4PR0A

Mycobacterium tuberculosis reca glycerol bound low temperature structure iic-n3
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
328
structure length
315
Chain Sequence
QTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Protein RecA, 1st part, 2nd part
total genus 96
structure length 315
sequence length 328
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4pr0A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4pr0A01
2Z43A 4DVGA 2ZYUX 2EFGA 3H86A 3HU3A 3RVBA 1W2HA 5FUXA 3WHLA 1FQJA 4TLEA 3SBDA 1EFRD 5C2JB 1H8ED 4ZDWA 3LW8A 4MITA 4RZ2A 4R71A 2VP9A 1JEEA 2FDCA 1EX6A 1CR2A 2A5GA 2AHOA 2I4IA 2B21A 2EU8A 3OE7A 3WBKA 3WYFA 3U7HB 3NDPA 4C3ZA 1IAQA 2ZRNA 3PENA 3LD9A 1R10A 1PV4A 2ZM5A 3HDTA 3KUDA 5FTLA 4YXWD 3QSYA 2HCBA 2KE5A 4CDGA 2IL1A 1HUQA 1KY3A 2OAQ1 1G21E 3AGQA 1OLOA 2FN4A 2QGZA 3FWYA 1Q21A 2C8VA 3H84A 3LO5A 1N5IA 2DBYA 2R8RA 3OAAD 4F92B 2ZREA 1GSIA 2C9OA 4RZUA 1E9RA 2XSZA 4GP6A 2JDIA 4EJSB 4LYJA 5HCIA 1NMYA 2MMCA 4F7WA 1R5NA 1VG8A 2V54A 2QPTA 4W5WA 1MO3A 6Q21A 4A0GA 5GVSA 2J7PD 4EPVA 3OFND 2XAUA 3K0FB 1R0WA 2Z4RA 4IHQA 4AD8A 2QMEA 4FMDB 5CM9C 4KFTA 1XZQA 5SZHB 2ZRJA 1JR3A 1YJ5A 3K8YA 4OQMA 3WYAA 2XGJA 1CJVC 1CR1A 1O87A 2CHQA 2GJ9A 4Q1FA 3Q7QA 4RCYA 4ILEA 2IT1A 3A37A 4RVCA 2KSQA 5CIWA 5AWFC 4PC7A 3AF1A 1D2NA 4PXAA 3S1AA 3U4QA 3QF4A 4XWAA 2QA5A 2ZI3A 2ZAOA 3B1XA 4DCUA 2VP4A 4LCBA 4TLDA 3T1QA 3V4FA 1J2JA 3K0CA 2J0QA 4QL3A 1GFIA 5EE9A 1S4QA 4BFTA 2ZS8A 1WBBA 3GLGA 4Q7LA 4U7DA 1N6RA 2QRZA 3SC3A 4AKGA 5FL7D 2N1BA 3GJ3A 4EQ6A 1D2MA 4AG5A 2OZEA 3WRXC 1N5JA 4KYIB 1G3UA 1S1MA 3WNCA 3A4LA 3KXKA 1IOZA 3QKSB 3W9YA 1TU4A 4CGZA 1OXTA 2ZR7A 2RGNA 4B47A 1QHHA 4M1SA 1U0HC 4ZIRB 1EFHA 3KKOA 2C77A 1VTKA 3UK6A 2OV2A 3KTAA 3K9HA 3TQCA 1E1QD 5JCZA 4L9SA 5AJYA 4QGFA 4LWZA 4LX0A 4LDJA 3THWB 3H1TA 3I4LA 3RRNA 2WMOB 4N3NA 4DSUA 4QHTA 3VU9B 4MYHA 1JAHA 1ZW6A 2J46A 1EFTA 4PC2A 2AD1A 2ZRKA 4QNMA 4OBEA 1EX7A 1Y3AA 4TSFA 3K9LA 3B82A 3PITA 1WCV1 2YOHA 4JS0A 4OQNA 2GCPA 5EP4A 1GKUB 1AA9A 4UNNA 1CJKC 1ZAKA 3FPAA 2WIBA 2IS1A 2BJVA 4JSTA 2IEYA 1FNMA 1WMSA 5FOUA 3KQKA 3SJBA 2JLZA 4O25A 4EDHA 4II7A 4AYWA 4CEIB 4NONA 4KODA 1RKBA 2P5SA 1G7RA 3TUJC 1N0VC 3LXRA 3T15A 3RS2A 1FMJA 1HT2E 4BFVA 2GZHA 3ASZA 5CDFE 4AKIA 4GRAA 3CNOA 4IVQA 1H8HD 4XJXA 4QBGB 4CYMA 3A36A 1DARA 4L16A 4PSKA 1WRBA 4UNRA 1G7SA 1XU4A 4UNPA 4TZ6A 3AKDA 4QBFA 1QHSA 5BN5A 1I4LD 2OXRA 2RGBA 3BH0A 4ON9A 4C0QC 4B32A 2XOKD 2ZRFA 1E9SA 5EP1A 5DE3A 4US1R 1Q22A 3E70C 4M1KA 5A0FA 3DDCA 2VF7A 2GJAA 3TE6A 4EAQA 1ZNZA 3EARA 1II8B 5KDOA 3IIJA 5G53C 3NEJA 2CL7X 2FZLA 5AR1A 2K5UA 3FE2A 3LX5A 3FMPB 3PVSA 1EXMA 3T34A 4DBLC 4RZXA 2F43A 1O3YA 1KMHB 3GMTA 5JHGB 2R62A 1XEXB 2RHMA 2O8BA 3K53A 3QNUA 4M4SA 2AFIE 2QT0A 3LY5A 4M9ZA 1H65A 3MUFA 3ZS9A 2YVUA 1OIVA 2ZRGA 1F2TA 3QOFA 4A2WA 5KDDA 1XD8A 3ZZUA 3SEAA 3FB4A 4UNSA 2LCFA 5GJVC 3U3KA 1IN4A 3UXMA 4JL6A 4JJKA 4KO8A 3EASA 3L43A 3EG5A 3MCAA 3J81k 2PEYA 1P3JA 1LFDB 1UAAA 2CL0X 1Q20A 2ZRCA 1KJYA 1NSFA 1UDXA 5F9FA 1SQ5A 1EWRA 3N70A 1KO7A 1J7KA 2DFKB 2QBYB 1Z63A 3NC1C 2ZRPA 3RWMB 1QZXA 3O8DA 3VKWA 4NE2A 1N6OA 1W4RA 2XX3A 4KSBA 5JRJA 3VR6A 2AWOA 3U5ZB 3ASYA 3F3YA 3CRMA 1CKEA 4UKDA 4QHYA 4PPNA 4XD7D 1ANKA 3GFPA 2FF7A 2YZ2A 4BEBA 3DL0A 4S2EA 3KKMA 3PEUA 1DADA 3RDPA 4NYIR 3DVLA 2ZUDA 3LAWA 3T1TA 2NOAA 2I3BA 2WKRA 2YC4C 3IDQA 1W2GA 4PSAA 2CDNA 2WAXA 2VHQA 4OI2A 3Q85A 5HTKA 4FWTA 1FUKA 1Q3HA 2BHRA 1GRRA 4LHXA 5E95A 3R9IA 4A0RA 1J99A 5AUOB 5JEEA 5E7MA 1WP9A 2P65A 3IPYA 1E79D 5UKDA 1ZU5A 5D3QA 3QF7A 3CKLA 3R8CA 2GWHA 2WJGA 1QHGA 2O8EA 3QEJA 1LV7A 2C5LA 4URUR 3W5JA 4EIWA 4ZKDA 3NC0C 3MWYW 1XFAA 4PZZA 2IYVA 4DSNA 4HAUA 4MRNA 3MGCA 1SVWA 3HJNA 4TMKA 4BFXA 2IS6A 3IHLA 2ZI4A 2JEOA 3CZQA 2A3RA 3WRYC 2P2LA 1GRQA 3AQ4A 2OCYC 3KL4A 1G1MA 1S0UA 1YHNA 2ZR9A 4EJSA 5J4HA 1P61B 5CJ2A 1AS2A 1DTSA 2GF9A 1COWA 4C0SA 1OH6A 1KI6B 5IRCD 4BPBA 3BH7A 4C4PA 3H0KA 3PUXA 3SHWA 2OO7A 4HAWA 721PA 3X2SA 3KQLA 1VG1A 2JASA 5AUPB 2MMGA 1W44A 2FE4A 2P6UA 1AZSC 2JJ1D 5E3HA 1DO0A 5FI0B 3BFKA 1IM2A 3AGPA 2WVJA 2HYIC 4G01B 2JIZD 2G88A 3AP1A 1HTWA 2A5DA 3GLHB 4I1OA 3QBTA 3S1AB 2KI5A 3U4QB 1RIFA 1ZD9A 4MYTA 1G18A 4FMBB 4QM7A 3C16C 4G5QA 2DR3A 3F8TA 4XH9B 1HURA 2W0SA 4E22A 4BRUA 1Z0KA 2AX4A 1UEIA 1G7CA 4G5GA 4D4MA 2WJYA 5BXQC 2FPKA 1E2JA 1BMFD 2CBZA 2H57A 2DYKA 4R2HA 1N3BA 2ZJ8A 3GJ7A 3LDAA 1II9A 1N6LA 1TPZA 1R8QA 1M7HA 2WHXA 4GL2A 5BYJA 2GNOA 1W5TA 2O5VA 5LB4A 1KK3A 1E4YA 4US2R 1G9XA 3QKSA 4TYPA 2FV8A 1XTJA 1GKYA 3QJYA 1QHHB 1Q57A 4UJ3A 4OKSA 2ODNA 3AUXA 4IDQA 4QRHA 1BYUA 4QJ4A 3QXCA 4ZIRA 2BBTA 3D31A 2BMEA 4Q1BA 1LB1B 3KB2A 4BZQA 3DO6A 2EFEB 4ACBA 4PANA 3CR7A 1XMJA 3TW4A 3VX4A 4G1UC 3CW2A 4QM6A 5JJIA 2OE2A 4KYUA 4OYHA 4HYYA 5EP3A 2JLVA 1XP8A 2HYDA 5BWMA 1G41A 3DMNA 1Q3TA 4JT2A 5C46F 4IRUB 3RRYA 4A0FA 2HJVA 1KGDA 3JZMA 4V03A 4BLSA 5EE1A 5F3WB 4Q9LA 4F4CA 4JBYA 2J59A 5L3VA 4IXNA 1MT0A 4HLDA 4DIDA 4LSGA 5EE5B 3CRVA 1WB9A 2QTHA 2IEZA 5TDHA 3FHOA 3G5UA 4DEXA 4LJAA 5DN6A 5FBVB 1GILA 1YRBA 2DWOA 2CEAA 3CR8A 2W0MA 2QAJA 4ZCLA 2ATXA 3VHLB 3DHWC 1RYFA 1GRNA 4CEIA 2C95A 3KDSE 1LVGA 5IHPA 2CLSA 2IYRA 4B3DA 