4PR7A

Kdgm porin in complex with disordered oligogalacturonate
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
171
Chain Sequence
b'VSIDYRHEMQDGHKDRLLISHRFANGFGLSSEVKWAQSVSNGTEVVASYVYKFNSVFSIEPGFSLESGSSNNNYRPYLRGRANVTDDLSVALRYRPYFKRKGYTLTGNIDYTFLKDYTIGYELEYKKGTSYDITHNVKLSYKWDKNWKPYVEVGNVSRQTRYRVGVQYSFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oligogalacturonate-specific porin KdgM
publication title Structure of the oligogalacturonate-specific KdgM porin.
pubmed doi rcsb
source organism Dickeya dadantii
molecule tags Outer membrane protein
total genus 45
structure length 171
sequence length 217
ec nomenclature
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 4pr7A00
2WVPA 2X9KA 2WJQA 2IWWA 4CTDA 2F1CX 4FQEA 2JQYA 2WJRA 2IWVA 4PR7A
chains in the Genus database with same CATH superfamily
2O4VA 1BT9A 2WVPA 2X9KA 3AA0A 3O0EA 3T20A 3LK42 2X27X 2K4TA 5B5EO 3JTYA 4KR8A 1BXWA 4G76A 1S5LO 4Z3TA 2LFUA 2N2MA 2KDYA 3PF1A 4LSFA 3UU2A 4GCSA 3BRYA 1T1LA 4AYEC 4RL9A 4PJ0O 2YNKA 4CTDA 5AFUL 2KZ7A 4FESA 3HW9A 1Q9FA 4LSIA 3UAQA 2J4UP 5DL8A 3LK2B 4JFBA 3DWNA 2M07A 1ZHXA 3TZGA 4G75A 2YPVA 1PRNA 3K19A 4FT6A 4AZLA 2R4LA 1GFOA 4GF4A 3BS0A 4O3YA 4C4VB 4QQ1A 2KXPB 4FZNA 2XTRA 1PHOA 1MM5A 3VZTX 1T16A 3NJTA 3HWBA 2R89A 3QRCA 4PUXA 3AA1B 1QJPA 2IWWA 3T24A 5H2FO 1GFMA 2J1NA 2WJRA 1MPFA 2GE4A 4IL6O 2PORA 4AKRA 5D5DA 1QJ9A 4FZMA 2XE5A 3PGRA 5FVNA 5AFUK 2JQYA 3LK3B 4AKMA 4D64A 4D5UA 2F1TA 2ERVA 1ZHZA 3AAAB 3PORA 3SYBA 4F4BA 2XG6A 4FOZA 5DL7A 4FSPA 3A2SX 1ORMA 4AYDC 3SYSA 2KC0A 5GTIO 3AA6B 4FRTA 2ZFGA 4E1SA 4RJWA 5KAIO 3EMNX 3DZMA 5TISO 4AYNA 1IZNA 1THQA 3DA4A 3LK2A 4FZLA 4U9CA 5G3AA 3T0SA 3VE1A 1MM4A 5KAFO 3VE2A 3QRAA 1GFNA 2QTKA 2Y0LA 2Y2XA 4UB8O 5JDPA 1H6S1 4UB6O 4RLBA 5IYUA 2XTQA 2FGQX 3A0BO 5GTHO 4FMSA 3UPGA 4GCPA 3JCUO 3AA0B 5DL6A 3AAEB 4FSOA 2R4NA 4K3BA 4O4UA 5E79O 4RJXA 3PQUA 3RBHA 1HXTA 3HOLA 2F1VA 2AXTO 3FYXA 4BUMX 5GV0A 3GP6A 3LK3A 4O3ZA 2MNHA 1ZHTA 3AAAA 1OPFA 1YS5A 2Y0KA 3NSGA 2MHLA 3KZIO 2R88A 5ADXL 2K0LA 3HOEA 3WI4A 2XE1A 1Q9GA 3AA6A 