4PRID

Crystal structure of tk3 tcr-hla-b*35:08-hpvg complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
202
structure length
202
Chain Sequence
EDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQDLGTSGSRLTFGEGTQLTVNPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title A Molecular Basis for the Interplay between T Cells, Viral Mutants, and Human Leukocyte Antigen Micropolymorphism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4priD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4priD02
4B5EA 1ZKAA 3CFBA 1U2HA 3UEZA 1OAYL 1CICC 5MENA 4NOFA 1AGCA 1WT5C 3U30C 4CADB 2B5IB 4R96A 1VEOA 3GI9H 5ACZA 1I3UA 2DWEA 3FN0L 5D1XD 5J13B 5HTSA 3TFKD 5DQDH 4ZUWA 2GT9A 4KJQC 1QTYT 4KRMB 4U0QB 2ARJB 4NKOB 1MJ7L 2IPUG 4U7MA 3MNVA 4ZFOB 2NW3A 3OBAA 4FFYH 4A6YB 2A6DB 2J3SA 4I0KA 2KPNA 1CD8A 2MTPA 4TVPH 4G8GB 2YRLA 1NLBL 4PJHF 1YC8A 4MXVF 3ZDZE 2RCSH 4D9LH 4PJDF 3IJYB 2CIIA 5HHOD 1EJ6A 3HNVH 4M48L 4DN3L 5KW9L 4XCCL 2WWMD 2ZUUA 4UT9H 3V0VB 1S5HA 1CD9B 4OIIL 3E6HA 5KANG 4Y2DD 2Y72A 5HVFB 1FZOB 1RIUH 2F54A 4XPHL 1GJIA 2R0KH 5ID1B 5LQBL 1U8OB 1I1YB 3VA6A 2Q7YA 5B21A 4WI3A 2NLJB 3WIFB 1D5MB 1KCSH 1MI5B 3VXMA 3KPPA 4FTVA 4OLUH 1X5XA 1WITA 2NY3B 3FCTB 3BISA 1UA6L 4LF3B 3SE8L 3O0RL 4JZNB 2A74B 4GS7B 2YD6A 3MLUH 3O3DA 3GIZH 2G9HB 1IL1A 4OGYH 1NFDE 1QKZL 3DGCR 4HH9B 5KSBB 2YBRA 3QO0B 3LY6A 2X4QB 5T1DH 1BP3B 3HPJA 1A6AA 1V7MH 5GGSB 3LKRB 1GL4B 4B7LA 4RGOH 4WI2A 5BS0E 4XVUC 1QLFA 3LH2L 4NHCL 3VFWA 2P48B 4KH2A 2AGJH 2H3NB 4QHUB 3CXDL 2B1AH 4XMLL 1QYGH 1GC1C 1R0AL 4NQEA 3MNZB 5FYKU 3SQBA 3KS0H 3TPUA 43C9A 4EBQH 3VFGH 4LVOC 4IIQB 1OAZH 1MPAH 4QRPA 4P4KD 1CF8L 5C0AA 5CD3A 1FAIH 4HSQA 3CSGA 5E08H 1I85C 1NMBH 5JMOC 2XTJB 4RQQB 9CGTA 3ET9F 2ZG3A 1U91B 2F58H 3FOMA 5F7NC 4R0LC 3QDMB 1N26A 4JREB 5E5MB 5AD0A 1MIEH 3E3QE 3HB3C 3RWIA 3O3BA 3QXVA 3Q1SH 3QEQE 4PRNA 1II4E 5EORH 4JFEB 4NOBA 3D9AH 4EN3D 1JTOA 2PR4L 3WXWL 4U6YA 4MWFA 3NFSH 1VSCA 4GKZB 3V6ZA 3VRIB 4NP4L 4HX1B 1W72L 4KAQL 1FO0B 1ETZA 1F4AA 4KK9C 5CJXC 3QIBD 2P8MB 4WW2A 2AV1B 2GI7A 3CJJA 3STZA 5F7DA 5I16B 2D9CA 2AK4B 4JCLA 3GMPB 5J4MA 2C3HA 3MBEA 4L4VB 1AFVL 3NFPA 1HOCB 4UT7H 3QZWB 4KXZI 5FCUL 5KANI 4DKFL 3DYOA 2WZPD 4WEUD 1MJUL 3GSOA 1G7PA 1MEXL 4LSRL 2DYPA 2XN9D 4HUMB 4PGDA 3OJDB 2UZIL 1A7OH 3TNMB 3MRKA 1IAIL 3RGVC 3ZZ1A 2OR9H 5CBAB 2KQMA 2BVOB 3QH3B 2NY1C 3X11A 1HILA 1XF4B 1KF9B 2GTZA 4YXKH 2W60A 3HMXH 2LAGB 3MRIA 2CR3A 1XGUB 2G5BB 3AXLB 1NAKH 5E8NB 4PP1C 5I2IB 4AQ1B 1S7WA 4M8QA 4OV6F 3SKUD 3HA0A 4S1RH 3SOBL 5B38G 3L9RA 4PBXA 2HH0H 4PGCB 5AZEH 5I8CA 2HKFH 4HUXB 4MQXC 3S5LB 2XZAL 3VRLF 3VMOA 5JW3L 5CZKA 4HIIA 1RZKH 3ZO0A 1DQDH 2C1OB 2VIRB 1Q72L 5FGBA 2W0FB 3HMXA 1CFQB 3VA2C 1FIEA 5DD0L 4GRWH 1CGYA 1L7TH 3P11L 1K6QH 3ECBA 4J8RA 4K3GA 4D3CL 3QA3B 3G5XA 4JVPA 3A6BL 4LLVA 1Q94A 1QNZH 1AY1H 3LKOB 3PWJB 1KLGB 5FYKD 4N8VG 3QDJD 1ZOXA 5T1MA 4FQXB 3O45B 5FAAA 3ZKMD 4X98B 3W5MA 4G6KH 4GKSB 4N0UA 4YHML 2E27H 3GHBL 1EERB 3O6FD 4XNYH 3RVTD 5FOJA 4UOW1 2F8XC 1IAOA 2JB5H 4PG2A 4YHPA 2VJXA 3PWPE 1EMTH 2G60L 5F7EH 5EC1A 3T09A 3WV0A 4M1CC 3EOTH 2LE9A 3CX5K 4JGUA 4ODXA 1N2RA 4HKZB 2XZQL 2IANA 4X5XB 5GRVL 5L88L 3VWJA 1W0WA 1IM9A 1FNEB 4PRHD 4Q6IA 1N5YH 1H15A 4Q2ZA 4QCIB 2EE9A 2VITA 4F7MB 5D7IE 5CZVL 2PTTB 1NC4D 1SYSB 3ES6A 1KT2B 1CFNA 2ENSA 4PJBB 1S9WB 4U6XB 2AK1L 5ANMA 5HHQA 2K9UA 5J6GA 5D7LE 4HLZH 4Y19B 4WFGE 4W6XB 4YXHL 1UM5H 3G9AB 3I3DA 4ZO7A 5T5NG 1E4XL 2BNRB 5EBLA 4W4OA 5KVGL 4XNMB 3MQIA 3DJ9A 3L5XL 2R56H 2FBJL 3DVNA 3G5YA 3HC4H 3LRSB 2ZZUT 1AR1C 3MZTA 1CU4H 3NN8A 1Z9LA 4L8SC 1SM3H 5DJ8B 2C4XA 5KAQF 1AXIB 4HXAH 3RBSA 3RTQA 1FNHA 3RGVB 4HW6A 1LGVA 1DN0A 1N3NA 1QFHA 1A21A 3VJ6A 1FBIH 4NC0B 2NY1B 4WI7A 3V8OA 3DSFL 3FOLA 4YHYC 3HI1B 5BO1L 3O41B 4ORGB 4D94A 4S1DD 5E8PB 1JNJA 3RY6C 5CCKL 5GRJL 2ZSVB 5C6PB 1VEPA 4MCYB 1FZKB 5SWSD 2O5ZL 1FVCA 1KCVH 3WJLC 5KG9A 3FZUC 4K94L 5IESL 4NRZB 3CDCA 1IILE 2IQAA 1QSEE 1XIWD 3HNTL 5SX5H 4LBEB 5ESQB 1UWXK 3B9EA 4WEMB 1I4FB 5T3ZE 4KDWA 2ADGA 5A43C 1MF2H 4PJCE 1EA9C 5DR5L 1BVKA 1U3YA 1N5AB 5I9QC 2A6JB 2ORBL 1LP9A 4P2RB 3IXTA 3AMKA 4NCC2 1FG9C 3MXWL 1JWMB 5CEZH 8CGTA 3D39B 2VDKH 2F74B 1FGVH 2EYRA 5B8CA 5IQ9A 1HEZA 4PJ5D 5BRZB 1MCCA 1H5BC 2VDQL 1BOGB 1INQB 1JJUA 5GS0L 2YPKA 1GOHA 1I8KA 4WWKD 2FH8A 1WJ3A 1TVBB 4WI6A 1UWEL 1NGQH 4LSTH 1C5BL 2AJXH 5GGRY 2Q8AH 3AREC 5EOTB 3VGDA 3QUYC 3QXDA 5DYOA 4OM1L 4DGIH 1YQVH 4OFDA 4HWEL 3OB0K 4XRCA 1YMMA 4KC3B 1N6QH 1QR1B 3PJSB 4RWYH 2ZKHH 4M4RA 5D2NE 4JRXA 2PW1A 3TV3H 1J0YA 3GMQA 3VI3F 3LZFL 4PJ7F 2FX7H 1OVZA 2FECL 3HN3A 4P5KA 2OQJB 2GY7B 3VD4A 4ELME 3OKLA 5A3ID 1WQVT 4YHZL 3C9NB 1JGVH 2Z31D 5E94A 5TH2A 1KJ3H 2LVEA 2YWZA 3FB5A 3SGJA 1QOKA 3DX7A 2BVEA 1RULL 1KBGL 3L3KA 1FGNH 3BFOA 4EUPH 3S34L 2GITB 1T2XA 2P5EA 4NHUB 1LEIB 2YA1A 4I5BB 4PD4K 3H9SA 4KXZH 4R4BA 3MACH 1BIIA 3EO9H 3GI9L 4HGMA 4HUVB 4L8SB 3EOAB 2UUDK 2IPTH 3KGRA 5DQDL 3EYUL 1P2CA 4FQ2H 3TIEA 2X9WA 4PRPB 2VYRE 1HQRA 2ZUQC 4X7FC 5DHXB 4F33B 3MR9A 5F71A 1XCQA 5CJ5A 4YHYB 4KK6C 4EUPA 5C08D 1MRFH 3AAZA 4KI5C 5IJVA 1YEHH 3DMMD 1KULA 5INCB 1YNKH 4D9LL 3V4VL 3MRLA 1ACZA 4HS6B 1FG2B 