4PRID

Crystal structure of tk3 tcr-hla-b*35:08-hpvg complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
202
structure length
202
Chain Sequence
EDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQDLGTSGSRLTFGEGTQLTVNPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title A Molecular Basis for the Interplay between T Cells, Viral Mutants, and Human Leukocyte Antigen Micropolymorphism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4priD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4priD02
1JTPA 1AD9B 1AH1A 3X3GH 1DQQA 4H0HB 4TTGA 3L3IA 3W0WD 3UX9B 5JW5B 5GHWL 3HAEG 2ICES 3SE4C 4ZTOH 3T4AB 1Y0LA 2GUOA 4MZ3A 4MCZB 5ID1B 2OL3B 4QOKD 1F8TH 3F5WA 2F53E 3OR6A 1AIFA 3WUWB 3KYAA 1VENA 3BDYL 3ZTJH 5BS0B 2BVPA 4OF6A 4P59L 4M43L 3QXDA 5C0CB 4AT6B 3O0RH 1FRGH 4HEME 4RNRA 2DIAA 4JHWL 4N5UA 4KTEH 3PGFH 4OGXL 4XP4H 1FFOA 1NBYA 4OZIF 3MLUL 2BVYA 2XZCH 1J10A 2IG2H 3IDGB 3N1QC 5C0BE 1ZHLA 4WI9A 1UKQA 1H5BC 4WFGD 4HPOH 5CJBA 3ZT7A 2FWOB 4ZFGL 5IROA 1MI5A 1N26A 4LPVA 4I0PB 4P5MA 4PJIB 4NQEA 4MHHG 4ZPVB 2GJJA 3S5LA 2CRYA 2NTFA 1YY9D 3LRHA 1CBVL 5D9SA 3VXMA 4JHZA 5H94A 4LAJH 4DJMA 4UOJA 4OCMC 4Y4KC 3QNYA 4ZDHB 5FO9A 5GZNC 4LCIH 4CMHB 3Q3GA 5GGUA 2VOTA 3I3DA 3MUJA 1TQCC 4PY7B 5DRXB 3GSNL 4XAKD 3H7BA 1L0YA 4XPGL 4PJXE 2DD8H 1XGUA 1RUPL 2IPUK 4MNHB 1WICA 5HI3C 2V9RA 1KEML 3GBNH 2IQAB 4N90E 4EQ3A 4Y5VC 2Q8BH 2DM3A 4FQXD 5GGSB 5IHZB 4JZJC 4PB0L 1U36A 4XHJC 1MELA 1F45A 3R0NA 2QR0A 1OTSD 5D2LA 5AYUH 5LGJB 2ADIA 3QNZA 5DRNB 5I1JL 1IL1A 3GKZA 5DD0L 5KN5B 3TT1H 1E4XH 1OSZB 1YN7B 2VMFA 2YMXH 1ONQA 4LHJB 4ORZC 3B9KA 2GY5A 3NFNA 3SDDA 3ULVD 5E5MA 5F3HA 1OAQH 1PKQE 3CVIH 4NZUL 1ZHKB 2DJ4A 4HIJA 4U0RC 4GG6A 5CJXA 2Y9RT 3CFCL 2Z4QB 4ZSOB 5D7JA 3MA9H 3ARED 4HWEH 4GXVH 3CMGA 1C5DA 4EI5D 5I1GL 1DLFH 1KCKA 4UU9B 1VESA 3HC0A 3U46A 4R4BA 4LDOB 2CIIB 2EXYD 3U7WH 4OZHA 3F7RA 3BKJH 3EOBA 5DD3H 2OJEA 1VACA 5ESAA 2ESVE 2OXGA 3VFUB 4DUXA 1MI5D 4JE4B 2WQRA 5DJZA 2CUIA 3SOBH 2EYRA 5IK3A 2R2HA 3X3FH 4ONOA 5MEOA 3F7VA 3EOAB 3U9PH 4C58B 2BDNL 1NFDA 5TH2A 4K8RH 4JM2F 5F6HI 4LAQH 3SDCA 1I7UB 3N85H 2PXYA 5ANME 3B8YA 2XXMB 4Z7NF 3RGVB 4R97B 3MRRB 5CGYC 4HH9B 5F89A 5BVJA 5J11B 2I25N 2A0LC 1XEDA 4ODUB 4TNWF 3WFBL 3NABH 3AMLA 3PGDA 5D1XB 4MJIE 1S7RA 4Y4FD 2BJMH 1QFPA 4Y8DC 3BESR 1KTKE 3EUUA 2OBGA 5J06A 5KVDH 2YPLB 1NL0H 3CSGA 4Z7VF 4JFXA 3P0VL 5F1NB 1NCUA 2Y25A 4HHAB 1HINL 1S78D 2Z92B 4X6BA 2Y72A 4IOFC 5AD0B 1D5BB 1BQUA 5C09B 3B9KD 4K71C 3BT2H 4P5TB 3RL2B 5D5ME 4G80B 3O3BB 4JKWA 4UQ2B 1NCAH 3CSYA 3SCMD 3IKCB 5CHNB 1JWSA 5J12C 5D7JD 3HNSL 4D9QD 2NY2D 3HI6H 5GISL 4TVPH 3QUMA 2IF7A 3C2SA 5A16B 4PGEA 3DX6B 3CZFB 5TDOB 4G8IA 5D72L 4OTXL 4F9LA 4DUVA 1C5CH 1KSRA 3QUXA 5E1AB 1MVFA 3I9GL 3G6AB 1ZA6A 4XNXH 5INCB 2Z93B 3AU1A 1VEMA 4J3TA 1S9YA 3MRGB 1AY1H 3DYPA 3QEGL 2R69H 4QRSB 1QSEE 1AD0A 1E6OH 3VD7A 1VGEL 1NCBH 4L4VB 3INUH 5JOFB 1J8KA 4NHUB 3P11H 5DQ9A 1G0XA 4Y4HB 4RISL 3HLAA 3MYZA 1Z6JT 3ZKND 2X9YA 4NIKB 1RK1B 3PWNA 2K7QA 1MJJA 4JM2B 3PWVB 4LLQA 2QQNH 3NGBB 1SBSL 4GJTB 1K85A 2DI9A 5F70A 1KJ3H 4X7SL 4HIHB 2VDOL 3IFLH 1FYTE 4ZTPH 4XCFL 3VXTA 5I1AA 2IAMA 4JDTL 5IOPB 3QQ4A 1ZTXH 1XAUA 5CD3A 2HFFB 5FYKH 4F7MB 1CIUA 1VFUA 4BH8A 3QULB 1PSKL 4JG1H 5ALBH 2BY2A 2I07B 4PG2A 1I3RA 4OQTA 3VXQB 3ARFC 1LO3H 1U8PA 1A1NB 1HEZB 2JE8A 3CXHK 3IU3A 3STZA 1U58B 1RVFL 4HUUB 5C7XL 1MUJA 3MV7E 2GSIA 3K2UH 1EERB 1U6AH 4P99A 3SKJL 2GAZA 2HTLD 3E6HA 3T65B 4EEEA 5HPMA 4IMKA 2P5EA 4CGTA 4FNLL 5ITFA 1ADQA 1G7HA 3QUXD 2F74A 1DQLL 4S1QH 4B53A 3WO4B 4H0IA 4JKKA 5I8CB 1FE8H 1YPZB 3UBXG 1MCSA 2IPUG 4PRNA 1QACA 4KKCD 5E0QA 4JFHE 3MRQA 3KXFA 4JQXC 4R3SA 4NNYA 2X9WA 3SQBA 1CT8B 1J05B 4MA7H 3LEVL 2IPKB 2EDFA 4NO5A 2AAVA 1UENA 1WZMA 3W0WE 1JHLH 3LKQB 2DIJA 2FGZA 5KBNC 5BRZA 2NY3B 4K9EH 3D1MC 1D5MB 4L4TA 3TO2A 3BKYH 1LD9A 2JK5A 2XXCB 5E8DL 1H3TA 5KSAA 4QOKE 6FABL 5JDJA 5H8DA 4OJFH 4XNZB 4LSRL 4U31A 2F5BL 3WN5A 5HDBE 4HIEB 1J1XH 3OBAA 4GRMA 5DQJB 3FN0L 2ZOKA 1QYGH 2PCPB 5DJ0B 2HAZA 3IDJA 3O8XB 1YEJH 1SEBB 5DS8A 1YY9C 1D6VL 1N4XL 4J4PA 1MAMH 2AABL 3NCBB 1PDKA 4DZBA 