4PR0A

Mycobacterium tuberculosis reca glycerol bound low temperature structure iic-n3
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
328
structure length
315
Chain Sequence
QTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 96
structure length 315
sequence length 328
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4pr0A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4pr0A01
1KO4A 3BB4A 3OEED 4MITA 5HKKD 3R9WA 3BFKA 1AK2A 2G77B 3K0CC 3RS5A 1P7CA 1GKYA 4M1KA 3AGQA 4I1OA 5DHFA 1H8ED 2H1LA 4E09A 1HH4A 3ZD6A 3JZAA 4LJAA 1MKYA 4HLCA 4HUQA 1VCMA 4PSAA 2QU8A 3QBTA 5FI1B 3T34A 3THYB 2GEUA 5DH9A 1F2TA 3K70C 1QVAA 2AK3A 2PBRA 2OXRA 2FA9A 2GCNA 3DKPA 2P2LA 1KAOA 1G64A 4V0ME 5C2JB 5CDFA 4HZUA 3SJCA 4M1TA 3C5HA 3QF4B 1X1RA 4FW9A 3IQWA 1VCIA 4FD2A 4M1WA 2NPFA 4JYCA 1Z29A 2GAAA 3DDCA 5GJVC 4QC2A 2YOGA 2FSFA 1ZCAA 4N0DA 4NTZA 2BJVA 3M6AA 3RRYA 3SU8A 4B76A 2H8KA 1JXMA 5FUXA 3K0EA 2ZE6A 4C2UA 4F4IA 4KI0A 5J4YA 1FX0B 2BJWA 4H1VA 4LBWA 3AVQA 1TAGA 3EW9A 3IUYA 4Q1FA 1XTIA 3E5HA 1CXZA 4JSYA 1RC8A 2HF9A 1ODFA 1Z6YA 3AVTA 3L0PA 3CX8A 2DYKA 3PQCA 4TN1A 4CRWB 1FMLA 3MUFA 4G01B 5F9HA 3LO5A 1P9NA 3NEYA 4O25A 3VX4A 4DSTA 2NO6A 4GOKA 3QVVA 4M4SA 1XD2A 2PMDA 1EFRD 4RCZA 3K9LA 3KB1A 2EFEB 1NN3A 3VKHA 1QBKC 4TQAA 2ERYA 4QGAA 1T9HA 3B13B 1RRPA 1ESMA 3MJRA 2H5EA 1L2TA 1NMXA 3MCAA 4RFSA 1A5TA 4MKIA 2P6RA 2OXCA 1WE2A 2A3RA 5KHOC 1L7VC 1KJZA 5K8IA 3MMPA 4WBSA 4QGGA 4DDWA 3O47A 3DMNA 1MV5A 5LBIA 4L9SA 1LF5A 2OBLA 3U44B 2X8AA 4KBGA 3W9YA 3P4XA 2E9SA 4MYCA 4TMKA 4TMVA 5LB4A 3X1DA 3U4QA 2IA5A 4B75A 1OYWA 2IW3A 5FUVA 1CJTC 1K6MA 2GA8A 3H86A 3FMIA 2GJAA 1OH5A 5AWFC 4R2IA 721PA 1MRNA 4HSEA 1N5LA 3TUZC 1PLKA 4LHVA 1US8A 3BK7A 4HLUC 4QG7A 5AJXA 3IEVA 3BBPA 4PHHA 4ITRC 4ZDJA 1KO7A 3NDBB 2YWEA 5KSZA 3CF2A 5LD2C 5KPDA 1G4UR 1N6IA 1OIVA 4OBEA 2LCFA 4MUAA 1CTQA 1M7BA 2D62A 4DHEA 3PEVA 1L8QA 2ZI5A 4M22A 1ZUHA 4GT1A 1SHZA 2WZQA 2YVUA 3QY0A 5EXXA 3FMFA 2J0VA 2RGBA 1HQYE 4YC7A 5JZVA 4DCNA 2ZRLA 1N6HA 4LK2A 3CM0A 4KYIB 2ZYTX 4PPFA 3NBYC 3U3JA 4HUTA 4XTRA 3R8CA 2F9MA 4G5OA 3UMFA 4XVUA 4V02A 1E6CA 4EKDA 4P33A 1UBFA 5DIFA 1W0JA 3T5DA 4AKIA 1HV8A 1ZD8A 5AUNB 3N70A 1G18A 4MH0R 2A5GA 2A5YB 3KUDA 4JZKA 3HR7A 1CULC 3A36A 2OM2A 4MKGA 1NY6A 4X8HA 3THWB 1X86B 2CLSA 1W0JD 3LDAA 1C4OA 1TTTA 2W58A 1XXHA 3R8FA 3B1VA 1AS2A 1YZQA 5JJLA 4ZO4A 5E95A 1NG9A 5D3QA 3KTAA 1XD9A 4OHYA 3IEUA 2W2XA 4EPYA 1G7CA 4A0HA 2W6JA 4ZDWA 3ZQJA 3GD7A 3T35A 5EXPA 1CRPA 3WNBA 2ERXA 3UG7A 1K5GA 1AGRA 1FP6A 1W36D 1ZM2A 3GLFB 1W5SA 4LHYA 4DLVA 1GFIA 3GPLA 1KSGA 1R7RA 2B8WA 1NN0A 4M1OA 3VQTA 2O8CB 4U5XA 4PO8A 2O0JA 2W6JD 1KTVA 2ZJBA 3GJ3A 1KYIA 1P2VA 2GAOA 2ZVQX 5HPYB 2ZJ2A 3AVUA 2ZAOA 2R9VA 2MSCB 3A58B 1G8GA 2KE5A 4JJKA 5C1BA 1GKUB 3ZGXA 4YLGA 4PPGA 1OKKA 1NVWQ 3E2IA 1MRSA 3CWQA 3MG9A 1E9DA 1PLLA 3CNNA 2ONJA 4CYMA 4I4LA 4RVCA 5C18A 1U9IA 3CZQA 3F0TA 5G3ZA 3X1XA 5BN3A 2JIZA 3I32A 3MFYA 3QF4A 4CVNA 4F7WA 4GZLA 2YZ2A 1W47A 1JR3E 3LNCA 1OKKD 3UK6A 1E1QD 3AKYA 1UFQA 1FOEB 2ORIA 1ZD9A 3AUYA 2PJZA 3EIEA 1ESNA 5L3SB 2ZRGA 5TVKA 1AA3A 1MR3F 2JIZD 4S35A 2XITA 2ZYVX 3SJBA 4LBVA 3LBNA 1E9CA 1Z22A 1WBBA 1XFAA 1J99A 3LXXA 4TMXA 1TQ4A 221PA 1FFHA 3SJZA 2FFAA 3FMPB 5AUOB 3A4MA 4UKDA 2QM8A 4G5QA 4KHZA 4Q5IA 5LD2B 1DAGA 2XB2A 2HJGA 1TUIA 4BEJA 2IUSA 5JFGA 1M7HA 3R7WB 2O8FA 1N6PA 2WWYA 1IN5A 5BXQC 1TU4A 2RB4A 2IWHA 2EFDB 1G6OA 2GXSA 1KOFA 2VSOA 2Z43A 3QEJA 2BV3A 4LJYA 4E07A 4AKGA 2FSIA 1XP8A 4FINA 1HURA 2IBMA 1KDTA 1PJRA 2BDTA 2FSHA 1RPZA 1XTQA 1Z0IA 1KK1A 3AH8A 1TF7A 2KSQA 2QT0A 1TADA 4G1UC 2QAGB 4KFRA 3U44A 2YWHA 2JCSA 1HA3A 2V6JA 2J5XA 3E70C 1F48A 2GXUA 1VYVA 2AK2A 2RGDA 1UKZA 1BYUA 4YMSA 3ZS8A 2V54A 3WXMA 1RYHA 2AHOA 2NMVA 4Q1CA 4D4LA 5CDFE 5JHGB 1DTSA 1ZNXA 2IC5A 4ZIRB 1OB5A 4LJ5A 2DWOA 2CL0X 621PA 4ZI3A 4QXAA 1KHTA 4IXNA 1OHHA 4IDOA 3WY9A 2X1VA 1KI4A 2R65A 3B9PA 2NQ2C 2WJHA 1XEXA 2V6IA 3CRRA 5EQTA 1GOTA 4Q01A 4UXIA 3QPVA 1FP7A 1BMFA 2JDIA 3G82C 3KJHA 4Q9IA 3WYAA 5FUYA 1VMAA 3KJIA 1NIJA 4ZDIA 4B2LA 1OF1A 1P62B 3GLIA 1OHHD 2XX3A 5JSZA 3I1FA 1GL7A 4MDEA 3CPEA 3GFOA 3TBKA 3K0CA 2NO7A 1ZU5A 3BXZA 1F2UA 3OAAA 2RGEA 5FI0B 2JLSA 2JDID 1BMFD 3TW4A 4D0GA 3TVDA 4GBMA 5KDDA 2G0TA 1KI3A 4BFYA 5KPJA 4W9MC 4DZZA 4MRSA 2C99A 4Z8YA 5H8WA 2C95A 2ZRPA 1RKBA 1CR4A 1Q1ZA 3OAAD 4OJKA 4WZAE 1RFLA 4B43A 5FBRB 1GITA 3QE0A 3LA6A 4IOJA 4MGIR 2IS1A 1OFTA 4OHWA 2C8VA 3PUYA 4EJSA 1ONBA 1GWNA 4CGZA 4URWR 3K70D 1GNPA 2FFHA 5CB8A 2OLKA 1Z63A 3I4LA 2Z6VA 1W2GA 2OSBA 2ZRMA 3AV0B 3C8UA 4BLSA 3FVQA 3KQKA 4KFTA 4DDUA 2Z4RA 1VDZA 5H70A 4DKXA 5DN6D 5FBLB 4Z8XA 3H1TA 5JS7A 4DCSA 3T61A 1PLJA 3V4FA 1GVNB 1AQUA 4IEIA 3GEHA 3BH7A 1VYUA 4M1YA 4M1MA 4F93B 4PO9A 4HAZA 1A2BA 4O2LA 1G8HA 1SULA 2XTNA 4CEHB 2IYYA 4QBIA 4MGYR 3GLFA 4EQ6B 5KTYA 1GZSA 4Q21A 2KBFA 1QHIA 4M8NE 1E2LA 1DS6A 2HLDA 5ANRB 4B3CA 2ZS8A 5B57C 1N2CE 1IN8A 3BFVA 3QXJA 5JRJA 2XB4A 3HP1A 1VYTA 1IONA 2ZQ5A 1QG4A 2IL1A 2HLDD 3CWZA 3PUZA 3NDPA 1G7SA 1ZUNB 2ZUDA 1NBMA 5FR1A 4HLDA 4NBSA 4JYBA 2JLYA 4CEIA 1XF9A 2ZAMA 1IHUA 4NYJR 5EE5B 5JECA 2QPTA 3U7FB 3NH6A 2BC9A 3ZJYA 3C7KA 4A36A 2F3RA 4XIGS 