4JPWH 1DUYA 5CIPB 2VDLH 1CN4A 1MFBL 1XR8A 3U7WH 4AH2B 4TVSa 3S36X 3ARFA 3QZWG 2I25N 4JFPB 4ZAKA 2BERA 4OCWH 5I1KL 4RAVB 3IETB 1ZLUH 4G7VL 5EU3A 5F97E 2FX9H 4JJ5B 4YBHA 1I7UA 4KFZC 5AUMA 1KCSL 3BRDA 4LLUB 4OLUL 1U8KB 5A1AA 5EZJB 3VGHA 5F9AC 1AXSB 1MFDL 1O0VA 3WJJA 5CJQH 2AEPL 1UZ6F 2FNBA 2LABA 3EIFA 2NXYB 4WUKH 1V3JA 1VFAB 2QADC 3SKJH 4LSUL 4PV8A 3GIZL 4C4KO 1MRCH 1XH3A 1H5BB 5F7YC 5HBBA 3CFEA 2HT3D 3BYYA 3LVEA 5IM7A 1V7ML 2ZWLT 1I9JH 3S5LG 1NBZA 4RGOL 5J06A 1OLZA 3T4AA 4NZRH 4XPFL 4QOKE 1BIHA 5CEXA 4UNVA 2Y7QB 4O02H 5DD6B 5IB4A 3AREB 3FO0H 2AGJL 3QUYB 2B1AL 2DI8A 3L95B 1QYGL 4MJ6B 3TPKA 4EBQL 3VFGL 3MGOB 5DGRA 4LPUA 3T1FA 1OGAE 2P5WE 5DA0B 4KKBC 1MPAL 1C5DB 1ZS8B 3KAAA 5EH1A 1JPFA 3EKCA 5LAXB 1GGCH 1KNOB 3KYNA 4K7PH 5E08L 1NMBL 4K3HA 4X6DB 3RNQB 2YD9A 4PJ7A 4JY4A 5GZOD 1KPVB 2OL3B 4OI7A 3VXRA 4R26H 3SDAB 3NGBC 3LN4B 2ZOKB 4ZTOH 3CFKA 1J1XH 3DI2B 1RJLA 3Q1SL 4X5WB 4PJGF 1QA9B 3O11A 5EORL 4BK5A 2NCMA 2BVQB 3L3GA 3MV9A 1QR4A 4OD2B 3OKDB 5D1QA 5J56B 3X3FH 1JFQH 4D0BA 4A2LA 2HJLB 2GJ6E 1HYSC 3NFSL 3LQZA 4GW1B 3MRHA 5JXEA 1UENA 2VLKB 3C5ZC 1C1EH 5TE4H 1SQ2N 3P9LA 2H2PC 2ATPB 3MUGA 3DYMA 4BK4A 5ISZB 4ODUA 1AHWC 3TBTA 2DRUA 4OFYD 3BQUD 3QDGE 4Y4FA 4YPGA 5ICXB 3GO1H 2D4FA 2KDGA 2EIZB 4YHKH 5TQ0H 1TQBC 4KK8D 2DQEL 4U1IB 4LSVL 5EUKA 2DOCA 3ARWA 1LMKA 5DQJB 1BBDL 1OAKL 5F7MC 4WUUA 4ZS6D 1ZT7A 4P3WA 1GHFH 5HI4D 2D31B 5IMOB 5HVWA 4E41D 2FD6H 5JNYA 1S9XB 1IQDB 3QUKB 4KQ3H 2ED7A 3CDGB 4H88L 2IGFH 4POYA 3V7MA 4OCRL 4MQSB 2PO6D 2DLFH 4S1RL 1LNUA 1KOAA 2CRZA 5E7BA 1MCSA 2R1YB 3JTTB 3HZYA 1XGYL 2HH0L 3BZ4A 3PWUB 3JUZA 1LO0H 3JWNC 2HKFL 4V2BA 1TDQA 4FOMA 4LLMB 1RZJH 3P77B 5C0ND 1A2YB 4XT1C 3BJ91 2NZIA 3RBGA 1OY3B 1CLOL 1YEGH 1F13A 3K2UH 2DKSA 3SJVE 1U8QB 4PLJD 3OXRB 4QEGA 1IGJB 1BZ9A 4QY8A 4XI5D 4CGTA 5C09D 2C3XA 1U3ZA 2CKBH 5L7XH 2QADB 1L7TL 3MGTA 1K6QL 4BYHA 4ZUTA 3REVB 3N0PB 3BIKA 1YEKH 1CL7I 3HFMH 2XWJB 4NBZB 4OZHE 1S3KL 3R4DA 3VXSE 2I07A 4D8PB 4N8VA 5BVPH 5K9KA 1QNZL 4KJPD 4NFBA 2IMNA 3CPLA 5GIRB 8FABB 1AY1L 4YWGL 3F7PC 5H2BB 5IF0A 3I6LD 3LEXB 4OF8A 1U36A 3MROA 4F57H 5D5MF 2ESVE 1FZMA 4OCYH 5GJTL 4NGHH 5SWSA 3ARGC 1F4XH 3QJFB 3RAJH 3EYVA 3HZKA 2B8OT 2V7HB 4ZDHB 3X12B 4HZLA 1SJHA 2CKBA 4GBXB 1NH6A 2YPLB 2E27L 5B4MD 4FQCL 4RDQG 4XNYL 2VLRB 2VQTA 5T1LB 4ONGL 1XIWA 1M4KA 2JB5L 4Z7WA 3RZCA 5I1EH 2RQ8A 1FLRL 5F7EL 4KRLB 2X4NA 3EOTL 4OJFL 6CGTA 1SJEB 5C0DA 2GIYA 4JJHA 1WFTA 2W91A 1N5YL 4JRYB 4LQ1A 1UGNA 3PHOB 1UWXH 5EO9B 4LARL 4P5TA 5IVXF 3I50H 3IYLW 4PGBB 1NSNH 1N6VA 2NTFA 2IH1B 3VMNA 2ID5A 1N64L 1DVFD 1PY9A 4Z7VB 1LEKA 2CK0L 3DVIA 5DJAB 1JHLH 4N0FB 3FAWA 4HZAA 4S2SB 3RVWD 5CJBA 1WFUA 3VFNB 5K93A 3C5ZB 1AKJB 2ATKB 5D71H 1S7XA 3UTQA 1UB6B 2Y25A 2BXYA 1G6VK 1F97A 1LDSA 1AHWB 1JPSH 4U1SA 2OBGA 4M3KB 4G8EB 4LLDA 5JOFA 4MDJA 1C08B 3SY0A 2R56L 3SBWA 2K3TA 1TQBB 3HC4L 1QSFA 4Z0BH 2JCCA 3D48R 5KSUA 1CU4L 2M2DA 3OB0H 1SM3L 3P0VL 3HE7D 4MB5A 1RK0B 2AABH 1A47A 2EXWD 3W81A 4A6YH 3UO1H 3WLWC 5AWNL 3V5HB 5LGKA 5CBEA 4WTWA 3S35H 3QIUC 2YMXL 4M7ZC 1AXTH 3LS5H 5CD5C 3RWFA 1FL3A 4HK3J 1U95B 4O9HH 4I0CC 1NANI 3LPFA 3O6MH 5BOZG 4FZEH 5D7KE 1KCVL 3TCXA 3T3MF 4HFUH 5SWQA 2O61B 4X6CF 4ZFOA 5C0CD 1F8TH 4A6YA 3ZKSD 2A6DA 2FIKB 3WS3A 3C8DA 3MRPB 1HSAB 4L4TA 5MEQA 1BM3L 1U0QA 1P6FA 2R29H 3TIDB 4HF5L 4Z7QE 5HJ3A 3IJYA 1BQUA 1MF2L 4PPTA 4IHOA 4YC2B 1FYTB 2OYPA 3WDJA 3V0VA 1PGRB 4ENEC 1FZOA 1SY6H 3C5SB 4L9LC 3FFCD 2UUDH 4M1GH 5GGVY 5ID1A 5CEZL 3K7UA 3SDCB 2HAZA 2VDKL 1I1YA 4ODHL 1FGVL 3I75B 1BOYA 5E2VH 4I4WB 1A6ZA 4S1SL 3WIFA 1MI5A 5D5MA 5KJRH 2EH7H 3O4LA 5DJYB 5IBTH 3ARGB 3FCTA 5IEHB 4LF3A 1F11B 1VERA 3ZDXF 1NGQL 4W81A 2GSIA 4J3TA 2A74A 4LSTL 5FYLE 1B6DA 3BXNB 3OGCB 5KN5B 3WHE1 2AJXL 3BD3A 2VXTL 2KBGA 1HINH 1WIOA 4KTDL 2G9HA 1FNGB 2PTUA 3BESR 1YQVL 1WWBX 4NKMB 1SY6A 3QO0A 5EU4B 4M3JA 3UBXI 5BOPA 2MKLC 1QRNB 2X4QA 5JA9A 1G0DA 5HYJD 4UAOC 4KHTL 4RWYL 1OD9A 1BD2D 2C26A 5GGSA 5HHNA 3LKRA 1TCMA 1EBPA 3R1GL 3UTTA 3TV3L 1ZVYA 4X9HA 5EN2B 3GMOB 1CFVH 3FQUB 4Y4HC 3VFMA 2FX7L 1PVHA 5K9QG 4QHUA 4GG6E 3PDOA 1DBBL 3MNZA 2JLLA 4R4ND 1JGUL 5LVEA 4IIQA 4KVCL 4K8RC 1JGVL 4Y5XB 3FO1B 3RWCB 4XP4H 1JWSB 2F53B 1FO0H 3EYOA 5M7QA 3WD5H 4I0PD 4HKBB 2VL5A 1S7UB 5JMRA 2FHBA 4RQQA 4GRLC 2VDNL 4MAYC 4Y4KD 1KYOK 5ELIA 1U91A 3ZMRA 1FGNL 3SDXE 1VFOA 2J8HA 3QDMA 3X3GH 3BUYB 3OG4B 4QRSA 2Y6SD 3QXWA 4K3JH 4PRDA 3RIFK 4G6AC 3MACL 5EZIH 3EO9L 2BNQE 4P99A 1FFNA 3KPSD 2IPTL 4XHQA 4GKZA 5GRXG 3VRIA 1UQSA 4HX1A 1OP3K 2E7MA 1FO0A 4ZFZA 1F58H 2P8MA 3QIUB 3IFLL 2AV1A 1AGBB 5I16A 4JZJA 4TUJA 4M7ZB 2AK4A 1XF2B 5FA3A 5KVFL 1JUFB 4GG8B 4LU5H 4XCNA 1MRFL 4UIKL 5FHAH 1XGRA 2E7BA 3B5GA 5TQ2H 3RWEB 4XB8A 1HOCA 4J4PC 3QZWA 2CMRL 1MCKA 1J8HE 4H26B 3PV7A 5FUCC 1RZGB 3MRDB 4QHLB 2XV6B 2VDLL 1I3GL 3ILPB 4OLYH 2H2SD 4Y1AD 5CINL 3U7WL 3BDYH 4LCWE 1OW0C 2CXGA 4X6CA 3NAAH 4ZFGH 2O5XH 4OCWL 5SV4A 3UPCA 3RJDA 2FX9L 3GSNB 5HHXH 4PJIF 3D25B 3WDHA 1J0ZA 3P0YH 2AJ3A 2XWBA 4I18C 4HJ0D 4OB5H 1AGDB 5BMFH 1GIGH 2G5BA 1HH6B 3AXLA 4K2UL 5E8NA 1NLDL 1RUQL 5I2IA 1CL7H 3TJHD 5CJQL 4LHUB 2MFNA 4QHNB 1MJJB 4L9LB 4X4ZA 4NNPH 5FOBB 2IFFL 4LVEA 3KXFE 