3DUSB 3LHPL 4PJGA 5D7LA 2P42B 5LAXB 1XIWC 3PIQA 4HKJB 4LIQL 4UAOC 3KLHD 5DMYA 4X6EB 5IVXB 2Z35B 4ZFGH 3L3GB 1ZEAH 1A3LH 3CFDB 4FQ2L 4P46B 1UJ3A 1FFQA 5B38B 2XTLA 4YAQA 2GITB 4RGMB 4FQXC 4HF5L 4BSWA 1SY6L 4IDJH 4JQIH 3HFMH 2DLTA 1OTSC 2Y06L 2B1AH 1DVFD 3HE6A 4LHUG 4O51A 3B83A 2F5AL 1DBJH 2OSLB 4NJAL 3U0TB 3QO0A 1TETL 1I3UA 3WFCL 2BY1A 3C87A 4Q0XH 4Z7WB 3C8HA 1MCOL 1TZGL 1CVSC 3R8BB 5EUOA 1A4JA 1KNOB 2DQGL 1DQMH 3HAEH 3ARDA 1CQKA 3PWUA 3ULVC 1KLGB 2NW2B 3GRWL 4Y5XB 3QCUH 1Q9KB 4C4KO 1NGPL 4PB0H 1NGXA 2VLJA 1KCRL 3AREC 2XZQL 4BH7B 3G6DH 5FV1L 4EI5C 4HUXA 4ETYA 3DROA 3TF7C 1X5KA 1WVZA 2W0LA 4XVSL 5I1JH 3LDBB 2FDBP 2EXYC 1YZZA 3AXLA 1RPQA 4L4TD 1NGYA 5CEYB 5FGCB 1I1YA 3IF1A 2CJUL 3QHZH 4DQOL 5KSAD 2V2XB 1IGTB 4XP6L 1KF9B 2D2OA 3EHBD 3MRDA 4NOFA 2ZSVA 4S2SB 3JUYA 5IROC 5KANG 4JJ5B 4HLZG 5E2TH 1RZGB 1DN2A 2RFXB 4AL8L 3RHWK 3ULVE 2C3VB 1P84K 2ENSA 4WUUB 3SE9L 3I02B 4PLJD 1TVDA 2N7BA 1X5JA 1JWUA 4X4ME 3KYKL 4PUBL 4J4PD 1FLRL 1MSPA 3LIZH 3QNXB 2YD6A 4FQLH 4ELKA 2CLZA 3ARRA 5D7LD 3VDCA 4YHLH 1D6EB 2HLFD 4HV8A 3K8MA 2CRMA 4X8JA 1ZGLP 2AKRA 4LHQB 1EFQA 5DEFA 4JFFA 4V1DD 5J3HD 2WBJA 3ET9F 3PP4H 1MI5E 2DQJH 1SJEA 3EO9H 4LMQI 4Y4FC 2YZ1A 4NQEE 1ZANH 3EYSH 1ZVSA 5HHVL 2YEZA 4JY4A 5I16A 2PYEA 2CRIA 2J88L 3BEWB 4OT1H 2P5WB 4D0BA 5FYLD 1V3MA 1JHTB 3TLRA 1JBJA 3MNZB 1VEPA 1S78C 2W92A 1OQOA 3ULUD 2AV7B 1A6ZB 3B9KC 5EBWA 3EGSA 1JF1B 4ODWA 4NM4H 5DR5L 3QIBA 1YMHB 1G7LB 4LSTH 5IMKB 3GJEB 1IM9A 1LHZA 1SBBA 5DUPH 5HYQA 1JIBA 3Q5TA 2C4FU 1LMKA 3MFFA 5D7JC 1YJDH 3IS1X 5CBEB 1NCDH 3G5VA 2NY2C 4B50A 1T22A 4PRPD 3ZLQC 2PTUA 5D2LE 1TVHA 1SMAA 1I7RB 4LASH 1T0MB 3QXAB 4UT9H 4HUNB 4UNTA 4LLUA 3F58H 2ZWLT 4HZAA 2HJKA 3RY6A 3WIHA 1E27A 1A5FH 1W0VB 4Y19D 5SWSA 3T77B 5KJRH 4DGYH 2VDQL 3DMMA 3KYNB 4OGZA 3GSNB 3LZFH 2IH1A 4NT6B 3R06B 1RZIB 4ZNCD 5EN2A 2GK2A 3VXPB 3HAEB 4OKVA 1V8HA 3S3SA 2APFA 5F93C 4PJFA 1G9MC 3D25B 1OM3H 1IZJA 3OKDA 1Q9OA 5JHDA 4P4RB 2XIDA 3TO4B 3PNWA 4KTDH 4YO0B 3UO1L 1S7SA 3SDCC 4NSKB 5DD5H 1CICB 2LTQC 2XQBL 3I9GH 5I8OH 1K2DB 3I75B 1KEGH 3QEUB 3QFJA 5D2NA 4PRIB 3GIVA 5EBLA 3QEGH 3RNQA 3K4AA 2AJUL 5E08L 2FH8A 1CD8A 4JFFD 1RUKL 2Y7QB 3HG1A 4G9FD 4A2LA 4P2RA 1A1MB 2P4AB 1DBBL 5L0QC 1NC2D 2XT1B 5EU4B 3SGKC 2QBWA 4MNGE 4YXKH 2Q76A 5F8RC 2B1HH 3ZMRA 2QSCH 4K2UH 5ELIA 1NGWB 3WL9B 3H3BC 3QDJB 2PYED 5GS0C 1L7IL 4BM7A 1H9VA 1DANT 4HUVB 3LQMA 5I15L 3QRGH 3CC5B 2ED7A 3JV6B 4X7SH 2VDOH 2IPTH 1IM9D 4O4YH 1OB1A 1JRHH 5C0DB 2D0HA 5T3ZD 3WNLA 2HG5A 3U6RB 2HTLC 1AD9A 3ZHKA 4QT5B 1GC1C 4LVNC 4JFPB 3WLWD 1K6QH 3GHEL 3NH7L 1PSKH 3QUXC 2H2PD 5JW5A 2F19H 4NHCL 1PD6A 5E8OB 4UIMB 3RWJB 2QJDA 1D5IH 4FQIL 1BREA 4MCZA 5JHLH 5ID1A 3G08B 1ZLUK 1Z9SA 5D93C 1RVFH 5FCUL 3FOLB 5C7XH 2AQ1A 3BO8B 4R4ND 3WUWA 1XGQB 2AI0H 4PJ7B 2P8LB 2R9HD 1KXTB 5IBUG 4MXWL 4DKFH 1ZAGA 2IQ9H 4TSBH 5IUSA 4AT6A 4LSQL 3O4OB 5DUBB 2XY1A 4N0YL 4D2NA 1YQVH 2RGSA 1NCCL 4WI5A 3E2HB 5HGBB 3H6JA 3MTRA 1B0RB 3IDGA 4ZOCA 3DGGB 4P2RD 2VJXA 3JWDL 1KTLB 4NQDD 1Z5LB 4RGNB 4S1DC 1UCTA 5CZVH 1OPGL 5DO2D 2DTSA 4PJIA 5DI8B 5CBAB 1NAKL 2HP4A 4UTAL 1VGKB 4WWKD 3SKMB 4D9LH 3MODL 2G2RB 5BVPL 1OP9A 1AGCB 3VFMB 1QEWB 4J6RH 1FNLA 1I1AD 4F33B 1F11B 4ZDHA 3S34H 4ENED 2R29H 4XPTL 1AKJB 2EIBA 2NXZD 3SE3C 2F5BH 4PY7A 2VLRD 1CN4A 1FBIL 3RI5K 1P1ZB 4U7MA 2VLLB 4WEUD 3VFWB 4MNHA 1N4XH 4AH2B 2IQAA 3QPXL 2G9HB 3BUYB 4OFVA 5CINL 5GGSA 5IHZA 5JTWA 2AJVH 4TSAH 1FHGA 3RVXD 4KK9D 1F5WA 5LGJA 1FVCB 4TQEH 5DRNA 4DEPC 3MA7B 4QNPF 4RRPG 4ERSH 2BMKB 1QFOA 5KN5A 1OSZA 1YN7A 2DLIA 1LEGB 3OJDB 3V4PH 5DLML 2OP4L 4XAWL 1SY6H 5AZ2L 3MGOB 1RZ7H 3CLEH 2MKWA 4L8SA 2Z4QA 5C0RL 4ZSOA 4NJAH 5J6GA 3ZL4H 1NSNH 4ZO6A 2VZVA 4XBEH 1TZGH 4JRXD 5ISZB 4JFYB 4UU9A 2MCPL 3QQNA 1T1WB 5K9QG 3HR5B 2X10A 5KSAC 1U3HB 2CIIA 3MCLH 4KROB 3QZWG 3PWPB 5DYOB 4DK6A 4K23L 5IFHL 2GJ6D 1W72H 3VFUA 1KCRH 2XZQH 4JY5H 4NCDA 3L3DB 4A2MA 4J4PC 1U8HA 5IJKC 2JELL 3LRGA 4GRWE 5JIIA 4XVSH 3QDGD 3UJIL 2HLFC 2YXFA 2C1PB 1MY7A 2Y6SD 2CDEA 3BSZL 3IETB 1I9EA 3MV9A 4L4TE 4G8EA 3UO1H 5I6XC 5J3HC 2C3GA 3RGVA 3MRHB 4MS8D 2VSCA 3MRRA 4HH9A 3W9EB 4IJ3C 