4KHZA 1AZTA 3SJAA 2ZYTX 4BLOA 4Q1EA 2R6FA 1CBUA 4MRPA 3TQFA 1E2NA 4URWR 2HF8A 1OSNA 5SZJA 1IN8A 1I2MA 2V7QA 1YZLA 1YZNA 1J70A 5M04A 1HA3A 1FNNA 3QKUA 1KMQA 1MO6A 2BMJA 3P4YA 3NDBB 4K81B 1ZM7A 4JLAA 1V43A 4Q9HA 3SN6A 1Q1EA 5B2ZA 5J4VA 4C0AC 1II8A 4H9GA 4CRWB 2REXB 2WJIA 4DLZA 1NIPA 2F43B 1KMHA 2DFNA 1XEXA 2O8BB 1DO2A 1R7RA 3ZVRA 1KNXA 3UATA 1F2TB 3H4MA 4UXJA 2NPIA 5F2EA 4HZUA 3ZIAD 4Z1MA 4Z8XA 4M0LA 3BRWD 2CK3A 1NMXA 1KSJA 1Z2CA 1EFUA 121PA 5B57C 1NLFA 3BGWA 3O8RA 3I92A 2QEQA 1XJQA 2PX0A 1KDRA 1SXJA 4PHGA 2J41A 1VG9B 2IW3A 1MOZA 1R0XA 2SHKA 4PZYA 4L15A 5EXPA 3B7GA 4HB2A 3NEYA 2LWIA 4Q7MB 3LX8A 2CCJA 2QU8A 1UKYA 3OEEA 5H70A 3I72A 2LKDA 1V5WA 3AF4A 1MKYA 3NBYC 1LY1A 1B0UA 4KLNA 3I3SR 3I1FA 2GXSA 4FD2A 1T3HA 3ZZTA 4B3FX 4HEJA 5FPHA 5BN3A 4F4JA 1JR6A 3IGFA 3UMFA 2ZI9A 3D7MA 3DOFA 1ZCBA 2F3TA 1AS3A 3JZAA 4ZDJA 2BV3A 4C7OB 5FOXA 4TT3A 5FBWB 5FR2A 2GETA 4G5OA 5FTJA 4DT1A 2R65A 2BKEA 4PQFA 3MMPA 2A30A 3T35A 1Q1QA 4EUNA 2ZI5A 5JZVA 3VKGA 4PHFA 4LV5B 1TEVA 4RFVA 4D2IA 5HR5A 3QEOA 1KI7A 3OF5A 4OHWA 3CX7A 2RH5A 4ZI3A 2XXAA 4HB4A 2IUSA 3CB4A 3EAQA 1JQJC 1OKKA 1UFQA 3L82B 4LY6A 2ODBA 4DHEA 1HQCA 3A1TA 2ZRLA 4DLXA 1J8YF 2J9RA 2WIAA 5JS8A 1WF3A 1AQYA 1ZUNB 1M74A 3P27A 2QQ0A 2BEKA 2HXSA 2J87A 2O8EB 4B2IA 3QY0A 4CZ2A 4Q7JB 4R9UC 2VO1A 3TR5A 5AJWA 3U3RA 3CPEA 5JWRA 3TAHA 2FFHA 4B35A 5FUVA 3PFIA 1YR7A 4XWKA 1Z0DA 3X1YA 1AKEA 2QSYA 1KZ7B 4WW0A 3CH4B 4FXPA 1KI6A 1N0WA 4B2PA 2H1LA 4BQSA 1CJUC 3IPXA 3FMIA 2WJHA 2O0HA 3KKNA 3WP1B 3VHXA 1ESMA 4AWXA 3QXSA 2VP5A 4LYHA 1NIJA 4PTLA 2XSZD 5CK4A 2UVQA 3B1VA 3NHAA 4GMDA 4LYAA 3SJZA 5JS7A 5B64A 3K09A 3R20A 2OEPA 1IN7A 3BIFA 3SQXA 3EPLA 3AP3A 1A2BA 3P26A 3GLHA 1XEWX 4B73A 4RJLA 8OHMA 5EXXA 2G77B 4Q02A 4Q4HB 3X1DA 2HEIA 2V1UA 2R6DA 3UANA 2JA1A 3UPUA 5FOSA 1GNQA 1II0A 1LS6A 3B1YA 4NCKA 4EPXA 1W4BA 2HLDA 1N2CE 2Q21A 2Q9AA 2ZU0C 4KV9A 4Q1DA 3FGNA 4KVGA 2CCGA 4O2RA 2G0NA 5JSZB 2GHIA 2REOA 2NMVA 3W6NA 5KNCA 1GP2A 4UQOA 4KAXA 1KKMA 2QM7A 1KK0A 2ZE8A 4A2QA 1ZIOA 4A8JC 2ZS7A 4TTQA 4PPQA 1NNEA 4TMZA 3IQXA 1W36B 2ZJAA 3HR7A 4MGZR 2WSSD 1QHNA 2GAAA 4FN5A 1NL3A 2MSCB 2ZRDA 1CJMA 1YZGA 3EW9A 3QPWA 2OHFA 2OESA 1DAGA 2A9KA 2JJ2D 5FOVA 1NBME 2ZANA 4DLYA 1KSFX 3NBFA 2ZYVX 3EIEA 4IOJA 5JWHA 5KNDA 3KFXA 4V0KA 4CEHB 4Q1AA 4TYWA 5KPDA 3AP2A 3KX2A 5D3MB 4EPRA 1KIMA 4OHZA 2J0UA 4AYXA 5KYKA 2AXPA 1XPUA 1J8MF 4MUBA 5DLQC 2IUUA 2ECKA 5EXTA 3LA6A 4B71A 5ELXA 4S35A 4X8MA 1Z8FA 2OBMA 4BLRA 3W3ZB 3REFA 1UDWA 2DHRA 2H92A 3CZPA 2ZE5A 4Q4LA 4LBYA 4TL8A 2DWPA 4JBWA 4BLPA 5IK2D 5DIFA 4LHYA 2GBLA 5FI1B 1IJEA 1KK1A 3VR4A 4AG6A 2ZE6A 1Z28A 1U0JA 1P60A 1RVDA 4TMVA 2QPAA 1T91A 2YOFA 2EVWX 3DZ8A 4QGHA 3ZIAA 4M1WA 4G5RA 4JKIA 4N1AA 4ASUA 5DYGA 2B92A 2OCAA 1TL7C 4PPGA 5G3YA 1TQ2A 2QI9C 3CO5A 3KXIA 4JL8A 4HAVA 3BB1A 4TMXA 4C0HA 3PXGA 1GAJA 1GITA 3FMFA 3RSLA 3W90A 4TWZA 2GCOB 4HLQB 4LJYA 1NSTA 3RRZA 3NXSA 4PR0A 2VSXA 3I8XA 1IY1A 2NO9A 2ZVQX 1DAEA 2VRWA 3X1WA 4XTCS 5CDFA 4XVRA 3ZVLA 4DLUA 3A1UA 5EUMA 2ZYWX 1M7GA 1GL6A 1YR8A 2ZAMA 2YWEA 4NCJA 4TL7A 5E7IA 5IDVA 5BN4A 3EPJA 1L7VC 3PUWA 3U2QA 1UPTA 2JLQA 3MJHA 3NVAA 2XNDA 1CULC 1KYIA 2BMFA 2VYFA 4HZUB 2OLJA 1R5BA 2YWGA 1XPRA 3HYTA 1F5NA 3AVQA 1RC8A 3AB3A 1SHKA 3LBHA 3TH5A 4K46A 4MGYR 2AR7A 3P20A 1E94E 5EZ6B 1FOEB 1SXJB 4PO8A 2QGNA 4JLPA 2RKOA 2W2TA 2PZGA 2D74A 1FPMA 3GD7A 4IDPA 3SBEA 5HE8A 1H8EA 1Z06A 3M4YA 4A6PA 1FW6A 3TKLA 2ZJBA 2XTNA 4X8LA 3FHTA 1W47A 4FMCF 2ZETA 5E7JA 4P33A 1ZM3A 2KBEA 4OQXA 4QJ5A 4B2LA 1EFCA 2P6RA 4BZXA 4JT4A 1QHYA 3R8FA 1E0JA 1CIPA 4RD1A 3TVDA 4LGMA 1NVWQ 3ZYCA 1VDZA 4C7OA 4LJ8A 4KFRA 2YOGA 5TV2A 3VR1A 2YNMA 1P9RA 1UEJA 2OSBA 3TJZA 2FOLA 3M6AA 4DT1B 1G8HA 1VMAA 2JDID 1XF9A 4RY2A 3NHBA 3GEIA 3KQNA 1Z6GA 1XTSA 1VECA 2CVHA 3I8SA 4LUCA 4M9SA 3MRSA 4MDEA 4RD0A 4H1VA 2XXAB 4WIAA 1PUJA 1S2MA 2ZJ5A 4L9WA 4NDZA 2JLSA 1QG4A 3FOZA 5FR1A 3WNDA 1JXMA 4RCZA 1JEDA 5HPYB 1N0UA 2GTPA 4TN1A 1QVAA 4D4KA 1Z83A 4LV8B 5JCPA 2FJUA 4DIEA 1UADA 2GVDC 2EYUA 2GZDA 2OM2A 5KOYA 3MAAC 3RSOA 1UM8A 4RD4A 1ZMXA 5K8IA 3WMEA 3OESA 2O8CA 2KBFA 4B3GA 3VNVA 3QQ5A 1P2SA 1NJFA 2VSFA 2ZSFA 4HDCA 4OHYA 5AUQA 1W0JA 4A1FA 2PH1A 1KDTA 4WOPA 1FFHA 4TZ0A 2ZPTX 2PX3A 3KUCA 1WQ1R 2GEUA 2F9LA 5TXGA 4ESVA 2BKUA 2DB3A 3AVUA 1PLLA 4OI4A 2RGNC 4ABYA 3FDIA 4LBWA 4KLZA 2ZRIA 2C98A 3QIAA 4FI3C 3EPKA 2ZRMA 3BAFA 1QHXA 1P2UA 4TQUS 5HKKA 5JJLA 1US8B 1VHTA 4NCNA 1X8JA 4X8OA 4ZV4A 4OHXA 1GM5A 1X8LA 1T4GA 1X6VA 1Z0IA 2F1RA 3ETLA 1EWQA 3C7KA 1YKSA 3BS4A 1CLUA 2NTYC 2R6AA 4L8GA 4O2LA 1UBGA 5JFGA 2JLXA 1F48A 4TTRA 2B6HA 3IIMA 4Q4HA 4P4TA 1KI9A 3DM5A 3C14C 3LQQA 5G41A 4Q00A 5C4MA 2IHBA 3VR5A 2GJKA 1EGAA 2G0TA 3LVRE 1E9AA 4JJZA 2E9SA 1CEEA 3TSOA 1G19A 3LVQE 4W5HA 2QTVB 2VLIA 1DBSA 4G5SA 1KJWA 5DISB 5JSZA 3GLFE 1TF5A 2W00A 4TLBA 1T5LA 3TUIC 1ZD1A 4HLCA 4BECA 5JLJA 4Y0AA 5KSPA 3DEFA 1MRNA 1EESA 2OG2A 1OHHD 2AD5A 3Q5DA 4JLDA 1D5CA 4FCWA 4QFMA 4YC7A 3WP0A 1OH8A 1KKLA 3CF0A 2ZIAA 4M9QA 1G20E 4F38A 3L8ZA 2F1IA 2X19A 1TQ6A 3W5IA 1Z07A 4XIGS 1VCNA 3A58B 4B43A 3B60A 1ZM4A 2F55A 1ZD8A 1IBRA 3GQBA 3HU1A 3K0AA 4KCGA 1N6PA 3TW8B 1P2VA 2NO1A 4MKGA 4D0LB 4I1UA 