1GL9B 1P4SA 3T5GA 1N5KA 1IJEA 1I2DA 1W44A 2VEDA 4MGKR 1NBMD 3QQ5A 4JL6A 4BZQA 5L3SA 2MSDB 2P6NA 2VHCA 4FXPA 1MT0A 1YZLA 1ZC3A 2BM1A 5DI3B 3RLFA 4LV5B 4DLUA 4HLUA 4RD6A 1XTSA 4PQFA 2PCJA 5FTJA 1YR6A 2ZR9A 2D3WA 2OZEA 4KBFA 5GVRA 2XSZA 3CRMA 2QG6A 4UXHA 1XXHE 2IWRA 2HXSA 3RNLA 2C03A 2EQBA 1QHGA 1PUIA 1W0KA 2ZROA 2IS2A 4TMZA 1T8TA 2ZPTX 4MGZR 4FWTA 2CE7A 1W7AA 3PUWA 1MO3A 1IN7A 1UBCA 4V0LA 1ZRHA 2XSZD 1UKYA 3BB1A 5DSZA 4QM7A 3R9XA 1N6NA 1NMYA 1F3OA 1A7JA 521PA 4BFVA 1U98A 3CF0A 1DEKA 2RGGA 4BFUA 2J0SA 1W0KD 2R2AA 3KB2A 1S9HA 4Q9LA 3QUSA 3B82A 4X8OA 4CZ2A 2WWXA 1LS6A 2W0SA 1R0XA 4A6PA 2ZEJA 4W5WA 2CCKA 4BZPA 4A15A 4LYFA 1AZTA 1DELA 3P1JA 5C4GB 5SZHB 3L43A 4W7SA 1Z0FA 4NYJQ 4A92A 1Z6GA 1F6BA 1XU4A 2W6ID 3QKSA 5IHPA 2W2TA 4LUCA 2BMDA 2P3SA 4NL4H 2ZE8A 1CU1A 3IPXA 4QHSA 5CLQA 5HCNA 5IRCD 2PMKA 3G0HA 1Z2AA 4NYIQ 4A6XA 3WMEA 3NVAA 5JEDA 1PV4A 3WBJA 2WAYA 1CIPA 3B7GA 4P4SA 1KJWA 1JAHA 2FF7A 1JBKA 4E5UA 1TF5A 3V9PA 1E79A 3Q85A 2HUPA 2QMHA 3K9NA 2HCJB 3VNVA 2HV8A 2QROA 2CK3A 4ZDKA 5TB5A 121PA 3V4RA 2GK6A 1M74A 4Q4JB 3THXA 8OHMA 1KI1A 4B2PA 1W4CA 3PEUA 2BCGY 5TV2A 1RE0A 2CDNA 4IJMA 1E0AA 2IYLD 2CK3D 1SVMA 3IPYA 1YKSA 2NO1A 3IHWA 3T1VA 4BZXA 3RWOA 1P60A 2VP9A 2P6UA 4Q48A 4QBFA 5EP4A 5AJVB 1U0HC 3ASZA 4H1UA 3L2OB 5CJ2A 3MLEA 2E1RA 4B6EA 3MRSA 3TK1A 3O8DA 1JNYA 3FFBA 2QSZA 4C30A 1AKYA 1ZNWA 3VX3A 3SBEA 3ND9A 3HPRA 2OESA 1CEEA 3LV8A 2O8DA 4U7DA 2OHFA 2BKUA 3C41J 3RRZA 1RRCA 5HZHA 3CNLA 1GP2A 4A0GA 4DCUA 4XOIA 2BIFA 1KAGA 1J2JA 2ZRJA 2OT3B 4F38A 4Q7MB 1KMHA 4GSYA 2YNMA 4M9SA 4CEHA 1QRAA 4B47A 3EASA 1S1MA 3B1YA 3MWJA 5J4VA 2WKRA 4PAOA 4MYHA 1XZQA 2D7CA 2O5VA 3DL0A 1YRAA 4RSGA 5EP2A 2WPDA 5CIWA 4D4KA 4ESVA 1G8FA 2R6GA 2WWGA 1R8QA 4FIDA 1E32A 5F2EA 4R2HA 3SR0A 3VR2A 1R0ZA 3BERA 3ECCA 3GQBA 4LJ4A 4EFLA 3GLIE 3I73A 4S2EA 3KQNA 2VF7A 3QJYA 1C9KA 3HU1A 2JEOA 3DMDA 3I62A 2GHIA 2CCJA 1R5OA 3A37A 1E9AA 3CW2A 5BYJA 3QOFA 4M9QA 1EFHA 4OI1A 1KSFX 3A1SA 1W46A 1KK3A 1CLUA 1KDRA 1TEVA 2CHVA 4YMVA 1P2UA 2Q3FA 4A0FA 1Q44A 2AD1A 2B6HA 2WWHA 2PL3A 3TMKA 4R71A 1ZMXA 1QHSA 4A9AA 1OE0A 3AUXA 4HDOB 4OL0A 2XAUA 1FMJA 2WJIA 3VR5A 1E2NA 1MABA 4DIEA 3OZXA 1CR0A 2F1RA 2ZUCA 4DT1A 4NCKA 4BEBA 4AI6A 4DSNA 5KUTA 2REXB 1Q1BA 3CX7A 3EWAA 1G16A 1CBUA 2OILA 4GRAA 2J0UB 3MSXA 5L8VA 1ZM3A 1AJEA 4NYMQ 1SXJA 3K0AA 3QENA 4LYJA 4LBYA 1OFUX 4HEJA 4TLDA 4FCWA 2HF8A 1AQYA 2XZLA 3GLFE 2LKDA 1G8PA 2H17A 1SVKA 2ZJZA 4CW7A 1ANKA 2FGJA 3TR5A 4LBZA 4UNQA 1L4YA 1SXJD 3H2YA 2ZS7A 4KAXA 1S4QA 2A5JA 4DIDA 2AD5A 2FE4A 1IY2A 1II8B 1NJGA 4NP6A 1X8LA 2ODWA 1OPXA 1OXVA 1W48A 5FL7A 4BPBA 4C2TA 4X8LA 1DAIA 1W2HA 3UIEA 5BWMA 3L8ZA 4FCVA 5D3MA 3BH0A 4AYTA 1KI6B 1N6LA 3KKQA 5FPSA 4PC3A 2BOVA 1NBME 1XNJA 4LC0A 1E0KA 5AJYA 3UMRA 5GVSA 2O8EB 1G19A 3IGFA 3PV0A 5FL7D 4D0LB 4US1R 2YKGA 1NKTA 2ZRIA 1NJFA 2B7CA 2CHGA 2GF9A 1FQKA 3ZVRA 2EU8A 3G5UA 3K0FA 4F92B 1IBRA 2QY9A 1IY1A 3ADDA 1II9A 1XEWY 3K0SA 1E9BA 4KCGA 3LBIA 3W6NA 2ZRFA 4Q4LA 2VP4A 2YINC 4G5RA 1U2RA 2ZRBA 1W4RA 1GL6A 4Q7KA 4XD7A 5CYOA 3TQCA 4CT4B 1TEXA 4RZXA 1P75A 1UDXA 2WM9B 3RS0A 1CRQA 3NKVA 3ICEA 1SVOA 3QKRB 1ZU4A 3NBXX 3BIFA 5FPKA 1NLFA 1KK2A 1KI7A 3WYGA 3AVPA 5DGXA 1NL3A 3IDQA 3GLHA 2WBLC 2OV2A 1LFDB 4XD7D 3U3MA 1UF9A 4URXR 5KDLA 3S1AA 4PZYA 4TTPA 4O3MA 1XEWX 1E4VA 2BM0A 2GXQA 3QPUA 2V3CC 3K09C 2FPMA 3PFIA 2R8RA 5FOXA 1VG9B 5JBQA 3GLGB 2XGJA 2K5UA 4JBWA 2C9YA 3LVRE 1EWQA 1D2EA 5AUQA 4KXFB 2O0KA 1VTKA 3CZPA 4OQFA 4GMXA 3WMFA 1YJ5A 2R6DA 3CPHA 1KI2A 1T3HA 3P27A 2FNAA 1P2TA 4QJ4A 2JLXA 2Z0MA 4B3FX 2V9PA 4JVLA 1DADA 3H4MA 3QG5A 5HCIA 3EPLA 1O87A 2NZJA 2WMOB 3AP2A 3NC0C 1IOZA 2ZR0A 4LJ9A 3VU9A 1KSHA 2QQEA 1R8SA 1AM4D 1EX7A 1I4LD 4P32A 4PXAA 4NMMA 1FL9A 4E22A 1OH6A 4BFWA 2GCOB 1Z08A 1GM5A 5JWHA 2ZE5A 1HE8B 5TXGA 2R6FA 3EIQA 4YMTA 2RGCA 1FNMA 1HT2E 4XVQA 3B8HA 1S8FA 3KKMA 2VHQA 1GIAA 1Z07A 3GJ7A 1RYFA 4MRPA 4MRVA 4BFTA 1FW6A 2C9CA 4QL3A 1NVXQ 3QBVA 4YDSA 3AF2A 3LVQE 3SOPA 1I4TD 1KO8A 1N5JA 3C16C 4TQUS 1Q1QA 4N0EA 1AKEA 1F60A 3OF5A 1G21E 2OFOA 3LBHA 4Q19A 3WRXC 3DOEA 5AJZA 1XZPA 4QKQA 3KXLA 3PITA 2IYTA 5DHAA 1A1VA 1U8YA 1HY3A 3LQQA 4WOPA 5H68A 1A82A 3GEEA 4ZKDA 4B3DA 3LLMA 1KZ7B 2ZJOA 1Q1EA 4EPWA 2J0UA 3M1IA 1R5BA 3OIVA 3H84A 3WP1B 3Q7QA 2GJ8A 5GJBA 2QAGC 2GK7A 4D4JA 1Z83A 2X2EA 5DE3A 1T8UA 1XD8A 2YJTD 4EUNA 1R0WA 2VHTA 4NZYA 3SQXA 2W00A 3PJRA 3TNFA 2ORWA 1QHNA 4KYUA 4AG5A 3VNUA 1GKIA 1WA5A 4DXAA 1VIYA 5JEEA 2ZI7A 1P72A 2V7QA 4C0BA 4EPVA 1V5WA 3RS2A 2OBMA 2F3TA 3IO5A 1II8A 2D2FA 2FU5C 3W5JA 1U81A 1S3SA 1G3UA 3LW7A 2LKCA 2BVNA 2G1KA 2ZREA 1OH8A 3DO6A 4IDQA 4UJ5A 4TL8A 1G3RA 1XB2A 3TVTA 1XBTA 2GTPA 2KWIA 1YRBA 1W4AA 4TQ9A 3FHCB 3CRW1 1OXSC 1Q20A 3GJ4A 4P3YA 3LX8A 1N0UA 2NG1A 3FKSA 2R44A 2QTHA 3ADBA 3MJHA 3PENA 3FDIA 4Q03A 1LTQA 1M1YE 2JJ1A 2GVZC 2YC2C 4V0KA 1XJCA 1SGWA 1J7KA 2EFCB 3TW8B 3THYA 1B23P 3VR1A 5KSYA 3TH5A 3BB3A 5DYIA 3THOA 2VO1A 4KODA 1T5IA 2IEYA 2KI5A 2ZVPX 3FKSD 1M7GA 4AURA 4HATA 4M0LA 1CF4A 2Z4SA 2FPKA 3AEZA 2GJSA 3CLVA 5M04A 2JJ1D 1AIPA 2DHRA 1WCV1 1R4AA 1E2QA 2QP3A 4M9XA 4O2RA 1BYIA 2RAPA 2VH5R 3CO5A 4B35A 4EPTA 2ZYWX 1PVOA 4PQRA 