4JO4L 3KYKH 3SEPA 2D03H 4ODUA 1FZJB 5ILTL 5D1XA 4NKIL 3HMXL 4YXHH 5IHUL 1KIUA 3K0WA 4ZFFB 4PJGE 5D7LE 1ZWIB 4LP5A 3ROLB 4PJCB 4ALAL 1X5GA 1TITA 3ULUC 3VA6A 2GCYB 1XFPA 3ARDC 4HHAA 4C4KT 1KBGL 4V1DE 1I9RL 4NC0B 5AD0A 1D5BA 1HQRB 5C09A 5I9QB 4P5TA 3RL2A 4G80A 3O3BA 4UQ2A 5CHNA 3ZDYE 1YEEH 2VUYA 3VRJB 4G5ZL 3HRZB 4TUKL 1EEQA 4FFYL 4Z7UB 2MCG1 3PV7A 3MLXH 4Z95L 2AEQL 5FYLE 1RUAL 3JXAA 5A16A 3CZFA 5TDOA 5LGKA 3SKOA 4PB9L 3T3PE 5EUOE 3ULUE 5E1AA 5INCA 5DR5H 1H8NA 2Z93A 1MVUB 2P47B 4Z0BL 3QXVA 4RMWA 3MRGA 1GGBL 4K3JH 2EH7H 2NY5C 4QRSA 3PG2A 2YD8A 4HBQA 3H9HB 2HJFB 5B3JF 2RQ8A 4L4VA 4FHBD 4V2BA 3H0TB 5JOFA 4NHUA 3QBTB 3CNKA 1OLZA 1LEIB 4PRPE 1DUZB 1XF4B 4Y4HA 4BKLB 3Q5YA 5I8KL 2NYYC 3UJJL 2Z8VC 3MV9D 1RK1A 3S3JA 5HHOD 4JM2A 5TQ0H 2A83B 3PWVA 4GAGH 5C0EB 1TJIL 5FDYA 5EBMB 5GJSH 4Q2ZB 1AHWB 4FTVD 5IT2L 4NOBA 3BXNA 4HIHA 4M6ML 2CLRB 3M1BB 3P9LB 3FQRB 1W72B 3L3JB 1CLOH 3P77B 4GMSH 2ZG1A 4X80H 1JFQL 3CLFH 4XPBH 1T2XA 5DURB 1MOEA 5IOPA 5GGTA 4O9HH 2OM5A 2YKLL 4DVBB 2HFFA 1L9MA 4M3JA 2AJUH 3OKKB 4F7MA 1A14L 2EIEA 1YEGL 4JFFE 2D7QA 4G9FE 2I07A 5HYJB 3VXQA 4GQ9H 1TPXC 1AQKH 4RFEB 1A1NA 3LN4B 4ZUTB 1KCUH 4PRHD 3H9SB 5CJOL 4HUUA 4LSSL 2AXGB 1X6NA 4QXUL 2PYEE 3ESUF 3UJTL 3MUY1 2H2PC 4UB0L 5D70L 3RY6C 3T65A 3T0DA 3OGCB 1F4XH 1N7ML 1HH9B 4U2YA 1YNKH 5FEBA 4O02L 5KTEH 2A1WL 1CU4L 1P4LB 1H3XA 3HNTL 1SEQH 3IFNH 2OZ4L 3HR6A 3FO2B 3D2UD 4H26B 4LHUB 5I8CA 1I7TB 4YE4L 4AEHH 4Q7DA 1U8MB 3AM8A 4R4NC 1YPZA 4RMVA 1U0QA 1A7BA 1BFVL 2R9HC 1IC7H 2ED8A 3L5JA 3C6SB 3FRPG 5T3ZE 4NUJB 4OCSH 4JN1H 4K3HA 1CDUA 3MLRH 3TJEH 1CT8A 1J05A 4BZ1L 5GS2D 5D2NC 1LE9B 1BGXL 2GY7B 3IU4L 3LKQA 4JO1L 2DQIH 3IAPA 1XGRB 4RQQB 3SE8H 2KH2B 1D5MA 2CK0L 4WGVB 1MFEL 3TZVD 1KIPB 4U4BA 2BZDA 1FG9C 1IMHC 4HIEA 1FIEA 4PJFE 5DQJA 3SPVB 5DO2C 3DO7B 2PCPA 4LU5L 5DJ0A 3QH3B 4KI5C 3O8XA 5FFLA 5F88B 5JHDE 1F6AB 4WWKC 1SEBA 3UYOD 4N0YH 1H8OA 4YDVB 1MCLA 3CFEB 2F54B 5L2JB 1YNLL 1UWEH 1I1AC 3O6FB 3DUSA 3QFJE 5D2NE 4ENEC 4XHQA 3K46A 4HKJA 4UIKH 2NXZC 4G7VH 2DMCA 1WJ3A 5IVXA 2Z35A 4EBQL 4P2RE 3F62A 1Q9WB 5DMIL 3V5HB 4XMKL 3L3GA 4DZ8A 2YRZA 2B39A 4P46A 3PQYD 3NIFF 3V0VB 4DW2H 3QEHA 2E6PA 1NAMH 3RVXC 5HSFA 1UZ8B 1P7QA 5E4EB 5B22A 5MEQB 5CEZL 4UBDD 1DFBH 1GAFH 5CJ5A 3U0TA 4Z7WA 5LVEA 3S37H 1KNOA 2HLAB 2KPNA 3O11B 4NZDA 5JQ6L 2VLRE 3H3PL 3GJFK 1I1CA 1ACYH 1II4E 4KKAD 5K9OB 2NW2A 4ZQKB 2MQCA 4JO3L 5CINH 3KR3L 4JFDB 4U6HB 1WAAA 2A2QT 4KJPD 5EU5A 3WSQL 4BH7A 4RFNB 5BMFH 4KXZH 5C0AD 1A7NL 1JN6B 1I8IB 1KPUB 1RU9H 4JREB 3AS0A 3FO1B 3KPRB 4WTXA 1YYLH 2HMID 4OZFA 4HK3N 5CJQH 3T0AA 3PL6B 1T83A 4LGRB 2DBJA 2FSEB 4KJQD 1IGTA 1BQHG 1MLCB 1UM5H 5EA0H 1RZGA 1SYSB 2RFXA 4PJ5D 4HX1B 3BRDA 3SKNB 2C3VA 1HIML 4WUUA 1IFHH 5HHXL 3I02A 3I2CL 5E94A 1MWAH 3WIFB 1YEKH 5HVHB 3VWJD 1IJ9A 3L9RB 4ZFZB 4KQ3H 2Y6SC 2D4FA 1UG9A 5FYJH 1KN2H 4KVCH 4JRXE 2X40A 3HI5L 2IGFL 3FB7B 5KW9L 2H6PB 4HQQH 2VAAB 5I0DA 4FXLA 2EE3A 5GGSY 3ZHDA 3WNPA 5IFHH 4PJEB 3A6OA 2ZCLH 2F15A 1RUQL 3TJHD 2WIIB 1BD2D 5J1AB 2ERJC 2GJ6E 4L3EB 1ZOXA 2Q8AH 3A6BH 3MMEB 4MAYA 5I1CH 1DLHB 4PJIE 3V4UL 1J1PL 2HKFL 1T89A 1P7QD 1GZPB 1W0WB 3QDGE 1S5IL 3BSZH 4F8TA 1EVTC 2GT9B 4PLKD 3BEWA 2P5WA 2Y5EA 2HT3D 2YC1B 1JHTA 3O81A 4M61B 2CGRH 4GG8B 3MNZA 1L9NA 5FUOL 4YGVA 5CKGA 1I1FB 4NM8H 3TVMD 2AV7A 1A6ZA 1M05A 4QY8B 1JF1A 1G7JB 4D3CL 1G7LA 5IMKA 4LL9A 5H37G 3SGEI 4G6AD 3R1GL 4OKDA 4L8SC 4NKIH 1ITCA 3P2TA 2VLKB 2C4FT 2ZG3A 2FECL 1JMXA 5GSVB 3MV8B 5CBEA 1NDGB 3IDXL 1OGAB 4HS3A 2VC2H 4K3DL 4JFQB 5IHLB 1C1EL 4ALAH 4RGOL 3BGMA 1EIBA 1I7RA 1NAMB 1T0MA 3QXAA 1TTGA 1RV6X 4XZUB 4CVUA 1TVBB 4WI7A 2NY6D 1AC0A 2AK4D 1K5NB 1W0VA 3MXWH 4PJAE 3K3QA 2QSTA 1KOAA 4MB4A 3VH8A 4PV8B 3KYNA 2ZJSL 3GSNA 4I0CC 3RWCB 4NT6A 3RU8H 1OVZA 3P73A 1RZIA 3AAZB 1S7WB 4LPWA 4PBXA 3AUVA 3VXPA 1FJ1B 4WHDA 4XPFH 1T3FB 5K9JH 1HZHL 3SDAB 2FGWL 3D25A 4JPWL 1KCLA 3D85B 5DD1L 1FGVH 5FF6B 2FX9H 1QR4A 4HT1L 4X7TB 1BWMA 4GMTH 4P4RA 3TO4A 3VDAA 3I3EA 5FA3A 4NSKA 4OAWA 4PB9H 1CICA 3RDTB 4TPRH 1S7QB 2O5YL 4S1SH 1K2DA 3I75A 2ARJB 4NZRL 3QEUA 4PRIA 3DVFA 5DEGB 4Z0BH 4OZIE 3RGVC 2VLMD 