2XZOA 4P32A 4TQ9A 3T1VA 2XTZA 1NG9A 4ASUD 4ZDIA 4CEHA 1GKIA 2VF8A 3AEZA 1VG0B 3UMRA 4Z54A 5K8UA 2N42A 1SKYE 1XRJA 5D3MA 4RD2A 1GL9B 2J0UB 3LRPA 5FTNA 4A92A 2XTMA 3GLIE 5TVKA 1NI3A 1G291 4Q9IA 1E98A 2OAP1 2G1JA 2VHJA 1TEXA 1TX4B 1W49A 4JVSB 3OIUA 3WHKA 3HPRA 3GLIB 1WDTA 1F60A 1KO4A 1SGWA 2GEVA 2KWIA 1VYUA 2IWHA 1OB5A 2HT1A 1VHLA 4Q1CA 4LBVA 1Q1ZA 1KI2A 4N0DA 4ZO4A 2RHDA 1W0KD 221PA 3EPHA 5HZHA 3IQWA 1NBMA 2QN6A 3LXXA 1E2KA 2F7SA 2FSIA 1WA5A 2P5TB 3R7WB 4BRWA 1RRPA 2YWFA 2PBRA 2RGEA 1PZNA 1R0ZA 1OXVA 2YJTD 1ZINA 4PX9A 4Q4AA 1DOAA 4D25A 5GJBA 2EYQA 4WAUA 1E0KA 1OV4A 1PLKA 1NY5A 3AM1A 1G5PA 3EZ2A 4P0TA 4JLJA 1NG1A 4WZBE 1Q1BA 2GCOA 2BBSA 1MO4A 3U7GA 1XNJA 3T06B 4DLWA 5AK0A 3IBGA 1G6HA 1M7BA 1YRAA 1ZP6A 4HZIA 1IN5A 1XMSA 3MWJA 1XPOA 1VCOA 2VHTA 3C15C 1SVKA 4NYMQ 4Q66C 5FBRB 4Q9KA 1L2TA 2OCBA 1E1RD 3M1IA 1E0SA 3NTUA 4AIIA 4HUQA 4BFSA 1RRGA 2ZR0A 2QENA 5AUNB 1W4AA 1N6NA 3V4RA 4XD7A 1ZC4A 1E2EA 4V0MA 2QE7A 1DAKA 1E2DA 4GOJA 3U6KA 2R44A 3VX3A 2ZSBA 2WICA 3TMKA 3GJ6A 3U3OA 2BCJQ 4PO9A 2RMKA 5CYOA 4PC1A 4JSYA 1ETUA 3FKSD 2XITA 2PZFA 1K5GA 2ZXUA 2ANCA 2FA9A 4QKQA 4Q03A 4RD3A 5TARA 2R9VA 4B3BA 1S3SA 1GDDA 1XMIA 5FTKA 5P21A 1OJLA 3V9PA 3A4MA 2JLWA 1HV8A 3JVVA 1P62B 2X8AA 3ZDQA 4C2UA 2IYTA 1Z0AA 3QG5A 3F0TA 1CU1A 4OJQA 2VPPA 4JL5A 2BM1A 4GFDA 4B3XA 1CRPA 2V3CC 1FTNA 2F6RA 1HE8B 2Q3MA 2GJSA 3Q5EA 1NJGA 4A15A 5FH9A 1W0JD 1X86B 2IXEA 1OIWA 4NCIA 4NYIQ 3IIKA 2A2ZA 1XEWY 4AY2A 1COWD 1ODFA 3K70C 1U8YA 4JBXA 2JLUA 2FSHA 3BB3A 1C1YA 4TT3D 4TYYA 3L0PA 3L2OB 2ZQ5A 4B6FA 3CH5A 5JMTA 1MRSA 4HAXA 3AF0A 3I61A 1ZU4A 1HE1C 4AKHA 1E99A 4JVLA 2ONKA 3OAAA 3RYTC 4PC6A 4K8OA 5LD2C 2I1QA 4LOAA 4JVMA 4OI0A 4QG7A 3RAPR 4QXAA 1KI4A 2QAGA 1Y63A 3RNLA 1EFRA 3PV0A 1U94A 1TAGA 3OZXA 1KJZA 2PEZA 4PAQA 3SYNA 2O8CB 4EKDA 4Q9JA 2FFBA 2WWGA 4LV6A 1JPJA 4W7SA 1KAGA 5DI3B 4HUTA 2QPOA 4YMSA 4M1TA 1CR0A 1SKQA 1E9DA 1S1CA 3D6TB 2WWHA 3ICEA 4IDOA 2ZEJA 1HQYE 4AKEA 3GJXC 3VFDA 4RZ3A 2F3RA 3BXZA 3IKJA 3UWOA 2DPXA 1HY3A 2OT3B 3BFXA 4XOIA 1G4UR 2F1JA 4YQFA 3NH6A 2QORA 1GUAA 1US8A 4XVUA 5B58C 3ZD6A 4BGDA 1NRJB 1CP2A 1SXJE 4KJZA 2D4HA 3C4JA 5GJCA 3EWSA 2L0XA 2X77A 3B2EA 4LJ6A 1OH5A 1SVSA 4US0R 1ZUIA 3OFNA 5DO9A 1C4OA 1W36D 4U5XA 1MH1A 5KSYA 4TYQA 1EK0A 3UG6A 2H18A 1G8GA 3OEHD 4QNRA 2ZSEA 4LPKA 2D3WA 2ORWA 2PMKA 2QMHA 3ADBA 4YONB 4N0EA 3CLVA 1G8PA 2A5JA 4CF7A 4KFSA 4B44A 1JJ7A 2W6ID 1DG1G 4TMTA 1YQTA 3HPQA 1MR3F 3BD9A 4DDTA 1KHTA 1Z0JA 2ZUCA 3AF2A 4MQBA 5LB2A 1E1QA 3SE0A 3VR3A 2HXYA 3SDZA 2HLDD 2ZSAA 1TF2A 4MRRA 4JKYA 4AURA 3KFVA 4NKRA 4WVFA 3PG5A 4TL6A 4NL4H 4DLSA 1JR3E 5FL7A 4I1VA 4PSVA 4M1MA 2J3EA 4KBGA 3TRFA 2H8KA 3RS3A 1LTQA 4GNKA 1AKYA 2QAGC 1XX6A 5FPYA 4B48A 4MYCA 4IVPA 2Y8EA 2H17A 3T12A 2Q3FA 1S96A 3UG7A 2C9YA 2GVZC 3K0AB 1ZJ6A 2PJRA 4BFWA 2OBNA 4M22A 4UXHA 1DEKA 2GCNA 5DGXA 4NU0A 1E69A 2V6JA 2FSFA 1OIXA 5H8WA 3EZ6A 2BDTA 2XB2A 2YYZA 5DH9A 2WSSA 2Z4SA 4IOLA 3SI7A 4YMTA 3RS5A 4C9BA 3ADDA 2BIFA 3BC1A 2HV8A 4HI0E 1N6KA 3MLEA 1Q44A 1JAIA 3X1XA 1T0JB 3EX7C 3ONWA 1QBKC 1KO5A 2ONJA 4RFSB 5A5GA 1ZYUA 1UJ2A 1G6OA 1MV5A 1NN1A 3CF2A 3GLIA 1B23P 2JGNA 1JBKA 1VCMA 3PCRB 4DKXA 1JPNA 1R5OA 2WAYA 2WWFA 1VIAA 3EC2A 3K0CC 3QG1A 1Z5ZA 1E2PA 2JLRA 1SVLA 1Z0FA 2W2XA 521PA 2PT7A 5EP2A 4FW9A 2UKDA 2NZJA 3PUZA 2AFHE 4FMDF 1M6NA 2XOKA 1RRCA 3B85A 3R7WA 4GSYA 3D3QA 1AQUA 4AC9A 2B8TA 3K0EA 1GL7A 3GJ8A 1TQDA 1A2KC 2ERXA 4ITRC 5A4JA 1IY2A 4Q4AB 5FOWA 2NPFA 1E32A 3F5FA 2EFHB 3U61B 2HCJB 4UNQA 1HEIA 1E9CA 5AJVB 3AVVA 2ZI7A 3SFVA 4QGAA 3TBKA 3IUYA 3UIEA 2G83A 2EFCB 3QKRB 4TLAA 1U8ZA 3KJGA 4XTRA 4KSCA 5CJPA 2ODWA 2CNWD 3EIHA 2W6JD 4EPYA 5L3QB 3ZH9B 3RWOA 5F9HA 4HUQB 4CT4B 2NO6A 3AVTA 5JHHB 1OFUX 1R0YA 2XZPA 3LLUA 5ANRB 1KI3A 3KZ1E 2W58A 1GIAA 3TUZC 1S8FA 1PLJA 1TF7A 1G3RA 2BMDA 3LBNA 4BASA 1SHZA 4FINA 3SJCA 2J0SA 4OHVA 1N5KA 3PIRA 4PPFA 4DEYA 4GDFA 3A1VA 4M1YA 3P32A 4RD6A 4UXIA 5CB6A 1QRAA 1CTQA 2WJVA 3I32A 4D0NA 5EE0A 1JB1A 5EJEA 2PZEA 1P7CA 2XJ4A 5CITA 3HR8A 2QM8A 4M1OA 1XB2A 3N2EA 4P4UA 1QF9A 4YMWA 1TUEA 2G9NA 3JVUA 4V02A 2ZRBA 2BCGY 5HE9A 2Z0MA 3R9XA 2ZI6A 3KJIA 1TQ4A 4P31A 4DZZA 1JXOA 2RGAA 2ZVPX 4CEJB 5TY0A 1LS1A 1YR9A 1X1SA 1Q0UA 2ZU6A 2PCLA 2Z6VA 4MUAA 4MA4A 1E3MA 2RGDA 3I5XA 3DPUA 1E0AA 1E2GA 5KPJA 1E2MA 2C04A 3B1ZA 3AVXA 3CIOA 3THOA 4MKHA 1F3OA 2XB4A 2PL3A 2FGJA 2JATA 1DAIA 3SYLA 2CLCX 4ARZA 2X1VA 4HSEA 3RS4A 4NP6A 1D6JA 2GEDA 3IHWA 3LNCA 3TK1A 4EPTA 4IFBA 2JLYA 5EQTA 1M2OB 2O8FA 3DZDA 3BERA 4J0QA 2GJ8A 4GBMA 5FL3A 1UKZA 2FH5B 2FWRA 1FUUA 2OLKA 4Q47A 4E09A 1M8PA 1SULA 4O3MA 2IHYA 2QAGB 3W6PA 5AJXA 4AK9A 2QUZA 3L0SA 1BO6A 1OFTA 4U00A 1KNQA 4E03A 1E79A 5J4YA 3M0EA 5KUTA 3DOEA 1KDOA 2HJGA 4IEEA 5DI3A 4BE7B 1P2TA 3EC1A 1I4TD 4P4SA 4XVQA 1ONBA 1KSGA 1SVMA 3RANA 1IY0A 4A2PA 4P3YA 4QOSA 1FMLA 421PA 4AI6A 4O0MA 4BEJA 4A8JA 1CRQA 4PO1A 1NN5A 3O8CA 1E9BA 2FPMA 3NKVA 4DCNA 621PA 2IS4A 1E2HA 1W5SA 3ECCA 1L4YA 4IFEA 2P67A 3HYRA 2VP0A 4TLCA 4X8HA 1GVNB 3CPHA 1FZQA 3RHFA 4C0BA 4DSOA 4DDUA 3ZD7A 1E9FA 3W8NA 4A4DA 4DJTA 4JLOA 2O0JA 2H7VA 1S9HA 4H1UA 4JYBA 3RS7A 5CYPA 4YXWA 1MO5A 1G3QA 4ERNA 5L3RA 1VPLA 2LKCA 