1SXJE 2I1QA 1O3YA 1Z0DA 1EK0A 2B8TA 2PT7A 3TJZA 4RKFA 2PX3A 4Y0AA 4RY2A 6Q21A 1ZD1A 1FX0A 3KZ1E 3LAWA 3U60B 4LDJA 3UG6A 2YC4C 4G5SA 4ZPXA 2J0QA 4JBXA 1OJLA 1NN5A 4B34A 3AGPA 4TL9A 1LVGA 3NC1C 1KJYA 1NI3A 2YHSA 3ZIAA 1XPRA 2Q3MA 2F1IA 3DPUA 1P9RA 1X1SA 3CKLA 1ZNZA 5TMPA 1E2EA 2O0HA 3GLGA 4NE2A 4LRWA 2BWJA 2EFHB 2ORVA 1E2PA 4A2WA 1Q3TA 3AKEA 3ETLA 1E94E 4AKHA 2HT6A 2JJ2A 2WJJA 4TSFA 1KO5A 1U8AA 1G41A 2AX4A 2XTMA 4N3NA 4BFZA 4X8MA 5FTLA 5EJEA 4TTQA 3CRQA 5L3QB 5DNYB 2IUTA 4LHZA 3CIOA 4KV9A 3WP0A 2JJ2D 3RVBA 4PX9A 4TSFD 2WOJA 4LV6A 4NDZA 2ZSDA 2QBYB 4E03A 1FQJA 4IVQA 4NCJA 4AKEA 2J59A 1BIFA 1ZAKA 2GEVA 5L3VA 3RC3A 3T06B 1BKDR 4IDPA 4G5GA 1P9WA 5P21A 1UBEA 1Q3HA 2D7DA 3PCRB 4Q4HB 3ZH9B 4AYXA 1JQLB 3P4YA 3I8SA 4NHOA 3JZMA 1WP9A 4II7A 5TY0A 4PZLA 2NIPA 2A30A 4TZ0A 1X8KA 3FTQA 2RKOA 2IHBA 2NTYC 2P5SA 3SBDA 4DEYA 3GJ0A 2B92A 3GLHE 4BLTA 5KSPA 1BOFA 4IVRA 1L4UA 2CJWB 4Q7LA 4TYPA 2FDCA 3PIRA 5UKDA 1Z5ZA 2JLUA 3U2QA 4JKIA 1XMJA 4U02A 1S0UA 4MRNA 3QPWA 1Z6AA 3EARA 1E69A 2AKAB 1X3SA 4B48A 3K9HA 4URVR 4QHTA 3SFVA 2WWIA 1H65A 4WIAA 2BBSA 2QA5A 2IYWA 4TLEA 4AY2A 3VR4A 1Y63A 1G8YA 3QG1A 4GOXA 5FPHA 1Z6TA 4LV8B 3RRNA 2OUKA 4L5BA 2ZRHA 3RANA 3FYHA 3W34A 2NOAA 4DLZA 3AQ4A 2PEZA 3BC1A 1IN6A 2QSYA 3NEJA 3QF7A 4EDHA 2GETA 1Z2CA 1X6VA 1NIPA 3SHWA 3IHLA 1Z0KA 2DCUA 2FFBA 5FL3A 4Q7JB 1OH7A 4Q47A 3VTKA 1YZUA 2DBYA 4ZI2A 3AVYA 3VR3A 4US0R 3THWA 3A1TA 1UADA 2WKPA 2V1UA 1XTJA 2QN6A 3IILA 1Q12A 2XNDA 2OCYC 3T1OA 3AP3A 1QZXA 1G6HA 3OEHA 4QBGB 1YZKA 4HLQB 4PSKA 3U6BA 3SFZA 3K09A 1R6BX 2QRNA 2GVDC 3QVUA 4DLYA 4PR0A 1YZTA 2Q0HA 2IT1A 3A1UA 2BKEA 3GJ8A 2FN4A 1OYYA 3KQUA 3GJXC 1MO5A 4B6FA 2E87A 1WMSA 4C9BA 4B74A 3OEHD 5C4MA 2O8CA 4BECA 5KNBA 3T1QA 3I61A 1OFHA 1GRNA 3SDZA 3F3YA 2YOFA 2N46A 3T1TA 5EE9A 2JJ8A 3VKGA 2V55B 3GFTA 1WDTA 1DARA 2ZU6A 2ANBA 2PEYA 2BBWA 1VKJA 4C0KA 1NG1A 4M53A 3OIYA 2ZETA 2XTZA 4FWIB 1XTKA 5IK2A 4HDQB 4DLTA 1E2IA 1E2MA 4QGHA 4L8GA 4HB2A 3F8TA 3LQRA 1YE8A 1YU9A 2D06A 2IYQA 4UNSA 4D0NA 4Z51A 5H1YA 2FPLA 2VYFA 3ADCA 2EWVA 2F43B 1G3MA 1OT3A 3ZLJA 3KFXA 4D4MA 4XWOA 1D5CA 5IK2D 4C7OB 4IHQA 4RZ3A 1RRGA 2G0NA 4NCHA 1DPFA 4NYIR 3GP8A 4C0LA 3NH9A 4NH0A 4ABYA 2RH5A 3B1ZA 4PQYA 1RZ3A 2FJUA 2ZM5A 3TKLA 1E9RA 5JS8A 1NVVQ 1SKYE 4DCVA 1P3JA 2PX0A 3DEFA 3IBGA 4L9WA 3ZVMA 1TNDA 4DRZA 3WYFA 2D4HA 1DBSA 5E7MA 2VQSA 4AWXA 4EFNA 4QOSA 2UZIR 1DAKA 3CR7A 3EWSA 4OHVA 4P31A 3SYNA 5B58C 5J47A 4TYWA 3EZ2A 3DKVA 2EWWA 4BLPA 4DB4A 4ZKEA 1N0VC 1OB2A 4KJZA 4KSCA 1I4DD 1Q57A 3R7WA 2GEDA 3KX2A 3DM9B 2C78A 3ND8A 1YQTA 2YYZA 4GPTA 4JJZA 4B32A 5L3QA 5KO2A 2V1XA 2IYXA 2UKDA 4JLAA 2HDNB 3A4LA 3I3SR 4A8JB 2IF2A 3EPHA 5CYPA 4RD4A 1C1YA 2KBEA 5IT5A 3IQXA 3P20A 3W90A 3AVXA 1MO4A 1SZPA 4BE7B 3LXRA 2QAGA 1TQDA 1DG1G 1XMSA 3W5IA 4IXMA 3NTUA 3PVSA 4JL5A 4KVAA 2A5DA 3MD0A 2O8BB 5JJKA 5G3YA 4EFMA 3KQLA 1BH2A 3EAQA 3U7HB 3BFXA 2RGXA 2ZSAA 1G5PA 1JALA 1DG3A 3R9IA 2CMKA 4ZIRA 2CL6X 2D2EA 3FOZA 1LY1A 1QVRA 2ZYUX 3ZZTA 1CR2A 2ZJ5A 4JIMA 1M34E 4FN5A 5F98A 2BBTA 2ZXUA 1I2MA 3U3RA 4JSTA 1G5TA 3N5CA 2ZJAA 2WIBA 4LI0A 1EFCA 3W3ZB 2WOOA 4B3BA 3A1VA 4HAYA 2YV5A 1D2MA 3RWMB 2KJQA 2GZDA 1G7TA 4JL8A 2DFNA 3CONA 3E1SA 4HAXA 4AC9A 1GG2A 4W5JA 1E79D 1JPJA 3D31A 3GLGE 4C0JA 2GJKA 1DAEA 2QTVB 5K8TA 4MQBA 4GFDA 3HU3A 3I5YA 1HTWA 1OIWA 4EAQA 3QSYA 4OKSA 3EIHA 1CP2A 3RHFA 2QRZA 1WB9A 1T6NA 3ASYA 3IO3A 4HZUB 5G41A 2OAQ1 4PZZA 2OAP1 1D8TA 4GP6A 4WA7A 3TUJC 5CM9C 5LB2A 1Z28A 2A9KA 3EZ6A 2WWWA 1TU3A 2IYVA 4TYNA 4JLKA 1LB1B 2WIAA 4BGDA 2EFGA 3CB4A 4JVNA 2CBZA 2QUZA 4IVPA 2QPOA 1P73A 4M1SA 3RS3A 1W36C 1QDEA 4TZ6A 3FFAA 2IEZA 2IS4A 1UKEA 3B2EA 4KVGA 4LSGA 3N2EA 5BW8A 2ASEA 5HZKA 3QI2A 2JLZA 2JLVA 2Q9BA 4D82A 4IOLA 1JQJC 2AR7A 2CNWA 2QORA 5JJIA 1U99A 4DEXA 4EQ6A 4NYMR 2HXYA 4F4JA 3CRVA 4RD2A 3TSWA 1KO1A 1XD2B 3FE2A 1H8HA 1N6RA 1NVUQ 1Z47A 5J4HA 2OCAA 4JBYA 2VP0A 2OE2A 4GMDA 4JLMA 5CK5A 5A0FA 3O8BA 2CNWD 4A0RA 4TYYA 2GNOA 2IYZA 3U5ZB 4XSGA 4F91B 1GRRA 4YQFA 3QXSA 2ODBA 1N6OA 3BAFA 4RFSB 1Z6XA 2KB0A 3T15A 1H8HD 3P32A 1EFTA 4Q1AA 5L3RA 2P0EA 2WPDD 3AF4A 3AP1A 2OG2A 2XJ4A 1XPUA 4A2PA 3RSOA 2J7KA 3V00A 1GNRA 2VTKA 3X1ZA 2IK8A 1GTVA 2FSGA 3SQWA 1JXOA 1KDOA 2F43A 2F6RA 1NRJB 3KFVA 2F55A 1CJUC 2C9OA 3AVOA 3HWSA 2P67A 4C7OA 2QI9C 3GFPA 1ZYUA 5DI3A 3RC8A 1RJ9B 2ZJYA 3KKPA 3EX7C 3NG1A 3K9GA 4HZIA 3FGNA 1US8B 2GBLC 4TTRA 3TE6A 3TSZA 1E0SA 1XCGB 1TF2A 5EZ5A 3REFA 1SKQA 5JHHB 1TQ6A 1AS0A 1ZCBA 2AFIE 3OESA 1G5RA 3RSLA 4ARZB 5KYKA 2JGNA 3FHOA 3QXCA 4BLQA 2VL7A 2H92A 2ZU0C 4GNKA 2QPAA 4LJ6A 1CJMA 1D9ZA 2FFQA 3IBYA 4WW0A 1S3GA 5G40A 3BH6A 1LNZA 1P5ZB 2J7PA 4OI2A 2QMOA 4D80A 3A8TA 5EUQB 2PZEA 3GJ6A 3HJNA 4IFBA 1XCMA 1GRQA 1KKMA 1HYQA 2IXGA 4JLNA 2MSEB 5LPNA 2WSMA 4H9GA 4RFVA 4N1AA 4Q9HA 4L15A 1XX6A 4MYUA 2JAQA 4QRHA 1SVLA 1TUEA 3SNHA 2RGAA 1FZQA 4F4CA 2GRJA 1E3MA 2Y8EA 3B1XA 4DDTA 1XPOA 3QNUA 4RD1A 3M0EA 2CHQA 1M2OB 2F1JA 2VHUA 4PHGA 3TIFA 1DO2A 3LRPA 3TR0A 1SHKA 2ZRAA 1ZM9A 4OHXA 1KIMA 2ZI3A 1JR6A 3DHWC 4B71A 1HT1E 2WMNB 1HEIA 3OE7A 4RCYA 5KDOA 1EXMA 4UXJA 1JJVA 1W36B 4LY6A 1WQ1R 1II0A 2FV8A 2B7BA 3ZVLA 1JAIA 2A78A 4KLZA 