GPBA 2OPBA 4EW2A 5JCXA 1T5LA 5IAEA 4UKDA 5CW2A 3PFKA 2ZE8A 1RJFA 2F3RA 2GEBA 1P18A 3HBLA 1QGYA 4GP6A 4J2HA 4KOAA 2X8JA 3SQLA 2ZIUB 2HJ9A 3TLAA 4RK0A 3C4QA 3KLPX 2I7XA 4B3BA 3BE8A 3GB9A 1UM8A 1LFDB 2XYGA 3ILXA 3C3BA 4EO4A 1LLDA 3NGXA 4CIBA 3ZJ4A 3WRWA 1UQTA 5TMPA 2OFOA 3NETA 2JGMA 5H02A 2PMEA 1NPDA 5HIAA 5ALMA 2QUAA 1N5DA 3U4IA 3TIGA 1RQLA 1EMDA 4ODIA 3L6UA 3UA3A 4GZ3A 5C1DA 1CIVA 4AUKA 2PZJA 3ESYA 2P9EA 1T4CA 4W82A 5GV7A 4IS3A 3ZZ1A 1VGRA 1OJ7A 1X8KA 4EPWA 4KXQA 1CQIB 2R87A 1K8RA 2BN4A 1C4KA 1TVKA 2D5IA 1YUMA 2QRVB 3JCZA 1ISFA 3VPXA 3VR3A 3SM9A 1XVTA 4DCPA 1U2GA 2WU4A 3COVA 3H05A 3FVWA 4MS1B 4DJTA 3DO5A 2OXEA 4H08A 1SB9A 5DRTA 3W6ZA 1NQXA 4WUVA 2WA2A 3QELA 3BJEA 3O8DA 3P20A 4MCHA 4X6UA 1N2HA 1Q7TA 5JS2A 1KJ9A 1MC5A 1R6BX 1Y3IA 2HIAA 2QZZA 5K5EA 5MN4A 4LXIA 1RADA 3O91A 3TM4A 2GLTA 1DVRA 1C4OA 4YONB 1P2VA 2HDHA 1GLVA 2BDTA 4MUFA 4EG8A 3O8OA 3L79A 1JMKC 3OLWA 1LEHA 1NOJA 3K8ZA 3UXMA 4LMPA 3RREA 3VC2A 4YV0A 2AL7A 3N7AA 2BFEB 2C4KA 4MV0A 5MFZA 3TSOA 1ISHA 4NCHA 1KDVA 3B9RA 3CEHA 2VAPA 2OFFA 1LA2A 1M0EA 4WKNA 2YVLA 3ZCPA 1WB9A 1GGKA 1GQ2A 2XODA 1RKBA 3SEAA 3ZBQA 1R6UA 4L3VA 3LFUA 1TTPB 2DPGA 3ORSA 1G5TA 4KQ2A 4PG4A 4QU0A 4FWIB 2FUKA 2ZGVA 3ITDA 1U3FA 2CLSA 2J9RA 1TEXA 2OK7A 3OHSX 2R1UA 3TRIA 1VKOA 5JJ5A 3MBIA 1W4BA 2NQ2C 3OJ0A 3FF4A 1OHHD 1NBAA 3VNQA 4AKTA 1M6YA 2C7OA 3L1UA 4NEHB 3FOBA 1LKZA 1UF9A 1LBHA 4NDNE 4RAQA 3OX3A 2ZWOA 3RSZA 2BGTA 3QK7A 3MCVA 2CNWD 1K9SA 1E98A 4ND1A 4WZAA 1E2NA 1X7YB 4OL9A 5JCOA 1RC0A 4ZCIA 2JGNA 3ZV5A 4QE3A 5JO0A 5EMMA 4EB6A 2MSWA 2ABWA 1QFZA 1H0HA 2BMEA 3ESAA 2B0CA 5IDYA 1ADJA 1FUUA 1TJNA 3EYAA 3MHPA 1AS3A 3MNFA 2P2LA 1ZQ1A 2WYUA 3H6HA 2V1UA 4EUKA 2M1ZA 1P3DA 3OMLA 4ZU1X 1NN3A 3DDUA 3MOSA 3V1YA 2IH5A 1PEKE 5M04A 2A5GA 3UT5B 4B4KA 4C0BA 1O95D 3CRVA 3DEKA 4Y9UA 1ZK1A 2VKQA 2B7LA 3AUAA 3VO1A 5HIKA 4G1UC 1RE1A 1WDWB 3W8FA 1BHSA 1E7SA 1UOOA 4YBZA 2J07A 4KJXA 5B3JA 4B3JA 2DE0X 2IHBA 3IERA 4GOKA 2XY4A 1FX0A 1HUQA 1SOUA 3LRTA 1TM3E 2HMTA 5HOQA 1ZWKA 2RKWA 4OQQA 1AC5A 2MYTA 2WZDA 1IHYA 1ZHFA 2LDXA 