1Q9WA 1GZQA 5JIIA 1F90L 4HUXA 1MRCL 3S5LA 3G08A 2JJWA 3ZKXC 1K4DB 1CDCA 3QUZD 3SO5A 5KBNC 1NGWA 4YZFF 1DR9A 4KRPC 2C1OA 1HYRC 2VSCA 4NZRL 1CFQA 5J9PB 5IIEB 4O02L 4HUWB 5KVDL 4JFQB 3EDFA 1KV3A 3FO0L 3WFCL 3VG9C 4CMHC 4DKDC 3QA3A 3MRMA 5DRWB 4P2QE 3EYSL 4UAOB 2Z9TA 3BAEH 4MSWA 3O2VH 5D1ZB 3STLB 3V6FA 4D9RE 3REWB 4P5MA 1A9EA 4PG9B 3OGOE 3PWJA 4K7PL 1KLGA 3V0AC 3W39A 3FRPG 4FXGB 2BHUA 4FQXA 3QUXC 3O45A 5GHWH 2XA8H 3UJJH 4OAWB 4M93C 4UQ2B 4GKSA 1F3JA 2X4SA 4R26L 1TTUA 1QQDA 1S9YB 4JHBA 2EE2A 1YYLL 5ESAB 4NC1C 1S9VB 2PYED 4KZDL 4QF1B 3V5KB 2ICWI 5CWSB 1RIHH 1JFQL 3ROOB 3BP5A 4X5XA 3KPNB 4MAYB 3ABZA 3C6LD 2WM0A 3V7AE 1JPTL 4NQXB 4YEFA 1C1EL 5TE4L 2FCBA 2NX5D 2VDPH 4UI2A 3S3SA 1QFOA 1XGTA 1O7VA 2RIKA 3FMGH 2PTTA 1HNGA 1KT2A 3GO1L 2HJKB 1I8MA 3ILQD 4TRPH 5ETUB 4YHLH 3LQAC 4XX1G 2GAZA 4PJBA 4OBRA 1BPVA 3IS0X 4YHKL 3RA7H 1UB5A 3FONA 1VKXB 1JYXA 3NIFF 3RP1A 4NQDE 5DURB 3IS1X 4R7DB 1GOFA 3CK0H 4X7TB 3ULVL 4MA7H 1OGTB 4JM2D 1UH3A 5IB2A 1EAPB 2FD6L 2V5RA 3JWDL 3QNXA 2BNRA 4LRNH 3DGGA 4KQ3L 1I1AC 4PJFE 3RVVD 1NANH 3HG1D 1I7TB 2Z8WC 4MNGB 4K7PY 1HSBB 1DVFA 4NM4H 1YPZF 3LRSA 4W68A 2GTWB 1AGEA 5DJ8A 1CG9B 5GSRB 2DLFL 1RZIA 3H42H 4MXVE 5DMGC 3ARSA 3AROA 4PJDE 3U6RB 3P2TA 3W0WD 2J8OA 1RJYB 4QXGL 1RZJL 4AY0A 4EJ1C 4XCYB 4UDTA 4I18B 3HI1A 3O41A 1I9RH 3ZHLA 4CMMB 4NYLB 2IQ9L 2VNCA 3KPRD 5I1GL 2APFA 2QHLA 3PG2A 3IDGA 3MLWH 1WK0A 1FZKA 2CKBL 2V5YA 5L7XL 3BI9X 1UJ3A 4RX4A 1M05B 1YEKL 3V0WL 3HFML 3FQNB 4ZQKB 3ZKXB 1NGPH 5CSGA 4HEPG 2EDBA 1PSKH 5BVPL 4AEHL 2E5EA 2YN3A 1EO7A 1CDHA 1N8ZA 4KRPB 3KJ6H 1H9VA 1ZE3C 4QRQB 1BBJA 1A3RH 2NZ9C 5ESQA 4P0DA 4KRNA 1I4FA 4NGHL 1RD6A 3VG9B 2BRRL 3V95A 1N5AA 4CMHB 1R3JA 4M62L 5L8JB 1U8PA 1T1YA 2MQ0A 4MJ4A 4P2RA 4U1HB 3RIFF 4MB3A 3ZYJA 4GLRI 3RKPA 1ZSDB 3PWPB 5T1KA 3EOYG 4NQCB 4OZGE 5I1EL 2MPAH 3I9GL 1BOGA 4YNYB 5DHVB 5IKCA 2C4FU 3BDXA 5IBUB 1TFHA 1RZ7H 3G04B 1UKQA 2M8XA 4N1CA 5CJOH 5EOTA 5ICYB 2AP2A 3I50L 5BV7C 1NSNL 2E9IA 3MRGB 4NCC1 1I8IB 4KV5E 3UBXA 4KKCC 3PJSA 4L3ED 5DVMA 5ESVA 1LK3H 5JOEA 1JHLL 1I1FB 1OTSD 4U1MB 4O58L 2P8PB 2UV3A 1L0QA 1VADA 2CLVA 2DBLL 1BFVH 1RI8A 2W9DH 4DJMA 3LN9A 5L2JA 2MCG1 3EHBC 5GRZA 2NY5C 1H8NA 2OQJA 3VXUE 4DCQB 2YZ8A 3FTGA 3FB8B 3T0WA 4LSDA 1UT9A 4XPGH 4X6BB 2VXQH 3C9NA 3NA9L 2A6IB 1R24A 2WUCH 5HYJA 5FUCE 1U2CA 2IBBA 4Z7NF 5FO7B 4O51A 4Z0BL 1VACB 5E8EB 1I7ZB 5I17B 1X5GA 3WHXB 4ZFOL 4XP9H 3WKMH 1ITBB 4PYGA 4A6YL 1VFUA 3O6KH 5GJSH 3TYGH 2X05A 2D03H 2KQNA 3W9DA 1ZXQA 2GITA 3S35L 4CNIA 1I1AB 5IMLA 1X6LA 1LEIA 2MHAA 4G9FE 4WWID 4I5BA 1AXTL 3DETC 1FN4B 3LS5L 4OFIA 2VDMH 5B3JF 5JZ7C 1U6AH 4Z7UF 4L8SA 5JW4N 4Z0XB 3AB0C 1P4IH 4I0PA 1OTUC 2DTSA 4FZEL 4PRPA 3ALWA 2XI9A 4OLXH 3RX5A 1QFPA 3IJSB 4HFUL 3JTSB 3OKNB 1S8DA 2GQHA 1F8TL 3DIFB 4OQTH 1HH9B 2E6QA 2W92A 4GRMB 3QFJB 4ZPTA 1TENA 2D4DA 3PUCA 4XCFH 4NKQB 2R29L 3QJHB 1KELL 1KLUB 2H32H 3BKYH 3C60D 2AS5M 2ZCLL 2J8UF 1T04A 3VRLE 3EYQC 4HS6A 4ZTPH 2G5RA 3GNMH 5E8OB 3S96B 4NT6B 3CD4A 4DWHA 1CR9H 3T2QA 4N90E 4KKLC 5LG1A 5C8JA 1SY6L 4JFPA 3BMVA 4R4FH 2XICA 4JM2F 4M1GL 2OR7A 4S1QH 3FHAA 4LMQI 3T0EE 4RAVA 3UTSD 1DLHB 1WFOA 4Z76B 2IAMA 4P46A 3DBXB 4JJ5A 1OP3H 3VGFA 4XVJH 4OQTA 5E2VL 3GJFB 4PJXB 1LHZA 4LLUA 5KJRL 4C56A 5IBTL 1U8KA 5EZJA 3L3HA 4ZOAA 2H32A 1AXSA 1S7QA 1CZ8H 3IJHA 4WY7H 1QEWB 4MNQD 1FL5A 3Q6FB 2IEPA 4HDIB 3CFDB 3RKDD 4FHBD 4R3SB 4NSKA 4P23A 5HHOE 2XRAH 1IAKA 2BOCB 2Y06L 2YZ1A 4CN1A 4LHUG 5IUSA 3ULUF 1UG9A 5HD8D 4JFOB 5DFVC 4U0RB 1JE6A 4M7KL 4X4XB 4AIXA 3TYFB 4L29B 3IFPB 5DMKB 3GMMB 1IC4H 5K9OA 1HHJB 1CFVL 2Y7QA 2OK0H 1PEZA 2HN7B 1UWGL 3D2UA 5BV7B 5H8DA 3IDYC 5GZNC 2ED8A 2V7NB 2H8PA 1KC5H 1CGWA 3MGOA 3GEWB 2IPKB 3MOQA 5CSBA 1NAMH 3LKQB 1A9BB 2V2TB 4Y16B 5DJ6A 5LAXA 1TCRB 4XP4L 5FO8B 2IBZX 4M7LL 4D0DA 1FO0L 4X6DA 3IKCB 3DUUB 4IMKA 4CAGA 1JI2A 3ZT6A 5IOPA 3MV7E 3RNKA 5T5FH 3V9FA 3D18B 2M1KA 5F1IB 2EDEA 1IEBB 1EEYA 3SDAA 1KLFA 4DGVH 3LN4A 4IDJL 2AEQL 3JVGA 3R06B 5EZIL 4OT1H 5IJKA 2BVQA 2ICWA 1WBXB 4OD2A 2CRMA 3OKDA 3QI9D 4YDLC 2D7PA 4J3VA 4NJAL 4TTDC 2FR4B 5D6DC 3AM8A 2VLKA 1F58L 5MEOB 4OV5A 3RFZC 4Z77A 4KMQA 2ATPA 4NRXB 5A40E 4BUHA 2LTQC 5DZNA 5ISZA 3MV8B 4LU5L 4MVBD 5FHAL 3AB0B 5TQ2L 1YUHB 1TNNA 3K80A 1LWRA 4LAQH 2EIZA 4NO3B 4OI8A 1JF1B 3C6LA 3VXPA 2A9ML 4HG4J 5BCAA 1AQDB 4OLYL 5IMKA 5CEYB 4OZIB 4LVNB 3NAAL 3MRRB 1TZIB 5GSVB 4ZFGL 3RUGF 5IMOA 3MXVH 1KN4H 1WC7B 3QUKA 5EPMB 1T3FB 5HHXL 3OJ2C 3CDGA 2A0LD 1QBMH 2RB8A 5E03A 4OM0L 5BS0D 1GIGL 5C0RH 2HMID 3GM8A 1AD0A 2MCPH 1CL7L 3QWRD 1F5WA 1KJVA 4NO0A 3S3PA 5C0BB 5J6HB 1PQZA 1V3MA 4NNPL 2R1YA 3ULUH 5L2KE 3PWUA 4BFEA 1G7JB 3I2CH 5I8KH 2VISB 1T1XB 1A1MA 4DTGH 3HE6C 4LLMA 2EDQA 3P77A 1A2YA 3QO1A 4YBQD 2E3VA 5HYFA 2XN9E 1N4XL 5FIEA 4LKCA 2YK1H 1J05B 3CFCH 1Z9MA 3QWQB 3OXRA 2GK2A 1AE6H 2EDKA 4UDUB 1GC1L 3VXNB 2L7JA 5IROA 1JMXA 1MHCB 2BVPA 4GLRH 2PN5A 4MJIB 5HI3D 1HIMH 3HPLB 1BWMA 2XWJA 5M94B 3DUSA 4HMCA 5CMAB 2OR8A 3W0WA 4D8PA 4U1LB 2BMKB 3FRPA 3BAEL 2DN7A 1BF8A 1K4CB 1T21B 5GIRA 8FABA 2UYLA 5H2BA 2NY6B 3LEXA 2YUXA 3KPRA 3TJEL 2Q6WB 1NDGB 4GKOA 2AJZB 3HRZB 3VD5A 1IGYA 5GHWL 3SKNA 3UJJL 1KACB 4ZDHA 5A2IH 4GBXA 3MBXL 