1J70A 2GESA 3L8YA 5EXTA 4GI7A 4V0OA 1KI8A 4EPXA 2ZRDA 2HYDA 1PUJA 3AM1A 1Z0AA 1DE0A 3NBZC 2G1JA 5G53C 2X77A 2QT1A 4Q1BA 1GILA 3BD9A 2QTFA 2ZRKA 4Q4JA 2XXAB 4B3XA 3W6PA 3F5FA 2VSFA 3U6KA 2C96A 4NPHA 2GCPA 3KJEA 1OXTA 2JLRA 3OIUA 3BJIC 3B6EA 2ZI6A 2PZGA 1WRBA 4B33A 1N5IA 1FPMA 4ZCLA 4Z1MA 3WMGA 1UKVY 4GZMA 5IF9A 3CR8A 3TRFA 4KFSA 3D3QA 1WBDA 1G17A 2WVJA 3AF0A 4MRRA 2C98A 4EPRA 2JA1A 4D6PA 4XSHA 4HYYA 4DB2A 1KZGB 4EJSC 2ZANA 4Z1MD 1TMKA 1TPZA 3CX6A 3RYTC 2B21A 4XVRA 4LPSA 2RMKA 2FWRA 421PA 2MMGA 5SZKB 1KNQA 3AKCA 2DR3A 3GJ5A 2ZI9A 1UEIA 3EZ9A 4TWZA 4AD8A 4R9UC 1EFRA 2ATXA 1AN0A 2UVQA 4OI0A 2H7VA 3CF6R 2SHKA 5FBQB 3AF1A 2ZSEA 3FPAA 3WRYC 2F7SA 1A4RA 4GP7A 2QM7A 4IOMA 4XH9B 2NO9A 5FPYA 3REGA 5B64A 3Q5DA 4C4PA 3KQHA 4TMWA 1TQ2A 1DAMA 2QGNA 4BLOA 3LD9A 1JECA 3EA0A 2VP2A 2A2ZA 3U7GA 2QL6A 2O8FB 3IIMA 3VAAA 4K8OA 1XTRA 4LWZA 5CIQA 1IAQA 2JASA 2J1LA 2MMCA 2Q9CA 4ESHA 2QZ4A 2HYIC 2ECKA 2GWHA 1D9XA 3PUVA 1EX6A 4YDHB 2N1BA 3MGCA 5A4JA 3KJGA 1YR9A 2ANCA 4TLBA 4POAA 1CKEA 1NMZA 1TL7C 1WF3A 2H18A 4MUBA 1ZUIA 3UANA 5HE9A 4Q02A 1UBGA 2EYQA 3C14C 4Q9JA 3EZ7A 3K8YA 1RJ9A 3WNCA 4LJ7A 1VHTA 3SEAA 4Q1EA 2R6AA 4LGMA 4JVSB 1NLYA 2W83A 1E0JA 1FTNA 3HR8A 3I72A 4L16A 4TL6A 4PO1A 1XEXB 1W1WA 4PPQA 2J87A 1W4BA 1RRFA 4R7ZA 2HCBA 2ODEA 3VHXA 3KKNA 1YZNA 3EPJA 1P6XA 4ARZA 1ZBDA 2VA8A 4NONA 2DFKB 4JLVA 3T12A 1OXXK 3GLIB 5JSZB 5LDDC 3M4YA 1K8RA 3WBKA 1T3LA 1JEEA 3A6PC 3FHTA 4DLXA 1F2UB 2H16A 1M6NA 4PC6A 3NHAA 4V0NA 2NO0A 1E2JA 3SYKA 3JVVA 5BYKA 2PLRA 2GJ9A 4JT2A 1OLOA 2YWFA 4DSOA 5F3WB 2CVHA 2GKSA 3K70B 4OYHA 4YMUA 3TUIC 3NHBA 4AG6A 1SVWA 2BHRA 4W5HA 1ZP6A 1M8PA 3JVUA 2V7QD 1KI6A 2G88A 4FI3C 5JI3E 3UKDA 4B3GA 2DPXA 4EJSB 1T5LA 1KMQA 2GDJA 1E2FA 5JRZA 3EA5A 2O8EA 1OSNA 3O8RA 3L0OA 3Q7PA 4YXWA 4ERNA 2VPPA 3B60A 5FOWA 2QQ0A 1JI0A 4AK9A 5EZ6B 4OK6A 4LHXA 3Q3JB 3TQFA 4BFSA 1WXQA 4LHWA 5JCZA 3AVVA 4ILEA 5BN5A 2DWQA 1UPTA 3FKQA 1RIFA 3Q5EA 1NKSA 4DBLC 5JWRA 1LF0A 4I99A 4URUR 4DSUA 2AN9A 3PG5A 4YXWD 4RZUA 2BCJQ 4Q66C 1UDWA 3HU2A 1D2NA 2DFLA 2G9NA 2XXAA 1DO0A 1NLZA 3D8BA 1UJ2A 5KSOA 4DCTA 2X2FA 3QKUA 3QKRA 4P0TA 2N42A 4QBHA 4CT5A 1P2SA 2VRWA 3RRMA 4QM6A 1E9SA 5HR5A 3W8RA 1E2KA 3GMTA 3RS7A 4Q18A 1MO6A 5EP3A 5J40A 4KFUA 3ADKA 3KUCA 1E1QA 2NPIA 5GJWC 2HEIA 1GSIA 4NU0A 1S2MA 4BWYA 1KY2A 3SHFA 4JLOA 3A1WA 2F1HA 3ONWA 5EUMA 4CEIB 2QAJA 2WKQA 4URYR 1IY0A 1UM8A 2J45A 1J8MF 1FNNA 1OW3B 4OJQA 1KNXA 1KKLA 2IF0A 1EESA 4ZV4A 4LYHA 4XWKA 3U7EB 1XMVA 2A5FA 1UAAA 3P26A 2R6CA 2G6BA 3ZIAD 1K5DA 4PANA 1U90A 1V43A 4OHZA 2ONKA 2GBLA 1VG1A 4YMWA 5DLQC 4BRUA 1MH1A 1W49A 4PHFA 1GUAA 3SS8A 3UMSA 4JT4A 5E4FA 1CJKC 3X2SA 4NCNA 5AR1A 1T0JB 3EC1A 1E9FA 3OFNA 4JLPA 2DFTA 2ZS9A 3EG5A 3DM5A 2AL7A 2IYRA 2DB3A 3SN6A 1ZVQA 5FTMA 4PTLA 4IRUB 5FOUA 3LWNA 3KXIA 2ATVA 1JEDA 4UNPA 4G3XA 4OQNA 3X1WA 4KITB 2GCOA 1LS1A 1LV7A 1E2HA 3BS4A 3OFND 4OQLA 2NZ8A 4FMDF 4JS0A 4LJ8A 2Z83A 4RD3A 1KY3A 1ZNYA 5TARA 2QMUA 4MYTA 4ZCIA 4Q00A 2CVFA 3HYRA 3X1YA 3PEWA 2PT5A 1G3QA 2AFHE 2XOKA 5JI2E 1VCOA 4I1VA 1R10A 1G4AE 4BRWA 4IOKA 3TAHA 2XZPA 5J4KA 1U94A 2C5LA 5DO9A 2Q21A 3QKSB 4HB4A 4IKEA 1F5NA 2XOKD 4WVFA 3A4NA 4BLRA 2BMFA 1RVDA 1VHLA 1HUQA 4LCBA 3PUXA 4HB3A 2FEOA 2IYUA 2CE2X 4Q4AB 3RDPA 2EW1A 3I5XA 4P4SB 2CCGA 1NP6A 5KNDA 2TMKA 4CF7A 1G291 3KXKA 4I1SA 4ACAA 2I1VB 2JLQA 4TLAA 4A8JC 1OV4A 1KDPA 1ETUA 1SVIA 3SZRA 4B44A 4D25A 2WJVA 4NCIA 2I3BA 2C77A 4DUGA 3LW8A 1ZINA 4WXPA 5J5CA 1SXJC 2OCBA 4BUJA 1SQ5A 1N3BA 1XMIA 1Y3AA 4PAMA 5FUWA 3L0IB 3AF3A 5FOTA 3THXB 2H57A 5KU1A 4BASA 3OIWA 4MKFA 1EG7A 1FUKA 3FB4A 5C46F 2AKYA 1S9DA 5HE8A 4C0HA 5FOVA 1KGDA 4DUGD 1DVRA 1Q0UA 1XJQA 5CM8B 5FBWB 1IXZA 4AIIA 1E99A 4LYAA 4UJ3A 2ZR7A 1Z8FA 2IS6A 1NVVR 1QHHB 2PLFA 3WNDA 3NBFA 1QF9A 1ZJ6A 4HB0A 3B5JA 4R98A 5CB6A 2AXNA 2IHYA 2BEKA 5J4LA 5DN6A 1Q22A 1DOAA 4TYQA 2QENA 4L4UA 2D74A 2VHJA 5FPTA 2RGNC 5KNCA 1Z0JA 1G7RA 2GF0A 1NF3A 4K81B 2XNDD 4GDFA 1PZNA 1GDDA 1CR1A 1LW7A 4UNNA 3BRWD 4M9ZA 3FWYA 3AB3A 2Q9AA 3BGWA 5EXSA 4CIDA 2O8DB 1Q21A 1JPNA 4A82A 1VG0B 1G9XA 3CH4B 2PCLA 2QMEA 4GL2A 2VP6A 4KU4A 2OO7A 1KSJA 2XJ9A 5GADl 3ZYCA 1VECA 2PZFA 4DLSA 5JLJA 1U8ZA 4TLCA 4WAUA 2PJRA 4PFSA 1Z06A 5BN4A 1KMHB 5A5GA 5EE3A 4BQSA 1W5TA 4AYWA 3H0KA 4KO8A 4MA4A 2FH5B 3L0SA 5SZJA 5JWOA 3UXMA 3L82B 1G1MA 2W0MA 3C5CA 3AVWA 2FOLA 1QG2A 3ZZ0A 1XDBA 1VIAA 2CLCX 2YWGA 2WTUA 2OLJA 1XCPA 2BBOA 4RJLA 5CJPA 2ZRCA 1CS4C 2WICA 1DAHA 4QJ3A 4ZCMA 3TSOA 5CLLA 1DAFA 3UWOA 2WHXA 3Q9LA 4YONB 2RCNA 3DZ8A 5E3HA 2GZAA 4A2QA 3BOSA 3KKOA 3BWDD 2V8OA 1IQPA 4CDGA 3TLXA 4KSBA 3QIAA 1AZSC 1E1RA 1XRJA 3BORA 3LH5A 2J9RA 2PH1A 2EYUA 2REOA 1U0LA 3PXGA 4LOAA 4OI4A 3MAAC 1T4GA 3W8NA 3DZDA 1J8YF 4XTCS 2WWFA 1TX4B 5CITA 1U0JA 5FR2A 2ZI4A 4IFEA 1IXSB 3BE4A 2C2HA 5FTNA 3B1WA 4JKYA 3SJAA 2JATA 4OK3A 1E1RD 2VBCA 2ZTSA 3MWYW 4V03A 3UATA 5FFMA 2WV9A 4HAWA 1MABB 4RKEA 4V0MA 2CEAA 3I8XA 2FX3A 5AJWA 4DT1B 5EP1A 3CBQA 4Y0VA 3B9QA 2FZLA 3UPUA 2VLIA 4QNMA 2QP4A 1R0YA 3DVLA 2QBYA 4TT3A 4FMCF 2I4IA 2AXPA 1SXJB 4IW3B 1EGAA 4GOJA 3K0AB 4M21A 1J90A 2ZSBA 3ZVNA 4A4DA 1ZM7A 1VG8A 2WSSA 3B78A 3HPQA 1AA9A 2IYSA 2VF8A 