4MVYA 1E9SA 4I99A 3ESRA 3N2IA 1NKVA 1OWPA 1E9FA 1JDSA 2ST1A 1NY6A 2YS7A 5C3MA 1FFWA 1JWLA 3TZKA 2G5GX 1IEWA 1QIKA 1VIVA 1RYMA 2VSNA 3P0HA 4G24A 5I6DA 4AXBA 3T41A 4YMWA 1LSSA 2WJ6A 1K2VN 4XRGA 2I8LA 4O1IA 3CNNA 3DBIA 2Q4BA 1K68A 1GRVA 4JLNA 2C97A 4G65A 4RVDA 5FT9A 1OBCA 1RVDA 5E9WA 3RIEA 2DQSA 2QTBA 4CKCA 3DMGA 3AILA 4RDHA 3B53X 1SWVA 1JHPA 2GFHA 3DAGA 1I3CA 4IDOA 4HNQA 4K6CA 4FXPA 1G2PA 1Z2PX 5LMZA 1X9GA 2OUKA 3WSVA 4C76A 3AL0C 4RHEA 3UAYA 3V4OA 3FY4A 4N5DA 3DZKA 4HDOB 1NP3A 5ESRA 3S7ZA 5A5FA 2XUQA 3NGMA 1LLCA 2AKEA 4DDWA 1WP9A 1C0EA 4WHMA 4C7OA 5DOVA 1B1AA 5TV2A 1Y8AA 3CZAA 2YXLA 1Q20A 4ER3A 1E20A 5JV5A 5GIOE 1JHRA 3RIHA 1B7GO 3CZRA 2XUJA 1GKIA 4LQCA 4EP1A 4Y2SA 3CUYA 1XJ0A 1KH2A 2A0UA 2ASVA 3A7DA 3PHJA 3GXBA 4IIDA 4WCFC 4W9RA 5KAPA 4ASUD 1T0PA 3U80A 4OP2A 3BFXA 1BHO1 4KQEA 7REQA 1YJCA 3SF8A 5A6VA 5ESDA 1YONA 4F97A 2GLUA 4L6CA 3RG8A 4CIWA 4C20A 3X1XA 2AQ8A 2FPKA 1V2GA 5DTJA 1UQUA 2FPPA 3PI7A 3NHYA 5HKKD 3I5XA 3CZMA 4CKYA 3PGXA 1NXVA 3JQ9C 2I7TA 3ZY6A 3D6MA 4HXGA 1DXOA 1U9ZA 3KDAA 4JJAA 4WN3A 5E1MA 5G3YA 4KH0A 2Q3BA 5BV7A 4NU8X 1EZ4A 1L7NA 5CH5A 4MEBA 4O5OA 121PA 1ETUA 1ENOA 4E32A 3U4MA 1R12A 3C3WA 4BBZA 1XZNA 5F33A 1P81A 1E2KA 1FNSA 2UYYA 4OA8A 1A9QA 5I4BA 1YV9A 4R71A 4G97A 5IDVA 3E1GA 2E82A 3I4LA 1ZN2A 2JAUA 3D7RA 1NWCA 4OB6A 4X92A 2C4TA 5CVJA 1E5TA 2ZTHA 5IPFA 5BWNA 5GY7A 2O59A 2R00C 4UUMA 4HFJA 3SJZA 3AH8A 3SQMA 2I91A 2UZIR 1PJ3A 4CU2A 3JD0A 3MFYA 3GGPA 3PGJA 1GQFA 3M1IA 1O6FA 2VQ3A 2AA3A 3ZWQA 2F7SA 3NH9A 4AIIA 5T7BA 3P2EA 1FA9A 1DWQA 4HNAA 4HGOA 2Y0EA 1D2EA 4GQBA 2GHQA 3HEAA 5IAJA 2FFRA 3LBNA 5IBQA 1TPYA 1UAGA 3CNQS 3JQFA 2W70A 3ZUGA 2HHHB 1TECE 1UBLS 1TUBA 2XRMA 3DYIA 4LRSB 1QHIA 3HY4A 4M1SA 4X1YB 1OH7A 5EJ7A 4FOSA 4YJ2B 4NNJA 5H81A 3COZA 4LA4A 3K94A 4MQ4A 3AVQA 2JJ8A 1LSOA 1OROA 2Z43A 4FGJA 4IW3B 3UXEA 3W7AA 4E11A 4WZ6A 1AV7A 4AICA 1M2NA 4WBNA 1MA0A 4KN5A 3B3JA 2NNLD 2HWWA 3QLVA 4RWEA 1NMZA 3ZWXA 2HLDD 2EHJA 3GRZA 2QP3A 2IEYA 4HLUC 3GELA 1QC5A 1S6YA 2MIIA 3M3PA 5M7EA 3EIXA 4GLBA 2WA1A 3LL7A 4BVBA 4K0KB 