5HKKD 2CE7A 2G1KA 2H5EA 2AWNA 4FCVA 1P6XA 1XCPA 4FMCB 1U9IA 5H68A 3W3AA 1W4CA 2JIZA 4HATA 1KY2A 1TUIA 2UZ3A 2GAOA 1DS6A 2BM0A 3ZLJA 4NYJR 1UBEA 2GKSA 1AN0A 1JJVA 2BEJA 2XZLA 2AKYA 2X2EA 2FPLA 1U98A 1JR3D 5CM8B 3LW7A 3MSXA 4C2TA 1IHUA 2GK7A 1GNPA 3PEYA 1K6MA 1E2QA 2VP2A 2WPDD 3CUEF 4OK3A 1SVOA 1XXHE 4G3XA 1KAOA 3WY9A 2C9CA 1N25A 4DLVA 1RYHA 5SZIA 2GZAA 3ADKA 1ZNWA 3T5DA 3CNNA 4QJ3A 4MGIR 4XSHA 5BQ5A 4EJSC 4POAA 4E5UA 1JECA 1NKTA 5KNBA 3U3MA 2IC5A 3G82C 2QY9A 1X8KA 4YDSA 3GCGA 1E9EA 4JLNA 2OILA 2PCJA 4Q21A 3QXJA 4V0OA 1SKYB 1T3LA 3G0HA 2FU5C 5EUQB 1A4RA 2WZQA 1KZGB 2WTUA 4DUGD 1Z29A 1JQLB 3PEWA 1XD2A 2BBOA 1J90A 3N2IA 4OQLA 3CNLA 2GXAA 5AJZA 3U6BA 2RCNA 2FFAA 2QP9X 1XTIA 2IK8A 3PUYA 2CE2X 4RFSA 5FBLB 4QGGA 3DMDA 4PHTA 5C1BA 3W6OA 1P4SA 1NVUQ 1W48A 1XTKA 1OYYA 2D7CA 4F91B 1OYWA 3B5JA 1U8AA 1ZIPA 4Q4JB 4LZZA 1U81A 1G5TA 4GOXA 4Q19A 1NVXQ 2DWQA 2HUPA 1Z08A 1HH4A 4KI0A 2YWHA 4HDOB 2ZS9A 3BB4A 5DN6D 1CR4A 1YZKA 4OK6A 2F1HA 5FFMA 2YV5A 3I73A 5JJKA 2VP6A 4Q01A 4BFYA 4BFUA 4V0ME 2ZSDA 5JWOA 2WKQA 1QVRA 1R4AA 3A6PC 2EQBA 4TSFD 2RAPA 1UBCA 1U90A 4MGKR 4ESHA 3O8BA 3W34A 1NVVR 2F9MA 1OPXA 1U2RA 2QNRA 1ELOA 4FCTA 4DXAA 1W36C 1EG7A 3QKRA 3HWSA 4TTPA 5JEDA 3FTQA 4W5JA 2XJ9A 3DM9B 2QMUA 2NQ2C 5L3QA 2PLRA 3KJHA 3FKQA 1ZNYA 2ORVA 1VKJA 3E2IA 3QE0A 4Y0VA 5FUYA 3FFAA 2VIIA 4URXR 3NG1A 1YE8A 1XMVA 1R2QA 4KITB 1H8HA 2B8WA 3ICQB 1ZUHA 3SR0A 1S3GA 2YINC 3OEED 3I62A 2CCKA 2O8DA 3CPJB 1D2EA 1OT3A 1A1VA 4M2LA 3VMFA 5DYIA 3W8RA 1A5TA 2NZ8A 4R7ZA 4ZI2A 2AL7A 2FFQA 3Q72A 4NBSA 3THXB 1KK2A 2H16A 4BUJA 3ZQ6A 3Q8XB 2CK3D 4MRVA 4ZPXA 1R8SA 1T0HB 1DVRA 3L8YA 1UBFA 5FPSA 5JECA 1SXJD 3FMOB 4IW3B 3FKSA 2GDJA 4CEJA 3AVOA 1XXHB 4IOMA 1BOFA 2VL7A 3VAAA 3E1SA 4URYR 2IF2A 4R2IA 3WYGA 3NBXX 1ESNA 4DRZA 1DELA 4A0HA 3IO3A 3K09C 4MH0R 4WZ6A 4B33A 3B9QA 3K70D 4Z51A 3B6EA 3NH9A 2WWYA 2QTFA 2XNSA 4BLTA 1A82A 4WXPA 4NHOA 3L0IB 3OE7D 3UWKA 4ARZB 3TGPA 1AM4D 5LBIA 3OHMA 3LWNA 4D0GA 5EXSA 3ZS8A 2GF0A 3DKVA 4JLVA 1XWIA 1XZPA 2EWVA 2ZJZA 3TR0A 3X1ZA 3BE4A 2CVFA 1PUIA 3LV8A 4JVNA 5TB5A 2O8FB 2ZJ2A 1BYIA 2ORIA 4HLUA 4JYCA 4B76A 3VR2A 5GVRA 4D4LA 1CXZA 4IJMA 3BH6A 2QQEA 2PLFA 3KB1A 3AKYA 3BFVA 1DAFA 2GESA 2IXFA 3LLMA 4KFUA 4YLGA 3LFUA 1DE0A 3K9NA 5JRZA 3NWJA 3B1WA 4P4SB 2C96A 4F93B 4PHHA 1UF9A 4NYMR 3CF6R 3GFOA 4WBSA 2QMOA 3RC3A 1RE0A 1GOTA 2VH5R 2WJJA 4M8NE 1Z47A 3B13B 3IEUA 3CRQA 3OIYA 4I1SA 4A8JB 3PJRA 4D80A 1Z22A 4LJ7A 4MKFA 5K8TA 2Q9BA 3SNHA 4DLRA 3CX8A 1E2FA 1Z6YA 4B3CA 2WPDA 4YMVA 2P0EA 1LF0A 1D9ZA 3MFYA 2OFOA 5FPKA 4GZMA 2WBLC 5CIQA 5BW8A 1Z3IX 2WWWA 2CHGA 3RS0A 1Q12A 3ZVNA 4MDFA 4EFNA 5C4GB 3ND8A 5L3SB 2E87A 1PJRA 2WMNB 2VHCA 5CK5A 1IXZA 3U7FB 3FHCB 5JI3E 2IXGA 4G0NA 4KBFA 4Q7KA 3T61A 1QDEA 4JLMA 4PAOA 3KKQA 3U44A 1LNZA 1KDPA 1T3SA 3Q7PA 2CHVA 5J4LA 3EA0A 3I5YA 1P75A 2ZRAA 3C8UA 2CJWA 4ACAA 3ADCA 3O47A 2IYXA 1C9KA 2V1XA 3NIBA 4LC1A 3KXLA 5DHFA 2YKGA 3WNBA 4HLUC 3P1JA 1IN6A 1IONA 1LW7A 2WSMA 2QROA 4JIMA 3TVTA 1XCMA 4GZLA 1NKSA 4U02A 1XD9A 4WA7A 2ZTSA 3QENA 3ZVMA 3ZJYA 1BS1A 3GJ5A 5E4FA 3KJEA 2RGCA 1NBMD 4LHZA 2G3YA 3TIFA 1RZ3A 2ATVA 3GJ0A 1ZNXA 2W2VA 4MYUA 2WOOA 3C41J 5G3ZA 1W7AA 2FX3A 4V0LA 1VIYA 4IDNA 1CS4C 3U7EB 4GP7A 1G17A 1JI0A 3BWDD 5SZKB 4A36A 3ZZ0A 1RPZA 1NVVQ 2DFLA 2WV9A 1OXXK 1XD2B 2VQSA 1DPFA 3CX6A 2EWWA 4I99A 4R98A 4EFLA 2OBLA 2A5YB 3BOSA 4UJ5A 3SHFA 3A1WA 1MABA 3CBQA 4NMMA 1VCIA 2NIPA 1RJ9A 2C03A 4NCHA 2NG1A 3GJ4A 2RGGA 2MSEB 4E07A 2J5XA 3MD0A 3T1OA 1LF5A 2AK2A 2OFWA 4FWIB 3E5HA 3CRRA 2HF9A 1WXQA 1TNDA 4ZCIA 1E96A 1FTSA 2UZIR 4PQYA 1ZBDA 5KO2A 4WXRA 4Q4JA 3AH8A 4PQRA 4F4IA 2IYYA 2A78A 2GK6A 2VBCA 3OIVA 4XWOA 1OB2A 1IXSB 4LK2A 3THYA 2FMXA 1XBTA 3MJRA 3AVYA 3QKTA 3B9PA 5IK2A 2V8OA 1AK2A 2ZITA 5JBQA 1G7TA 1WBDA 2ODEA 2BJWA 2QL6A 4C0KA 1T6NA 2AKAB 5EZ5A 4JZKA 2CXXA 3KQHA 1VYVA 4DC9A 3QPVA 4TMWA 3IEVA 1IXRC 1U0LA 1F6BA 3KKPA 4FIDA 1NMZA 2X2FA 3CONA 1P73A 4IVRA 2KB0A 2N46A 3SYKA 2IYZA 4LHVA 2AK3A 4KVAA 2WWXA 5KTYA 4GI7A 5FUWA 4DLTA 1NLYA 2W6JA 1N6IA 5BYKA 2WKPA 3LBIA 1N6HA 1RRFA 4OK5A 2O8DB 4OL0A 1FP6A 1OFIA 2V7QD 1IQPA 2PMDA 3AVPA 4RKEA 2ZJOA 4CW7A 3U60B 3CWQA 1KO1A 1KOFA 2XEXA 2XNDD 2HDNB 2O0KA 2JCSA 1AIPA 3THXA 4LJ5A 5GJWC 1FX0A 1M34E 4V0NA 2GBLC 3SFZA 2P3SA 3IO5A 2IF0A 3Q9LA 3QI2A 1QHIA 2G6BA 1E6CA 1OFHA 3AKEA 1F2UA 4M21A 1XXHA 2FEOA 4TYNA 2C99A 4C30A 4DCSA 2FEMA 1GG2A 4BFZA 4DCVA 4JLBA 3SZRA 4URZR 4Z1MD 1P9WA 1HYQA 4WZAE 3GLFA 3BK7A 3GLHE 4L5BA 3QXXA 1D8TA 2GRJA 1XJCA 2EFDB 1KTVA 3EZFA 2P6NA 1IJFA 1AGPA 2OXCA 1KSHA 3C5HA 2D2FA 2D2EA 2WWIA 1P72A 4B6EA 1YR6A 4DWJA 4L4UA 1N5LA 4W9MC 2KJQA 1G3IA 3SQWA 2V4ZA 3QBVA 1SXJC 2BVNA 2ZRHA 2VHUA 3MG9A 5J5CA 2E1RA 2V9PA 1I2DA 4I81A 5KSOA 5CB8A 3P4XA 1YZQA 2CMKA 4JMPA 3K0SA 3OIWA 4D26A 3AVWA 1UKEA 5JI2E 2O52A 1ZC3A 3A8TA 3BORA 3PEVA 1OF1A 1T9HA 2ZJYA 2JAQA 2BC9A 2OFXA 2YC2C 4RSGA 5IF9A 3B78A 4YDHB 3OEHA 1U9IC 4KXFB 1K8RA 2Z5FA 3EXAA 4B34A 3PR1A 1ZVQA 4XSGA 1SZPA 1JALA 3CWZA 5B30A 4OQFA 2JJ1A 4PZLA 3AF3A 2TMKA 2ANBA 5CLLA 4MKIA 2W6IA 5DNYB 1DAMA 2I1VB 2NO7A 2J0VA 1E2IA 3K0FA 2YHSA 2Q0HA 2ASEA 1OXSC 4GT1A 3U3JA 1E2LA 5HCNA 2AN9A 