2J46A 3PR1A 4Q4HA 2QGZA 3ZQ6A 2AWOA 3PEYA 3D6TB 3CNOA 4TT3D 2VSXA 2W6IA 4FCTA 2XZOA 3SC3A 5E7JA 1Z3IX 3I92A 3U3OA 3KDSE 2GXAA 4P4TA 3EXAA 2WSSD 1IXRC 2X19A 4O0MA 4BFXA 3GCGA 3LFUA 4DC9A 4UNRA 4U00A 4WZBE 2NGRA 4ASUD 2CJWA 4OQMA 5D3MB 1JJ7A 2BMJA 2IUUA 4Q9KA 3W6OA 1QHXA 4CEJB 1A2KC 2O52A 5GJCA 1E4YA 3HYTA 3CUEF 1ELOA 4FMDB 1P61B 5HTKA 3WHKA 2G83A 5TDHA 4C0QC 4QHYA 4Q4AA 4PC7A 2A7QA 1T0HB 4C0AC 1NSTA 3D7MA 4JLDA 5K8LA 1GAJA 3LY5A 2WAXA 1OFIA 1COWA 2GZHA 4Z54A 1AGPA 1E9EA 4HUQB 3K0FB 3QKTA 3QEOA 1MOZA 5FBVB 4IDNA 1ZW6A 4HAUA 1F2TB 4DJTA 4KLNA 4LPKA 2ZIAA 1E2GA 4QNRA 1EFUA 1ZC4A 1XEFA 2OCPA 2Q3HA 4OQXA 1BS1A 2AWNA 4C3ZA 5FTKA 2ZSFA 1COWD 1X8JA 1N6KA 1ZM4A 2G3YA 3SI7A 4G0NA 4HAVA 4K46A 2VIIA 5IDVA 5SZIA 2OEPA 2REBA 1XWIA 1YR7A 2QE7A 3LLUA 3TAUA 2V4ZA 2HJVA 3GLHB 3DOFA 4IEEA 4JMPA 4DDVA 2QEQA 2ZUBA 4B2IA 3TGPA 1KI9A 3K53A 1QHHA 3S1AB 4XJXA 2FG5A 1YVDA 1D6JA 4IDHA 2LWIA 2R62A 3CH5A 2CXXA 4QJ5A 1HE1C 2JLWA 2YOHA 3Q8XB 1CJVC 3GEIA 1R5NA 4D81A 2QE7D 1HQCA 3LX5A 2CLDX 5AUPB 4QGFA 2FZ4A 2L0XA 1YR8A 4XWAA 5B30A 2ZRNA 4JLJA 1E96A 4JVMA 1IJFA 2IXEA 3HDTA 4P4UA 2F9LA 5DYGA 5FH9A 5JMTA 3VKWA 3OHMA 1YZGA 1S1CA 2GILA 1GNQA 3B85A 3ZS9A 1OIXA 3QXXA 5FOSA 2RHMA 3EZFA 2OFWA 3EPKA 5AK0A 4MDFA 3VU9B 2IXFA 1U9IC 2FEMA 2OBNA 4MKHA 1T91A 4ACBA 1UEJA 2CL7X 1N0WA 2Z5FA 1FTSA 3NIBA 4LX0A 4RZ2A 1KK0A 3U4QB 1VCNA 2ZE7A 3WHLA 1QHYA 2RHDA 4LC1A 3AKDA 1T3SA 2J3EA 3R20A 1N25A 4PC1A 4URZR 3ZDQA 1AS3A 2Q6TA 4M2LA 1SVSA 2VP5A 3RABA 3IIJA 3ZZUA 4EIWA 1ZIOA 2WJYA 3FMOB 2BMEA 4FMBB 4DLWA 3C4JA 3IKJA 1XJ0A 3RAPR 5F9FA 3SE0A 3U3KA 2HT1A 2WJGA 3MWLA 2C04A 4DLRA 5JCPA 2XNSA 3VMFA 1E98A 2EVWX 4J0QA 1BO6A 4JLBA 4PPNA 2UZ3A 2DWPA 4D26A 5ELXA 3W3AA 1NSFA 2ZJ8A 1IN4A 4QFMA 3NWJA 4US2R 2ZITA 2XEXA 4OK5A 5B2ZA 2DY1A 1NNEA 4RD0A 3ZD7A 5EE1A 3QXHA 1S96A 4B73A 1G3IA 1IM2A 3J81k 4HI0E 5EE0A 821PA 3RS4A 2FMXA 4A8JA 3EC2A 5BQ5A 1EWRA 4D2IA 1NY5A 2ODNA 1JR3A 2QNRA 3MWKA 3SYLA 4C0SA 5K8UA 2J7PD 1B0UA 4ON9A 4PSVA 4A1FA 4WXRA 2O8BA 4Q1DA 2QP9X 3IIKA 3Q72A 3NXSA 4DVGA 2BEJA 3VFDA 2IX3A 3U61B 1SKYB 1JR3D 2P5TB 1NN1A 5KOYA 3KL4A 2P65A 3O8CA 1OXUA 4PC2A 2FGKA 1XXHB 3UWKA 4WZ6A 4ASUA 1RW4A 1YHNA 2J41A 4HDCA 1JB1A 5DISB 3OEEA 1FUUA 3C15C 1ZIPA 5HKKA 4I81A 4LZZA 1R2QA 3KTAB 4TL7A 5E7IA 1E2DA 5CK4A 5DI9A 4I1UA 2OFXA 4DWJA 3CPJB 3VHLB 4FMCB 4UQOA 3ICQB 4TMTA 1H8EA 2W2VA 3OE7D 2RGNA 1G20E 3K1JA 4PAQA 3VR6A 4CEJA 4NKRA 3N2IA 4PHTA 1VPLA
chains in the Genus database with same CATH superfamily
4P2BA 2JD0A 3UAZA 1P19A 3SVTA 2A1UB 3R9WA 1AKNA 1NP3A 2YV4A 1SH7A 1SZCA 3ND7A 3T9EA 4BX2A 1I14A 4DFDA 1JXAA 4M1KA 1M2VA 4HEHA 4ETIA 5I01A 1M0TA 1H8ED 2H1LA 4OO3A 1KH3A 3TIIA 1JHXA 3INTA 4HLCA 1VCMA 4J43A 5FI1B 5KIAA 1MX9A 5CFOA 4OSPA 2CMHA 4PGHA 2CNOA 1H2YA 1F2TA 3OU7A 5IJAA 5EHQA 3TPCA 3EGIA 2PBRA 2I7CA 1T3ZA 2WVAA 3K70C 3KQMA 3ICWA 2FA9A 3QVMA 2GCNA 4RAQA 3GHHA 5CW1A 3G79A 2DF8A 1G64A 1GG5A 1WCIA 2I71A 5C2JB 5FNVB 4TUYA 5CDFA 1LZKA 4HZUA 3HNOA 4LMBA 1E7YA 5A9TA 4RYLA 4PW0A 5DNAA 2AMVA 1KFCB 3GUZA 2QTNA 3IQWA 4FW9A 4CG3A 2GAAA 4GX2A 1NQWA 3CEJA 3DMGA 2I99A 5DTJA 3U81A 2YOGA 3UB3A 4JUBA 2GOYA 4BKPA 4B76A 2EDAA 4RDHA 2IHUA 2ZE6A 2P9GA 1TA9A 3PXUA 4UEOA 1FX0B 2Y68A 4H1VA 4F4IA 4UZEA 3HJAA 4HNVA 2EGGA 5KYVA 4N6GA 1VJ1A 3IUYA 3U39A 3E5HA 1RC8A 1IOLA 3HYCA 1GADO 5DV9A 3AVTA 1NUQA 1WSBA 2BM8A 2PGOA 3CX8A 4TN1A 1Q7BA 3VR6H 2Y9MB 4ZYYA 1VLVA 1CNEA 3CG0A 4ZHQA 5IF3A 1G9SA 1XJ5A 3KB6A 1P74A 2QLJA 3VX4A 5JQGA 1VJ5A 2NO6A 4GWKA 5TPWB 1XD2A 2Q1SA 2W22A 3K9LA 1I24A 1V48A 3DYIA 3ZDFA 2P6MA 1NN3A 1QBKC 1YBVA 3O03A 4JD5A 4Z2YA 2TSYB 3KHKA 4UMVA 3SBXA 1PUXA 2D5LA 3GG2A 2ERYA 2FB9A 2D1TA 3BK1A 1FFSA 4KVFA 4M7PA 1RRPA 3ZY6A 3MYYA 2H5EA 2P1RA 5CG2A 3OTOB 5NULA 1EQ2A 4RFSA 2OYRA 2WQ6A 4MKIA 1CB0A 2OXCA 3QHAA 4WXYB 1UMBB 2A9PA 4GYWA 3V8MA 5F2OA 5FUQA 2BCEA 4G1MB 4DDWA 3O47A 2Q1XA 3LT0A 2I4MA 4J2OA 1MV5A 3EEQA 1E1DA 3WL8A 3LT4A 4TXNA 2HA5A 1GZ7A 4MS3A 4AECA 2PA3A 1TCBA 4KBGA 5G02A 1T1RA 5TRTA 3UO8B 2E9SA 4QXQA 3W9YA 4DBLE 5IUJC 5FWXB 1RAIA 1VI2A 2IA5A 1KP2A 2BRUC 3FDXA 2C88A 3OKAA 4L6IA 4B75A 1L9KA 4B7AA 1Z7GA 2GJAA 1BDBA 1W6UA 3FMIA 5G2OA 2IS6A 4B5KA 1A69A 4B84A 2CHUA 1GQYA 2TYSB 4UBIA 5LYJF 4RLSA 5EWJB 1PLKA 3KYDA 1US8A 2AV6A 2X0NA 1X19A 2ALJA 2UVDA 3GRKA 3H4TA 3LYUA 1QO9A 4O4LF 4RMHA 2PT6A 4PHHA 4ZDJA 1KO7A 3BL6A 5FORA 2CW5A 2VJPA 3NTXA 4PE5B 1F14A 4EG8A 1UC8A 3FPLA 4H7DA 2WTEA 5ENVA 1GUFA 5LD2C 2Q41A 3ABRB 4Y1RA 4F1KA 3I6YA 3QE3A 1FVXA 4HVLA 4RK6A 1A9XB 5HOQA 5KVCA 3PEVA 4X1IB 1L8QA 4Y98A 3KD3A 4WLVA 3I23A 4R6WA 1MTZA 3SD7A 2ZUTA 5ED0A 4HNSA 3Q1KA 2WU0A 5IYZA 1XKLA 5FO0A 5GONF 1HQYE 2XLBA 1Y9EA 5JZVA 4KNWA 4L6CA 3Q3CA 4N82A 1PGQA 3U3JA 1QFJA 4QYWA 1N4DA 4X6LA 4DYVA 1Q92A 4XX0B 2I67A 1QYDA 1VPVA 3BXFA 3UMFA 3L4BC 4XVUA 1RRKA 2P9EA 4OXRA 4P33A 1ZQ1A 1DV1A 3T5DA 1ZD8A 1NBWB 3P2KA 5CT5A 1G18A 1HORA 2PSSA 4JZKA 2R8BA 3AY6A 3CW8X 2Q0SA 2YVLA 1CULC 4OB6A 3A36A 4W1PA 1Q7RA 4KQXA 3HCRA 2HB6A 5K8VA 2HU7A 1FRVA 4DQUA 4PV7A 5A04A 3R8FA 1DIOB 4Q82A 1SBTA 5EQDA 4ZO4A 2DPYA 1GKKA 3RLIA 1ZJ4A 4DLPA 4HH0A 4MUNA 5D3QA 2XV1A 2Z30A 3C87A 