2VLRA 4G8GD 5H94B 1FL6B 2CD0A 3NIDF 4YX2L 1JL8A 2EE3A 1OAUH 3VWKD 1JN6B 2ICCA 1S7SB 2E7LA 2V17H 3MOAL 4XWOD 1EEZB 3DYPA 3OQ3B 1SJEA 2GJ6B 3DO7B 4KZEH 3G6AB 2WINB 4X4YB 4PJAF 5JW4Q 3IRPX 1CFBA 3PHOA 2DBJA 3ARDC 2R8SL 1T83C 4XVSH 2C3VB 2HTLD 2J1KA 2VDPL 5C0GB 5J1SC 4W6YB 5FYKE 4PGBA 4LKXB 4MXQC 5HI5C 5IBUG 3QDJE 4NDMB 4MAUH 3VXQB 4LPVA 3O8XC 2NY3D 1GGIH 2FL5B 4TRPL 4S11A 5DJAA 2GW5A 4N0FA 4S2SA 1T2QL 5FFLA 4IEFB 4UOJA 4PUBH 4QT5A 1T7XA 4XHJD 1X3DA 2DI7A 3GKZA 3K4DA 4JN2A 2FWOB 4ZXBB 3QDAA 1IM3A 1CGXA 3CK0L 2R2EB 3SDDD 3W11D 4OCSH 4WNQB 3WLBA 2LTQB 3VD7A 3EFFB 3QXAA 4YHIB 3DXAB 3DURB 1HKLH 4G8EA 4G6JH 4PRHE 1OSZB 2NQCA 2ZNXA 3LD8C 3D3VE 3F5WB 1W72B 4NPYB 3PQYE 4EIZC 1RK0A 4LPXA 3BD4A 2R2BA 1J8KA 2IFGA 1GYAA 4J3XA 1ZEAH 4QWWD 2VUYA 3OKOB 2JK5A 2JKXA 3TGXA 3K1KC 5LBSH 1TIUA 3HC3H 4PIRF 1FQ9C 1BFOB 2DD8H 3B2UC 1QVOB 1JHTB 4P9ML 1I9RL 2D7TL 3FRUB 2R9HC 3ZDZF 4LCCA 3BPOC 3V6BR 4L1DA 1MIMH 1QACA 2R0LL 1HNFA 2OJZH 3S4SB 3SGKA 3MV01 1D9KC 4ODVL 1F4YH 4OZHB 4KJYB 3S7GA 4HBCL 5I1IH 3D1MC 1NGPL 3IDIB 4JFED 4DQOH 2FIKA 1PSKL 1BJ8A 2FJGB 3MRNA 3MRPA 4C59B 1UZ6E 4NJ9H 5TDNA 5D72H 2OTWB 3TIDA 3BKJH 1A3RL 4QTHB 2ESVB 4OKVB 2DMCA 2MJWA 5L0QB 3JV5A 1G9MH 1FYTA 1CICD 3DRQB 4YUEL 4FQ1H 4DFHA 1WUNT 4OGAC 3C5SA 4PJEE 3LKNA 2WW8A 5IP4A 2YUVA 5T3XL 4L4VD 2ZUWA 5D2LE 3SDCA 3WFZA 5DUBB 1OP9A 4TNWK 3I75A 3WO4C 2JIXB 5IB3B 4KJQD 1MHPH 4G8IA 2MPAL 4JCMA 4JQXA 3GSRB 5FM5M 3ARGA 5IEHA 4TPRH 1GH7A 1Q9LB 1IKFL 2PETA 4P48A 3Q0HA 3VCLA 3BXNA 3OGCA 4GH7B 5KN5A 4RZCA 4YIQA 1IC5H 3CMGA 1FNGA 3UTSA 5ENWB 5E99H 2VQ1A 4JDZA 1QRNA 3IXAA 4PP2A 1LK3L 1CDGA 4JB9H 2PXYD 4PJGE 3ARDB 4L8DA 1BFVL 2W9DL 4MNQA 3MMEB 4U4BA 5LJYH 4UQ3B 2GSGB 2WK2A 4P9HH 5E6IB 3O8XB 2HLAB 4X99A 2FDBP 4XPGL 2VXQL 2WUCL 5DO2C 1DBJH 4Y5XA 3FO1A 5EWIH 2AKRA 1T66C 4QRRB 2F53A 1PJ9A 2DQUH 4HKBA 3GJFK 4JFHE 2HT2C 4FABL 4OSUH 1F2QA 4XP9L 3WKML 3SKOB 4NO2B 4RGNC 3O6KL 5GJSL 3TYGL 2D03L 5F9JB 3BUYA 2HFFB 4EQ2A 1BLNB 1T22A 1ZA6A 5E2WH 3RI5F 4IOIB 5ERWA 4XVUD 4APQA 3A0OA 2X6MA 1E27B 2VDML 4OI9A 2RJMA 4B50A 5TPWH 2QQKH 1TXKA 2WP3O 1WTGT 2D0FA 3OF6D 1P4IL 4Y0GA 4NZDA 3C08L 4ONHB 5DC9B 1JTPA 3QR2A 4GT7A 1ZA3B 1AGBA 3EBAA 3TESA 2O26U 1SBBA 1Q8MA 4HFWB 4OQTL 5FGCB 4JR9H 1JUFA 4GG8A 4XCFL 1HXYB 3PWVA 3FO2B 5LWYH 4MA3B 1FZJA 3BKYL 3L5WB 4UTBH 3RWEA 1J18A 3IT8D 4NN5C 1S7RB 1Q9KA 1ONQB 5IVOA 3CZFB 3HB3D 5C0EB 2CSPA 3MRDA 1MY5A 3GNML 4WI4A 5JPNA 5GGRB 3QHFH 3MJ7A 2ZUYA 1KCUH 5FDYA 2D3VA 4R4FL 4U2ZA 1HZHH 5IGXH 1KEMH 1DLFL 4AJ0A 3INUL 3RWDB 1X5KA 5DLMH 4ZSOE 4GKNB 4OZ4B 4X6EB 3WKNA 3WUWA 3MLXL 4KK9D 3U46A 3HMWH 3K4AA 1UJTA 4LCYA 4JM4L 2CRYA 2GJZA 3IDMB 2CIKB 3WL9B 3FL7A 1CDIA 3DARA 2BSSB 2FHCA 2J6EA 3MFGB 1MJJA 2P24B 4L9LA 5C08E 3FQWA 1F00I 1Z9SA 3OXSA 1NFDA 2VN4A 3WO4B 2G75B 3OKKA 3M1BB 4KHXH 2XTLA 1L9MA 1ZANL 4AT6B 1OLLA 5BS0A 1IC4L 5GXBB 2YC1B 3RGVD 1WICA 2D7NA 3TBSA 2OK0L 5EOCJ 3WHE0 4HUWA 2NY1D 5IW3A 3SE9H 4F7CB 2VOTA 3OR7B 1PYWB 3HUJF 1KC5L 3LIZH 3IAGC 3CSYB 3D0VB 4D0CB 2IJ0C 5DEZA 1LEGB 2NY4D 3BRGC 4RWHA 5D1ZA 5DEGB 4XPAH 1U8IA 3STLA 4ODBD 3REWA 3BVNB 4PG9A 5IVXE 1DEEB 1G1YA 5EU5A 4ZS7L 4M1DH 4NRYA 3ORJA 3IB4A 4MQXD 4QHMB 5EU7E 1G0XA 2W65B 3CXHK 4HWBH 4UQ2A 4QRUB 3B6SB 3TO4B 1ADQL 1J5OH 1CDUA 1ZHKB 4DGVL 1JK8A 2XQBH 1RJZA 1S9YA 4PB0H 1TJGH 2DF3A 3NABH 3QEQA 5ESAA 5M95B 1S9VA 5SWZE 4FQHB 5D7IF 4WO4B 1DANU 5I8OL 1DQJB 3V5KA 3VXTB 4MZ3A 4JG1H 1IGTB 1X44A 2YUZA 4WW2C 2FATH 4MAYA 3ETBF 1C7SA 4QHKI 4BQ9A 2YPVH 4YFDB 4RGNB 1AGCB 4NQXA 4R96B 3U48A 4XNXH 5A16A 5ACZB 2QQLH 3D39D 2E9JA 4F9PA 2DWEB 3MBEC 4HWBA 5BRZD 4D9QD 1D3CA 3L7EA 3VWKA 4U6HB 3MSPA 3LMJL 4WU5A 5ETUA 3PL6A 3O81A 5HYQA 1J8HB 2BRQA 4QYOA 3VI4E 1VKXA 2IWGA 4BFIA 1QFWI 5KOMC 5F6HI 1OARH 4X7TA 5INDA 4M1CD 4PJ9D 4YQXL 2CIIB 4M6AA 1A6TB 3WXVH 1KN4L 2X44D 5E8DH 1V5JA 1I7TA 3B9KA 3T3ME 3E6HB 1Q9OA 1OWWA 2F54B 4QOKD 5C0RL 2BY1A 4HKJB 2H26A 5DUMH 1OW0A 5C3LD 4WI8A 3DV4A 1KN2H 3KXFB 3ULUL 3VXMB 3U9PH 2FLRT 3OR6B 2NY0B 3T4YA 5I8KL 3QG6A 3U6RA 4BZYA 4EI5D 1CDBA 4JO4L 5FGBC 5IQ7H 4XCYA 4I18A 3UAJC 2HP4A 4CMMA 4NYLA 3PHSA 2YK1L 3CFCL 1T2JA 4GFTB 1IL1B 4WFED 1AE6L 4E41E 4NN6C 1CIDA 4PJCF 4JLRB 5LXGL 2G2RB 5EIQA 3DTXB 4G6FB 5EUOB 1ZHBB 1HIML 1BVZA 3LEYL 4ZQKA 3EDJA 3S4SG 3ZDXE 4F2MB 1AR1D 1QLFB 4GXVL 1RZKC 1A8JH 4IJ3C 4CU6A 3ZE2F 3FN3A 3KHOA 5D7SH 3F58H 4QRQA 3TPUB 1EFXD 2Q86B 3VE0A 1XMWA 3MRFA 3IAPA 4FMKA 4U1HA 3BGMA 3V4PL 5J57B 1ZSDA 4HJGB 5C09E 3PWPA 4AZ8A 4XTRC 4BELD 3FOMB 2V17L 4Q6IC 3LS4L 5AD0B 1Y6MR 4HIJB 3E8UH 4V1DB 5MENE 3GB7B 3FZUD 5DHVA 1DQML 4DK6A 4Z9KB 5IFHH 2YXMA 3O3BB 4KZEL 3LHPL 4AMKL 3FB7A 1AO7E 5I15L 1A6VL 2ITCA 2FRGP 4HV8A 4HHAB 3DNKA 3I6LE 5L9DH 5ICYA 1CXEA 2X70A 3N9GH 4U6YB 5D7IA 4MAUL 3V6ZB 3O3AB 2ICEA 4MD5A 4RRPG 4NFCA 4WW2B 2QKIA 4EVNA 3L5HA 4XP1H 1UXSB 4TSAH 4PUBL 4D2NA 5BJTB 5D7LA 1DUZA 4RFOH 4WHYH 3MBEB 5EZOH 3LV3B 4W4OC 4O4YH 3OAUH 2YEZB 4OCSL 5GGQH 5FEBA 4N0RA 2VZTA 3FB8A 2ICES 3H9ZA 1HKLL 1ROWA 4G6JL 1G7PB 3HR6A 4X80H 2DYPB 4K71C 4PGDB 3SJVD 4JKPH 1HDMB 2XT1B 3UPRA 4OCLC 3MRKB 5I0DA 3NACH 4MNHB 1FLTX 3X11B 5I17A 4PJHB 3ARBA 1HILB 2GTZB 3NCBB 