4PRLA 4CQMA 3H9GA 3RRBA 4MUKA 3HXOA 2XMQA 3HA3A 3M9LA 1NIPA 3PQ4A 3MCZA 3RTDA 1HYBA 1PT5A 2I2BA 5DH9A 2CWDA 1UKCA 2C5FA 1QP0A 4BC0A 4QOJA 5C46F 1CEYA 1MB3A 1JSRA 1WDTA 1MMFB 4JOQA 1QQ7A 2BEUB 4IOKA 4PHCA 2X7XA 2JLVA 1G8JA 1TA4A 3CWCA 1N2CB 3WYFA 4G4GA 1EZZA 4W1SA 5DT9A 1F2DA 2QG4A 1ZJJA 5EXXA 3ER9A 4M7WA 3UN1A 4OX9B 3FPHA 4JQOA 3ABOB 4ZJUA 3N8KA 4OM8A 1EFPA 4QARA 4WZBA 4RSRA 4CHTA 1HURA 3PI6A 5ETJA 1SCUA 3AEQB 4CLHA 1LUAA 1ZUNA 2BV3A 3T1YB 3AHEA 2FETA 4X65B 3SC2B 3M0EA 2RGBA 4QYSA 4HB4A 1KO7A 2V54A 3CUTA 4LF7B 3GGOA 2SKDA 5CK4A 4P4GA 2BONA 4QSMA 4RTNA 1ISMA 1T0JB 3LY9A 4XE5A 2C84A 4O4LB 1UUFA 4UMEA 4RACA 2O7NA 1Z9BA 3JQBC 1JGTA 2CXRA 1C9MA 1SCIA 2L69A 1MDBA 1XVUA 2OMKA 3C5HA 3OZEA 4IL5A 5ALDA 5HCNA 3ZE9A 4CIXA 4J7AA 1M8PA 3L7NA 5HFAA 3ANNA 1VPLA 2CNWA 1HH4A 2RHRA 2ZBUA 3DO8A 3RSCA 3TTUA 3UHJA 1U4OA 1YZGA 3GGCA 3TLMA 4RTJA 4OYLA 4BV3A 2K7FA 2PSEA 4QNRA 1FSZA 4FKBA 4OHBA 1LBSA 1JZQA 3IEXA 2AOVA 2FSSA 2H29A 3F9RA 3HH8A 1XP8A 4JZKA 4LY3A 3OCVA 1RWMA 4LJ9A 4QD3A 5K51A 3RE1A 2W2OA 1KOGA 3RDPA 1E9RA 3CLVA 3IV7A 2ZKLA 1WXXA 2QSUA 1NHWA 4MWGA 4FGUA 4YO8A 3U9LA 2BM1A 5KNCD 1AJEA 3WL7A 2PH7A 3EQ9A 1M0SA 4L75A 3RVRA 4S1PA 2L42A 2FK8A 2DTDA 2I54A 3PT9A 1FYDA 2RGNC 4FYXA 4MYTA 1Y9AA 3W5HA 3WLJA 2GN8A 1KMHB 1M75A 3LPMA 4UDNA 4JT2A 4MS3A 3H2YA 4X71A 2VHJA 3GZNA 5WRFA 1NR7A 2GUWA 3PXGA 4E22A 4YAKA 3L8ZA 3MWGA 2J0SA 3PFBA 4MLPA 1VA5A 3N2ZB 3NZEA 1ES9A 3TQSA 3EPLA 4TYYA 1X0VA 1ULZA 1DBRA 2G1JA 3FRJA 4B45A 2NLOA 3O94A 4KDRA 2B6HA 1OFTA 4LE0A 2PS0A 4KFUA 2GF2A 4I6GA 2VQDA 2VDWB 4LW8A 5LOVF 1LB1B 1UXIA 5SY6A 1E0DA 5KDOA 4KZPA 3R3XA 2IXDA 2OWEA 2Q2QA 1Y6JA 2W2QA 1ECPA 4RESA 4TPKA 3NORA 1ECFA 3AWDA 3TAHA 4YRKA 3NHFA 2J67A 5MN6A 5J2UA 1R0RE 4C6TA 1E1RA 1WR8A 3DPIA 5K3FA 2I80A 1CY4A 4LSZA 5LB4A 2QVGA 4N49A 4XR4A 4E51A 2RBGA 3IQGX 3ZCXA 4M2LA 4P3KA 5C8YA 3WO1A 5F7JA 3U60B 4BNGA 4H9GA 1T2AA 3GR6A 2YYAA 4DLZA 1G20B 1XXHE 1LBQA 4JEMA 2RK3A 2QYHA 1YHNA 4LG1A 1DX9A 4TWJA 2JGJA 4HX2A 1CF2O 1BXRB 2VSQA 4EY7A 5JCJD 1ZSNA 4ENRA 3HFRA 1FRVA 1EYZA 