3POXA 3SY9A 1HXXA 2FGRA 4O49A 2W80C 4KR4A 4XNLA 3AA7B 3WU2O 5B66O 2Y0HA 2LHFA 4GHBA 3KVDD 4GCQA 4C69X 2IWVA 3DA3A 5EE2A 3V8UA 7PRNA 4N74A 4AYMC 3LK41 4C00A 4FRXA 4C4VA 2KXPA 4JCHA 2XMXA 5DL5A 1ZHWA 4O3WA 5PRNA 3AA1A 1P4TA 2XE3A 5G38A 4B61A 2ODJA 3PGSA 3AAEA 2R4OA 2WJQA 3SZVA 4AUIA 1E54A 1QJ8A 5ADXK 3C5OA 4N59A 5G26A 2ZLDA 3SZDA 3VY9X 2PRNA 3SY7A 2KZ7B 4AFKA 3A0HO 3DWOX 1BH3A 2N2LA 2R8AA 3BRZA 3POUA 4FUVA 1IZNB 4LSEA 4N75A 4E1TA 1G90A 4RLCA 2R4PA 3PGUA 4LSHA 4AYID 3VY8X 2W81C 4PR7A 3WI5A 5G39A 3VZWX 3G7GA 1ZHYA 2Y7SA 4FQEA 4KRAA 1OSMA 3AA7A 3POQA 3PQSA 1HXUA 4N58A 3VZUX 1GFQA 3PRNA 4O3XB 2JMMA 2M06A 5T5FA 2XE2A 1GFPA 2F1CX 4D65A 4O4XA 6PRNA 4AKRB 2OMFA 8PRNA 4K3CA 4XNKA
chains in the Genus database with same CATH topology
2WVPA 2X9KA 2WJQA 2IWWA 4CTDA 2F1CX 4FQEA 2JQYA 2WJRA 2IWVA 4PR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVP A;  2X9K A;  2WJQ A;  2IWW A;  4CTD A;  2F1C X;  4FQE A;  2JQY A;  2WJR A;  2IWV A;  4PR7 A; 
#chains in the Genus database with same CATH topology
 2O4V A;  1BT9 A;  2WVP A;  2X9K A;  3AA0 A;  3O0E A;  3T20 A;  3LK4 2;  2X27 X;  2K4T A;  5B5E O;  3JTY A;  4KR8 A;  1BXW A;  4G76 A;  1S5L O;  4Z3T A;  2LFU A;  2N2M A;  2KDY A;  3PF1 A;  4LSF A;  3UU2 A;  4GCS A;  3BRY A;  1T1L A;  4AYE C;  4RL9 A;  4PJ0 O;  2YNK A;  4CTD A;  5AFU L;  2KZ7 A;  4FES A;  3HW9 A;  1Q9F A;  4LSI A;  3UAQ A;  2J4U P;  5DL8 A;  3LK2 B;  4JFB A;  3DWN A;  2M07 A;  1ZHX A;  3TZG A;  4G75 A;  2YPV A;  1PRN A;  3K19 A;  4FT6 A;  4AZL A;  2R4L A;  1GFO A;  4GF4 A;  3BS0 A;  4O3Y A;  4C4V B;  4QQ1 A;  2KXP B;  4FZN A;  2XTR A;  1PHO A;  1MM5 A;  3VZT X;  1T16 A;  3NJT A;  3HWB A;  2R89 A;  3QRC A;  4PUX A;  3AA1 B;  1QJP A;  2IWW A;  3T24 A;  5H2F O;  1GFM A;  2J1N A;  2WJR A;  1MPF A;  2GE4 A;  4IL6 O;  2POR A;  4AKR A;  5D5D A;  1QJ9 A;  4FZM A;  2XE5 A;  3PGR A;  5FVN A;  5AFU K;  2JQY A;  3LK3 B;  4AKM A;  4D64 A;  4D5U A;  2F1T A;  2ERV A;  1ZHZ A;  3AAA B;  3POR A;  3SYB A;  4F4B A;  2XG6 A;  4FOZ A;  5DL7 A;  4FSP A;  3A2S X;  1ORM