2CIKB 3DSFL 5AG8A 2FHFA 5EO9A 1T7WA 1OAUL 2Y7QA 1RIHH 2ZUSA 1A1MA 3FAXA 2DQEL 3ZZ1A 1T03H 1IGML 1F90L 2EO9A 2R2BB 4G8GD 4K7PY 5EU4A 4MAYD 5I2IB 1G6RL 3QDHA 1E4KC 3V6FA 1AE6L 5DQDL 2R39A 4U6XB 5GRVL 3WL9A 1NGWA 3QDJA 2ZUWA 3DGCR 2F58H 1TJIH 3MV9E 2R56L 4HUVA 1JUFB 5HHOE 4YQXH 1S7TA 2ZPKL 3CC5A 2CDFB 1QA9B 4QHNB 2G5BB 3MRFB 3JV6A 4FTVE 3EW3B 1A8JH 1AO7D 4JFZL 1PEZA 1HN1A 1OWWA 4HFUH 1JFQH 5C0DA 5JA9A 5ICZA 3WMSA 1UB6B 4CDHA 3OG4B 3U6RA 2Q7NA 3O3AA 1B9ZA 1U9KA 4I3RH 1FNGA 4JFPA 3NZHL 2XACC 3TNMB 1NKRA 2V5MA 1GZQB 4YBQD 1R24B 4UDTB 3LS4H 1NEZG 3RWJA 5C09E 2ZP0T 3WFDL 5EUKB 5FGBA 3QUKA 3G08A 4XP9L 4A6YL 3U36B 1HNFA 4MXQD 3FOLA 4XVJH 3BO8A 4DN3L 1F58H 4PRHE 3K74B 4PJ7A 2P8LA 1LQSR 4Y4HC 4MA3B 4YDKH 5D70H 2D7MA 1QHOA 1ZGLA 3VE0A 1MCWM 1ZS8B 3EJZD 4GW4B 5CSBA 3DTXB 5FKPB 4JB9L 1RUML 5DUBA 1A9BB 2J2ZA 4L5FH 4ODTL 4OQ1A 1F97A 4YHYC 5HGBA 4YE4H 5SWZD 5K93A 1B0RA 3TZVC 3LKPB 4F80A 3DGGA 3UEZA 4RA3A 3HN3A 5CIPH 4CDGC 1KTLA 5DFVD 2H9GB 3MBEB 1ZLUH 5I17B 1Z5LA 1RJYB 3ZO0A 2XKNB 4BZ1H 3QXWA 3OKMA 4NUGL 3TA3B 1S7UB 5DI8A 4FG6D 2EDYA 3V8OA 4JO1H 5CBAA 1U8LB 3SKMA 1J8HA 3T04D 1CF8L 4KVNL 1AGCA 3VFMA 1QEWA 2A74B 4F33A 3NN8A 2CK0H 1F11A 1MFEH 3KHQA 3SHSA 1AKJA 1LO0H 2BSRA 3VGDA 4Z7NE 5E4IA 1B88A 1I9IL 5J4MA 1JPSL 3RZCA 2Z31D 3FQUB 3MO1B 1UZ6F 4I4WB 3CJJA 1IBGH 1P1ZA 2A9MH 1K8IB 4G6KH 5E8EB 4R2GD 2DM4A 4AH2A 1YNTB 4ZPTB 1YA5A 5D6DC 3BUYA 1KUMA 3TC9A 3ARGA 1S3KL 3Q48A 4KTYA 7CGTA 1XT5A 2FEDC 1N6QL 1AP2B 1FVCA 4JPKH 3WO4C 1MQKL 3MA7A 4Z7VE 5DMIH 3H3KA 4M8QB 3NCMA 1YYML 4WCYL 4LSVL 1C12A 2BMKA 1QHPA 1WT5A 4JKLA 4PGBB 2WUBL 1B0GB 3OJDA 3GSOB 2YUWA 5KVMC 3PQYE 4PJBF 5I1HL 1CG9B 1RZFL 3MGOA 4MB3A 4UV7L 1NMAL 3PHSA 2OI9C 4N0CD 5CEZH 1B2WH 5LKNA 3OX8B 2R0ZL 1HWGB 2DTML 5FHAL 3S98A 5ISZA 4K94C 1P7KB 2HMIC 1BOGA 4JFYA 3RY4A 4NJ9H 1T1WA 3HR5A 2BFVH 3C5JB 3T4YA 1U3HA 1WV7T 3KS0H 4KJQC 4H8WL 5A2JH 2AJZB 1ZSDB 1MRCH 1YMMD 1GCFA 2FHBA 5EH1A 5CILH 1AGFA 5DYOA 3MOBH 3EZ8A 4PD4J 3E8UH 5F7WC 1MRFL 3AS1A 2VH5L 3O8XC 1FV1B 4NC1C 3L3DA 4N8PA 1QRND 4QEGA 5IB2B 3VWJC 1U3ZA 4B7LA 1SJXA 3V0AC 2FIRT 3O2VL 1FCGA 1GPOL 4MYWB 1P4BL 1BEYH 3CGTA 1J8HD 5ACLA 4LMQE 2C1PA 3RFZC 2E6JA 2AJSH 3CMOL 4N1EA 3IETA 4N0FB 1JZ3A 2QQKL 2FIKB 1MCKA 3TJHC 3HB3D 2IJ0C 4FP8L 3C6LB 3MRHA 3RZCD 5HHXH 4PJ5E 3SJVD 2L7JA 3I2CH 4NQCB 4Q6IB 3W9EA 3GO1L 5FO8B 2Q87A 3RWFA 5CIPB 3UTTB 4F3FB 2V2WB 3UROR 4P3CL 1RHFA 4EDWL 3O2DL 1J5OL 1FZJA 5CKAA 1A7PL 2PN5A 3MCKB 3ARGD 4GS7C 5B39B 1KJ2L 2H1PL 3QEQD 4X7EC 3HI5H 4PLKC 1EV2E 2HT3C 2DLHA 4ZFFA 4PJ8B 5JUEL 1ZWIA 3IDYB 3ROLA 4OLXL 3RIFF 4PJCA 1DL7H 3TVMC 3FHQA 4OGYL 2GCYA 1PX4A 5E8PA 3B2VL 2IBZX 1DBML 1HOCB 5IESH 4M48L 4HXBL 1CQYA 3TV3L 1A6WL 2FNBA 4G6AC 1BD2E 1HQRA 2DKMA 1PJ9A 2NY7H 4NZJA 3WDHA 5FYKU 2E7LA 2YA0A 1T5WB 1HI6A 1QNZL 5L2KB 2XQYK 5I1IH 2GIYA 3VRJA 1NBQA 5KVGH 4EN3D 1WUNT 2CKNA 1I8KB 3HRZA 4OV5B 4Z7UA 4QRRD 2NY6C 3QO1B 1A6PA 2WW8A 3NFPB 4N1HB 3S5LG 3ZKQD 4DKEH 2CUMA 1T83C 3QG6B 1LVEA 1GOGA 2DBLL 4D3CH 3GI8H 1CFVL 1MVUA 2C4XA 25C8L 1UGNA 5EC2B 2F8XC 3QDAA 4OM1L 4L8BA 1T66D 4YZFF 4Y7MA 2HJFA 3PV6B 4P4KB 4LLMB 3F7QA 4K3DH 3SN6N 3OTTA 2APXA 4F2MB 1SY6A 1LEIA 3L5XH 1EEUA 2GTWB 3DNKA 1DUZA 1RMFL 1H3PL 1XF4A 5L7XH 1J11A 4X6FB 4Q9CA 2C3HA 1QFWL 3DURA 2CSPA 1EX0A 3FT4B 3ZTNH 2DQFB 3HNVL 2A83A 4XWGL 1AJ7L 5C0EA 4WHCA 4HUWA 3BWUC 4FABH 1RURH 5EBMA 4KHTL 4P23B 1AHWA 1M4KA 4Q2ZA 4MQTB 4AEIL 1KACB 4MAYC 1QPPA 3GRWA 3VXUD 3WNOA 3ZSTA 2O26U 4LGPB 2CLRA 3M1BA 3NMEA 4HT1H 4LCYA 5FK9B 3FQRA 1T6WA 3L3JA 1DR9A 1OTUC 3T1FB 2V5RA 3BH9B 1EMTH 3BEVB 1IAIH 5IW1B 4XMPH 5FB8B 4DVBA 2F53B 4U1GC 3CXDL 4M7KH 2VLME 5EULV 3O6MH 3WXWL 4LDLB 5AYQA 2I60L 1KIRB 1I7ZB 1IGMH 1UVQB 3OG6B 5HHMB 3UC0L 2JJSA 5HYJA 4OCLC 4TULH 1S8DB 4F7PA 4R8WL 3CFKB 3QHFL 3Q6FB 1QUNA 3J7HA 4KQ4H 4RAHA 2BERA 3LN4A 4ZUTA 2X89A 3H9SA 3CUPB 4Y2DB 1NC4D 5H37H 1ZA3B 4YWGL 2AXGA 4RAVB 4FOMA 5CSGA 1J0ZA 4CW1A 2HTKD 5HYFA 2RBLA 5H35A 5C0BB 4IS6B 3GMMB 1CWVA 1HHJB 3OGCA 1HH9A 1A2YB 1P4LA 3DX7B 2VDNH 4H26A 4LHUA 3EKCA 4MXQC 1AO7E 1FQ9C 1U8MA 2CPCA 3G5ZB 5KOMC 1I75A 2OXHA 5LBSL 