5F7XA 4UUAA 5AK4A 5AK5A 2XQIA 1V6SA 1PW7A 3OIDA 1G7CA 5C9ZA 2PWAA 1XXLA 5LQNA 3GD7A 2X40A 5EXPA 3HJHA 3TOXA 2ERXA 2OHIA 4BAZA 5KYWB 1FP6A 4RPCA 4BLWA 1NM5C 1JLKA 1W5SA 4LHYA 2ETVA 5EMHA 3S55A 4DLVA 5KTTA 4AO8A 2RHBA 1E5QA 5F21A 3RT9A 1HLPA 2X13A 5IWCA 3ANSA 3RFCA 3TMYA 4DW8A 2HH9A 2ZJBA 1KDYA 4IIYA 3DEZA 5LNK6 1AGNA 5H3HA 5HPYB 4R1OA 1KEPA 3QITA 1H85A 2DY0A 2KE5A 4O8CA 1ONPA 4OQYA 3CE9A 4YT8A 2CMDA 2HA3A 3ROGA 2CBGA 4X90A 1Y1TA 4E2XA 1KQGA 3DNPA 2NU7A 1QQ7A 3EB9A 4CYMA 4RVCA 5C18A 4OXXA 5G0WA 2A33A 3MT9A 5BN3A 5HIAA 4CVNA 4CLDA 4GZLA 1EQAA 1RXIA 2J5KA 4N7BA 2O54A 1W47A 4C5AA 4Z9FA 4BJ5A 3GEDA 4HK4A 4G4SP 1NJ1A 2XUFA 3AKYA 2NNWB 3NW9A 2C00A 4UHJA 1Z88A 3L06A 1AHIA 5A2GA 5BR7A 2ORIA 4MI3A 3AUYA 3GNTA 5L3SB 1ESNA 4UHEA 4RS4A 3IKTA 2XVMA 1TLFA 2JARA 3GRZA 5TVKA 2KS6A 2HW8A 2ZYVX 1WHTB 3SJBA 1SC1A 1JEAA 1ISHA 2QQFA 1J99A 3LXXA 4ZK6A 8ADHA 4XYLA 2IH2A 1MJFA 4BIIA 4OKIA 2YXLA 2FFAA 3LL4A 4EA6A 4EYGA 1LDBA 3FMPB 4OGFA 4C7VA 2A0KA 1QFYA 4KHZA 4CUJA 4Q5IA 2W2LA 3O8QB 2HJGA 1SA0A 2GB4A 3G88A 4Y9UA 2VJCA 3UHPA 2IUSA 5JFGA 1K86A 1NYLA 4KOEC 2JIBA 2QNBA 3Q41A 4W6QA 3R7WB 1T2FA 2XW6A 2XUDA 3MWDB 2K87A 1N6PA 3OLQA 2ZJ4A 1IN5A 1WWKA 2V59A 5B4TA 5BXQC 4IILA 1G6OA 5BRAA 4G5YA 2W2LD 3QEJA 4N9WA 1PT8A 2OK8A 4R8MA 5ALHA 5ETJA 3PX7A 2I8CA 2O19A 2FSIA 2PV0A 1H2EA 1HURA 5JBNA 5CIYA 4GI5A 1U65A 2IYNA 1Z5NA 3BJZA 4G07A 5DK6A 4MVXA 1P45A 4DTIA 3UK2A 2Y6VA 5JSKA 4G1UC 1GDHA 2JC3A 2SKCA 5JNSA 2UZ0A 3I2FA 3ZG6A 4C03A 1AB6A 1RYYA 2V6JA 1F48A 4G09A 4BNMA 3AEKA 1BYUA 2AEFA 4XR9A 2Y9PB 4RELA 4CM4A 1Y3IA 2ECOA 1T0PA 1CX9B 3RC2A 2P9HA 2FHPA 2FLWA 1E5LA 5CNIA 4KGVA 2CL0X 4QTUB 2VQEB 2WF8A 4PY2A 2EATA 3FOBA 1I4OA 2XE4A 3WY9A 3RSQA 4H3VA 4J6EA 5L4LA 3KR0A 2OVBA 1HNZB 1QR2A 3RB8A 1U8FO 3Q98A 4B09A 4MVJE 4U0JA 3GCZA 4I6EA 4M36A 1NIJA 1Q83A 5U1PA 3VZCA 5A2QA 4MI9A 3PNOA 4L51A 2JBHA 3KYIB 3NIDB 3ESAA 5JCJD 2ID4A 2OGTA 3I1FA 5JTUA 1E3WA 3D5EA 2FI1A 1DBIA 2ACVA 4O8ZA 5D5HA 1G60A 3BXZA 4LRQA 5CB0A 2JLSA 3BYZA 3LDHA 1OXKB 3ETCA 2ZT8A 4R5MA 1X7HA 1VBFA 3JQ9C 5KDDA 1WVIA 1Y1LA 3PKZA 1BSVA 3W77A 1EJ6A 4H35A 5A0TA 1KI3A 4W9MC 1VC2A 3TZEA 2QYTA 4XQCA 5KYYB 4MRSA 3WGJA 4Z8YA 2Y77A 2C95A 3PUIA 2VJLA 4DYHA 3CPSA 2A8YA 1IHDA 1IHOA 3JQCA 3R09A 5TR9A 4NFLA 3DFMA 3LA6A 4RHUA 5LDGA 1E61A 5T64A 1OFGA 1XTZA 3M5DA 1W5FA 2OCGA 3H2HA 3IHTA 4RHXA 2J9FB 4HCJA 3K70D 4PLVA 3T0FA 2OLKA 2O2XA 5TX7A 3AM3A 5I3CA 2M1ZA 4F60A 2VJMA 7MHTA 5I9TA 1U8XX 2Z6VA 2R68A 5CCDA 2OSBA 2XQFA 5FBKA 3WKAA 4BLSA 3FVQA 4DDUA 1RXYA 5DN6D 3LM8A 2EKQA 3D1LA 3H1TA 1YVRA 2W71A 4YB8A 3COVA 4C7XA 1X0XA 3GXBA 1Z38A 4M1MA 2ZFUA 4HAZA 3N2NA 4ETMA 4TKZA 4QU5A 2FWAA 3N59A 4HPWA 5DW0A 1SULA 3D6VA 5EIWA 1GUZA 4GYKA 4K9SA 3TPZA 4L78A 2B1GA 2DBQA 5KOYA 1DIGA 4RF2A 3TB6A 2AVNA 3U80A 1NWCA 3HCPA 4BVFA 3BRCA 1Y42X 2J9YB 1XU7A 3F6CA 2ZM6B 4QOFA 1DS6A 1WSWA 2DHCA 4JQZA 3ISTA 2C2WA 4MVWA 3IIEA 5EKSA 3ABSB 2FQXA 3CLRC 3VR4H 1T1EA 1XDWA 3VSBA 8LDHA 2IU4A 3GNLA 5LCXA 3VVCA 2I87A 3BFVA 3FCAA 3JQRA 4UEJA 1MP0A 4A6EA 5BYAA 2IU3A 1QG4A 2IL1A 2O3QA 3T3DA 1QC5A 4D9KA 1CUWA 3CVYA 3E5MA 3ACCA 3CH6A 2VWHA 3NDPA 4AZWA 1IQ0A 4CF5A 1GAWA 4J8PA 1K9SA 1N9GA 3P0RA 1EUDA 3MS7A 4HLDA 1Z6ZA 4ENQA 1EIZA 1J7JA 2ZAMA 4L5AA 5JECA 5EE5B 4U3JB 2Z1DA 4FMPA 5BN1A 2GBIA 4AY4A 3GZJA 2BRUA 1EDEA 1YRQA 4J3JA 4XIGS 3A4YA 1SCAA 5HIJA 3X44A 1WB5A 4MGKR 5HF8A 2ZSUA 3K92A 3QQ5A 4IKOA 3ZGOA 4B6SA 2P6NA 2VHCA 4BZQA 2BM1A 1YZLA 1ZC3A 2DJIA 3NBMA 2CLFB 3O9ZA 3QBJA 4LV5B 4XQGA 5BRJA 5LU9A 2C57A 2HF7A 4PQFA 2PCJA 2PUGA 1GSAA 3HRHA 1O0SA 1OLXA 2YN0A 3DV2A 2ZR9A 3V1UA 4EJ2A 5JSUA 2HIAA 4KBFA 4DJEC 3NHKA 2ZBRA 2OM6A 2J6BA 3L40A 4GEKA 3PBKA 1QCZA 9ATCA 3IQIX 5KQPA 2F00A 3JR3A 3WK5A 2EQBA 3KYCB 3NXKA 2V6MA 1QHGA 3F3MA 3AONB 2ZXFA 1UBTS 1W0KA 4H0NA 4L5JA 2M2IA 5TNXA 2E4ZA 2IS2A 4FWTA 1A4XA 4G0YA 2DQYA 4LSZA 3RS8A 4HQLA 3PUWA 4D3YA 1F7VA 3ZN2A 1UBCA 3PA8A 1WTCA 1ZRHA 4HH1A 1K0UA 3MIZA 3PHIA 5DSZA 2BKXA 521PA 1LUAA 3U3XA 4K3UA 4HNQA 1NW9B 1DEKA 2RGGA 4BFUA 2OV1A 3DXFA 1W0KD 1S9HA 2P4SA 3K4QA 3QUSA 3B82A 2A3NA 2W11A 2WD7A 4I46A 2X23A 1LS6A 2BFMA 3K4HA 1V9CA 3N0WA 2V0GA 3L4BA 4W5WA 4RV4A 4BZPA 4H4CA 4IGFA 1CY6A 4LYFA 4RVDA 1AZTA 3PJEA 3R4VA 4X24A 2QW1A 3AX6A 2IIQA 3NRBA 4J7XA 2OGZA 1H42A 2JZOA 2XE7A 1TMGE 2XNKA 4N5NA 4B3JA 5IHPA 1OOEA 1QNFA 5MDHA 4YJGA 3A1CA 4LUCA 2BMDA 2G5TA 4QHSA 4M9CA 3PFBA 5IRCD 1O1YA 2DU8A 3EAGA 3G0HA 4A6XA 2GBFA 3OWOA 2R1ZA 1FYVA 3AIIA 4DV1B 1DUVG 3PNBA 3RUDA 4P4SA 4P3NA 2VUUA 4MLZA 3HKDA 2CSXA 3AR3A 1EVIA 5JXHA 3ZHYA 2O5EA 3JARA 4YDRA 3EIWA 1ZONA 5KWIA 3KJZA 1TD1A 3LMKA 5COBA 4WNAA 2QMHA 2WWRA 3K9NA 2HCJB 4P84A 1FTWA 4U7GA 1OFUA 5AKHA 4ZQBA 4ARSA 3U1BA 5INTA 2A88A 2CK3A 1BHSA 2HO4A 3BXEA 3VDXA 4C7MA 1PNRA 121PA 2GK6A 3ZZMA 3BX1A 1WUHS 5H81A 2D8MA 1VQ1A 3C6XA 3NTQA 4WK4B 5JSYA 5TV2A 1RE0A 3NWBA 3FROA 2OZKA 2CN1A 1QCYA 2HWKA 3K6RA 1LBIA 2IYLD 4J0EA 2CK3D 1UFKA 5EGSA 1ITZA 5F76A 3G6KA 4ZXFA 5A5VA 1YKSA 3T1VA 3C0KA 5CB4F 5CGQB 4BZXA 3AL0C 2PM8A 5EI5A 3RWOA 2WHEA 3ZLVA 5AVZA 2P6UA 1EX9A 4LF4B 1ADGA 4RTRA 4Q48A 2BYTA 1J0DA 5DMHA 1TLLA 2X8LA 3ASZA 3PFCA 3T95A 