2ZROA 1G16A 5J4KA 3H2YA 5LDDC 3GEEA 2GILA 4HDQB 2J7KA 4Q48A 3GEHA 1T5IA 1NN0A 3QVVA 1ZRHA 4A82A 2DY1A 3EWAA 1ZM2A 2IYUA 1BMFA 2OCPA 1OE0A 1FQKA 1G8FA 2QG6A 4HAZA 2VEDA 3GPLA 3WBJA 3QF4B 1G8YA 1FP7A 2C78A 1XEFA 1PVOA 1TU3A 4RKFA 2ZUBA 2A7QA 5F98A 3GLGE 5L3SA 3BJIC 4PFSA 1Z2AA 1YVDA 1FL9A 4ZDKA 4NH0A 5K8LA 3CRW1 5J40A 1DAHA 1W1WA 4LBZA 2D62A 1P5ZB 2NO0A 4IKEA 1DG3A 1L8QA 4Z8YA 4D81A 3GLGB 1YZUA 3B8HA 1JNYA 2J7PA 1ZM9A 4DDWA 4EQ6B 4LYFA 1SVIA 2OUKA 4QC2A 4IOKA 3MWKA 3U44B 3VKHA 1NP6A 2BWJA 2R6CA 2QT1A 1AJEA 1W46A 1D9XA 2CJWB 3FYHA 4BLQA 1OW3B 1KI1A 3PQCA 3RLFA 4BWYA 2IUTA 1YZTA 2PJZA 4HB0A 2QP4A 4EFMA 1ZCAA 1I4DD 2J45A 2D06A 3QVUA 3VNUA 2IX3A 5L8VA 4LC0A 3R9WA 3KTAB 4DSTA 1G3MA 2IS2A 4M9XA 2IWRA 3TSWA 1GNRA 3THWA 1AA3A 4YMUA 5IT5A 5KU1A 3ZGXA 1A7JA 3RABA 1OHHA 3ZQJA 2IYLD 3K9GA 3VU9A 1Z6TA 2C2HA 2GXQA 4GOKA 4HB3A 3NBZC 4QBHA 3TSZA 2EW1A 1K5DA 4CIDA 5KHOC 4D82A 2IYWA 4NPHA 4CT5A 2NGRA 3VQTA 2A5FA 2R2AA 4DB2A 4PC3A 1MABB 3IILA 1W0KA 1R6BX 1BIFA 1RJ9B 2DFTA 4CVNA 3TLXA 4TQAA 5DSZA 3GFTA 4NYJQ 3EA5A 2Z83A 3SS8A 2MSDB 3QUSA 1L4UA 3D8BA 3HU2A 3Q3JB 3N5CA 3A4NA 4DUGA 4DB4A 2WM9B 5EE3A 2CNWA 2QRNA 3AKCA 5C18A 4D4JA 5KSZA 2IA5A 2IYQA 1XCGB 1T8UA 2FZ4A 2PT5A 3EIQA 2CL6X 1M1YE 5DHAA 1NLZA 3TAUA 5FTMA 2JJ2A 1RW4A 2VA8A 3FFBA 4HAYA 1Z6AA 2W83A 3FVQA 3THYB 4I4LA 4B75A 4B74A 3HP1A 1NF3A 3RC8A 5J47A 1X3SA 4C0LA 821PA 4LHWA 4TL9A 4URVR 3WXMA 3TNFA 5GADl 1G4AE 1TTTA 2JJ8A 3T5GA 1E1RA 1CF4A 1P9NA 3EZ9A 5FPTA 1G5RA 4MRSA 2VTKA 4QHSA 1X1RA 3VTKA 1XTQA 3RRMA 1TMKA 5DI9A 3WMFA 2QSZA 2GXUA 4DCTA 4ZKEA 4IEIA 2AXNA 4LJ9A 4LRWA 1T8TA 2Q6TA 4OI1A 2WOJA 4QBIA 2V6IA 4Q5IA 2REBA 2V55B 5H1YA 2VSOA 1CJTC 4AYTA 3ND9A 3REGA 3PUVA 2B7BA 4NZYA 1RFLA 2IBMA 2RB4A 4JLKA 2DCUA 2ERYA 3DKPA 4NTZA 4EPWA 2Q3HA 3KQUA 3K70B 4A6XA 2FGKA 3EZ7A 5CLQA 2FG5A 2D7DA 2FSGA 4C0JA 5FOTA 1OH7A 3UKDA 3QXHA 1E4VA 1YU9A 3AUYA 5TMPA 1XJ0A 3WMGA 2J1LA 4GMXA 4GPTA 3C5CA 1QG2A 2CLDX 4A9AA 2ZE7A 4LI0A 1S9DA 1HT1E 2R6GA 2BOVA 5LD2B 1AGRA 1TADA 3LH5A 1GZSA 2FNAA 1NY6A 1FX0B 2QE7D 1NN3A 2RGXA 2QZ4A 3BBPA 5LPNA 2BBWA 2QBYA 1WE2A 4LJ4A 1U99A 3A1SA 1G64A 4PAMA 4LPSA 5KDLA 2QP3A 2IYSA 4M53A 1BH2A 3SU8A 3QPUA 3IBYA 4IXMA 1VYTA 1BKDR 4OJKA 4Q18A 1Z6XA 1F2UB 2GA8A 3SOPA 4D6PA 4IDHA 3CM0A 3UMSA 2Q9CA 3MWLA 1XTRA 4DDVA 3V00A 1UKVY 4KU4A 5HZKA 1XDBA 2HT6A 1AS0A 3GP8A 1OKKD 3K1JA 3GLFB 4BZPA 3LQRA 3L0OA 5FBQB 1KO8A 4ZCMA 3AV0B 1KI8A 5G40A 2B7CA 1OXUA 1GTVA 1GWNA
chains in the Genus database with same CATH superfamily
4AF7A 3RIMA 3CF4G 4E21A 1EQ2A 3L77A 3V8PA 3BN3A 4IFIA 4YJ2B 5J1TB 1A8HA 1ULTA 5REQA 5FUXA 3FDFA 2V6FA 1FQJA 4TLEA 4DG9A 5C2JB 1H8ED 1N2BA 3DCIA 1LDMA 4PBRA 2G25A 1OU0A 5JY1A 1YQQA 2GPSA 4XYLA 4ZYYA 2FDCA 1CRWG 2I4IA 1JIQA 3K7EA 3GO4A 2C7PA 2VATA 4D02A 3NDPA 4C3ZA 1IAQA 1QIJA 2BRUC 3C3WA 1K2VN 5CB4F 3PKIA 1KWGA 1TC2A 1GZ7A 2PKEA 2ZM5A 4R8RA 5LYJB 1YQXA 4IUDS 3OCJA 1TU0A 4UASA 4YDRA 4DNPA 3A11A 3RWBA 1SPXA 5G1NA 3H5NA 1Q21A 3HA5A 4R1MA 1W5AA 4PAWA 1DB3A 4LHSA 4ALNA 2H2HA 3VTAA 2C9OA 3A7DA 2XSZA 4EJSB 2MMCA 2YVKA 1CFJA 2QIPA 4GPIB 4IINA 4UTXA 1VG8A 9LDBA 1K6JA 4B46A 4C4OA 2ZUFA 1XC7A 2YXPX 4HUJA 5KTNA 4S04A 5AHXA 1ORWA 3QJGA 1THTA 3DBOB 4H16A 4ZO6A 5EKTA 4BN5A 3A6GA 4MVJD 3GFVA 3K0FB 1MAUA 2Z4RA 4DM7A 2NV0A 1JKJA 3M8KA 1N2ZA 4N6NA 4AD8A 4F2HA 5SZHB 4OQMA 3VZSA 1V6SA 5DYYA 1CJVC 3MTIA 1CZKA 2CHQA 4Q1FA 3Q7QA 4ILEA 1H22A 3WGVA 2IT1A 2YJ6A 3VC2A 1QANA 5CIWA 1CUJA 4N18A 3K20A 4BEVA 4WCFC 4ZV7A 3ZU2A 2GK4A 3QF4A 5AM2A 2B82A 4XWAA 3U19A 3TZEA 3B1XA 4DCUA 5LLTA 2VP4A 4TLDA 1GADO 3PC4A 3T1QA 3V4FA 1U0OC 5DIZA 1YFZA 2ZUEA 3K0CA 3VGJA 5I4KA 2HKIA 3E9RA 1OD6A 3OWOA 2IPNA 5EE9A 1ND5A 1GUZA 4GVXA 3GH1A 1S4QA 1D0IA 3UK0A 4CG3A 4DM4A 5KOHB 5LP6B 3FWPA 6ABPA 3GLGA 5EQJB 1PZGA 5LQKA 4FILA 4B5KA 3RVRA 1ZI8A 3U9TA 1XMXA 4XVHA 2OZEA 4QTYA 4EW1A 1T5HX 1G3UA 1M76A 5ES3A 2P68A 2AW5A 2ZB3A 4TTVA 4HGQA 1EJ2A 3E7FA 2DP4E 4KIUA 2J3IA 4N49A 3V42A 1KJNA 3F5QA 3KSUA 3RBAA 3W9YA 3ZR4B 1X9GA 3AEKB 1Y80A 1N57A 3CVUA 4CMKA 1N78A 2QRGA 1DQNA 5C9ZA 1L5RA 3AZQA 3ZI4A 4EG4A 3UMGA 1AN9A 2C77A 2WI8A 3TS1A 4IY1A 4TXMA 1Z82A 1U02A 2I99A 3UK6A 1PDOA 1Y1KE 1XZKA 3ZEAA 5KX5B 2B25A 1ECJA 2YICA 1FSFA 3PQ4A 1DP4A 1L4GA 4L9SA 1VJCA 1RWWA 4ZAGA 2OCLA 4LDJA 4ESEA 3X2FA 3JQGA 4LE1A 3SMQA 3I4LA 4X9XA 4XYEA 1YMQA 2W2KA 3GRVA 4FFOA 4XX0A 2LIVA 1ZW6A 3U5TA 2HL6A 1V8BA 3OTOB 1HM5A 2OCIA 1X7YA 3RROA 5CBKA 4F72A 4JXXA 1IEQA 1X0XA 2V7XA 1G5QA 5KHAA 3K9LA 1IQ0A 1KC3A 4RA9B 5JC8A 1HOTA 4Z7JA 1GKUB 4JR1A 1AA9A 1XLUA 4J76A 2P2SA 1KAMA 4W82A 1LQTA 3R6DA 1RKQA 2IS1A 4I3FA 3QPDA 2LDXA 4JSTA 2Y1KA 2IEYA 2H4JA 3GYBA 3CS3A 3LYUA 3SJBA 1ECCA 2O8VA 2YMPA 4TWAA 3V8QA 4BVKA 1J9EA 3W77A 4KI7A 4BTVA 3HNRA 2Y1EA 2BTEA 4NS4A 3KYDB 1SCUB 1YRYE 2IPLA 4KODA 1G7RA 1RI5A 1N0VC 4ENQA 4WDRA 4PPYA 3WGIA 3KLNA 1PGJA 1VKZA 1DJNA 3HB7A 4JQYA 2WFLB 4AKIA 3CNOA 3RM3A 5B7PA 3QYPA 4BVJA 1DARA 2A4KA 3EDYA 4JODA 4D6XA 3I2FA 3GR6A 5BN5A 2VF2A 4PFJA 3CHYA 1VSVA 3V7FA 2PSHA 1PYDA 3QUCA 4FT4A 4MAAA 4B32A 4F9FA 4ZHQA 4US1R 2BELA 4QLBA 2BGWA 2PUGA 3E70C 3DZIA 4M1KA 4B6SA 3K8QA 3OTHA 