4DT1A 4TN1A 2DFDA 1AF7A 5KHAA 4D3XA 1XMVA 4JU9A 3AM3A 3UMMA 2WJWA 1FXWA 3COYA 3H65A 3BG5A 3QVTA 4GLJA 3R4CA 2ZR0A 4PYRA 4PX9A 3VH3A 2CJWB 1F2TB 4RK5A 1C7JA 2BR5A 2Q2WA 4XVRA 3REGA 4D2IA 1C0LA 1WZUA 5MGBA 4QDTA 3U4GA 4BWYA 3IS3A 1GA6A 3HN2A 3KSDO 3OHMA 4YS6A 5EMHA 4F96A 1MQAA 4JOSA 3PS9A 2FMIA 3DKIA 3RVMA 1X77A 3USCS 3NKLA 4PFJA 4WESB 3EFBA 4FHZA 3K15A 2FUEA 1ZU5A 4CKWA 8OHMA 3OOEA 2O8FB 3H18A 4FMDB 4DS3A 3GYGA 3NIFB 1TQ6A 1VM6A 1XRPA 1U6JA 2UZAA 3AEUA 4DNQA 1FBNA 1NRJB 3LMKA 3NYIA 2ZBVA 4PW0A 4G5HA 2GEKA 4R81A 4R9VA 5EP4A 4R8KA 2H5EA 4YUAA 1NC1A 2P68A 2NZYA 3HWSA 1H2FA 3I83A 2X7JA 4LYDA 4PC6A 3U0BA 3B51X 2EKBA 4CDGA 5BNWA 2P7HA 4IIUA 5EQJB 4QU8A 9ABPA 3R9XB 3R6GA 3RWMB 2ETVA 2VT7A 2XB6A 5E3JA 4J0GA 1XTSA 3IMKA 1KP2A 3ABSB 4QO8A 2FMTA 4F45A 5KOIA 2QQEA 4RK4A 4JYAB 3STXA 1EX6A 2FOIA 1X8JA 3NAGA 1GKLA 1Y80A 2ZBEA 3I6BA 1T1SA 2FPSA 2PS3A 4W1PA 3D31A 4MHOA 1G9XA 3PVCA 3QPBA 2V65A 1W49A 3HVUA 2V97A 4LAFA 3U3KA 2C58A 2NYRA 4UMVA 3WYGA 5LVAA 1TM2A 3K6JA 2LUOA 3WLAA 3P52A 4ACBA 4ESHA 2AKYA 3CC8A 1XTPA 3QU5A 4X20A 1SCBA 2QROA 5FR1A 1ZIDA 3DEYX 1SIOA 1D1TA 1OY1A 4OGWA 5JJBA 2CLOB 1EWQA 4RSGA 4ZOQI 3R7BA 1H85A 4LSGA 3V5NA 1V6AA 1HZJA 1GZSA 1B41A 1EAMA 5TXGA 2GARA 5CB0A 3EEBA 2QZJA 3FJYA 3SFZA 2BGWA 2NVOA 3GU3A 2FPIA 1OVMA 2EV9A 2ZYHA 3H2IA 4YMVA 2AXPA 1U0BB 1LK0A 2ODNA 4WW0A 3D4IA 4F93B 2VOJA 4YRFA 5K4HA 1QG4A 2IDJA 4J4BA 1EZ1A 3KYDB 1LBEA 3G5UA 2Q0HA 4Z1MA 5CVTA 1Z3CA 3SYTA 2YBEA 1Y8QB 4TTSA 2IEDA 4BEVA 1YRHA 5JECA 3INRA 1B0ZA 5G53C 4YV7A 4BNZA 1E2UA 3KL4A 4TYQA 1NDQA 1Y3DE 1BEZA 4M1EA 3D2BA 3CXRA 4G0QA 4YQZA 1M2HA 2GHTA 2XQGA 2HUNA 3HA7A 1JTEA 3WDLA 1VG8A 2AYYA 1QFJA 2E18A 3A4VA 3OZVA 2WY2D 1BX0A 5DM70 2CLFB 3AR9A 4PZCA 4HQKA 5EC8A 4DMLA 5A0VA 4LCBA 2QQ0A 1EVYA 4J0HA 2PSHA 1Y37A 2Q3JA 1ZRNA 3TQHA 5TF4A 1MVLA 1II9A 3ID6C 1RAEA 2BPOA 5ALGA 4C3VA 2R8PA 3T0IA 4N9QA 3BERA 2FY8A 3FHCB 2EP5A 1QQTA 3CY6A 1G8HA 1SRQA 2PMFA 2Z2ZA 4JC5A 4TKUA 5EN4A 4CLOB 4RS3A 4BRUA 3F6SA 2JLYA 3DWFA 1KFBB 1MG5A 3DE3X 4D80A 2KX7A 3HKEA 1NULA 