3ARRA 4TOYL 2W60B 4YPJA 4PLNC 5FM4A 5F3BA 4XGZA 3MRQB 1I1AA 4M03A 3KR3H 2VXVL 1S7WB 2FEEL 4M8QB 5T3ZH 3V6OE 5ACLA 2DD8L 3L9RB 1M7XA 3PDGA 5I8CB 3W2DH 4Z0XA 2X1QA 3P40A 2OJZL 4S0SD 1WEJH 4PJIE 3SO3C 4Q9BA 4HIIB 2NXZC 3RU8L 4TUKH 1K8IB 2HFEA 3OKNA 5DD3H 1QSEA 5DK2A 4F8TA 4DQOL 3GJFH 1T0MA 5E24E 3MLVH 5FCSH 4NJ9L 1YJDH 4QXTB 3ECBB 5KSVA 4CU7A 3BKJL 1KLUA 4NN6B 5CFHA 4C58B 4PJCA 1M71A 4QRPE 5KS9E 1X5ZA 1Q94B 1G9ML 1YEEL 4ORZC 2QSVA 4F8QA 5E8OA 5JQ6H 4NT6A 3QSKB 4YZFE 3LB6C 4L9DA 4FQ1L 1YNLL 5B8CC 2CLRA 2VN7A 3JV4A 3WSQL 4C57C 4NNYB 5FUZH 1DLHA 4Z76A 5A2KH 5T1MB 1FDLH 4PRIE 4P2OB 3GJFA 1VGEH 4PJXA 2A83A 5D4QA 5JDSA 4OLZH 4Y2DC 5C0CE 3T0BA 4GW4A 4TPRL 2EDDA 3U4EA 4BA8A 4YHPB 4KK6D 1NCWH 4FQLH 5EC1B 5J3HC 1MFCH 4WFFE 2P44B 2FO1A 3BN3B 2K7QA 2EIEA 3Q6FA 4ODXB 2VLJE 2IANB 3D85B 1W0WB 1IM9B 5E99L 3V2AR 5DMIH 4PS4H 3V5DA 4EI6B 1DQTA 3BW9A 4JFOA 1EUUA 2MOVA 5D2NA 3T65A 2QL1A 2LAAA 2N7BA 4Q2ZB 4JB9L 4L5FL 3FFCE 2MKWA 3IFPA 4TULH 1H3TA 2VITB 4G9DA 1HHJA 5CHNA 1X5FA 4EOWH 3ES6B 1SBSH 4R2GC 4BFGA 3IU3B 2V7NA 1MFAH 4P9HL 5ANMB 4ELMA 1FHGA 2IPKA 2V2TA 2YD3A 4YHNA 3SGJC 4Y16A 1SEBA 5J6GB 3TZVD 2C4FT 1DBJL 4Q74A 4X7SH 4YK4C 4DAGH 3IDNB 4CVXB 2BY3A 5EWIL 2XA3A 5EBLB 1MFEH 3DUUA 4NNXB 5I75C 2HRPH 4PRBB 1KFAH 2YS4A 3FT2B 3NPSC 4H1LB 4IDLA 1FORH 5F1IA 3G5YB 3DVNB 1IEBA 1BD2E 1FE8H 3QXUA 4FP8H 3FT4A 3NN8B 1IRAY 2SEBA 3NIFE 4HT1H 4X8XA 2ADFL 4K71B 3WN5B 5D7JA 1N3NB 1DN0B 1TZHB 1QFWH 3VJ6B 3KYKH 5ECJE 5TPWL 3NCYP 4I2XE 2FR4A 3JUYA 2H1PL 3N1FC 1KTDA 2YPLD 3TLRA 1MNUL 1X5LA 1S9KC 5T1LD 4KKBD 4DUXA 3NCFB 3QULB 5MEOA 1YPZE 3PE9A 2DLIA 3ZT5A 4IOFC 4NRXA 1C8PA 4EN3C 2LU7A 4JR9L 4YDVB 1EJOH 2XXCB 4EXKA 3VW3H 5LWYL 1JRHI 4RBPK 5KG9B 3O2WH 4UTBL 2FJFA 4I3GA 5AYUH 4HIXL 2J6EL 2IQAB 3SO3B 1R3KA 1CGSH 2V5TA 1KJMA 1JF1A 1Q0XH 2W07A 2NXZB 4ZUUA 4OF6A 43CAB 4XAWH 1AQDA 1CFTA 1K85A 4BH7B 4OZIA 3GUTB 1KCUL 3MRRA 2V9QA 5GSVA 1T0PB 1HZHL 5IGXL 4MXWL 1BVKB 5DJXA 4N0UE 1HYSD 4ALAL 1RHHB 3MREA 4URTB 5DLML 4F7TA 1LP9B 4C55A 3WJJC 3IXTB 5JORA 2Q86A 3HMWL 1OAQH 3CFJB 3VD9A 5I66A 2H2PD 1E0OB 5IQ9B 1HEZB 1MFNA 1BJ1J 1U8MA 5C0FB 5I8EA 3NH7H 3PIQB 5HHOB 1KUMA 1QD0A 3JZ7A 2EDNA 5FM5O 2GHWB 3OZ9H 1MUJA 3I3EA 2EDYA 5IV2A 4OFPA 4Y1AE 4Y2DB 3MYJB 1J05A 2DMBA 1U92A 4NZUL 5DYOB 1CXKA 4UDUA 3VXNA 5E5UB 2DAVA 1UACL 3SE9L 1CLCA 4YAQB 3C6SA 3A67H 5I1CL 1NDMA 3HPLA 3T77B 1MOEA 2DMKA 2PW1B 5H37G 3LIZL 1OGAA 2P5WA 1BQHB 2Q8BH 4W70A 4XPAL 1T21A 4MA1C 3PXHA 2BNQD 4LNVA 2R2CA 1H8OA 4LEXH 4P5KB 1TTFA 4JKLA 1PX4A 4KVNL 2AJZA 2JJSA 4R2GB 1OCWH 2DQHH 4NO5B 2D7MA 3DPBA 5TH2B 2BNUB 4YO0B 1J5OL 1HI6A 2X1PA 1G7IA 4NKDB 4M6OH 3FB5B 1PG7X 2XQBL 5D1QC 1TJGL 3NABL 1NJ9B 5E1AA 2PCPA 3AS0A 3HAEB 1U93A 1ACYH 1NBQA 3L3KB 1S7SA 4HS3A 4I48A 1P7KB 5JXEC 1EEZA 3MOBL 5ICZB 1EFXA 5I75B 5J0BA 2GJ6A 2FATL 4PB9H 5TDPB 2YPVL 3H9SB 3THMH 3FHQA 1QLEH 3NPSB 3G6AA 1JPGB 3VFRA 1BREA 4LCWD 1BIIB 3OMZA 4H0GA 4XNXL 1J0KA 1P4BH 2ZG1A 2C3VA 4Y4FC 1CQYA 1A5FH 4NDMA 3TC9A 3ZLQC 4XC3H 1P2CB 2R4RL 2V9TA 5C0JA 3QDGA 4K07A 1EK3A 2A77H 1HQRB 5E00A 3MR9B 3QEUA 1XCQB 4I77H 3UTZA 4EUPB 1OARL 4GXUM 1R3IL 4ZXBA 3AAZB 4Z7UE 1AP2B 4EN3B 4LLWB 4WNQA 4FZ8H 3MRLB 3EFFA 4YHIA 2EH8H 3QEHB 4GQ9H 5E0QA 1DUYB 1A6UL 4BQCA 3QIBB 1OSZA 2CJUL 3F5WA 5KSAD 3S9DB 1IE5A 2NX5E 4NPYA 5C6WH 1QHPA 4PLOB 5DTFA 1I7UB 1CIUA 4HXBH 1J7VR 1Z5LB 3TBVB 1NCDH 1J88A 3FQTA 1KN2L 3U9PL 2J8UE 1EO5A 2XPGA 3BIBX 1OD7A 1TQCC 4N8CH 1RUML 3BN9C 1T6VN 2IBZY 1BFOA 3SDYH 5IQ7L 2VO5A 3H3KA 4Z6AT 1OM3H 2Z4QB 1F6AA 4AIZB 4LCIH 3UTPE 1YMME 5CEZE 4JFDD 1XH3B 3F6IA 2P42B 4JRXE 4XZUA 3EJJX 4RNRB 3CFEB 3HG1E 3OKYA 1EAJA 5IM7B 4RA3A 4OZHA 3BH8A 1KGCD 3VXSA 1NBZB 5JHDE 3B5HA 3MPCA 1RZJC 3IDIA 5JOPE 2OTWA 1RIVH 3F58L 3NBNA 4AG4H 1VFBA 1FNLA 3N85H 2ESVA 4EDWH 3WLWD 2QEJA 5K9JH 3QIUD 4NKIL 3QWOB 1FCGA 1I75A 1XIWC 5EG6C 4AK1A 1JPFB 1Z0NA 3RZCC 5JR1H 5CD5D 1KXTB 3PV6B 3KYNB 5AG9A 4UZGA 5GGTH 1EUTA 1A1NA 4MA1B 5DUBA 4PJ7B 4PY7A 1B6UA 5IHUH 4JY4B 4PGEA 5IB3A 3M8OH 1J0JA 2CUHA 2EDJA 1NCCH 3EO1A 1IKNA 4AIOA 1P69B 4M7LT 1E4KC 1JNHB 3CFKB 4CBPA 5IFHL 1RVFL 4P5TC 5LGJA 5FB8A 4V2CB 3V4UH 3L3GB 3QCUL 4BQ6A 5D1QB 2VB5A 4KUZL 4RMVA 3U7YL 5L9DL 4D0BB 1QSZA 3N9GL 2J88L 3LQZB 3MRHB 4WWKC 3QHZL 5GGTA 1EXUA 5EBWB 3P9LB 4JHAL 3OG6B 2COQA 4JZOB 3O6FB 4ENED 2DM7A 1T89A 3GHEL 3MUGB 4JPKH 5HYSA 4TSAL 3G5ZA 5E95B 3KJ4B 1VDGA 1A22B 3TBTB 4EDXA 1KCLA 2Z35B 5EZOL 4HC1H 3RHWK 4O4YL 3OAUL 5GGQL 2VXSH 5KVMC 2I5YL 3SBWC 5E6IA 3OTTA 3O8XA 5IFJA 1WVZA 5EUKB 2RGSA 4X80L 4WUUB 5DI8B 1GXEA 1DTUA 1ZT7B 4RIRB 2AJYH 2VDOL 4OZFG 4RFNC 1G6RH 5JNYB 4YBLC 5IBLC 5IHLB 1KCKA 1NC4B 1BZ7A 3S6CA 4NO2A 5A3IC 4L3EE 1WLHA 5CKGA 5KTEH 3G6JE 1EHLL 5F9JA 2Z31C 4QGYA 1JRHH 4HC1A 4HS8L 3D0LB 2FGWH 3KR3L 2WBJD 5T3ZL 2P45B 4KPHH 2YXFA 4MD0A 5D70H 4H1LG 1FP5A 3TZVA 4Y4HD 3HZYB 4DOHB 1CT8A 3RUGE 2H41A 4TSCH 3W2DL 2VZOA 1QPXA 4XNUH 4O2CB 1WEJL 4ONHA 3IVKB 1G6RA 5F21B 3SQOH 2ZPKL 3GDBA 1ZVSB 4TUKL 4HLZG 3CDFA 4K8RD 5DVOA 5L8KB 5DD3L 1BZ9B 4QY8B 4HFWA 5I30L 1A4KB 4PJ8D 3RVUC 4H8WH 3MLVL 1A7NL 1C16A 2QJDA 4MS8D 3RWHB 1HXYA 1YJDL 3U82B 1NEZG 2CGRL 2UWEE 4GRLD 