5AD1A 3FUCA 1FVFA 2GJAA 3O8OB 4I5FA 3ZXUB 5HUHA 3LX6A 1II8B 4UM5A 3IIJA 4EEZA 1YQWA 1N2SA 3LX5A 3BQMB 1UMDB 3ON5A 4WY8A 2F43A 4RUKA 1HSZA 1KMHB 1ZN8A 3KYBA 2J3JA 3LWBA 2IV2X 5IS2A 5GP1A 1H65A 4MRAA 4B5LA 4DYVA 4FKBA 3FBGA 1OIVA 3QOFA 4QOGA 5BORA 5JNLA 3D59A 5HOQA 4PS0A 4UAJA 3SEAA 1J1ZA 1PG2A 2OGZA 1Y1RA 2QR5A 3B6JA 3DOOA 2LCFA 2ROQA 3U3KA 1IN4A 3WRYA 2OCDA 2GMWA 2RAFA 4JL6A 5E6RA 3EASA 1NW5A 5KQGA 3TSCA 5JE8A 4AZ0A 3J81k 2PEYA 3K5PA 1Z12A 1NA5A 2CL0X 1BGWA 5EHNA 2Z3VA 3N3AC 3TSAA 2FLVA 4DJ5X 1K1EA 4OD0A 2WZCA 5F9FA 3VYRB 2GZ1A 5LQCA 5D85A 3J81A 2FZGA 4CM8B 4AKSA 4MAMA 3GWZA 4RLSA 4MQMA 1OLUA 1XZLA 4UW9A 1Z5WA 3A4IA 4B7CA 1X7ZB 2XX3A 2I1LA 5JRJA 4KSBA 1P2DA 5DMXA 3U5ZB 3A4VA 3GELA 3RTBA 3F3YA 4CWAA 1DC8A 1FRFS 3EFHA 1ADJA 4G4JA 1C0IA 4QHYA 4PPNA 3FAZA 5KAMA 4XD7D 2HSEA 3OPNA 2FF7A 1PL8A 5JBIA 4BEBA 3HXOA 1Y6GA 4XSVA 1HQKA 4RX1A 4S2EA 2VDVE 2GN6A 1DFGA 3EG9A 4YJ3A 3COSA 5EWMB 2I54A 4NYIR 4RA6B 4BNNA 1TM3E 5KNDD 1DBQA 2LUOA 2XIJA 1QBGA 4HF7A 2NOAA 2WKRA 1FTYA 2YC4C 3VHQA 3IDQA 4U2BA 4MUEA 4PSAA 3AJAA 5HF8A 3O1LA 5D5QA 3W2GA 2WAXA 4MRMA 3HHPA 4RSRA 4UVHA 3S1SA 3RH0A 1FUKA 4MKZA 3K9BA 1Q3HA 2YUTA 1GRRA 4LHXA 1WP4A 5D7BA 3RU9A 1UFKA 2ZK7A 4BNLA 5AUOB 4RMJA 4B3TB 1WP9A 3X43A 3IVXA 5CW2A 2P65A 3IPYA 2F3UA 3ORRA 5JMPA 3I2KA 4CU5A 2GWHA 2CZGA 1Y0BA 2WJGA 2J08A 1DUIA 4URUR 5CHYA 4EIWA 3VM6A 2HIGA 2J3QA 1ZLXA 4KRFA 4MRNA 3NC4A 1Z6PA 3MGCA 1HSOA 1QIMA 1SVWA 4TMKA 3RYIB 2IS6A 5AVOA 4KE6A 4GKVA 2PXAA 2IOHA 2PUDA 3KAKA 3CZQA 2CSXA 4RF3A 3JD3A 1A9RA 4MQFB 1JFSA 1NVFA 2WKSA 2OCYC 3AQ4A 3UAYA 1MU0A 5J4HA 2ZR9A 1C30B 2CZCA 2GN9A 3LVBA 1Q7RA 3VUFA 5J1SB 2X86A 2XMQA 1DDOA 2ZVJA 2Q50A 4E3ZA 3MMZA 5IRCD 4C4PA 2Z2IA 1GSHA 3SHWA 2Z09A 4HAWA 2AZ4A 5JCOC 3PLAE 4EYSA 1QAOA 4MW7A 3SIPA 3WYNA 3BWBA 1T5DX 1YQGA 2FE4A 4PLTA 1VB3A 1BS2A 2P6UA 3V5NA 4DGQA 2OV4A 4GC9A 2WE8A 5FI0B 1CYDA 3BFKA 1W6UA 2Y1OA 4GWLA 2YWRA 5IC5A 1KE1A 2ZUTA 2E1PA 1AXGA 1YTLA 3KRTA 3QGMA 4LY9A 1HTWA 2A5DA 5J43A 4RH0A 3S1AB 1XDWA 3HYLA 3F7TA 4MYTA 1ABBA 4FGWA 3L0ZA 4G5QA 4U2DA 3O26A 1HFEL 3P2OA 2XCQA 1FTWA 3A25A 1E1NA 4KV7A 2KLHA 2AX4A 4G5GA 1UEIA 4N03A 4W1RA 2A0FA 2K4MA 4CCYB 3BHNA 5ITSA 2Z6UA 1ZOIA 2ZIUB 5BXQC 4OXYA 2V98A 2PKXA 2V65A 3NHMA 1AUPA 1KY4A 1MJFA 1HLPA 1RWPA 3I39X 4CFSA 5JD5A 2B3TA 5LP6A 2GRUA 3HXMA 1DX9A 1E1YA 3WADA 4DQLA 3P4UA 1Y4AE 3T7JA 2O2IA 2JGAA 1QH8A 3KT0A 5BXYA 2VPTA 1JE1A 3LF1A 1JVSA 3DC7A 1ZMBA 2JZCA 4U0JA 5F76A 2A1TR 3L0DA 4DW8A 2FQYA 3IALA 1ZH4A 3F6SA 1ATZA 1W5TA 1MEOA 2OZVA 3NGLA 1UDAA 2AE1A 5EKXA 5LB4A 4CMEA 4WOKA 3QKSA 4CMGA 1SCQA 5CH5A 4RPLA 3Q2OA 2EG9A 3OQMA 2FV8A 2QZPA 4P4LA 4UJ3A 3E5RA 4OKSA 1X7WB 4IDQA 3AUXA 2ZBRA 1U65A 4NK4A 3TRDA 2AYZA 3CNHA 2E4UA 1L1QA 2BBTA 1S89A 2YIJA 4ZIRA 1NOIA 4ZAVA 5A9RA 1LB1B 3DLBA 1EG2A 2XNHA 3A9WA 5KX5A 2PMEA 3L02A 4IS3A 3D0OA 3I09A 4LVCA 4RGBA 3CW2A 5JJIA 1MJGA 2OE2A 1G8JA 2G70A 3EPRA 5EA2A 2RHGB 1XP8A 4ZVMA 2VVTA 4P34A 4EKYA 1EZ4A 1G41A 4X85A 3OHSX 1AUQA 3N0XA 4HDMA 1WPGA 1YCDA 2Z3ZA 3S44A 4PZEA 1VIMA 3O31A 1X7YB 4HAIA 3D81A 4CXMA 4WXHA 1E20A 4A0FA 2HJVA 1KGDA 3M6LA 4PBSA 4V03A 3DWFA 4TMYA 4BLSA 1SHLA 1XV5A 4HQKA 2NAPA 4Q9LA 4YV1A 2JRCA 3IV6A 1U2GC 3HP7A 3Q98A 4FLEA 4IXNA 4G1FA 4X7MA 4YP5A 4DCJA 5EE5B 1QFXA 3FXAA 3DFKA 1VPDA 1X7DA 4OA8A 1OROA 3KZMA 5H83A 4E2XA 4A16A 3KPVA 2IEZA 2LV8A 3FHOA 4DEXA 4P7FA 3BVPA 1NXTA 2ID8A 3IP3A 5DZSA 3L1UA 5KOJB 2EJUA 3WI7A 1YRBA 4C76A 3DGFC 1IEVA 4OHPA 2JIOA 1GRNA 1QG6A 4H4CA 5CDHA 4ZTUB 1SCUA 4J7AA 1LVGA 3LQ1A 5AJUA 2CLSA 3QI7A 4HDNA 4KHZA 3FCAA 4YV2A 2P2DA 2ZB8A 2HMVA 5TF0A 1DC5A 5KMGA 4Q1EA 5EMHA 1JE0A 4NMHA 2F90A 1FRQA 2HA2A 2HF8A 2Z3WA 4EFKA 5SZJA 5CA1A 1IN8A 2V7QA 1YZLA 3AETA 3CLHA 4I5DA 4NDNE 4F5WA 1Q0TA 1OWNA 1FNNA 4C7JA 1VPEA 1KMQA 2BMJA 2Y0BA 4ZHQB 1ZM7A 4Y1FA 1V43A 4QECA 4RFLA 1I6WA 1XDGA 4OIFA 3VYTB 1V6CA 2JKZA 5I4CA 1GT6A 2J32A 3AEQA 3RSZA 1II8A 3BGIA 4QAQA 5LLSA 2H4HA 2O2DA 2WJIA 3O8LA 2Z30A 3PPYA 1UMDA 3FCUB 4KSYA 1A27A 1MIOB 3UFBA 7MHTA 2DFNA 2GFQA 3T0GA 2WHPB 2O8BB 1DO2A 1FDSA 1NU8A 1R7RA 1ZJZA 2FF5A 1PS8A 2P2YA 1RQGA 3ZVRA 3GMIA 4PLYA 1A95A 1GAWA 1PJTA 1Z2EA 1F2TB 2QNBA 3AI7A 1W96A 5DDIP 5FPPA 4EG5A 4MVWA 2G9QA 3IKMB 2I6UA 3VZDA 3ZIAD 1XZIA 3AJDA 2YCLA 2AXQA 3CVOA 3HE3A 4UU1A 5AI6A 1I51A 1NMXA 1SH7A 2P78A 3O9VA 1Z2CA 2G72A 4JBNA 4QU0A 3MT8A 4TWIA 5ALPA 121PA 1Y7PA 1ZHHA 3DQQA 3BGWA 3UXYA 2QLFA 1JBEA 1GZHB 3W5UA 1J23A 1M34A 1KDRA 4BQRA 1T2DA 4LWPA 1MOZA 3G68A 4MMZB 1CUWA 4NOLA 1R9NA 4TLLB 4XYMA 2P9EA 4PZYA 3RKRA 4HB2A 2LWIA 4FYXA 3LX8A 3DR5A 1ADGA 3FOFC 3IYLW 1UKYA 3WQSB 1U6KA 2CSUA 4K6FA 3TB4A 3I72A 4CFZA 1JHUA 2R1UA 5EYPB 3KPUA 4DMGA 3W4IA 1B6RA 2RIPA 5K51A 3E23A 1LY1A 2WJAA 3DFMA 1B0UA 3V6LA 5M2QA 3I3SR 1ORVA 2HDWA 1EUZA 1C2TA 2GO1A 3DKIA 5GAJA 4B3FX 4HEJA 4M86A 1UPAA 1GZ3A 3R44A 4F4JA 4R1LA 3NM4A 3EEQA 2Q07A 4B6QA 5IM4A 2O2CA 4FU0A 2XYPA 4LTMA 2ZI9A 4R6WA 1FMTA 4CDNA 1ZCBA 3SIXA 1O6BA 4RDIA 1BRTA 3JZAA 4G56A 4WK2B 3ROEA 3JCZA 4E7OA 4M8KA 3OTQA 5ILQA 5ED4A 3ZUGA 2GETA 4GM0A 1E1CB 1N8KA 5DGDA 3T9EA 4PQFA 1CUIA 1E92A 1GPMA 2YH2A 3PQDA 4C89A 3VKGA 3AF5A 4O2BA 5EKUA 4RFVA 