5L6YL 5T1LB 1I3GL 3BRFA 3C6SA 1WIUA 1QFUH 4Q97A 3P4NB 4MSWA 4NUJA 5F8QC 3EJZC 2XI9A 5JW4R 4L9DA 3T0EB 2NR6D 1LE9A 2YD7A 4PJXB 1XGRA 4M8VA 4RQQA 2BRRH 1H5BB 5DA0B 2YR3A 4XP9H 1CGUA 4A6YH 4K3EL 4DN3H 1KIPA 2RR3A 3BD3A 1G9NL 4ESKA 3ILQC 1L7TL 4DN4L 3SPVA 3QDMA 4HBCH 3DO7A 1D9KD 1QRKA 3AMKA 2G5RA 3S3PA 3B5GA 4FG6C 5F88A 4XMLH 2D7OA 5LJYH 1F6AA 4R7DA 3QWOA 4YDVA 1F02I 3CFEA 3KPLB 2F54A 1BP3B 5L2JA 2HFTA 3O6FA 4L1DA 3UCRA 5L8LB 1TQCB 2LV4A 4PY8J 4YHOH 3BZEB 1B3JA 1F42A 1J7VR 1PKQB 2YBRA 3QA3B 4KZEL 3MLPA 1XR8B 2Z31C 1Q9WA 3SDYL 3RX7A 5ICYB 3TIDA 3V5HA 1G9ML 3BYYA 4R2GC 5EOQL 2D9CA 4Z5RB 2OLDA 5FOBB 4JZJB 4FZ8H 2H41A 1BJ1H 2CR3A 1KT2B 1GVIA 4HXAL 4ODXB 1UZ8A 3U7YL 4ONGH 1N6VA 5TPWL 5BQ7B 5JOPE 5MEQA 1T7ZA 4WEBH 4O2FB 2ESVB 3O3EB 1JNJA 4YBHA 4YC2C 5FGBC 2DYPB 4HUMB 4KKBC 2Y23A 1AC6A 2HRLA 2HLAA 1JF5A 4OCWH 4JKMA 5IBLD 4WDIA 5CZXD 1S7VA 5K9OA 4DVRL 5HHQB 4U0RB 1LDSA 4ZQKA 2YS4A 3QFDB 1U8KA 3B6SB 4N0CC 1RIUL 2A6JB 4JFDA 1R3KB 4U6HA 5FA4B 1IAIM 3GB7B 1FL5A 3O3UN 2CK2A 1B4JL 1CFQA 3SKUD 1A6AA 5DHYA 3E2HC 1MQKH 5ANMB 4DGVL 2N7AA 3U7AA 3D87B 1IKNC 1I8IA 1KPUA 2FB4L 3DXAA 2E27L 1W8OA 3KPRA 4UOW1 1JGEB 2P43B 4OLWL 3PL6A 4MJ6A 1IAKA 4XXDB 5I1HH 4YHIB 2FSEA 4FZEH 3VW3L 4UQ3B 2OJZL 4MJIB 3RAJL 1MLCA 1RZFH 1KG0A 2DQUL 3GJFH 3CVHH 3QDMD 1FORH 2XQYG 3GHBH 1BQLL 2FJHB 4MD4B 3B2UC 1IILE 2DTMH 3WIFA 4E42A 1AXSB 3WD5H 2X5PA 2NW3A 3V7AG 3CK0L 3L9RA 4L3CB 3KPQB 4H8WH 3FB7A 5L8KB 5D5MB 1FAIL 2VAAA 4YNYB 4OI7A 3HB3C 3S88L 3KYOA 1ETZB 4KKNA 2BSED 5TE7L 3RZCC 1MRFH 1YMME 4PJEA 1G7QB 4M7LT 4J3SA 4A6YB 2WIIA 1FGNL 5J1AA 4DTGL 4LRNH 3EFDH 4L3EA 4PYGA 5HDQL 3MMEA 1QRNE 1P7HL 3ARGC 1IEAB 4JDVA 3M45A 3NTCH 1DLHA 2BSSB 5ECJE 5HI4D 5MP6L 1GZPA 1W0WA 1J8HE 2GT9A 3ARTA 4GBXB 2YC1A 4M61A 3VCLB 4GG8A 3X11B 2W9DL 4NPYB 4FP8H 3VJ6B 3LD8C 3QB7C 1I1FA 2EDDA 1P53A 2RCSH 2FECI 4QY8A 4JG0L 4JLRB 1G7JA 3SJVE 5J12B 3IS0X 5JMRA 3S8WA 3O2DH 4LNRB 3IXTB 4CADA 1KJ2H 2H1PH 1YEFH 2VLKA 3MJ9H 1BVKB 3SBWA 5GSVA 3MV8A 4EN3C 3TYGH 3HUJF 2KQNA 3QEQE 4U1MB 1OGAA 4MWFB 4JFQA 2B0SL 2FD6L 2VAJA 2EYSA 3EJYC 3JVGA 2R15A 3DXAD 3WO3B 1DBMH 4XZUA 4M48H 1C8PA 1TVBA 1EXUA 5HDBF 3DSNA 1SVCP 1FNFA 1FYTB 1KELH 1K5NA 3GIZH 2FATL 2VXTL 3RL1B 4FQPA 1WBXB 3U9UB 5BJTB 4PV8A 4Z78B 1T66C 4LLWB 4O5LL 3RWCA 1U91B 2OMNA 5IVNA 1INEH 3AAZA 2JB6A 3K8KA 3RIAF 4ZNEE 1S7WA 2AS5M 3VD4A 3SGDH 1FJ1A 2CMRH 2NNAB 1T3FA 1RZKL 5FF6A 4NQXB 1OSPH 1KN4L 4QRRE 5T3XD 5DJCB 2BRQA 3RDTA 2ARJA 4Z7QF 5C71A 4JZOB 5DEGA 5FM4A 4B0MM 3U4EB 2CIKA 5IB1B 4LRIA 2VXQH 3U4BL 4QCIB 2NX5D 1U92B 2E5EA 2LE9A 4OF7A 4WFHD 2OTPA 3MV7B 3RQ3A 5LGHH 4OCRL 1Q8MA 2OS7A 2LVEA 2QHLA 2R2BA 4J7RA 5GGRB 5I2IA 4XCYB 3GJFB 4LQFL 4LOUC 4U6XA 3C5ZB 1Q0YH 2UVEA 4GRLB 3ULVH 2NY0D 1JUFA 1XGPB 3ARFB 1TJHL 5I19H 1MHPH 1CGXA 5I18H 1YEDA 2CDFA 1QA9A 4QHNA 5LCVL 2G5BA 3MRFA 1NBZB 4ZOAA 2DDQH 4U2ZA 3GMPA 3MOQA 2VZOA 1UJTA 3STLB 3P0GB 4P2OD 3VXUE 1GHFH 3K7UA 1A3RL 3W0WB 4DWHA 4BA8A 3FT2B 5SV4A 2B5IC 2HTKC 3DX9B 4HDIB 5L9DL 4XC3L 1CD9B 3C5SA 3FT3B 3MLSH 4HS8L 4U6VH 3PDDA 3HZKB 4ZS7L 3TNMA 1T7VA 5HVFB 1GZQA 3WXWH 4QOKB 4MAUL 1EHLL 3QJHB 3S9DB 5EOTA 2YRLA 4UDTA 4QNPE 5KSUB 4PBVC 3VFGH 1UA6L 5E9DD 1A02N 4OCXH 3IDNB 5EUKA 5DT1L 4RMQA 2XA8L 3BE1L 2YPKB 3U36A 3OF6A 3C8DA 5A2FA 4WU5A 5FYLL 2H32H 3LPFA 3X12B 4MA3A 4KI1A 4LLYA 4AG4H 5MEPB 5I1KH 1KJ2B 4JR9H 2NR6C 3GUTB 1A1OA 1O7VA 5KSVB 1FFPB 1ZS8A 3ZYJA 4GW4A 2A6KB 4HWBL 3DTXA 1EEZA 1JPTH 4RAUB 5FKPA 3ZT6A 3A67L 1ZLWK 1YEHH 1A9BA 4LIQE 1PVHA 4NWUL 2X4QB 1AHWC 1PQZB 1MPAH 5A2IH 5D7IF 1CVRA 2XY2A 5L6YH 1LE5B 4XNUL 1I3GH 1MFCL 3RBSA 3CFJB 1MIEH 1HQ4B 2X7LB 1A0QL 3T09A 3MJGX 1D9KC 2H9GA 2R1YB 3HZMB 3MBEA 5I17A 1RJYA 2XKNA 1QVOB 1RULL 2FRGP 5EG6C 1KGCD 3IAQA 5I30L 3TA3A 1T1YB 1HCFX 4N8CL 3WKNA 1EJOH 4NGHH 1NMBL 5TDNB 3ME0A 1BF8A 2J3SA 2A74A 3BWAB 3MX0A 1H0DB 3T3MF 1N0XL 5DRZA 4FA8A 4X4XB 2JJSC 3RNKA 4DOHE 5C0IB 2J5LC 3ARQA 4YDLC 2CDGB 4I3GA 1L7TH 4FQXB 4HUKB 3UPRB 3R4DA 5MENA 3MRLB 3HI1B 3FQUA 3MO1A 4I4WA 3QCVL 3O45B 4LCCC 3L3IB 1K8IA 5C6TL 5TFSL 5EWIH 3QCTL 2Q86B 1UCBL 2XWTB 1YNTA 3MLYL 