1HORA 1OFIA 3W7VA 2XOKD 1DKNA 4A2WA 2V6GA 5EJMA 1N0VC 1DQRA 3TDMA 7ADHA 4GYYA 1GTL1 1M7BA 2H52A 4F4HA 5F7OA 2G77B 3HLTA 3HUUA 3P7MA 3K7EA 2Q6KA 4JHLA 4TL9A 3OF5A 2NZWA 3ANMA 3NPAA 1QO9A 3AX6A 2IUFA 4MKXA 1GTMA 4ZJYA 1GTSA 4EVQA 5AM4A 4WQMA 3IBYA 4YJGB 2DPXA 2ZYAA 1HDYA 1ZA2A 1FS4A 3HCWA 3HNPA 3BWYA 3PXAA 4Q15A 3RTCA 3A14A 3EUWA 3EZLA 4E0BA 3B9BA 4L0QA 2VOEA 4UOQA 4FYMA 3GLFE 5E6RB 4Y2GA 2RIRA 3M4YA 4O4HA 3AVVA 1DEOA 3DCYA 3LYAA 2JI9A 4RW0A 5JBNA 4Q93A 3EXHC 1GU1A 3UAWA 2XMCA 5J2TA 2H63A 3GGJA 2XJ4A 3C7AA 1XMIA 3K3PA 4IZOA 4Q1EA 4UU0A 2BMDA 1P1CA 2GA9A 3B6MA 5E8RA 3OIUA 2D0OB 1GARA 4IIJF 4QU9A 2O7SA 3SKYA 2HZ7A 5D86A 5CDYA 1X80A 2FEKA 1FTWA 2YX1A 1CQWA 2G8LA 4Y2XA 5KOJA 2XXAA 4WOPA 1JR4A 2B7BA 2C4NA 3A8TA 4J4TA 3E8SA 2J3EA 3K92A 4AAYA 4KLNA 4QZVA 2Y93A 4GKBA 1RHQA 5KS2A 2Y9PB 4ZO8A 3GN1A 2V74B 2W2LD 1N9GA 3EIOA 5ED0A 3URMA 4B7UA 3QMVA 3AEKB 4QYMA 3FB4A 1MQ8B 3SYLA 2C4VA 3CW2A 2BFCA 5F1PA 3SJ7A 1U0TA 2OLEA 5JS1A 1FQWA 3LC2O 2WTUA 5ES4B 1VPWA 2A9RA 1UJ5A 2XKJE 3O2SB 4XWAA 3RFFA 1Y4UA 1C9YA 5HYVA 1Z0JA 4XM1A 3HGQA 2A92A 5ADUS 1SBYA 4XDZA 1DHTA 5J5CA 5JAQA 3SIXA 3GX1A 4PIPA 4K5QA 1PZMA 3DMYA 1G3QA 3SVLA 4MS3B 4R3NA 1QCZA 2PU7A 2PT7A 2QTVB 4TTJA 1CULC 1IRXA 3EH2A 1CDDA 3E15A 1OPRA 1CERA 1E1DA 2CJFA 2JGDA 3LC7O 2L19A 4MB0A 4R2KA 4Y1RA 1BMFD 3KAKA 5HQJA 3H5NA 5DXAA 1FX1A 3I5MA 1A82A 4S35A 4ZEOA 4EJSA 5I3CA 2J31A 4NE9A 5H4GA 4PQFA 1FZQA 3LUKA 4WCFA 5D1HA 5EKSA 2O2CA 4YUYA 1KEVA 3H9QA 4US1R 3T0GA 2I55A 3H7AA 1Z5PA 5A62A 1X14A 4KXFB 3DZHA 1V9SA 2J7PA 3MG9A 3T4UA 2J3DA 4CI0B 3TRFA 2GYWA 2R8RA 1T6XA 3MXOA 2XGSA 2AWNA 5EZSA 2Y4OA 3V32A 3SY8A 1JHVA 1O6ZA 1YBVA 1H6AA 2OZEA 3RH0A 3ZV3A 3KYBA 3UGJA 3ZGLA 3H9JA 2P2GA 1N9ZA 3KZCA 3AHGA 1Y82A 2CCJA 4M1ZA 4BFWA 3CH4B 1MNQA 2RGGA 2QF7A 2H1LA 2VBIA 3ORYA 3GUCA 3FIUA 5PNTA 1O5TA 3VDXA 3FFAA 2I4OA 1YIDA 4BMCA 1JS1X 1AHHA 3QKTA 1PBTA 2FW0A 1PJAA 2NSDA 1LC3A 1EFHA 3CHYA 1X94A 1X7DA 4O4JA 1N57A 4IDFA 4X60A 4P0QB 4RH0A 3ZHVA 1L5OA 1N1DA 2Y2UA 1D9XA 2GO7A 4YIKA 4TTPA 2NU6B 3DE5X 4DCGA 3AV3A 