1YUNA 3HFJA 5CURA 1W0CA 1KI7A 4NMXB 5LZ5A 3CX7A 4YT5A 3RV4A 3OLCX 4LY6A 1JQJC 2B4YA 4DHEA 2PD3A 3A1TA 1QVWA 5FYQA 3EH1A 3EYAA 1J8YF 1RR6A 4GKAA 2GH1A 1UBTS 1AQYA 1PHPA 4IGFA 4I4TA 2A92A 2QQ0A 1XTZA 1GZ4A 2GZSA 2HXSA 3DF7A 4BMPB 2O8EB 4JH0A 3W9UA 2PL5A 2WSLA 3C6MA 4MV1A 4UATA 4JJ8A 1A8UA 3STYA 1TA4A 5A4FS 2WVGA 3OSZA 4H08A 3U3RA 3RYIA 5JWRA 3CTMA 4GUAA 1I33A 4K9OA 4XAQA 3OZEA 4LDQA 1PR9A 3PFIA 3V4VB 4XWKA 1DIOB 4O4LF 1KTIA 1F4PA 1MQ8B 3H17A 3I28A 2H85A 3ZDEA 2FPRA 4QWMA 1KZ7B 1M73E 2IOQA 3CH4B 2OSVA 4ES6A 4V1CB 2V7UA 3ELDA 4RVNA 5DWDA 1YR1A 2SNIE 3KDAA 4BKMA 2FEPA 2X8JA 1HDCA 2Y0CA 1N0WA 3LE8A 4N8DA 1C9EA 5AK4A 2WR8A 2IHZA 4MPPA 3H0EA 1DC6A 1D0SA 3WLJA 4TRMA 2QTTA 2IP2A 3QXSA 2VP5A 4LYHA 1JDBB 1NIJA 2EFJA 3IQIX 3WQRA 3ZOKA 3NS7A 4RM3A 3B1VA 2AYYA 2HLHA 2P2CA 3ICPA 5JS7A 2OEPA 1IN7A 4WNCA 4XQ9A 5CG2A 1UC5B 1A2BA 1GPUA 2WHQA 1MIHA 4NE7A 2ZG6A 4MVJA 1WEKA 2AG1A 1BRMA 2IDKA 5ERXA 5JD3A 3P97A 5IVIA 5TX7A 3R7NA 5ED0A 3UCXA 5EXXA 4ZC1A 5SY4A 5A4AA 1WB5A 4G9GA 5A9SB 1ST3A 3OQVA 3ZCUA 3UANA 4N9WA 1UXHA 5IDXA 1PZMA 2JA1A 4FW8A 2ZSIA 1JQAA 5TPZA 3B1YA 4NCKA 2P90A 1W4BA 1ZI6A 4EPXA 5T57A 3P9IA 1N2CE 1L6RA 2IPMA 2Q21A 3DBHB 3O0DA 4M7RA 3DOCA 3SGLA 4BV9A 1O6FA 4LZJA 1O1YA 1QH8B 5FV7A 3TCKA 4EUFA 4LF8B 2REOA 1LTHR 2XD4A 1AO0A 3W6NA 4JUCA 1FYVA 4KAXA 3ZZMA 1PR5A 4ZRDA 3W2TA 1IMJA 5EJFA 4K9DA 5TRTA 3OWXA 1OTHA 1Q15A 1PT9A 2OKCA 3IR6A 1E5LA 2ZT7A 1LU9A 2ZS7A 1EJ6A 1P31A 2VJBA 3HRHA 4AWAA 3AHIA 3O9MA 3P94A 4WY2A 3UENA 2PZBA 2I7XA 2ZJAA 4XCQA 5D6OA 5TJHA 2WSSD 2GAAA 1NL3A 1RHRA 1EP3B 2MSCB 2FWJA 1CJMA 1TDJA 1YS9A 4PSUA 3QPWA 3OX3A 1CEQA 2JJ2D 5FOVA 3TZQA 1WUYA 4G23A 1CEXA 3MRVA 3TW8A 1KSFX 2QJFA 1EBUA 3GFRA 1WXEA 1CDEA 1KDZA 1X1BA 4BKUA 5HHTA 4IOJA 1BCSB 2BF4A 2DFPA 3KFXA 5G2OA 1QIIA 2NYVA 3JS5A 4Q1AA 2V97A 1C7IA 2BFBA 3KQMA 1UMBB 1RM4A 3AP2A 4OIMA 4FYIA 3U62A 2RK6A 5L7YA 1XUOA 3QK7A 1MAVA 5FX2A 2AKEA 1ZR4A 4A0QA 1TW3A 1SG0A 2I6XA 2HO5A 4N7JA 1J8MF 1V8ZA 4MUBA 2JL1A 2XY4A 5DLQC 4D3SA 1GSAA 5THXA 2IUUA 3FFXA 3GVIA 5CLIA 3WWOA 4S1TA 5ELXA 3ZXXA 4B71A 1AY0A 3OM8A 4HZGA 4S35A 4KQKA 3W6UA 2OBMA 2NU9A 5ALOA 1O94D 2BP7A 2PX6A 4LOIA 3REFA 3V1TC 1B7GO 1UDWA 3UJNA 1BDIA 4Q4LA 3PQ5A 2HK8A 5CA0A 3HFGA 2I4TA 1HLDA 1F0PA 1QYVA 2DWPA 2J4CA 1OCEA 2VHWA 2VOEA 3GDGA 1NF9A 4BLPA 4UTRA 4BNUA 5CFOA 5DIFA 5A62A 2P3LA 4DANA 1IJEA 5IK2D 4B6RA 3PFCA 1DC7A 2RGWA 5E9QA 4RGVA 4AX8A 3CG4A 2G5PA 4L1KA 4QUIA 4PLGA 2XDQA 3PT5A 2YOFA 4KIGA 3R5SA 4GLBA 1PYOA 4M1WA 2XUZA 4G5RA 3GGDA 1A2QA 4NBUA 2FWBA 4K9KA 1CY8A 4PPGA 1DG9A 3DZKA 1IBCA 3D6FA 3C8HA 4ZEXA 4LQLA 2CUNA 5CA1B 4UEOA 1I7DA 5CB4A 3OHPA 1Q7EA 5JG7A 1D8AA 2CFOA 4C0HA 5YASA 2PTGA 4N7MA 3FMFA 4IAOA 1VYHA 3FUXA 4B6JA 5I3CA 1ZMTA 1NSTA 2Y1LA 3ESYA 1UT6A 3L06A 4H6VA 4MS4A 4QDZA 1KZHA 3L8GA 2VSXA 4QSMA 3HEMA 5B58T 2ZVQX 3PXUA 4LRQA 3LP8A 2N9UA 4XGKA 4CU2A 3X1WA 4EO7A 3QPAA 1OZFA 1MIOA 1AK1A 4NCJA 2Q5LA 4Z0TA 4U3JB 2YWEA 4MV6A 5B1IA 6REQA 4EY6A 4EHLA 3U2QA 1QGAA 1PJBA 1UPTA 4KX3A 5AHRA 5BV8A 3D6JA 4RGYA 1GEGA 3L6CA 3NVAA 2FXVA 2HQOA 4MYRA 1EE1A 1KYIA 1EWVA 3LT0A 4MUXA 4DL9A 3GL9A 2VYFA 3HDGA 1JSZA 3KSMA 3C3DA 4H35A 4HZUB 4ZXPA 3SZOA 3W1WA 1TUBA 3GLQA 1PKXA 1N1EA 1NWHA 2RHJA 1L3IA 1U28C 2Y9PB 3AW9A 2FX2A 3P20A 5I7EA 3WBBA 4RKRA 2J85A 2ZWVA 1EK2A 4F6LA 2QGNA 1QFZA 3BWYA 4KZPA 3W78A 2RKOA 4ALLA 2W2TA 2VH1A 1H4SA 4F46A 2D74A 1ZA1A 5HIIA 1J4AA 3IHTA 4IDPA 3SBEA 5HE8A 1X0VA 1Z06A 2NXJA 4Q0MA 1BE6A 1KEEA 4DPLA 3AWIA 1YKFA 3TKLA 1UOPA 4DLLA 3UK2A 3U13A 1A7AA 1W5FA 5E7JA 4NEGA 2KBEA 1DV1A 1M2EA 4GI1A 4OQXA 1FNSA 4TRNA 2PZKA 4YQYA 5FO1A 2Z98A 1SXGA 2W2LD 3V1MA 2DY0A 4G6ZA 1WXHA 1QHYA 1VJGA 3TNLA 4PM4A 3GJRA 3Q7RA 1BX0A 2AOUA 1E0JA 1Q83A 2A4MA 4BE4A 4LA4A 3HO1A 4O08A 1VDZA 2VUTA 4LJ8A 4YV7A 4LXIA 3Q6IA 1H2FA 1JLKA 1P9RA 2OSBA 3O4RA 3KEOA 3GCZA 1L5HB 1G8HA 3GIDA 1WCIA 5LZ8A 3ZHCA 1XFDA 2IZZA 5JS6A 4X44A 1ORDA 1PJCA 1TZ2A 3N8NA 2O9JA 4RDCA 5K0GA 1YHYA 5EGNA 2A9OA 1Z6GA 1V7CA 2CVHA 4LUCA 4OOEA 4U7HA 4MDEA 1YCFA 4AB1A 2IDZA 4AN4A 4L9WA 5CVEA 4GR4A 1PR1A 2B3DA 2QPLA 3PFGA 5FR1A 1JXMA 3DL7A 3V7YA 4IIVA 4HNTA 5K6TA 4I4TB 2PS0A 2IYEA 4BVGA 3E58A 5KTOA 5JCPA 5K0FA 4MW4A 3INNA 4B4OA 2QV7A 1UADA 3ZD9A 2OM2A 5BN1A 1X7GA 4YRNA 3A32A 4RD4A 1ZMXA 3I6QA 3DO8A 4D6YA 2O5EA 3WMEA 4LHEA 2O8CA 4OX9Y 1GL3A 3EXG1 4QUEA 1QQAA 3OCWA 2GAFA 4U2EA 4WZZA 4NJOA 1NJFA 3RFTA 5IZ4A 2C5FA 2PD4A 1N92A 1Z39A 2ZSFA 3BTUA 4HGPA 2LE0A 3G2KA 1W0JA 4J0KA 3JARB 4JASB 5B12A 2ACEA 2JZNA 1FFHA 2Q5QA 3DUWA 3Q6NA 4J2TA 3GMDA 4U6NA 4TZ0A 5JNWA 1WQ1R 2GEUA 2XB9A 2CWDA 4ESVA 1L4BA 2HMTA 1PLLA 3HFSA 4OI4A 2RGNC 3JR3A 3R6LA 2JA2A 3OP1A 4B40A 3FDIA 5ALFA 1DCMA 4KLZA 2H4ZA 3QHPA 5C31A 2ZRMA 4CV2A 1Q7GA 1R6AA 1ST2A 1QHXA 2FUNB 3BAFA 4MTLA 3UB3A 4EX6A 5JJLA 1HDXA 4X8OA 2IRWA 1GM5A 5F1YA 3LQFA 1L7RA 3S2UA 1EWQA 1E8MA 1WWKA 2VC2B 3C7KA 3BS4A 4I2VA 1CSEE 3DB1A 4IZOA 1EK5A 4R0NA 1ZJYA 5K99A 1P0CA 1H5UA 2W8BA 3A2KA 3UO8B 1DKNA 4BNHA 5A9SA 4D8UA 5ALRA 3C14C 3T3GA 4AJPA 3DBRA 4D0SA 1ZMRA 1GTRA 5C4MA 2IHBA 4YN3A 3VR5A 3LVRE 3KKKA 4XPIA 2E9SA 3BMQB 4GGOA 2GBCA 1K4YA 3C1OA 1L4FA 5FJJA 4ENUA 2GKGA 