3HA0A 2X4SB 3KHOA 1QSVA 4L9LA 2GUOB 3L5IA 1OCWL 4BQBA 1AP2A 3I6KB 2JCCF 3SDXF 2VDPL 3FRUB 2QHRL 4OZ4B 3S36H 1G9MH 4M8QA 1LDPH 5IBLC 5J6HA 2Y07H 3MRPB 5EOQH 4ZAKD 4PGBA 1A21A 1EJ6A 1B0GA 2HKHL 4HWNA 1IQDB 4C55A 3GSOA 3AREB 4ZUSB 2FBOJ 1U8NB 1CG9A 4LVHC 4EI5B 3FZUD 1U8OB 3GBML 4HXAH 1F4AA 3BP5B 3U7YH 1EZVY 4K7FB 5A3IC 4LLAA 3OX8A 1CGVA 2R0KH 1ZHLB 1AFVL 3GBLA 1P7KA 3JUZA 1MJ7L 1MI5B 1PG7H 5D7IB 3D18B 3QG7L 1EH9A 5T3ZL 2AJZA 1ZSDA 4WVRA 5IR1A 4YLQT 4RZCB 5GS0H 5SV3A 1CFSA 3WUZA 5C3LD 3QNYB 5IB2A 2JB5L 4N5EC 4JRWA 2XYCA 1I85A 3O6FC 1RHHB 2H32B 2H2SD 4HAFA 3H7BB 3UAJC 4IRZL 4RCAA 3ZE1F 5F7HA 3WJJA 3G04B 2FIKA 2H3NB 3RAJH 3WHXB 5JW3H 1TZHB 4P9ML 5HJ3B 2YPVH 3QUMH 1GC1H 1RFDH 4YHKL 5MEND 4EOWH 4Y4FB 3DOSA 2QR0B 4M3KB 3ZE0F 5D2LB 1BQLH 4NQCA 4PLNC 3QDME 3PWJB 5FO8A 3ORJA 4MDJB 1X44A 3Q0HA 5CIPA 3UTTA 4F3FA 2V2WA 2YN3A 1LO5B 3B5TA 3N1FC 3CK0H 4LFHD 4PTUA 3H8NA 4Y89A 5HI4C 7FABH 5K9KB 3MCKA 3WFZA 4PP1D 5B39A 4KMLB 1OARL 1A7RL 2J6EL 3FQXA 4PJ8A 3S88H 1XGTB 3B9KB 4TNWK 3NFNB 35C8H 1DBKH 1C08B 5FHBH 1FGNH 1HOCA 1MQ8A 3SCMB 3WE6B 5D7JB 2BVOB 4MXVF 1JYWA 1C5DB 2NY2B 2O5ZL 1T5WA 5L2KA 3BP7A 2VDKH 2DKUA 4R4BB 4D0CB 1QKZL 3FL7A 1XGYH 4QF1B 1OD9A 1E0OB 4MLSA 1I8KA 4OV5A 2C1OB 4HD9A 3QO1A 5ESAB 3NFPA 3LY6A 3PL6C 3QG6A 5DJZB 4GKZB 1BZQK 4MNGB 4OIIH 5DK2B 1OP5K 3MJ7B 2H45A 1CR9L 2EE6A 2EYRB 4RX4A 3B5HA 5EC2A 4I8DA 5M95B 3EIFA 2YD5A 4XVTH 5F7YC 1Q94B 1K3IA 4P4KA 4AEEA 4XT1C 4LLMA 1AGEA 1QFWI 3PF2A 4OQTH 4F2MA 3AGVA 2GTWA 3V9FA 4X6FA 5JW4Q 3DXAE 1GYAA 3OXRB 3FRPA 4IIQB 3ZYIA 3FT4A 1YY8B 3IFOB 1VFMA 2DQFA 5D7SL 4O5LH 5IIEB 5L0QB 4JKPH 4N8VB 4KUZL 4M02A 1WC7B 1R3IH 1NANH 3EYUH 3VXSD 1MNUL 4UILL 1F3RB 4L3AA 1URLA 5DZNA 4Z9KB 5EORL 1M6OB 5FK9A 4ONHB 3T1FA 3BH9A 3MRCB 3BEVA 2AJXH 3NACL 1JHKH 4X6BB 5T1KA 5T3XE 5KANI 5IW1A 1PFCA 5FB8A 1CL7H 4XH2B 5EZOH 3ARSA 1MHHB 4HZLA 4AIZB 1A6UH 3JWDC 1KIRA 2ITDB 2NX5E 1RK0B 1I7ZA 1UVQA 4GRWH 4P2OC 4WFHE 2RB8A 4BELD 4MJ4A 1S8DA 4L3EE 1KCSH 3Q6FA 1SMOA 3QUMB 3SBWC 4LVNB 5DA4A 1CDCA 3NAAL 5DC9B 4QGYA 4UINL 4WI8A 4G8IB 3CUPA 4Y2DA 4NKOB 1ZA3A 2FO1A 3PXJA 3QUXB 2KUTA 1ZA6B 3JVGC 3PGCB 4RAVA 3N9GH 3AU1B 1S9YB 1BFTA 3E3QC 4IS6A 2UZIH 5C0BA 1LP9F 1HHJA 1TJHH 3ZTJG 4BQ9A 3MACL 1U93B 4N0UE 3HC3H 1TQBC 4U1SA 2OCFD 3B9DA 4R90L 3L5HA 3VRIB 5JXAH 4RX4D 5KOVC 3BZ4B 1JGLH 3REVA 4ZXBA 3A6CL 2ICWI 5DQ9B 1TNMA 1G1CA 4GRWF 3G5ZA 4FFVD 1Z0MA 4OI9A 3QI9A 5T1LA 2W0PA 3BP6B 4OD1L 4QRTB 2VLKE 4HMDA 3GK8L 2VL4A 2NXYD 3MV8E 3NA9H 4HS8H 3P4NA 1OGAE 3HS0B 2ZCKL 2XWJB 1EEYB 3T0EA 3QUZB 5IP4A 1JZ7A 4X4ZA 2ZUXA 2X42A 3E3QE 3JBG7 2EE2A 4LRIC 4R4FL 3IB4A 3AS2A 3NCCB 1H5BA 1CE6B 1RIVH 5E9DE 1FG2B 5CCKH 5FYLH 2JTDA 5ITBH 3RPIA 4G43B 4TRPL 43C9A 5CD3B 1JNNH 3NCJL 4UOW0 4GKOA 3H42L 1DTUA 3ULUH 1QD0A 5DVMA 4H25B 3VWKD 1P84J 5T1KD 3KPLA 3QISA 5DMGD 4PJHF 4QKXB 4MLIA 5F7EL 1INDH 4KMTL 3BZEA 4HKBB 4LCUA 1OAYH 1PKQA 4U1HB 5D1QD 1A7QH 4ELMF 2GSIB 1E4JA 3QA3A 5FYJU 1OTTD 1XR8A 3BPOB 3WFEL 3UZEA 1WISA 4NP4H 1DVFB 5EB9A 5FOBA 4Z5RA 3IVKA 2ZSWB 4JZJA 3GSRB 5ITFB 3WNMA 4LSPH 3LPGA 3MUGB 2F74B 3F8UB 3HE7D 1WTLA 4QRPA 4R96B 1KT2A 4M6OH 4ODXA 4AQ1B 3GSWB 2NY5H 2BVEA 4NFCA 5KS9E 1E4WH 2NY4D 3GKWL 1MFDH 4O2FA 2ESVA 4ZAKC 1HH6B 2E8ZA 3MGTB 3O3EA 4BSJA 2DYPA 2QV2A 4ZXBD 1INQB 4MD5A 5F7MC 1FLTX 3V0WH 3AY4C 3I84A 3QI9D 4GRWB 2R2CA 5HHQA 4JVWA 4F37F 3QFDA 3B6SA 3MLWH 1GGTA 2A6JA 5E2JA 1MCBA 1MF2L 3ALPA 3MRIB 4JJHA 3GB7A 1OAZH 5SWQA 4L4TB 3T0ED 3F6IA 2FBJL 4LARL 3QUYD 2APTA 5GGQL 3GZKA 1G6VK 2ZUQB 2QHRH 5ANMA 3T2OA 2AGJL 5KSAB 3X14B 5FUZL 4W4OC 5B4MD 4HLJA 1OOAA 1XR9A 4KH2A 3V5KA 5TE6L 1JGEA 2YD9A 2ZOKB 5IQ7L 1IC5H 4M6AA 3IDJB 4HC1H 5E2UL 2JIXD 3P0YL 4XXDA 3PDGA 4YHIA 2VIRB 4UQ3A 3W39B 2H26B 1I3VA 3GBMH 1T04B 3NCYS 3P4OB 4YFLF 4AK1A 5D7LB 4YIQB 2XG4A 5F9JA 1UH2A 2FJHA 4MD4A 5E7BA 4DAGL 1HNGA 1MEXL 4P57B 1AXSA 5GGVL 3V4VH 2LVCA 4NO0D 5D71L 1KLUB 1E6JL 1MJ7H 4V1DB 5I6XB 1PLGL 3KPQA 4Y88A 4RWHA 1UACH 1EO8L 5C9KA 3PWLA 1BFOB 5T3ZH 1OL0A 3O6LH 4IJ3B 4U6YB 1IKFL 2W65B 1G7QA 3NFSL 4A6YA 2ADFL 4O51B 3QQ3B 1T7YA 3IYLW 4ODHL 4L9LC 4PP1C 