4ZUTB 4RFEA 3BIKB 3L5WA 4ODSH 3PNWA 3CSBA 1IEHA 5FYLH 1S7RA 4Q0XH 2I07B 4IBLT 3IU4H 5C0EA 2FJHB 3EZJB 4AYFA 4Z95H 4IM8A 3CPLB 5GGRA 4G6AD 4B7IA 2P49B 5IF0B 3L3JA 4JAMA 3BHBB 5EIIA 3MROB 4M5YH 3I6GA 4EIGB 2CDEA 5FUZL 1LO5B 5SWSB 2GK0B 1FDLL 2GJJA 5DFTA 1WWCA 3VXRE 3HZKB 4GKNA 5F6IB 4X6EA 1VGEL 4JN1H 4NCDA 3U9UA 1J12A 2OM5A 3G5VA 4GS7C 4UTAH 4OLZL 2BX5A 3IDMA 2CIKA 1XIWB 5T33H 3WL9A 5BV7L 4JO1H 3RZCB 4FQLL 2R0WH 3BDBA 1MFCL 3AY4C 2X4NB 3F7VB 4RBPH 3RDTA 3WUZA 4N5UA 2Z8VC 3VXUD 4NZTH 1YN7B 3OSKA 4J4PD 4U1JB 1KB9J 5DMIL 5FYJL 2BVYA 3M1BA 1WIUA 2NNAB 3H6JA 1OTTC 1BEYH 4AT6A 1MWAH 4TULL 1BGXL 3NIDE 2YC1A 4PJGB 2PKDA 4ZUVB 2NTFB 2WBWB 4EOWL 4F7CA 1SBSL 2E8YA 4PJ5B 4DZ8A 4GG6A 3UDWA 3RJQB 4IIQC 3OR7A 4JFFE 3QNZA 2HT3C 4Y5YB 1MFAL 4G9FD 4WWKB 3BOVA 3D0VA 4D0CA 5GISH 1LEGA 3UTQB 1S7XB 5DEGA 1RMFL 1N6UA 1AJ7H 1U8LB 2XTJC 2YOCA 4YDKH 4DAGL 5HHMD 5HGBB 3ALXA 5DHYB 1DEEA 1M1SA 1BQHG 2DDQH 3O9WA 4U1SB 4JREC 1MFEL 1R5VB 1JHKH 4LLDB 2HRPL 3JBG7 4QHMA 5JOFB 3JV0A 1KFAL 1E4WH 2Q76B 3SDXA 2AAVA 3TO4A 4IRSA 3SY0B 1WIPA 5C07E 2JCCB 5KSUB 1QHOA 3BWAA 4HT1L 3ZKNC 3A6CH 4ZD3L 4JO3H 4M5ZH 4WO4A 1S7VB 3TN0D 1DQJA 4RFNB 2CH8A 1GPOH 3ULVE 4YBLB 1KPRA 3KYKL 5CBEB 4ODWA 2LQRA 3HAEG 1GAFL 2OJEB 2XWTA 4MQTB 4G5ZH 2QSTA 3MLYL 4JZJC 3GBMH 1AI1H 3RWFB 2Z31B 1FL3B 4N90D 4TTGA 4IRJA 3QRGH 2Z8RA 3FKUS 4NQCD 3T0ED 4JY5H 3U0WH 1NFIA 2Y07H 1T1WB 1EJOL 4PJFF 4XVTH 4AL8L 4U6HA 3QUXD 4LL9A 3VW3L 1CWVA 3O2WL 5SWQB 1BAFH 5AYUL 1J8HA 5KAQG 4KY1H 1CGSL 4FFVD 3WS3B 3GSVA 4L4TB 4XAWL 1YMHA 5MEQB 4MDIA 3TBYB 3F12B 2Y36L 3KWWA 4OTXH 5FKAA 5I18H 5HJ3B 1A6TA 4EUPG 4IHOB 3KYMB 4ZSOB 2X89A 1MAKA 2E8ZA 3UYOD 3GZKA 1YECH 3H3BC 5H37H 4EKXA 4HKJA 2OI9C 1HE7A 4YHOH 1VPOH 5FYJU 5DZOA 1PFCA 5C08B 1A6ZB 1QZ1A 5E2UL 1G9EA 2W9EH 1T4KB 3KXFA 2HKHL 5D5MB 3OR6A 3DMMB 3O4LB 1OQXA 4J7RA 1QBLH 2VZ1A 3K4ZA 2GSIB 3GSXB 1CXFA 4KWUA 3OZ9L 4KK5C 1P5UA 4P3DB 4K3EL 5KSAA 4BSVB 3S37L 4P4RA 4LP4A 4JLRA 2G2RA 3RHWF 3DTXA 2I60H 3MV7D 4GAGL 4YXLH 2CO7B 1MVUB 5EUOA 1ZHBA 1CLYH 3A67L 5HHNB 3C5JB 1ES0B 4P2QA 3UTTB 2NY2C 1KJ2B 2ZUSA 1AR2A 4F2MA 3BGFC 4XI5C 5AG8A 3VFMB 3LN5A 4OZGF 1D5IH 4FQXC 1MQKH 3PDOB 4KUCF 1VENA 5IVXB 1T20A 4MYWB 1G7MB 5BZWB 4JRWA 3BKMH 4G7YL 4NQVA 5J1TC 2WUBH 4G43B 3QFJD 5EOQH 5GRUH 4CW1A 1FPTH 2EC9U 3ESVF 1PKQE 3EYOB 4HJGA 3NZHH 2VL5B 3B2VH 1GGYA 4KV5F 5HDLA 1Y18B 1XZ0B 4KKAC 4HIJA 1NCTA 4V1DA 4QRSB 3GB7A 3CLEH 2VQUA 3PGCB 3HCVB 2VDRH 3THML 4PRDB 5HGHA 2V2WB 1NC2A 2MSPA 3KYOA 4HHAA 1Z3GL 1FFNB 5CKAA 4H0IA 3HR5A 3HZVA 2AEIT 5IHZB 1B0GA 3O3AA 1UQSB 1TMCB 4ZFZB 3ARXA 1DQLH 5EU6D 2A77L 2XFXB 1KTRL 4JZJB 4X7CC 4TUJB 3P4OA 2ADIB 1SEQH 1MAML 4G8GE 3TVMD 3GFUA 1UXSA 1QPPA 1U3HD 4I77L 5FA3B 3U36A 5BJTA 4NQDA 4UV7H 3PWNB 4XCNB 3LV3A 5L2KD 3E1F1 1XGRB 4J3SA 2YHGA 1CE6A 1DANT 4OLEA 2YEZA 2OMNA 1DVFC 4ONFH 3RVWC 4GAYB 4PJFA 4DKAA 4GQ9L 1LQSR 4LLYB 1FFRA 1O7SA 1WZKA 1TPXB 4X6CB 1HDMA 1ED3A 4XMPH 2XG4A 4MNHA 1OL0A 4PJHA 2APBA 3BQUB 1U8HA 3X13A 4XMKH 2YD2A 3ZL4H 2AJ3B 4PJDA 1RURH 1AIFA 2XWBB 3EJYD 1WZLA 3MRQA 4N8CL 4WHTA 4RMTA 2IG2L 5I73C 2B4CH 1T80A 3SDYL 1JI1A 3HE7C 1OM3L 1UJ3C 2IH3B 2OI9B 1Q9WB 5KSBE 1GZQB 2A1WH 4BFBD 1JWUA 4HD9A 5GS1A 4LCIL 3EHBD 4OCMC 4Z5RB 2A6KB 3TNNB 5DK0B 4UUJA 3G08B 3STBA 1NGWB 3QIWA 1K8IA 1DEDA 1M7DB 1UADC 3WS6A 4TNVF 1T03L 2P8LB 1PY4A 2WBJA 2PO6B 3RIAK 4QRTB 4OF7A 4QXTA 4NM8H 1RIVL 4AG4L 1KIRA 3N85L 4HQQH 4EDWL 3MRMB 2FB4H 1AC6A 3P9MA 5K9JL 1CGVA 1G7HB 4MSWB 5E5RB 1TJHH 2AJUH 3V6FB 4P5MB 1A9EB 4JANA 3DETD 5JR1L 5JZ7D 2NY2B 2XTJE 4NNYA 3ZSSA 3BGFB 5C09B 3W39B 1E4JA 4PJ8A 3SKMB 2RBLA 4N1EA 1OTUD 5DJDB 5IHUL 4P2OA 2DQDL 3M8OL 2VWEC 1B0RA 1F3JB 2X4SB 2C5DC 1NCCL 3HUJE 1QQDB 1V7NL 2LU3A 2OTUB 4JFEE 1RU9H 1CXIA 4K7FA 4OZFH 5ID0B 5I1LA 3RWGB 3EFDL 5ITFA 3BP5B 2HVKB 2H45A 3D85A 1I9IL 4WI5A 2R69L 3BP6B 3EYQD 1ZLSL 4EI6A 2FX8H 3D3VD 2AQ1A 1NCAH 2AK4E 5TFSH 1PKOA 4BQBA 1R6VA 3PQYD 5C0BD 4JQVA 4JPKL 1XGTB 4L4VE 4H1LH 3WFDH 1A3LH 2VMFA 4HWZB 4HC1L 1I8MB 3IU3A 2GAZB 1HWHB 4OZFA 3GMNA 1UB5B 3FONB 2F9BT 4CU8A 4OF5A 4FS0A 2BSED 2AVGA 2CDGB 2AJYL 5JXAL 3IDNA 4CVXA 3Q6GH 3VFUB 1G6RL 5IB2B 3ZTNH 3HNSL 3QNXB 4ZOBA 3DGGB 2VLLA 3BSZH 4NNXA 5GGVH 4PRBA 1JBJA 2P7TB 5JDJA 1EX0A 3WE6A 3FT2A 1DVFB 2EDWA 4H1LA 5DFVD 3KLAB 3SPVA 1AGEB 3PDDA 5C86A 2DQTL 1RZIB 5GRWA 1A7QH 4H0HB 2QHRL 2E6PA 4I0PC 3WN5A 2CXKA 4KPHL 5D70L 2VABB 1DSFH 1KTLB 3RVXC 1TZHA 4MJ5B 1RUPH 1RFDH 5GZND 4X8JA 7FABH 4UDTB 1Q0YH 1YDPA 3QULA 1NEZA 4R90L 1GGBL 5I73B 3IDGB 4ISVA 1IGFL 4H8WL 3HE7B 2ZSWA 5A2FA 2X4UB 2ZJSH 4YDVA 1UJ3B 1MY7A 4BSJA 5HSFA 1IAMA 3PP4H 2NYYC 5JUEH 2Q87A 4JVUA 5FYLL 1IMHC 3IU4L 4Z95L 3L3DB 43CAA 1INDH 1N8ZB 2JELH 5HDQH 2IAMC 4P46C 4BH7A 1BBJB 1I3VA 3GUTA 4LAJH 5ALCH 3QQ9C 5D1XA 3MCLH 3T0EA 1BQLH 3B4NA 5E2TH 4TTDD 4XNQA 1R3JB 3F6LA 4M02A 4UILH 1U8PB 1T1YB 1RHHA 1IQWH 4JN1L 1H3UA 2VZ3A 3CFJA 4UTAL 4OCXH 4U2YA 4WCYH 2NXYC 3PP3K 4RISH 5T1KB 3ZE2E 1QBAA 4P23C 4TSBL 1MJ8H 2R0WL 3FB6B 5C0FA 5CILH 3CVHH 3DXAD 3K8LA 3U0TA 3PIQA 4NZTL 5HHOA 5IKCB 5ILTH 2BHZA 1BX2B 2WSKA 2JJVA 4LOUD 4ERSL 1WAAE 4Y2DA 2QSCH 3MYJA 4KTEH 3GJEB 4HGWA 