4ZYZA 3QKWA 3PEEA 4PYRA 4RPHA 5IG2A 1VSQA 2QTVB 1DBSA 5AKJA 4CTKA 1KJWA 2Q9UA 3FJ1A 5JJCA 2AQHA 2G71A 1U2EA 3R0JA 2R47A 4RACA 2O2EA 1T5LA 2ODQA 4LVNA 3RBZA 4BVHA 5F7XA 3KE8A 4DR6B 4BECA 5JLJA 4ZQGA 1V47A 4F5YA 1A04A 2BCEA 1XZBA 3MJEA 2FP4B 1Z9BA 2GF2A 4Y1RB 2WE7A 4FS8A 2QXYA 2AR0A 4QFMA 1H2EA 4BYMA 1D3AA 4YI5A 4B6GA 2GSDA 1JPUA 3RU7A 2OGTA 4RXMA 4FP9A 1UFOA 2HQSA 3R2JA 3U56A 4PE5B 4MUIA 1Z07A 1ZM4A 2QRPA 4EMSA 1ZD8A 4TV9F 1U7HA 1N6PA 2B2NA 1P2VA 2BEVA 5FLEX 2NO1A 2ISQA 2I7TA 3MS7A 3TW8B 5TQ0B 1SQSA 1VBMA 3GUHA 4P32A 2AG5A 3FD8A 1BCSA 1NG9A 4ZDIA 1JR4A 1G8AA 1D6MA 2VF8A 3DD1A 3EXFB 3AI2A 1SXHA 4GPAA 4Y9RA 5AKYA 2OENG 2XB8A 1OR8A 4JQZA 1XRJA 2QT9A 4MO9A 4U7JA 5D3MA 4X97A 2J0UB 4F12A 2Y0EA 2CDRA 1H2RS 1NF2A 3KVNA 3GLIE 4NOJA 4F0JA 1NI3A 4PYJA 2YJZA 3C6QA 3FPLA 1PJZA 2OAP1 4YJFB 3MUNA 3MEQA 3VC3A 3C85A 4FHDA 3N59A 3RC1A 4M1EA 4J0JA 2FEKA 3PHIA 2PX4A 1H1LB 1RPTA 1PS9A 1VYUA 3LT4A 5TQ2B 1DCTA 1VHLA 3M5PA 2HT1A 3ZK7A 5BW4A 2UXDB 5CA0B 3PLNA 4Z9XA 2ID4A 4FMPA 3BEOA 4N0DA 3K0KA 4ZO4A 2NSDA 2X41A 5FNVA 4OAOA 2R6ZA 5GMOA 4CQMA 3C1TA 2XA2A 4GKBA 5LWHA 1YR2A 4MVJG 4F11A 1WA5A 2VDPB 5L4SA 3SMVA 3BRQA 4ZRNA 2E82A 1RRPA 4OLHA 2JW5A 3L7MA 2PE5A 2PBRA 1ZHOA 3NFRA 1R0ZA 2YJTD 2DMRA 3EGXB 2IE8A 4HNRA 2C84A 4RHFA 1DOAA 3S2GA 3ZUPA 2AZXA 2GPJA 1PLKA 3UJBA 4F2WA 1W4ZA 1NY5A 3LT2A 2CC2A 3OO1A 4BN0A 1UZAA 2HNBA 2R5NA 1Q0RA 4JLJA 4WZBE 2P4HX 5IKPA 1HKHA 2GCOA 5EEGA 1EGMB 4EVSA 3ZCVA 1R6XA 4MS4B 1MG0A 1BD3A 1V7QA 3FJOA 1MB0A 1BHQ1 2BF7A 2OBFA 2YBEA 4U9IS 1IN5A 4ND1A 4PCUA 4E3WA 1VCOA 2VHTA 4YGYA 5IJ9B 3CLSC 1XRMA 1L2TA 2PQ6A 2H3EA 2R97A 1UBLS 3AZOA 4MWOA 2Q7DA 3M1IA 5ARDA 1ZVVA 4U3JA 3VR6D 4PGMA 2OD7A 3G59A 3H7IA 4AIIA 3QE3A 4IV0A 3EVCA 4U1RA 3KOOA 3CY6A 3IEMA 1RQ7A 3AQIA 2QENA 3ZTWA 4JI3B 2AQIA 5AUNB 2I65A 3OE5A 4C22A 1LJ8A 2YMQA 3A9VA 3V4RA 1QNFA 5CX4A 1H3NA 2D0IA 2QE7A 3EVEA 3A3PA 3Q2IA 3EDOA 3PPIA 1GCUA 3B8EA 2R44A 2QMYA 4N5IX 2WICA 3TMKA 3GJ6A 3U3OA 3LU1A 5IAJA 4FJ0A 4NC9A 5CYOA 4PC1A 5KKAA 3YASA 4RMIA 3ZN2A 2XITA 4O4LB 3NGXA 3EVBA 3K31A 1CF9A 5D8DA 2HH9A 2ANCA 4UDXX 1FS5A 4KXXA 4QOEA 4Q03A 4RD3A 5TARA 1R8JA 5DULA 4B3BA 1NBHA 4ZEOA 1OJLA 4JU8A 3A4MA 3CJRA 2CLIB 4X1YA 3LHSA 3BIXA 3CZ9A 5LUBA 1DHTA 4X62B 1CU1A 2M6RA 4OJQA 3EDQA 1RTTA 4FNOA 5GONB 5DRTA 5C8ZA 1Q7TA 1TYAE 3MQFA 4JL5A 3HGMA 3NATA 1MAAA 4L76A 1ML3A 3TIVA 2QUKA 1CRPA 1MB4A 3G9QA 3Q5EA 3TG8A 1L5HA 2IXTA 3BSSA 4DNFA 4JV5B 1ZGAA 2X5XA 3GC6A 1SRQA 4U8GA 3PFKA 3ITKA 1AZWA 1RZUA 1GYPA 1YB2A 3H4TA 3HCFA 4AY2A 1COWD 4G26A 4BKOA 4JUFA 3K70C 3CWCA 3ACBA 4JBXA 1PNTA 3N28A 2P27A 3OCCA 4EABA 5LKAA 4F60A 1U3DA 2GASA 3EGVA 5JD6A 5EY5B 1XNHA 5IX8A 1UC9A 3ME5A 1SCDA 1GZ5A 1Y5RA 1ZU4A 1E99A 4BLWA 3OAAA 5B7NA 2PT9A 1G1AA 4W8GA 4ER7A 2NTEA 3SM3A 2P4UA 2CV1A 4OI0A 2H29A 5CUQA 4MR8B 2P11A 5JSYA 1A7KA 1HMYA 5EPEA 1KI4A 3UICA 1VBFA 1Y1LA 1Y63A 1XZCA 3RNLA 1T5OA 1U94A 3D43A 2C4WA 1KJZA 2DLCX 1T2EA 3NI2A 4CM6A 3HBFA 4DCPA 5IDYA 5K0ZA 1J97A 3HB0A 4G0UA 1EFDN 1JPJA 4AJHA 2PK3A 3JARA 5C7LO 4YMSA 1HLFA 5JMWA 2DBQA 5ALSA 1EXDA 1NXPA 2L18A 2GCIA 2QY6A 1L7PA 1AHHA 3D6TB 1H05A 4YCAA 3GNTA 2PUJA 5JS1A 4AKEA 4Y98A 1QP8A 3A1DA 3GJXC 5K3FA 4S12A 2F3RA 5AI5A 3BXZA 4C04A 3MK31 2ZCJA 1YQEA 1HY3A 3BFXA 4MCHA 4PTZA 4DNOA 2F1JA 3SF0A 4MB0A 4JB3A 1P80A 1P6QA 1UT8A 2PTHA 4HJXA 1SB9A 1CQIB 1RACA 2WU1A 3OKFA 4YP6A 4BMYA 1CP2A 2D4HA 2PFSA 2R1VA 1PD0A 2RKBA 1XA4A 3DF9A 3B2EA 3LXMA 2DX7A 4LJ6A 2IZ5A 4G9BA 3OM0A 1G6KA 2FN3A 1X13A 1XTUA 2HDOA 4IZIA 5DO9A 3TEMA 2VQEB 1E60A 3T7SA 4L6IA 4TYQA 5CEJA 1XSEA 3E48A 4M1ZA 3SKXA 3SS7X 3WK6A 1EK0A 1BVUA 2WIKA 4UOZA 5BWNA 1FFEA 3MF4A 5KNCH 5C37A 5B55A 1JMVA 2RG1A 5E9WA 2O6LA 3ACDA 2XT6A 3OX2A 5HGJA 1T9ZA 4BP1A 3O95A 1ORHA 4YONB 4N0EA 3D9QX 4YHBA 2NU8B 4W5TA 5CFRA 2YZMA 1Y9ZA 1AQLA 2VJPA 1JJ7A 1ZH8A 1JILA 3ENKA 1DHRA 4KFSA 5DM70 4D9KA 1Y7TA 4JA2A 4TMTA 4C6TA 5KHLB 4JXZA 3BD9A 1RAEA 1LA2A 4I0WB 1ZESA 4MCIA 3LS2A 4AWBA 1WTAA 1KHTA 4MQBA 2ZUCA 2QR3A 5FYDA 1IE3A 1PGOA 4MP6A 2HXYA 1W6RA 2HLDD 2ZSAA 3GGGA 3T3PB 4FUTA 2ZYSA 4JKYA 3WVNA 4BBAA 4JHLA 4H6XA 3F9RA 4KX5A 3DA8A 2ZAGA 5IVHA 2GRAA 1DTWB 1SIWA 1J21A 5EINA 4PSVA 4M1MA 2J3EA 5DM1A 3RSQA 1IU9A 2CD9A 3K8ZA 1MA0A 4YRRA 2N0SA 4Z9YA 3HKBA 5IZCC 3TL6A 4MYCA 4Z4IA 2Y8EA 2JGDB 3J7AC 1TAUA 4AZWA 2VDWA 3GGPA 1CB7A 4MQEB 4BB9A 2GVZC 3K0AB 4FN4A 3KTDA 4RPIA 4O5AA 1IXKA 4UXHA 1KRWA 2RCYA 1YB6A 3MCZA 1E69A 3V4PB 1YOVB 1KA9H 1Q84A 1OIXA 2FSFA 1IB0A 1IOVA 2Q5JA 3EXFA 3L7DA 5IKEA 3CURA 3VYVA 2WSSA 2Z4SA 4IOLA 4L8WB 4C9BA 1P77A 3BILA 4CLOB 3PHBE 2PXHA 3DCYA 4B2YA 4HI0E 3K0HA 1N6KA 3DOIA 2YYSA 2OP1A 1VJDA 3GCDA 2G1PA 3ZGLA 3KV3O 3QFCA 4GNRA 3JR7A 4GKJB 1SCAA 2O0MA 1KO5A 2WDZA 2ONJA 4WWHA 5A5GA 2R00A 1G6OA 1RRMA 4OY3A 4AO8A 1YH3A 1DNPA 1ULSA 1VCMA 2AUNA 3P5BA 4X1KB 4DKXA 1VIAA 2Y4NA 3I9JA 3JQRA 4HYQA 1R0BA 3EQ6A 1E2PA 2GYWA 3B6IA 1JSCA 521PA 2W2XA 5IH3A 5EP2A 2GPNA 3NHJA 2UKDA 2FW0A 2NZJA 2PH5A 5IMSA 4R9VA 1M6NA 1ZWLA 1GPKA 4P38A 1RRCA 4BY9E 2HJ9A 4MP8A 2CNNA 3R7WA 3NPAA 1TK2A 1XCJA 1AQUA 3KQWA 2PMCA 4KRGA 3RR2A 4L0CA 3FUVA 3UMVA 2H1VA 1ZEJA 4PSDA 3GRZA 5ERGB 1M54A