1IEAA 5F21B 1Z3GH 3DRQB 4TN9A 4QRPD 2BSSA 5EUOB 4BYHA 1A4JB 1F3DH 3DI3B 3NZ8B 4P3DB 5IGXL 1DQJA 2V17H 4GBXA 1A7OH 3VCLA 3X11A 4KY1H 4NPYA 3T0VA 4XVUC 2PO6D 3D39D 2VXSL 5L88L 3G6JF 4CN1A 5MENE 1EGJL 5AWNH 4PRPB 5IEHB 4JLRA 4Y16D 2KBGA 3DROB 4XPHL 2E9IA 5F9OL 3RWGB 5DJXB 4LNRA 5FV2A 1CZ8L 4AMKH 3IXTA 3H9ZA 1OARH 5GRXG 1E28A 1A7RH 5I76A 3AXLB 1BVKA 1Y6KR 4GQPH 1ZVYA 4U1MA 2R8SL 4KKLD 4Y19B 2X9XA 1I1YB 1K4CB 4MWFA 3VG0H 3ZT5A 5CD5C 2NPLX 2WWMD 4FQ1L 5DZOA 1XMWA 1EPFA 1MFBH 1J18A 1Q0XL 3BIAX 3BD5A 5INDB 5C0GB 1AI1L 1EUUA 5F9WC 5EOCH 1CK0L 1WEJH 3LKNB 2WLYA 3MLTB 3QRFM 3RL1A 5BJTA 1WBXA 4XNMB 4Z78A 1NBVL 1HKFA 3C2AL 4NNPL 1P9MA 2VDRL 1FVDB 4XPAL 5HVWA 1QKZH 2NNAA 1I85C 1MJUH 1VPOL 4HV8B 4X8JB 1UYWL 3JTSB 3TBYB 2O5XL 4UT6H 4NQXA 3F6LA 2K9UA 4JFFB 4G9FB 5DJCA 3HZVB 2R0WL 3NA4A 2EDEA 1AR1D 5GZOD 1CR9H 1NC2B 1SJEB 4BJLA 4JZOA 3OKLA 3U4EA 3L1OL 3IGAA 3OAUL 3BAEL 4QCIA 1U92A 1I8LC 3MV7A 2MOVA 2DL9A 4RFOL 3WIIL 4M03A 2PYEB 2AEIT 3LMJH 5KZCD 2JJTC 5GGRA 4M5ZH 4XCYA 3GJFA 3QWRA 2VISA 5C08A 3U0WH 1JE6A 4K94L 3C5ZA 3IDYC 1H15B 1SVZA 3BMVA 3MXVL 2VZTA 4GRLA 3FB8B 1IM9B 1F4WH 3U30C 4ZD3H 2WUCL 1XGPA 1N8ZB 1S9WB 2EC9T 2ADGB 5ICXB 1X4XA 4HJ0D 3MFFB 4I48A 3OXSB 1NBZA 1T22B 4QHLB 3G6JB 4OZFG 4NQCE 4I77H 4U33A 5EORH 1D5XB 3STLA 3VXSE 3W11D 3OJMB 1UZ6E 3UTTE 4KDTA 1G7PB 5T5FH 3W0WA 2HJKB 4Z76B 3NACH 3FT2A 1EO7A 4HDIA 4TOYL 5JR1L 3HUJA 4IHOB 3HMWH 3HZKA 2IH1B 5BZDA 4W70A 4QOKA 3QJHA 3DYOA 4WU7B 4X9IA 5KSUA 4FFVC 5GIRB 2M8XA 3IDNA 3KS0J 2X4TB 3PNWB 4P4KC 3SO3C 4JQXA 2YPKA 5L2KE 1TLKA 4PJBE 2Z8RA 1BBJA 1MIMH 2BNUA 4JHBA 1KCVH 1NUFA 5D2NB 4J3XA 5KVEH 3O2DA 3X12A 1AGBA 2MQ3A 5EBLB 1IGIL 5MEPA 2R0LL 5EU3B 1KJ2A 3GUTA 3GM8A 2YD1A 5KSVA 1FFPA 2A6DB 4P2RB 2A6KA 3ZYOA 4RAUA 5DGQA 1KJVA 4NQDB 3C8KB 2DF3A 2X4QA 3A6CH 1PQZA 3GSUB 2BX5A 1WFNA 2GW5A 1G0YR 1J0IA 1LE5A 2IWGA 4KJYB 4HK3J 3CFJA 3GK8H 1HQ4A 3FB6B 4WWKB 2R1YA 3HZMA 4XCCL 3I6LE 3H7LA 1QVOA 2HH0L 4U1JB 4E41A 4R26L 3VWKC 1I1AB 5C08D 3CU1A 1AQDB 3QIUD 1A6VH 1T1YA 2NXZB 5DMGC 4U3CA 2DQCH 1K8DB 4P9HL 3BKMH 5TDNA 2K1MA 2VLRB 1B6UA 3L3OB 3FFCD 3BWAA 5BXFA 3T2NH 1H0DA 2CKBL 5D1QC 1ZLWH 5IVZB 5IW6B 1N5YL 4FMFA 1OTTC 1CLYL 5FGSA 5C0IA 4YFLI 2X6MA 1B6DA 2CDGA 4FQXA 3UPRA 3H42H 3MRLA 3VH8G 3HI1A 4Y2DC 4G6FD 3O45A 1VERA 3HE7C 4PPTA 2EEAA 5GXBB 2Q86A 5IBTH 2XWTA 3U1SL 1FIGH 3GSVB 4PJAF 5CUSL 5FCSH 4ZFOL 2X4SA 4H20L 3PHOB 4UTBL 4M62L 5F7EH 4KMTH 4TVSa 1HSBB 2NY4C 2VDLL 2OK0L 3L5WB 4HWUA 4JM4H 4KAQH 3I6KA 4ZXBC 3FRUA 1QLEL 4O2EB 2EKSB 4RWYH 3MRJB 4OZ4A 4YUEL 1PG7W 4LBEB 5I1DB 5HHME 3TT3L 3QI9C 4O00A 3MRPA 2HRPH 3FONB 5E6ID 2F8OA 4UZGA 4X4MA 4MMZC 1IQDA 2XPGB 5ADPL 3AREA 4ZUSA 4OBSA 1U8NA 4WUKL 3VGGA 3KLDA 3VRLF 4EI5A 1U8OA 3NOIA 1KC5H 3KLAB 4JRXB 3T0EC 3BP5A 4U1KB 2P7TB 3QUYC 4K7FA 4XGZB 4JO2L 3I3BA 1UFUA 1JZ2A 3BQUD 4TYUA 3T1WA 1XF2B 2VDML 1Z2KA 2GJ6B 1WZKA 1ES0A 5D7IA 3S35H 1V7NL 3D18A 4XB8A 3IJHB 1IGFL 2X4UA 2E7MA 5IG7B 4RZCA 3TWCH 2EDQA 3QDGB 4K7PH 1MCHA 1S9VB 4YZFE 5IB3A 4E41D 1RZJL 4LARH 2XZAH 4UMGA 3TFKD 1MCEA 3T0EE 2C26A 1CGSH 4Z0XB 5EZIH 1RHHA 2KKQA 2H32A 4NBYB 1BM3H 1GIGH 2VWEC 5LXGL 3LH2L 4JHAH 2VKWA 1HKLL 1DQTA 3G9AB 4F58L 4JCLA 2PYFB 2ERJB 3G04A 2H3NA 3WHXA 3MC0A 1WWBX 1TZHA 3U83A 5EFIB 5HJ3A 2BXYA 3SQOH 1NGQL 4NFBA 2IC2A 4Y4FA 3QAZC 5F1SA 2DQHH 3FO0L 4WW1B 4EJ1C 4DAGH 3PWJA 5KG9B 5GGVH 4MDJA 2WNGA 5E2VL 1LO5A 3BHBB 2ICWA 1RQ5A 1DQDH 5K9KA 2QADD 5AZEH 1FCCA 2BOBB 3MBXL 4PJAB 1UM6H 3LEYH 1XGTA 4IDLA 1VADA 2VWEE 2PO6C 2M2DA 1WF5A 5E99L 1C08A 3PJSB 2EDWA 5GS1C 4ODSL 4NKMA 2ADFH 3ARBD 4XBGB 4HIXH 3SCMA 4Y16C 1HHIB 2I5YL 3WE6A 4L8SB 5GS2H 2E6QA 4M6NH 4NCC2 3NCYP 2BVOA 4F7CA 5J6GB 4X0KB 1DDHA 2VXUH 4KKLC 3W2DH 4QRPE 2UYLA 1A22B 4D0CA 4QF1A 4OZIB 2IFFL 4G3YH 4FQCL 2UWEE 4IRSD 2C1OA 3K1DA 5EDXA 4OB5L 4H88L 4NNXB 3HC4L 4HCRH 4BUGA 2VE6B 3D39E 4GKZA 1W0YT 3B4NA 4MNGA 5DK2A 4ODVL 2YRPA 3MJ7A 1U8HB 5GGTH 5KSBF 1R0AL 4OSUH 1YECL 1Q72H 1U8IB 5HGDB 1Q94A 2CDEB 2R8SH 2BXZA 2W59A 5C2BL 3CCHB 3MV9B 2HT4D 5HHOB 4G8EB 3BGAA 1BZ9B 2IAND 4FTVB 1AR1C 3I85A 3OXRA 1KB5H 4IIQA 4JFOB 1YY8A 