5K2OA 1G21A 3PD7A 3MLEA 2Y93A 2YCLA 5J1SB 3F6YA 5HEKA 3N2ZB 3OPYA 4CL0A 1PSZA 4NLLA 1JNYA 2QSZA 4C30A 3AYZB 4WQMA 4FYIA 2ZWVA 2FMTA 1V7PC 3E1GA 3SBEA 5BMOA 3DL2A 2W42A 3LV8A 4OQ4A 2O8DA 3V8RA 3JALB 3M6MD 2RCYA 3RRZA 3RJ9A 2I29A 3EC7A 2G9VA 3ISVA 2L2QA 1Q11A 1LDGA 1PNQA 4A0GA 4DCUA 1ZKDA 1WOYA 2BIFA 1KAGA 3COZA 3ZU2A 3IR6A 1WY5A 3OLVA 4ICIA 3QU2A 1YAHA 4LTNA 4Q7MB 3PNSA 1RZUA 3PGXA 4FXOA 3W8DA 5ERXA 1ZCJA 2OECA 4W4TA 3RV4A 5BSWA 3MWJA 4PRKA 6CHYA 4PAOA 2ABWA 4MYHA 2V74B 4ZO9A 1XZQA 5DM70 2Z5VA 5IKXA 4RSGA 5CIWA 4OBBA 3PFWO 1CZLA 3VH1A 3EHEA 4XE5A 3GUHA 4FIDA 1E32A 5E3IA 3SR0A 4I55A 1GXSA 1R0ZA 4EFLA 2I7DA 2BJHA 3I73A 4FS3A 2XWQA 3RVKA 3CT6A 3DLPX 4ZOAA 5DYNA 1E58A 3OFJA 4ABTA 2ZB8A 1MFPA 3QJYA 3EGDB 4UZSA 3HU1A 4CE6A 3ESYA 1E4OA 2R1VB 2GHIA 1EP9A 3A37A 1R5OA 4R41A 5KJ1A 9ABPA 4E6PA 1TIKA 3EY9A 2QRLA 4PFJA 1L5VA 1EFHA 1EB9A 2A9RA 4NOKA 1IVYA 4OI1A 5H4HA 4ATNA 1EH5A 2NLOA 3FR8A 2IHTA 1TEVA 4PZEA 1G5HA 2Y3IA 2BFFA 5EIFA 2WWHA 2PL3A 4N5HX 2WTXA 4A9AA 3G2HA 5IXYA 4HNAB 4KQEA 4E4RA 1DC3A 5F3RA 4E5PA 3ENKA 4OL0A 1BHQ1 3PGVA 7YASA 1WZEA 2XCIA 2QSUA 3OZWA 2HRZA 4ZU3A 3OA0A 3OZXA 1CR0A 4KSYA 4NCKA 3S2YA 1ORWA 1YZYA 2JAXA 5C1PA 4HFNA 4C20A 2REXB 3CX7A 2YIDA 3MN1A 4TT8A 4YAIA 1G16A 1HDXA 1DC5A 1CBUA 4GRAA 5DM60 1WPRA 1X74A 3ZDCA 1AJEA 3PWKA 4D41A 3H2GA 3QKIA 4NYMQ 1XF1A 3R7SA 3QWHA 4FD3A 4UUQA 5AKLA 1ODIA 4CMBA 4ZJYA 4BO0A 3QMPA 2DERA 1FSFA 4GPEA 4HEJA 4KAAA 2VUIB 1YDGA 1U3CA 3PL5A 5DRTA 4C4SA 3GLFE 3IJ5A 5CYFA 2GO7A 1MJ5A 2LKDA 2ZJZA 2ZKIA 1ANKA 2VHYA 4I4CA 5K6TA 2HXGA 3V55A 1L4YA 1GG8A 2YZ7A 4ZU6X 5JPDA 4PYLA 4UW9A 2HTEA 1S4QA 2A5JA 4ZVSA 4DIDA 3P2MA 2AEJA 1KMMA 1OXVA 3RW9A 1YJ8A 4GYYA 1W48A 1UPUA 4RMIA 5FL7A 5EWMB 2YIMA 2GSWA 4CF6A 4BPBA 1DBWA 4JWTA 3L8ZA 4FCVA 2IPOA 5JBIA 4HR7A 4EJ6A 1KI6B 1R4NB 1VFNA 1ZMRA 3I1JA 1DQYA 1LLUA 3ILXA 1KOJA 2P2ZA 4PC3A 5I9NA 2WM3A 4FYYA 2VVTA 3RJ5A 2LDYA 4UASA 4CMIB 1NBME 1XNJA 2XVAA 3H1BA 3GLQA 4AFNA 1YE5A 5GVSA 5LQUA 3MXTA 3E48A 3GIDA 5FL7D 5JH7A 1BW9B 1JVNA 1NI4B 4X60A 4EB3A 1GD1O 1N1EA 2B83A 1U9CA 4IS3A 1JG4A 5B7NA 1D2CA 2CGEA 2GF9A 3KOUA 3R6LA 1MMFB 3ADPA 2F3SA 3O0TA 4AIRA 4AS3A 1RWNA 4ME6A 4F92B 1C3OA 5LQMA 1IBRA 3HB9A 7ADHA 2NYRA 2YWDA 3ADDA 1II9A 5KMGA 3AUSA 4F3KA 1E9BA 1Y7LA 4XWYA 5K3AA 3W2HA 2V7UA 3TQRA 4YRNA 3RQSA 2G28A 1U2RA 1LBQA 1W4RA 5CYOA 3AUFA 4DMUB 4Q7QA 4RY8A 5IAEA 5D3ZA 2V9ZA 1P75A 1U9ZA 4PHCA 1CRQA 3D3WB 5LYYA 3ZTTA 1ZMOA 1XZBA 4DYDA 2REQB 3AIOA 2SKDA 3UH0A 3W9SA 1X13A 4I50B 1ZU4A 3CVXA 2Z6AA 1NLFA 3WYGA 1KI7A 5DGXA 1NL3A 3IDQA 2P9JA 2VJKA 4P3OA 3ER9A 3UGQA 1DHRA 4HRAA 4U7TB 4XFJA 2R5WA 1UF9A 4BKOA 3MJVA 4V39A 5BVHA 3L6CA 5FF9A 3KQOA 3QVLA 4TTPA 4R3UC 2ZOSA 3GEGA 2QN3A 5T6BA 4MVJM 3ZJUA 3CLRD 1ZY2A 2WVGA 4NAUA 3AM4A 4Y8VA 1PGJA 1UBMS 4X54A 3BE5A 2FPMA 3AOGA 3GLSA 4RA9A 4PRLA 2HPZA 3VV2A 4MUMA 2R8RA 3G9ZA 3ZDEA 1RHKA 4ZP1A 4OLHA 4AO6A 3OUUA 1DEAA 3IKMB 4EG3A 3QHQA 4WLFA 5EZYB 3JWJA 4JBWA 3LVRE 1E5VA 4Y2SA 3ZCRA 4QGBA 1QO7A 2EL7A 3B1JA 5ADUS 4G81A 4GMXA 3WMFA 4MV4A 1AKTA 4Z0TA 1ATZA 3C4VA 1KI2A 1E5TA 3CPHA 1WPGA 1DCKA 1N2BA 4QGSA 1HYEA 2IIVA 3FI0A 4NBWA 5GPBA 2PPVA 4QJ4A 4FFVA 1CUYA 2D5CA 1KU0A 3R3YA 3V7FA 3V7UA 1N34B 1JQ3A 1NJSA 3UBTA 1EP3B 2W7TA 2HZ7A 1IDN1 5BQ3A 5IJ9A 3TZBA 1UZMA 3DMRA 4HDRB 5C31A 1IBMB 1JG3A 3KLMX 4LJSA 3P0JA 1IOZA 1Y8AA 2WMYA 3VU9A 5LIPA 1KSHA 2I33A 1R8SA 2P4EA 3BUSA 4WLOA 1PTJC 5DCLA 2YFQA 3A28A 4H3HB 4PXAA 4NMMA 2O1EA 3SQDA 1ZIYA 3ANXA 1TT5A 5K0JA 1RBQA 3L04A 5ALQA 2G9QA 4HG2A 3GA7A 3LUFA 5U4QA 3WO0A 3H5WA 1MIHA 1T5BA 5TMDA 3VYSB 3AK4A 5JWHA 3GUUA 3IMCA 1C50A 2XRMA 3EK2A 3QHPA 3DWFA 4U5QA 1FNMA 4BBPA 3B8HA 3VC1A 1S8FA 3DEYX 4KR0A 1PL7A 3T5CA 3FI9A 3B36A 3I1YA 1XPRA 4QVGA 1GEEA 3VPGA 3A2NA 1TAUA 4C87A 4JXXA 5ALXA 1Z07A 1RYFA 1Y5IA 4RLFA 4UTZA 2V98A 3DHYA 2W90A 5AOCA 3T9DA 1D4FA 3TVYA 3SOPA 1I4TD 4D5EA 1N5JA 1Q1QA 4N0EA 1PJLA 4CCSA 2R11A 4WT7A 4JI7B 1SHJA 2OFOA 1JDBB 2JFGA 4OHOA 3DB1A 2H4WA 1YDFA 2IEAA 1YOVA 3S6JA 4QKQA 4OXIA 5C81A 1BQ4A 2IYTA 1A1VA 2VJOA 3LQQA 3M4ZA 1YJXA 1QLWA 4ZKDA 5DYWA 1KZ7B 3REQB 3MOIA 2ZJOA 4YFYA 1ZI6A 3GDGA 4YT2A 2J0UA 3OIVA 1SXGA 5CDYA 5TT1A 1K7EB 1ZDMA 4I8XA 2GJ8A 1WKBA 1IBSA 1KZ1A 2QAGC 3TQQA 4ZZ0A 4D4JA 1Z83A 2IW1A 1T8UA 3OY2A 4FE3A 1XD8A 2YJTD 3I0ZA 2CLMB 4C1BA 2EKPA 1Z2PX 2R7NA 4W99A 5KVQA 2W00A 2DHQA 1QHNA 4KYUA 2ZB3A 5CDUA 1DIAA 1GKIA 2PMWB 1WA5A 2FZ5A 3FFXA 1VIYA 2NUAA 3EQ9A 3WWYA 4F5ZA 2JGIA 2ACEA 2NXCA 2V7QA 1P2DA 4N3GA 5CDHA 3GZTB 4JYPA 5F23A 5IP5A 3M9WA 3IO5A 5IW8A 1CEYA 4MV5A 1S3SA 1G3UA 5JPIA 3RK1A 3LW7A 3O1JC 2A0YA 1F5SA 2BVNA 3ROXA 4CM1A 2R8OA 3ML1A 1CP3A 5DZSA 4TL8A 1XB2A 2GTPA 4AP5A 2V5VA 5LZ8A 4NY1A 3G2PA 1NASA 3GL9A 4RW0A 5D2CA 4JXKA 3NJ8A 3VJMA 4KTVE 2VUHB 4W5RA 5MGNA 5ED4A 2IY7A 3FOAA 5AW0A 2WV7A 1MTOA 1L7XA 2XMDA 3N8IA 3TIVA 4DA9A 1N0UA 2NG1A 3UMGA 2R44A 4L27A 5ENZA 2QTHA 4G86A 1H05A 3SZUA 4YRAA 3ADBA 1CS0B 3PENA 2VP3A 2PHZA 3QUAA 4UEKA 3SYMA 1C81A 1IUKA 1J0AA 2WTNA 3THYA 1B23P 3KT3A 4RJKA 4JC4A 4YT4A 5CLJA 3VJLA 3IP1A 2ZVPX 3OJLA 4X0EA 1M8GA 2WT4A 5DP1A 1IFXA 4P80A 5ESDA 2Z4SA 1YB2A 2DKFA 2FPKA 2GJSA 