1TM5E 1BDBA 2R1VB 3G8AA 5TMBA 3HSKA 2XSZA 5BRJA 3BMCB 2D2XA 4W9MC 1PK7A 1NIJA 2FWPA 1VKZA 4JLJA 1PJSA 2BR3A 5F35A 2W2KB 2AJ8A 3H0CA 1P1KA 4H7JA 1GTRA 2H7YA 5CYGA 4KH1A 2AXEA 3SX4A 1UBFA 5TMDA 5KNBA 2CFCA 5LP1A 4HNSA 4LNUA 4FC6A 5BR8B 3ZD6A 4UUQA 4POOA 5LZ7A 2XZTA 3D6FA 1GGJA 1YTLA 3DGEC 1QKKA 3LC1O 2JEZA 2VZ0A 2YZNA 1VJCA 3IT2A 4YDSA 4L1KA 4UREA 2PQ6A 5HGXA 4AJHA 3OTHA 1L1FA 1BE0A 1WHSB 1L5HA 2H08A 2DFVA 3EUEA 4O63O 1UZMA 5AOCA 5AI0A 2C54A 3E9YA 3ICPA 1DTEA 4HNVA 4CMJA 3PJEA 5KJFA 1M0TA 5KI6A 2CZGA 3IPAA 2XUGA 3PNMA 3P8ZA 3VVBA 2R84A 4DLTA 1QQBA 3BPSA 3MM4A 4RJJA 4P5EA 4YCBA 3IAUA 3CLTC 4O2BA 3TPCA 4KPGA 1E1MA 1UWVA 2CLLB 4B83A 2AB0A 2OENG 5CX4A 1XMOB 1O94A 2BKEA 2IZ0A 3ZIDA 2VTVA 3AUYA 3FNFA 4YAFA 4H1TA 2PUAA 2W6IA 3ZUPA 2M2IA 1JA0A 1JG1A 1E9DA 1WRBA 2PCJA 3ND7A 1NONA 4LRWA 2HD4A 1HZZA 2CUKA 2JFOA 4HX5A 1T5OA 5J9FA 1YVPA 1JIKA 3D5EA 5TPZA 3SXPA 2IHKA 3ZWCA 4I66A 3BGDA 4KUEA 3QOYA 1ZAKA 5JY1A 1P1BA 4MW5A 4P80A 5JMTA 3L7YA 4BIIA 1G4UR 1USKA 1FMCA 3HDGA 1P9NA 3EIHA 3M2PA 4NYIQ 3FTQA 5KTOA 1OLUA 1JV2B 1H2YA 2ZIFA 3C3MA 3UHPA 1AHPA 1UODA 1C4XA 1JIQA 1CTQA 2NXJA 3WBFA 3E7FA 3C1OA 1C1DA 1VRCA 1RKUA 2ILTA 5KYYA 5E9JA 3HC7A 4B7CA 2JFGA 2EAUA 1G21E 5U1PA 3ZHSA 2IOHA 3C0KA 1GR0A 4NATA 4QOHA 1RYFA 3IC5A 1NDUA 3H86A 4TKZA 3DE2X 4Z4IA 1M8JA 2OP1A 4EFMA 5CDFA 4KIUA 1OXTA 2HXSA 5DLPA 1QIEA 3D64A 2I1LA 1N6RA 2HIGA 2PZGA 3EZNA 1J22A 1FUEA 2WAMA 4HZUA 1ORHA 1LTKA 2VZ8A 1CF9A 3CLHA 3DQZA 3HLYA 3OE7A 2FQ1A 3LBHA 3PYMA 2IWHA 1E3MA 4Q02A 1YA8A 2H51A 4TS9A 1N3IA 5C32A 2RGNA 5GADl 1PSDA 2BIFA 1XVAA 2I4TA 3VDRA 1FU7A 1SUCA 4YX9A 1VP9A 1XCJA 2WHEA 5ALSA 1WXGA 4YY3B 2V6FA 3MINA 5DBOA 5LXTA 2P9JA 3GLGA 1Y9ZA 4JI0B 5B7PA 2AEFA 3ST7A 1WCYA 2I6GA 1E2EA 3KLMX 4JYPA 1XOIA 3IX7A 4JV5B 1K06A 2HJSA 2AJCA 1XFDA 4WJKB 2IHTA 4L2IA 4RS4A 4NMHA 3X0DA 4LHXA 3ZZ0A 5KWIA 2Z30A 3AHHA 3NHSA 4PEVA 1YL7A 4IIFA 1S9DA 2G4CA 2HX1A 1TZ2A 3CF6R 4OUDA 1N34B 1Z56C 4MAAA 2O8VA 1DC7A 2IWRA 5ERXA 1T36A 2X0EA 5M3BA 1I13A 4KK3A 4QUGA 1SEPA 4JJIA 2V6IA 4OBXA 5IARA 2H06A 