4P3CH 4JFHD 2RHEA 3QISA 4FNLH 3UBXB 2P1YA 1MCPL 4PJBE 1LO2L 1INEH 4K23H 3R8BB 1K5NA 4MLIA 5ESVB 4YAQA 3HAEH 2BXZA 1L7IL 3T77A 4AEIL 3VGEA 5BZDA 1BQHA 3CVHA 4Y19E 3UYRH 1LILA 1VADB 2CLVB 1MCJA 4IMKC 1TETH 1A7RH 5J1AA 1DBKH 5TF1H 4POUB 5L2JB 2BNRE 3EYFB 3PWLA 4LSQH 1PZUB 3TP4A 4LPTA 3FTGB 3NCYS 5DT1H 2DDQL 4PFEA 2JB6A 3SDAC 3MV7A 1WBYB 3HE6D 3JVGC 4NO5A 5HPOA 1R24B 5HYJB 2BNUA 2OMBA 3OB8A 3LKSA 4YO0A 5IJKC 4NKDA 4O51B 4LPYA 5JW5B 1NJ9A 3HAEA 2XQYK 3K81A 3PXJA 3GK8H 4JO3L 3AM8C 5ABDE 1P7KA 5EFIB 1GPOL 1PEWA 3W9DB 1NAKL 5ICZA 5I1DA 3PABA 4CNIB 2HWZH 2HT4C 5F7WC 5IMLB 2MHAB 5IK3B 5TDPA 5E9DD 3MJ8B 1JPGA 4G6MH 4P4KA 1YEDA 1AI1L 2OP4H 1T7VA 5HGDA 3GRWH 4CVZB 3UXFA 1XGQB 1YPZB 3Q5TA 3QRGL 3RIAF 1E28B 4I0PB 3U0WL 3LPWA 4X4ME 3PF2A 2Y07L 4BSWA 1FJ1A 4XVTL 3C6LC 4HK0B 1BAFL 3WIIH 1S8DB 4FFYL 5EB9A 3MNWA 4ZPTB 2Z8SA 4TVPL 3BWUC 4OTXL 1AP2A 2RCSL 4EN3A 1X6NA 4LLWA 2DICA 3KPSB 3ILQC 1T04B 3HNVL 2Z93B 3QEHA 4HUUA 4P2RE 4F7EA 3FAXA 1F4HA 2EIBA 4UT9L 1NEUA 3QIBA 1YECL 5C8JB 4JG0H 2NW2B 3D39E 3DSNA 1RIUL 2R0KL 4W6WB 1U3HA 4YHOL 3QPQC 5FA4A 1VPOL 2IAMB 2DLTA 4P46B 5BRZE 4I3RH 4MXQD 5HI5D 4D9QE 4HAGA 5JIPA 3I85A 5DUPH 1Z5LA 3TBVA 4E42A 3RVVC 4C56B 4DVBA 4NQUA 3OJVC 1QBLL 3L3HB 5F93C 2H32B 1S7QB 3IJHB 2XKSA 5F9OH 2GFBB 5IROC 3MLUL 4QLRA 2XN9A 4CJ1A 1FL5B 4G80B 15C8H 4LNRB 4OGXH 2Z4QA 4H25A 4NSKB 4AIZA 4OGYL 1OF2A 1UM6H 4P23B 5T3XE 1YZZA 1IAKB 1U8NB 4FFWD 2I60L 2I9TA 2W59A 3ULUC 5T1DL 1D5XA 2D0HA 4RNRA 4YXLL 5TE6H 4PJEF 3HI5H 1P7QD 5K9OB 2X1WL 3CAFA 5I0ZA 5D2LF 1EHNA 5SWZD 1J87A 4UB0H 5C92A 5IVZB 3D2UB 1MQKL 3VGGA 2H8PB 3DV6A 4GBXC 4KTYA 3MRBA 5DJ6B 4EXPX 1OAZL 1PLGH 1JGDB 3BKML 3QUZB 3QWOA 5FYKH 3DHMA 1AC0A 1FAIL 3B2UD 3MFFB 3VGBA 2WUBL 3PV6A 5GRUL 2E7LC 2R9HD 1FPTL 5HGAB 4D0DB 3DX6A 4WFEE 3NZHL 3BE1H 3N50A 3B2VL 4HKXB 5FF6B 5IOPB 3RNKB 2F58L 1D9KD 1OAYH 1EHXA 1EEYB 1MIEL 5HVGB 2EDHA 2CK2A 5CUSH 4KI1A 1JNHA 3CZJA 4JVWA 2VDRL 3T3PF 4MB4A 3FN0H 2ICWB 3HLAB 3D9AL 4E0RA 1NAMB 5J7CC 4KMTH 1YEIH 2Z0BA 1TLKA 3QDJA 3ZHDA 3OHXA 3CNKA 3S3JA 3UJTH 4PTUB 5EBWA 1DQLL 1WZMA 2MNUA 4HPOH 4OV5B 1NQBA 1AH1A 4JZOA 4KQ4H 3O6FA 4Z77B 4OGAD 1SEQL 4S10A 2PYEB 3BGAA 4UV7L 5L8LB 2Z35A 4Z7UB 4DN3H 2CKNA 4UT7L 1NL0H 3AU1A 2Y1VA 3C6LB 4J12A 3VXPB 1OTSC 2EZ0D 4PRHA 4XPHH 4CDHA 5IMKB 5DI8A 4RIRA 5LQBH 2NX5B 1A7OL 2X2YA 4GQPH 3PQYA 4JFYB 4XMPL 3WCYA 2OR9L 2I27N 1LDPH 1NC4A 4YXKL 1UA6H 3KDMB 1RZ8A 3HMXL 5C2BH 1RURL 3O0RH 5GS0D 2IALB 4G3YH 2L0DA 3D0LA 1AD0B 3GSUB 4LCCC 4TQEH 2B4CL 1KJVB 4NO0B 5E70A 5KZCD 1PQZB 2C3WA 5I1JH 3SGKC 1QKZH 4JM2B 5AZEL 2A1WL 3HZMB 4B41A 1UEMA 1A1MB 3BT2H 2IADA 1KPUA 4O2CA 3IVKA 3QO1B 1RZKL 1ORSA 3MZGB 2BSTA 3UX9B 1Y6NR 1ZVSA 1DQDL 4LKCB 5DO2D 3RPIB 4XCEA 5DC4B 2DIAA 1T66D 3CXDH 1A4KA 4XMLH 3ME0A 2BVPB 3RWHA 2YN5A 3CIQA 4YC2C 4NM8L 1B4RA 1MCRA 4H5SA 5MEND 3LEVH 4HQQL 1CF8H 2FB4L 3DUSB 2FGZA 3W0WB 5JA8B 2FJHA 1EO8H 1AO7D 1R3LA 2AJUL 3SDCC 4QNPE 2UYLB 4P49A 4PY8J 4X6DE 3GKWH 4PJEA 2WIMA 3BHBA 3KPRB 5HGGS 4HGKC 3CLFH 4JQXC 1LO5A 2W0LA 1IGYB 2GK0A 1ZLVK 3SKNB 3MCKB 4G6KL 3S8WA 3CCHA 1G9MC 1DN2A 5D9SA 4IMLA 1EMTL 5K33A 1CE1H 1ZAGA 4P57B 3F7VA 3L7FA 1TITA 4WTZG 3HKFA 4KAQH 1YN7A 4U1JA 1NUNB 1H3WM 2R0ZH 2C3GA 2F54D 3BUTA 3QQ4B 4QXUH 2ZOLA 2QLVB 2FX8L 1NCAL 2BHYA 2NNAA 1E4KA 5TFSL 1XCTA 5F1SA 4PJGA 4ZUVA 3VFPB 3VXMD 3WFDL 4FTVD 4TVPD 4K9EH 5FCUH 2B2XH 2BY2A 4PJ5A 1MVFA 1HHIA 1D6VH 1UH4A 3WNOA 1MJUH 4ONOA 4Y5XC 4Y5YA 1MEXH 3PP3H 4WWKA 3UBXG 4QT5B 4LLQA 1U58A 4JN2B 1IM3B 1U8LA 2EICA 5HGBA 4N9OB 1UM5L 3WLBB 5DHYA 4KI5E 5DS8A 3ZTNL 4J1UA 3QXAB 5DDHB 1YEFH 3BSZL 1R5VA 2Y5TA 5GGVL 4R8WH 3RY4A 2Q76A 5F6HJ 1S78C 4L3EB 2C9AA 3WFEH 4APQC 4P9HC 1RPQA 2W0KA 1GCFA 5DJZB 4JDVA 3WEXA 2UZXB 3MJ6A 2BVUA 4NQED 1A7QL 4HXAL 2R2BB 1S7VA 2XZAH 1RUPL 2B0SH 2JK5B 4YH6A 1FBIL 3TCLA 3EJZD 4QRPD 4HK3N 4UT6H 5C0AD 2OJEA 3VI4F 1RFDL 5C9JA 4L8BB 4FQQA 7FABL 2DM3A 1Q72H 1JMZA 5D6CA 2R1XB 1Q0YL 2Z31A 3OAZK 4MCZA 3KNBA 4LCCB 4PRID 3BX7C 1T1WA 4KDTA 2ZJSL 5HHVH 3B9DA 3LCYA 1L6ZA 3TF7C 3PP4L 3PHQA 1XR9B 5C3TA 5JUEL 4DGYH 5IB1B 5IFAH 3MRNB 4WENB 1XF1A 2JELL 1QFWM 4WFFD 3TBYA 3F12A 5TDNB 1ZVHA 1RHFA 2VLJD 2VE6A 3MCLL 4FQJH 3L5JA 4XWGH 5E2TL 4YHMH 3KYMA 1AD9A 2YPLE 4UILL 4ZSOA 3GSQA 5F44A 2R15A 2VLRE 4AQOA 2C1PB 3LKNB 4OCXL 4WCYL 4Y2OA 1D5BA 5A2LH 3MBED 3WBDA 1F3RB 2APXA 3O3EA 1MJ8L 2XZQH 5C08A 3D6GA 4G8IB 4IOSD 2OCFD 5L88H 1T4KA 1KJ2H 5GS2D 3DMMA 4XBEH 5FV2A 1KEGH 3ZYOA 4HG4K 4Y88A 2HRLA 4JRYE 5ILTL 1HQ4A 3TWCH 3GSXA 2KZWA 3VCLB 5FXCH 4HWUA 4LRIA 4XX1E 3T08A 4ZYKA 4P3DA 1JGLH 2QSCL 4RZCB 3KPLA 4YIQB 2Q8AL 4BSVA 4KTEL 3UTSB 4DGIL 5C0IA 3AY4A 4RAUB 2VQ1B 1ODAA 4Z7VE 1L6XA 4JDZB 2EEBA 1INEL 3IXAB 2P47B 3VG0H 1MVUA 1N6QL 4PP2B 5D1ZC 2ZKHL 4YBQC 5J12B 3C5JA 1ES0A 1KJ2A 3JV6B 2C7UA 4QGTA 1CYGA 4PJAB 5EA0H 3UYRL 4L8DB 2H9GA 4MNQB 1A7RL 5TF1L 4UV4H 4MMXC 5IVXA 4LSQL 5KVGH 1G7MA 5DT1L 3E3QC 3L5XH 2FBJH 5BZWA 4X99B 3GMRB 4YFLI 2LFGA 1L9NA 3FQRA 5I74C 4MHHG 3P4NB 1KJ3L 1UXWA 4G43A 2QQNH 2AKRB 3K0WA 4O00A 4KROD 5SWZA 1ORQA 3EAKA 3GK8L 3C8KB 4RAHA 3LDBC 1Y18A 4AENB 5I19H 1L4IA 5JPMA 5F96H 5FKPA 1XZ0A 3L6FB 