A;  4AYD C;  3SYS A;  2KC0 A;  5GTI O;  3AA6 B;  4FRT A;  2ZFG A;  4E1S A;  4RJW A;  5KAI O;  3EMN X;  3DZM A;  5TIS O;  4AYN A;  1IZN A;  1THQ A;  3DA4 A;  3LK2 A;  4FZL A;  4U9C A;  5G3A A;  3T0S A;  3VE1 A;  1MM4 A;  5KAF O;  3VE2 A;  3QRA A;  1GFN A;  2QTK A;  2Y0L A;  2Y2X A;  4UB8 O;  5JDP A;  1H6S 1;  4UB6 O;  4RLB A;  5IYU A;  2XTQ A;  2FGQ X;  3A0B O;  5GTH O;  4FMS A;  3UPG A;  4GCP A;  3JCU O;  3AA0 B;  5DL6 A;  3AAE B;  4FSO A;  2R4N A;  4K3B A;  4O4U A;  5E79 O;  4RJX A;  3PQU A;  3RBH A;  1HXT A;  3HOL A;  2F1V A;  2AXT O;  3FYX A;  4BUM X;  5GV0 A;  3GP6 A;  3LK3 A;  4O3Z A;  2MNH A;  1ZHT A;  3AAA A;  1OPF A;  1YS5 A;  2Y0K A;  3NSG A;  2MHL A;  3KZI O;  2R88 A;  5ADX L;  2K0L A;  3HOE A;  3WI4 A;  2XE1 A;  1Q9G A;  3AA6 A;  3POX A;  3SY9 A;  1HXX A;  2FGR A;  4O49 A;  2W80 C;  4KR4 A;  4XNL A;  3AA7 B;  3WU2 O;  5B66 O;  2Y0H A;  2LHF A;  4GHB A;  3KVD D;  4GCQ A;  4C69 X;  2IWV A;  3DA3 A;  5EE2 A;  3V8U A;  7PRN A;  4N74 A;  4AYM C;  3LK4 1;  4C00 A;  4FRX A;  4C4V A;  2KXP A;  4JCH A;  2XMX A;  5DL5 A;  1ZHW A;  4O3W A;  5PRN A;  3AA1 A;  1P4T A;  2XE3 A;  5G38 A;  4B61 A;  2ODJ A;  3PGS A;  3AAE A;  2R4O A;  2WJQ A;  3SZV A;  4AUI A;  1E54 A;  1QJ8 A;  5ADX K;  3C5O A;  4N59 A;  5G26 A;  2ZLD A;  3SZD A;  3VY9 X;  2PRN A;  3SY7 A;  2KZ7 B;  4AFK A;  3A0H O;  3DWO X;  1BH3 A;  2N2L A;  2R8A A;  3BRZ A;  3POU A;  4FUV A;  1IZN B;  4LSE A;  4N75 A;  4E1T A;  1G90 A;  4RLC A;  2R4P A;  3PGU A;  4LSH A;  4AYI D;  3VY8 X;  2W81 C;  4PR7 A;  3WI5 A;  5G39 A;  3VZW X;  3G7G A;  1ZHY A;  2Y7S A;  4FQE A;  4KRA A;  1OSM A;  3AA7 A;  3POQ A;  3PQS A;  1HXU A;  4N58 A;  3VZU X;  1GFQ A;  3PRN A;  4O3X B;  2JMM A;  2M06 A;  5T5F A;  2XE2 A;  1GFP A;  2F1C X;  4D65 A;  4O4X A;  6PRN A;  4AKR B;  2OMF A;  8PRN A;  4K3C A;  4XNK A; 
#chains in the Genus database with same CATH homology
 2WVP A;  2X9K A;  2WJQ A;  2IWW A;  4CTD A;  2F1C X;  4FQE A;  2JQY A;  2WJR A;  2IWV A;  4PR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...