4ZQHA 4G23A 5LZ5A 2EEPA 3P26A 4PYKA 2Q1XA 4UNQA 3K8YA 4GI2A 4E31A 1ZUWA 3AUKA 1NVGA 4MX8A 2XQKA 1M66A 3D4LA 2P9BA 2CLDX 3RFXA 4X3CA 3F8SA 2WAXA 1AGNA 5AXBA 3NJ8A 1KI8A 1X7ZA 4MUGA 1JYFA 1U8XX 5DTRA 5KU1A 4CMBA 3JS5A 4XXHA 4CMKA 4A6PA 4I55B 2JRLA 3MWEB 3W5AA 3ZWNA 1AKTA 3WGZA 1I0LA 3MT7A 2O2GA 1E4EA 4PNPA 4L5YA 4L57A 3EHEA 2ZYWX 2LBPA 4JCOA 3NAMA 2YKOA 2IT1A 3EC7A 5FDFA 3W6PA 1Y8CA 3ESZA 3M5PA 2Q49A 3FUWA 1FRQA 2FRVA 1OA0A 1EE1A 3KFXA 4TRNA 5JWOA 5A0TA 5HIMA 4M8SA 3GVCA 3PNBA 5BSUA 1E1QD 1UFVA 2OD9A 3GFQA 5AK3A 4UJ5A 3KAQA 2VH1A 4S1VA 1VPTA 2ODEA 5DGDA 3RQIA 2XX3A 1Y1KE 3FIJA 3GAAA 1PI3A 3IOCA 2Z6AA 4BLTA 2X0DA 5TPZD 3DEIA 1JQJC 2OCBA 2X8JB 2ZG6A 2M9MA 3IBFA 3NTUA 5FB3A 2VT3A 3R44A 1RZVA 2VSYA 4F06A 4QDZA 1N9GB 4PPFA 1CS0B 3HKBA 2AG6A 3PHHA 5GZ6A 4HXYA 5GGYA 1OI2A 1NJ8A 4S3MA 4R54A 1CR0A 4GMXA 3FMOB 4RGVA 4F3NA 1EAYA 3JX9A 1NSTA 3R7NA 1T34A 2NZ2A 2P0EA 1BH2A 5FFFA 4NZZA 4ZXPA 4QTYA 2PUCA 4FR0A 4W63A 1GL3A 5JASA 3E9RA 3W3ZB 2JJ2D 1W4RA 4GG1A 5CVEA 2HSZA 1SVWA 1ZVMA 2EFGA 5CHEA 4FQ7A 1OYOA 1SCNE 3CUUA 3PQ3A 4KWHA 1JZSA 2V9PA 1DHRA 3PGVA 1V0JA 3H8JA 1PW7A 1UPBA 4J0QA 5K8LA 4PO9A 2Z6UA 3BXZA 5IVDA 2R8EA 1WUHS 5DNVA 1P9RA 4GFDA 1IBRA 3E81A 4HAVA 1YJ5A 4KQHA 1XFAA 4CLDA 5HEKA 3EVZA 1CZUA 1QYXA 4HD8A 1VSVA 3GBVA 4J0IA 1CRQA 4E1VA 6PFKA 3R2JA 3R8CA 3HPQA 1Q0LA 4E6EA 1G6OA 4V0NA 3MCTA 4R68A 1EB8A 1DRJA 3GDOA 1PJLA 3I37X 5C5IA 1KOJA 4FK8A 4ZAVA 1ELOA 5DK4A 3SR4A 1GDDA 4I1IA 1ESDA 3GJ6A 4YA6A 4X62B 3QHQA 1F6DA 2QTCA 4HFRA 5J40A 2CDRA 1OZFA 3N2KB 3OQMA 1L7XA 4IJVA 1DADA 2Q6VA 3COPA 5CEFA 4ZKDA 5B2EA 3CT6A 4TX1A 4LF4B 3P0IA 2IHUA 4HEA1 1PCXA 3IP8A 3EPPA 4MKZA 5IJAA 2RB4A 4KDCA 4F8JA 2OFXA 2RJNA 3M4XA 2G9NA 3LY7A 5JC1A 3AFHA 4BNVA 1E2MA 2I2FA 5D1NA 2YQZA 1ZRHA 3Q6NA 1EFCA 3DYVA 3NUZA 2WNIA 2QX9A 3E0XA 3GMIA 3LFTA 2P8SA 3WNCA 1FDOA 3SVTA 4FD3A 2JLRA 4NHEA 1GFIA 1J9ZA 1L5VA 1UZUA 2ZJ1A 4O1HA 4R1TA 1G5FA 3G0BA 4X6LA 3UWDA 3V2HA 4BECA 2FZ4A 2JAHA 4I9FA 3UWSA 4DV7B 1WEHA 1MB4A 2R8XA 2CVFA 4FQ5A 3GLFB 2BH2A 1DAGA 1B1CA 3MK31 2P1ZA 