3CLVA 3RAFC 3ITKA 2IZZA 2DHRA 2VSYA 1R4AA 3KOWA 3OOEA 4OHFA 4HAIA 1C7QA 3FZNA 4E2WA 3J7AC 3OFVA 3RVNA 3OPYI 1N1MA 4P5PA 4EPTA 3BJMA 1KZYC 3Q0IA 2V0NA 1GPUA 3HS3A 3NWOA 4UATA 1U3WA 3RSHA 3DW1X 1XSEA 2VWPA 1CYEA 4X3CA 2PT7A 3G1UA 4FZ5A 4Q6WA 4RTJA 3NZEA 3UXHA 4C04A 1XQXA 2NTNA 3TIGA 3VU3A 4PCLA 3KZ1E 3R7FA 2C2MA 4U9HS 3GGCA 5DBIA 3OQJA 3GRYA 3IP6A 4UCQA 2B4AA 1U3UA 2PR7A 1YB4A 1OBHA 3D4OA 3OLWA 4BZWA 4ADSG 1LVGA 4LW8A 3L1VA 2HREA 1QJ4A 1XHFA 5FWNA 1P9RA 3CKLA 5FIUA 2WD8A 1E2EA 1T9BA 1Y6JA 2FK7A 2O0HA 2ZUWA 2HK8A 4XUEA 3CKKA 4IH4A 1STOA 4NE2A 1TVEA 4QAJA 4U7PB 3WLAA 3RQIA 3W2FA 4F8EA 2ORVA 2FUG6 5KYXA 2FP4B 2VPIA 1E94E 2HFJA 1CJCA 2HT6A 4FNGA 3N2GA 3JYQA 1KO5A 4LXGA 4D3FA 1JFFB 5IWAB 1QP0A 1C30B 3EUWA 4B31A 1ZH2A 4ZVOA 3DMFA 4JP1A 4CIAA 1PI3A 4TTQA 3CRQA 3HY4A 1TKRA 5DNYB 1NA5A 2F90A 2LXNA 3IJPA 3KQTA 1V3UA 2KMLA 4LOIA 2XKKA 2H31A 2H51A 4LHZA 4AZ0A 3WGOA 4FQ8A 3O6VA 4KV9A 1ODKA 4C21A 5LKAA 2WOJA 1IG0A 1G2OA 2WUEA 3ST7A 2QBYB 4E03A 2XQVA 3F90A 3EIFA 3RIXA 5BSMA 1FQJA 3N3AC 3Q0EA 4AM8A 2M1XA 1HYGA 2G67A 2J59A 4DA4A 2EZ9A 1XZGA 1BIFA 5FFFA 1QWOA 1KRWA 3QV1A 1RS0A 1KDZA 2RC6A 4IDPA 3IDZA 4J76A 3C98A 5JZ9A 1UBEA 2NU9A 2D7DA 4FOPA 2R48A 3PCRB 4Q4HB 3ZH9B 2D2VA 1GNLA 2WMDA 3I8SA 2Z5GA 3EAFA 5ICSA 3UEOA 1CRZA 4U2GA 1WP9A 4MIEA 3HB7A 3GXOA 4IJKA 3JV7A 1AXRA 2CLIB 2H4XA 5K3SA 3ZWDA 4YQZA 2QWXA 1GR1A 3KV1A 3O0DA 5CTJA 2P5SA 2CFRA 5T4FA 3UYLA 4FFSA 3FNFA 3UAYA 5FQOA 2GM5A 3GJ0A 3LIPA 1QX3A 1BOFA 1CY7A 1UT6A 2WEKA 3PGMA 2CJWB 2TMGA 4DG9A 2FDCA 2ZIEA 5F1OA 3HP4A 3U2QA 5KWEA 3A7EA 1H66A 4MRNA 3FPBA 3HI4A 1E69A 3TRKA 1XTPA 1UQTA 5HSGA 1QKJA 5IDWA 4ESVA 1YB7A 2FPOA 3T7EA 1IOWA 1G6Q1 3SEFA 5JD5A 1DDIA 4ARUA 4CFZA 1WBJB 3CMMA 3M33A 1EUCA 4OM8A 3CZ9A 4QPCA 1A98A 2QLTA 4FP9A 5EVCA 1JI3A 1Y63A 3QG1A 1TFRA 3DLBA 1K92A 1LJ8A 2OUKA 2QQGA 4L5BA 3C3PA 2NOAA 5I7FA 3AQ4A 1UP7A 3AFIA 3QF7A 2GM4A 4EDHA 3VPDA 1Q50A 2Y05A 2GETA 1Q2XA 3CTPA 4CHGA 2H08A 1SCIA 3O3CA 3GJTA 5L95A 4AN1A 2VQ6A 2FFBA 2A84A 3JVDA 4Q7JB 1TZBA 2P1DA 3DTVA 3EFOB 1FFCA 1SCJA 1E7QA 2JCVA 2VTDA 3CH7A 1PTKA 4P83A 1HPLA 4URHA 5ALZA 5JT1A 3A1TA 5ESWA 5C8YA 3WV4A 3R7DA 5LNK1 3G2KA 4HWOA 1MX5A 2QN6A 5D00A 5EKDA 2B8EA 1E6EA 1H93A 5JADA 1JDUA 3COYA 3RYFB 5ICGA 3T1OA 2DUJA 3D6FA 3LLVA 1NW4A 4MPJA 3BRWA 1QZXA 2ISSD 3PFHA 3QA3E 4Y7CA 1G6HA 3N8KA 1T2UA 3DTVD 4QBGB 2J6IA 5FTWA 4EGFA 3SFZA 4GVLA 2OFFA 3EXFB 5KEIA 4MAAA 4PU0A 2QRNA 2JVIA 2PKXA 1PQYA 4PR0A 1YZTA 1VRCA 2Q0HA 1E0DA 1CJSA 2IT1A 3Q87B 4N3AA 2BKEA 3L6EA 2BFBA 3GJ8A 3VNBA 4TPKA 2GX6A 4R6XA 1T4CA 1XT6A 2QMYA 3H3JA 4B7XA 4DMCA 4B6FA 2E87A 1WMSA 3HLYA 3JWGA 3L7BA 2JK0A 4X92A 1PZGA 1RMTA 5C4MA 5K0TA 1M72A 4UTNA 5GJWC 5KNBA 3I61A 2HJRA 4IYRA 3SMQA 3SYTA 1USKA 2YXNA 3N74A 3TQSA 5LU8A 3T1TA 5EE9A 1ZNQO 1E60A 3IEIA 1BJKA 5EJIA 3GFTA 3VKGA 4FBLA 1CNMA 2ZU6A 3MFQA 4X65B 4D5GA 2ANBA 2P3QA 3WNQA 2FFJA 2BBWA 2GCIA 1NG1A 1Y6RA 3GGOA 2FMFA 1GJRA 1XTKA 3AU9A 3OMXA 4HDQB 4NFHA 5KNBD 4BY9E 2Q5JA 3A9TA 4M6WB 3FSEA 3LF1A 4KX3A 1XK6A 2XD9A 4O1HA 1QP4A 1ZX1A 1VZ3A 1WHSB 4KGDA 2VS1A 3MRXA 2IU0A 1PG0A 3JQBC 1YS6A 2VYFA 4G24A 3UXEA 5JOQA 3ADCA 3G23A 3ZX5A 3PXBA 2Q3LA 2WJPA 1H1TA 1U6JA 2IXDA 3CTMA 2HBYA 2IEDA 2G0NA 2VHEA 3O74A 4RZ3A 4Y2TA 2RSLA 4C0LA 4DM7A 2AJDA 4E13A 2RH5A 2RJOA 2HUNA 4OPMA 3V4OA 3ZWBA 1VI5A 1RZ3A 2FJUA 2HMWA 3OCYA 4FKBA 4EL0A 2E4VA 4EEXA 1E9RA 4X6XA 5JS8A 4DCVA 1SU6A 4ZQHA 3R0IA 3B12A 3NM4A 1U2EA 4X3OA 3BSSA 3M82A 4MQEB 1MXHA 2JKYA 3D3EA 2PT9A 3IYLW 5LP6A 4EFNA 5JFOA 3UN1A 1HFEL 3C1OA 4GEGA 3P9ZA 5IFKA 2C7OA 3EWSA 1VHWA 5DK4A 2B4YA 1HC7A 4TYWA 4GOOD 2AZXA 4PGFA 3VPFA 3WK7A 4PYKA 3MQ4A 2JRLA 2VK2A 4CN8A 4KSCA 1T35A 1I4DD 3PFNA 2NN3C 3KZVA 4LC9A 4E3ZA 5JSQA 4LZOA 4I08A 3KX2A 3T7DA 3UV7A 5IXJA 1YZHA 2PUBA 3IC5A 4IPTA 3UQYS 5ITSA 3TEJA 5JS1A 2WZCA 1Q2UA 4BCDA 4MGEA 3K5HA 1T1GA 2CMGA 5AI9A 3OH8A 4NFSA 4YAWA 3A4TA 2ID8A 2IF2A 2X0RA 3PA6A 3DH0A 5CPBA 4P93A 3AVXA 3K8ZA 1ORIA 4WUTA 1UBUS 4B45A 1SZPA 4TV9B 4U2DA 4F4FA 2FSUA 2ILTA 2QAGA 1LK0A 3L8GA 3F7MA 3ZNOA 3W5IA 3ETGA 3NTUA 3UAGA 4JL5A 2XMSA 1KR5A 1U1CA 3KR2A 2O8BB 5JUWA 4G0MA 4EFMA 4RPIA 3KQLA 3HBJA 4GWLA 3U7HB 3MCVA 1N7IA 2BEWA 4DA0A 1UEXC 2ZSAA 1SZDA 3QE4A 4MYDA 2H1OA 1T2VA 3EUAA 3WYCA 1D09A 4WN3A 3ZWVA 4ZIRA 2WQZA 3EEIA 4ZYZA 2O0LA 5LXTB 4UM8B 1Y6FA 4Y6QA 1LY1A 3A3YA 1N7HA 1X9HA 3A3OA 4X1KB 4ZVMA 4CCYB 3ZZTA 2XTJA 2ZJ5A 4JIMA 4FN5A 3OT5A 5KU7A 5CTAA 2BBTA 3JQ8B 1I2MA 3Q7TA 3JQDA 1KOGA 1E6UA 1AN9A 3FETA 3GUCA 2YV5A 1D2MA 2FPRA 1EWYA 3OPXA 3I4CA 4D56A 2GQ0A 2VDLB 4ARIA 2BKVA 3HSSA 1G7TA 3FMGA 3UQZA 1VE3A 3ZK7A 2F3QA 3E1SA 4HAXA 4UHHA 3SMVA 1V11A 2FPGA 4H7KA 3SR3A 3WQBA 2DUUA 4QEKA 4W5JA 1QVWA 2AMLA 3MWFA 2H48A 2WUDA 2GJKA 4NH4A 5E3JA 4GXQA 4X71A 4YJ2F 1M2VB 2GLTA 2VDUE 5AW9A 1IYZA 2LDBA 2OKGA 3OP4A 2H4HA 3D81A 2CNLA 3KE8A 1HTWA 1L6IA 1OIWA 4MWEA 4OQZA 5LMZA 3I5YA 5HYVA 3E35A 1I9CA 1PFUA 1QYWA 2G82A 1O6GA 3G6WA 1H4SA 4BJ3A 5DVZA 5LLSA 3EE6A 1WB9A 5CM2Z 1R74A 4KGXA 3HB4X 1N2OA 1WCIB 4GX5A 1T6NA 2PLNA 3ASYA 3IO3A 4TUYB 4HZUB 2WYWA 5DBOA 5G41A 4K26A 4XLZA 1V8OA 4BVBA 1R12A 1D8TA 3DOUA 1A9OA 3STUA 4RK0