3DSFH 3DX8B 1T22B 1ZA6B 2VSDA 3PGCA 1G1CA 4F9PC 1CCZA 2BOBA 3HCVA 3LRGA 5ERWB 5CCKH 4APQB 5GRJH 2V2WA 4WEBH 1F45A 2WMPA 3VWKC 3RL1B 3KPQB 2AJVH 4OUUA 4BZ1H 3PL6C 5IHZA 1PAMA 4Q7DA 2EIDA 4K94H 5FO9A 4FQ2L 1A1OB 1JV5A 1MH5A 2VZSA 2XFXA 1JCKA 5FGSA 3WIIL 2ADIA 2DQFB 4RMRA 1NBVH 2OLDA 2JJTA 4F58H 3PWVB 2IAND 3PWNA 4LGRB 1SMAA 1FZJB 5EC2B 3VWJD 4XTRD 2XNAA 1YEHL 3QI9B 3B9KC 1YNKL 4I1NB 1Q9KB 2ORBH 2PYFA 1HCFX 4GAYA 1R3HB 4JPWL 5JPNB 4LLYA 1V05A 1ITCA 3MJ7B 4XHJC 1NGXB 2LVCA 1BJMA 4JG0L 5IVNA 3SDDC 3W11C 2ZUXA 2IMMA 1W2KT 5GS0H 4OCNC 4X7DC 4OFYA 3BQUA 3WUWB 3GGWA 1WV7T 2X09A 5CINH 3U46B 5C70A 3MLZH 4XBPA 4LCYB 2GJZB 1C5BH 5GS3A 5MI0C 3BPCB 5EZLB 3S36H 2YSSB 1X7QB 1FC1A 3ZYZA 3FQWB 4WUKL 4MZ2A 1FRGH 1AQKH 15C8L 2IH3A 3P3YA 4OD1H 4OGXL 3SKJL 3OXSB 1X5YA 4E41A 4WJ5B 1NFDB 1UM6L 5KS9F 1QRNE 4CVWA 4Z5RA 1PG7W 2A6KA 2JF1A 5DK0A 3TNNA 5DC0A 3OKKB 3WNPA 3ZKQD 1Z2KA 3LZFH 1G7LB 1I9JL 1M7DA 3HI5L 5BS0B 3RTQD 2P8LA 4CL7A 2PO6A 3TBSB 1DDHB 4QRTA 2J5LC 4F3FA 2PNDA 3AUVA 4ZNEE 2YRZA 2DJSA 4MHHI 3SCMD 3DRTA 3HS0B 3U4BH 1G7HA 2XKUA 4RMWA 1PLGL 5FYKL 1U8IB 2F53E 5CGMA 3ZTJG 1GGCL 2CDFA 1I7RA 2EKJA 1C5CH 5EU5B 3AFLA 4NRYB 3KLDA 5C09A 3SKMA 3AC0A 4JFDE 3S34H 3V79C 5DJDA 3VDBA 4XB7A 3ARQA 2NXZD 1JK8B 1KGCE 5CUSL 1RJZB 1SVZA 2DTMH 2OTUA 4Y89A 4ZTOL 3QEQB 3DX9B 1J1XL 5I74B 1CLZH 1AO7A 5ID0A 1ZV5A 3EYUH 4KMTL 3RWGA 1YEIL 3X3FL 1JYVA 2HVKA 3LDBB 3C2SA 3BP6A 3UJTL 1SYVB 5A16B 1KB5H 4HPOL 3LB6D 4KQ4L 1BZQK 3T0VA 1BECA 2EC9T 1ZLVH 3L7EB 1UYWH 3QQNA 3VWKB 3V4VH 4HWZA 4YFLF 4MD4B 4WU5B 3PL6B 2XG5A 1F3DH 5HYQB 1NL0L 1MFBH 4QYOB 5TQ0L 4BFIB 5I1KH 4BKLA 2PXYC 4QXWA 4LIQE 4G7VH 5J3HD 2CDGA 3ARBC 1GHFL 4YLQT 5INDB 2MMXA 3A6OA 3VFUA 4MA8H 3UTPD 1YMMD 5CEZD 1KB5A 2HYMA 1LDPL 4JRXD 2P7TA 3B9KB 2W38A 1KIPA 1ZHNA 2FYYB 1MFDH 1Q9OB 4U3CA 5C2BL 2IGFL 5JHDD 2AEPH 3KLAA 1S5IH 2IPUK 5JOPD 4G3YL 5AAWA 2H26B 3V6OA 4TQEL 4LSUH 5FDWB 2VABA 3DV4B 5I1JL 1BF2A 1KTLA 3SDDB 4Z8FH 4MJ5A 1OP5K 3K1DA 5MERA 3EDKA 3T4YB 1LO0L 4R2GD 3K74B 4ELKB 3QG6B 2OXGA 1K3ZA 4PJIA 3BT2L 4X83A 2DJ4A 3JWOH 1M7IB 1JF6A 2PTVA 4XPFH 1MLBB 1YEGL 4K7PX 3IDUA 3K2UL 5BW7A 5MI0B 4Z18A 1IZJA 4XXCA 3HE7A 2X4UA 4GRWF 2P5ED 4U7SA 2N1KA 4WW1B 1UM4H 3ELAT 3H9SD 1PBYA 3LEVL 4XH2A 3UC0H 5KS9A 2AERT 1EO8L 1BFSA 3L3DA 4Z78A 2APTA 3GKWL 2EO9A 4F57L 2R2HA 3CLFL 4OCYL 3VE0B 4RA0C 4PRIA 2J5LB 1YJDC 1F4XL 3RAJL 3MRFB 1IARB 3OAZH 1ZWIA 2AEWA 5DRNB 3BGMB 3HUJB 4LCUA 5C0CA 4WTZA 1N59B 1OT1A 4PBWD 1B88A 4IOFD 5GS2H 3N06B 3FB6A 1DJSA 1MCDA 1CE1L 1ZLUK 4L4JA 2VLJA 2WBKA 4U0RC 5D2NC 3ARFD 5F88B 4NQSB 4ZAKD 1BX2A 2R0ZL 1CICB 3FB7B 1UFUA 2ZUVA 4LEOB 2N4IA 4QXUL 4BQ8A 5DWUH 3QDHA 2ITCB 3QFDA 3U30B 4HV8B 4UOW0 4FG6C 1DBAH 1XT5A 3FFCA 3I02B 4POZC 1CGTA 2X70B 3GJEA 4ZUSA 5D7IB 2ICEB 1YA5A 4MD5B 5BQ7B 4K9EL 5BVJA 3H7BA 5IR1B 2E9BA 2B2XL 3L3IA 4Y16C 1D6VL 2QKIB 2DQEH 4LSVH 3BEVA 4FXKB 1BBDH 1OAKH 4EVNB 5ADOH 5J11C 3K8KA 2UVEA 3TA3D 1C12A 2X9YA 5D7LB 4GO6B 1YY8B 5D71L 1DUZB 1VHPA 4TUOA 5E2JA 3EYFA 4YGAB 2DJUA 4L1HA 4H88H 1JPSL 1YEFL 4IS6B 1UVQB 3E6FA 4MNGE 1WBYA 4R8WL 4OCRH 1EVTC 3WFEL 2NY4C 4F7PB 1HHGA 1BD2A 5D7JC 4OD3H 3UPRB 5ITBH 4NUJB 5JW5A 4Q58C 2YR3A 4F9LA 2PXYB 3T2OA 1XGYH 4GXUN 3ARBB 2AABL 4KJWD 3QYCA 5DFWH 1OPGH 5EFIA 4MQ7A 3UO1L 2B0SL 2XKNB 5F3BB 4XGZB 4I2XA 4UT6L 1OAXH 1EIBA 2EYSB 4LGPB 1CLOH 5IK3A 3MJ8A 3CH1B 2D2OA 1MHHB 5DJ2A 2EKSB 4CVZA 1XGQA 4XP6H 1YPZA 5HHME 1E28A 4O9HL 4O5LH 3ZE1E 1IEAB 3O6ML 1LP9F 3VXRD 1PZ5A 5HHVL 2Y23A 1NKOA 1S3KH 3GMLA 4Y4KA 4HK0A 2AQ3A 2ITDA 3MCG1 2HFEB 4DGYL 1QSEB 5DK2B 2KUTA 1GZPA 5IFAL 1UKTA 3MV9D 4LVNC 1T0MB 4R97C 4YWGH 5D1QD 2X4RA 1W0VB 1B2WH 5F3HA 3T0AA 5GJTH 5KSVB 4FQJL 4PJCB 3KPSA 4XWGL 1M71B 5JXED 4HWNA 2R4SH 2Z93A 4LVOB 5SX4I 4FQCH 1OOAA 3EDEA 4ONGH 2CLRB 4PREA 1WTLA 1H8SA 1TNMA 2NW2A 3JV4B 2VUOA 1FLRH 4NQCE 4Y4FD 4JFZH 4PJ9C 1H3XA 2VZVA 3O3UN 4JPIB 4OJFH 1VA9A 3Q2CA 1WF5A 1KJ2L 4JFFD 2A83B 2EH7L 4R0LB 4U3HA 4XBEL 5JDSB 1KEGL 1CVSC 4WUUD 2GY5A 2D0GA 1T5WA 4GW4B 3U4EB 4LARH 3TWCL 3WUWG 2X4OB 4Y1AA 2GFBA 2YA0A 4FQPA 4NC1E 2Q20A 4G80A 1JGLL 3U83A 4LNRA 1HINL 12E8H 1L0XA 1N64H 1U8NA 1MCHA 5TE7H 2CK0H 3V5DB 3BD5A 4EI5C 2HG5B 3OKMB 3BW9B 3VG0L 1HKFA 4RSVA 3KS0J 4X9FA 5D2NB 3T65B 3EGSB 1VGKB 5C07D 3FT3B 2NY6C 1WCBA 4G9DB 4BJLA 1JNLH 5EA0L 5E56A 5CHNB 3IDXH 5D8JH 5IVZA 2JJSC 3F7YA 1SHMA 1LVEA 2EO1A 3ULVD 3S35X 4UV4L 3KYAA 4U1NA 3FQXB 3S98A 4ELMB 3OAYK 2Y5EA 4YHNB 4RMQA 1SEBB 1JGDA 3QUZA 3BN9D 5J11B 3MFFA 3P0VH 5IW1B 2QQNL 3P4MB 5HGAA 3WD5L 2X7LA 2QR0A 2WP3T 5AWNH 4HKXA 5FF6A 5I19L 2YMXH 5F96L 4XP5H 1KSRA 3BP4A 3X3GL 4TYUA 3SCMA 3FT4B 4K3JL 2SEBB 4LLAA 2NPLX 2NY4B 5D7JB 4WEBL 3HLAA 1P1ZB 1NAMA 1MCEA 4E5XA 5KOVC 2AJVL 4L3CB 1N0XH 4N9GB 4BZ1L 4BH8B 1KTDB 5JQHC 2FZ3A 3U2SB 1Q1JH 1UZ8A 4JO2H 4PTUA 2VR4A 5E6YA 3KLHC 3RZCD 3QFJE 1BM3H 4ZXBC 1NBVL 4G42B 4HF5H 3C2AH 2PYEA 4F58L 4NBXB 1SMOA 3WFBH 3L1OH 4Y5VA 4Z7UA 4JY6A 2Z91A 5HHPA 1JGEB 2FJFB 3G6JF 2R39A 5HDBE 1R3KB 1KJMB 4ZUUB 3MA9H 4P5TD 1CFTB 4L3AA 3VGAC 3BDYL 1VEMA 4ODHH 1X5IA 4R97B 2NX5A 32C2A 2O5XL 1R5IA 4JFYA 1J0IA 4S1SH 4ZFFB 1YQ2A 5DJXB 4PJXE 1OB1B