1UT6A 4HDSB 4MUBA 1IG3A 3G7UA 4NOJA 2GZRA 1E9CA 3EFOA 3U3OA 5AW7A 4ON9A 1L5ZA 2FLWA 3W5JA 3FOEC 2C96A 3I42A 3IP9A 1WL8A 1Q3TA 3GRYA 4YAIA 3NBZC 3R7AA 1UDRA 4EVIA 2OBFA 3LBFA 1M34E 4N3GA 4M1MA 4INPA 4H1WA 1LNSA 4RTOA 3GLIB 1KAQA 3NDIA 4F6RB 1O7JA 1R10A 4X8OA 3JD1A 1COWA 4MI6A 3UJ8A 1TMYA 1UPTA 1SB8A 1R88A 4PSDA 4AD8A 3I61A 3M8KA 3BJIC 2YXPX 1MO6A 1ZUHA 1RI5A 1Q6YA 2WJ4A 2RHMA 1CDZA 1U3GA 3QQ5A 4J1SA 2PKRA 5KTPA 4ZAYA 3GDWA 4OXKA 2P5YA 4GI5A 3GEGA 1X7YA 1E6WA 4PLHA 1EFRD 3L41A 4MIOA 2EF1A 2DWPA 1EPUA 3USZA 3GI1A 3FGNA 4HDMA 3Q41A 4RKFA 1O6BA 2LNDA 1PFUA 5CIQA 4JLBA 5FI1B 4XWKA 3BX1A 4NAVA 4BLPA 1NT2A 1CB7A 3KJNA 2VTBB 5DISB 1OC2A 4PHFA 3ORHA 3QVGA 5K8UA 2FMHA 2G82A 3AC0A 4NEQA 5DI9A 4YRQA 1PN3A 4LHYA 1DAKA 4KG7A 3EVEA 3TEFA 3ZEIA 2QE6A 1G20E 4J76A 1Z6QA 3LP8A 3GP8A 2FUG1 3COSA 3BIJA 3F9IA 1OH5A 3K0SA 2WICA 2QTWB 1HE4A 5EJIA 2NPIA 2O2XA 1U90A 4UUPA 3I52A 4OYRA 3ZQUA 4DQDA 1WQ4A 3RYFB 3C41J 3T9AA 4CV1A 4BUJA 3QFHA 2XCUA 3U13A 3X2EA 3ZD7A 4DNFA 1Z2NX 5BSWA 2UVDA 1E77A 1GNVA 3ZKAA 1ND6A 3HR4A 2R6R1 5CG1A 3IT0A 4XYEA 1DV2A 5ALNA 1DOAA 2B98A 1KNQA 1IDOA 3FWPA 1Z0AA 4IWYA 2XB8A 3RRMA 2AFHA 2HRZA 2OKGA 2LP4Y 2BEVB 4Q3DA 4YCSA 4UMFA 3CW8X 2ID4A 3DP9A 4ZO7A 1ZFNA 3QFTA 4NDAA 4Z51A 4G2TA 4YAGA 1AQNA 5T4EA 1QR2A 3JQ7A 4HQRA 4I1YA 1RM4A 3PWTA 4MSUA 4CUJA 1JA1A 4KQXA 3ZHRA 3TSAA 4H4DA 4Y0VA 5FNVA 3V4VB 2RJOA 3PUVA 4EY5A 5AW0A 2KBFA 4XDYA 2F43B 4YPVA 3E9EA 5IKMA 1FSPA 1JUDA 1ZK2A 2JPDA 3SSNA 1CK4A 1D2HA 1Q0UA 3I28A 4DKJA 2HB6A 1KBQA 1JEQB 4NK5A 1YBAA 4RKQA 4BNLA 5I48A 4L6IA 4RLFA 3B6ZA 3DD1A 3H0EA 1AN9A 1USWA 3H16A 3NW9A 1MR3F 1CY6A 2EQ5A 3AVPA 1W94A 1GNLA 1XP5A 2JB9A 2XVXA 3MGAA 5AW8A 4ZMSA 4RV5A 1NVBA 2I3GA 3U81A 4CETA 1SELA 3UUGA 2GR9A 5JRJA 2X6TA 1UMBB 2Y1FA 3R76A 2HPVA 1T91A 3QKSA 3PQCA 5F2EA 2HHLA 4IGAA 3SCZA 5H9VA 4W5QA 2P3SA 1Z2DA 3OUZA 4Z99A 1SXJC 3CPJB 5DN6D 2YJ6A 5ALFA 4LE1A 3IV9A 5FLEX 3FZEA 5CHYA 2OY0A 5ALKA 4DR3B 2C2HA 3O2JA 5J3JA 4PYOA 4BAGA 5FV4A 4U63A 3BHNA 3WIDA 3ZH2A 3W5DA 2ZRKA 3TUJC 2HPAA 1IAVA 2YASA 3I58A