3UZVB 1QBLL 3IFOA 4YBLC 5IIEA 1IT9H 3C2AH 4N8VA 3SGKA 1F2XK 4OLUH 4J3OC 1OP5H 1WC7A 3BRGC 4OLEA 1VPOH 4AEFA 2OR9L 4ZO8A 2X4NA 3VG9C 3WS6A 4L8CA 2O5XH 43CAB 1JNLL 1M6OA 2AVGA 2O61B 5LWYL 4ONHA 3ARYA 5SX4I 1CLZH 1WWWX 4KPHL 1UWGH 2PR4L 3MRCA 1IAMA 4GBXC 3C08H 2R2EB 1T80A 4I9WE 4OCYL 1BJ1J 5T1DL 3D6GA 1WLHA 4LEXL 1EUTA 4XH2A 1YUHB 5F96L 3L1OH 1NCWH 4QXTB 1MHHA 2E7CA 4JCMA 4N9GB 4AIZA 4PRHB 3EYOA 1M7DA 4M5YL 1MREH 3KVQA 2ITDA 1RK0A 3W11C 3VXRA 2ZCHL 3OPZH 3GEWB 4XWOD 3BD4A 2PW1B 2LAAA 5IB5B 1GGIH 4K94H 3RGHA 3SKOB 1HHKB 1WZ1L 4NKOA 4RMTA 3PGCA 3D2UB 1FO0H 1WK0A 4F15C 1U93A 5DJ8A 5F72S 1ADQL 5AUMB 1WFOA 1X5YA 4XC1L 4URTB 3VDBA 3VRIA 4NQSB 1UM4L 3BZ4A 1P9MC 1MCPH 3CDFA 2KL6A 3FKUS 4TSCL 2FX8L 3G9VA 5DWUL 3OGOE 1BOYA 3BP6A 1PY4A 3ZKXC 4QRTA 5JR1H 5D7KD 4YPJA 1ITBB 1R3LB 3AC0A 3V52H 1F13A 3HS0A 1BF2A 4R0LB 2XWJA 1EEYA 1QLRB 3O4LD 4YHYB 1MY5A 3QUZA 2BNQD 3ABZA 2BVTA 2ZUTA 4AIXA 3TZVB 4UT7H 1SM3L 5GGRY 3BXNB 3M8OL 2VR5A 4N1CA 4I3SH 2QQLH 3RX8A 1BAFL 1CE6A 2DOCA 4Q9RL 2EDKA 4X6DF 3S6CA 4WY7H 1NEUA 3DO3A 3Q6GH 1FG2A 2DLFH 1A47A 4G43A 4HJJH 1JGVH 3JWOL 3M07A 3C5ZC 3QIUC 2DLGA 4CJ0A 1FC2D 2IADB 4GRLC 1R6VA 4Z7VB 4H25A 2DMKA 2AK1H 3SE3A 3ZE2E 3KJ6L 5JZ7D 4H8WC 3UXFA 3PQYB 4PS4H 3C60D 3D3VD 1KB5B 2R4RH 4HKBA 4U1HA 3VXRD 3ETBF 5DRWB 4KDTC 4XCCH 1T2QL 2BSTB 4UUJB 2G75A 3LKSB 4PGCB 4E0RA 1KFAH 1P2CB 2C3WA 1DVFA 1IGCH 4BZ2L 1QBMH 2ZSWA 1NUGA 1ED3A 4OZFH 3GSRA 5C08E 3MUGA 1R5WB 2FX7L 4YHPB 4QRQB 1Y18B 5I74B 4R96A 1FH5H 3GSWA 3O3DA 4Z18A 1QP1A 3O6KL 1N5YH 3FFCE 1DSFH 2BOCB 4WI2A 4P5KB 1M1SA 1K4DB 1CI5A 3T08A 1HH6A 3MGTA 3OWEA 5E6IC 1UEYA 1INQA 2BCKB 4HPYL 4YDIL 1FPTL 5TE4L 5GHWH 5GRUL 1YN6B 2OI9B 1GH7A 4IOSD 5C0AB 4ZUWB 3RUGF 4H20H 4G7YL 3MRIA 3HUJE 2EE9A 2OK0H 3LKOB 4NRYB 3QUZD 3BQUC 1HHHB 2V7NB 4WEMB 3BDYH 2AJ3B 2X1PA 3X14A 5HGAB 1BECA 4POUB 1FO0B 3TT3H 4PJ5B 4P59H 4M43H 1TZIB 1P4IL 2X70A 1S7XB 4OM0L 4NCC1 4X6DB 4JHWH 1KJMB 5I8EA 2VIRA 3W39A 2H26A 3VWJB 1T04A 4OGXH 3TNNB 5IJKA 3P4OA 3MLUH 4YJZL 3KPMB 2NY1D 4YIQA 2Z8WC 2NZ9D 4BFIB 2BK8A 5C07A 4P57A 4MX7B 1HDMA 1KLUA 3IJSB 3RKDD 3QT2A 4V1DA 4DZ8B 4WFGE 5KVFL 1BD2B 4GT7A 4NO3B 4AJ0A 1ORQB 1NCTA 1QLFB 4Z7QE 1BFOA 3N06B 4UNVA 3D9AL 4U6YA 3QEHB 4ELMA 3RVTD 2MWCA 1CBVH 2FLBT 4I5BB 3X17A 2W65A 3B3IB 1P7QB 1BPVA 5EIIB 3QQ3A 4GS7B 4WI6A 2W0KA 5CSZB 4E41E 2QADC 4KGLA 4AM0B 4GKNB 3DRQA 3GSNH 4C56D 5ID0B 3B9VA 2AEPL 3BUTA 4XPGH 3TVMB 4F58H 3K8LA 1RUPH 4XAKE 4HWBA 3NZ8A 4P3DA 1KEMH 1BIHA 3ARBC 5J13C 4LDEB 4RDQF 5LQBL 4OZHF 3FO0H 5EU5B 2EIDA 4IM8A 5EZJB 1FFRA 4PRPA 5GRJL 5IEHA 1KYOK 5HYSB 2B7DT 3RWGA 5DJXA 2V5SA 1YEIL 3MBXH 5DD0H 3DUUB 4OZGF 1D3CA 2NY6B 3TN0D 2AK4B 4OZFB 2PUQT 3QIWD 4Y19A 2AJYL 1K4CA 3LV3A 4IRSC 5BW7C 1NFDF 4HG4J 5INDA 2VNCA 2C7UB 4KHXL 4NZUH 5C0GA 1IQWL 2B4CL 3CFCH 5E94B 4OLYL 4OFIA 1ODAA 3LKNA 3WYRA 3MLTA 5I1GH 4XNMA 1U8JB 3CFBB 3LPWA 1LK2B 3GDBA 1FVDA 4TTDD 2HT4C 4GAJL 2YD4A 1XZ0A 3NBNA 3MOAL 5C07D 3W9DB 4ZFOB 4X5LA 4FQCH 3JTSA 3TBYA 2AQ3A 4M4RA 4H88H 5EPMA 1J9CT 2OTUA 1CE1L 4G9FA 4GO6B 1KIQB 3MLVL 3HZVA 2HWZL 1BHGA 3GMLA 1LO4L 1B90A 3WV0A 1NC2A 4G8GB 5D7IE 4MAYB 2D7TL 4HWZB 4JGMA 3P30L 2BDNH 4TNVF 4HC1A 1ZLVK 3QQ9D 4GH7B 15C8L 3OR7B 2IMMA 4F7TB 4YGVB 4YXLL 4JRYA 3ZKMD 5I75C 4CVXB 1M05B 4U1GB 4XP5L 1H15A 4RIRB 2EDRA 5EU6A 1UB5B 1AO7B 3FB8A 4AQOA 1FNSL 4L29B 1OAKL 3WFBH 4Z8FL 3SCMC 2D7NA 3T3ME 1L6ZA 1N8ZA 1S9WA 4OLVL 4LLDA 2ADGA 5ICXA 5D4QA 4EUPH 1G9NC 3OXSA 3FMGL 4HS3B 2OR9H 2Y5TA 4XWOC 4QHLA 5IFAL 3G6JA 4I0KA 4G6ML 1JNLH 3BGMB 1D5XA 3K4ZA 3TBVB 4CJ1A 2ATKB 3P0VH 4JGJA 1G7PA 4KPHH 1HINH 4Z76A 2F8VA 4OCYH 4PP2B 4OZGB 3V6ZB 3F7YB 3VGAB 5F7LB 3CX5J 3VH8B 1OWRM 5F96H 4IHOA 1T2JA 2W9EL 3P73B 1ROWA 2YD3A 2JCCE 3SDXE 4WU7A 2VB5A 2ICEB 3HNSH 3BPLB 3HHRB 5GISH 1JPFB 3MRKB 5GIRA 3ZKNC 4D9QE 4YHZL 2X4TA 2XN9D 3L7EB 2EH8L 5BO1L 2OL3L 5D72H 3ARWA 3IFPB 5FA3B 1WBYB 4OAWB 4OTXH 3MZGB 5BOZG 12E8L 4TUOA 4AY0A 2VN4A 3NIDF 1I4FA 3ARPA 5SWZB 5EU3A 3D0LB 5EO9B 5GJTL 5ERWB 3TESA 1AXTL 4IIQC 2YUZA 1VGEH 2A6DA 1PAMA 2J6EA 5IEKB 5FECB 3C09C 4NQDA 3C8KA 1VA9A 2XG5A 5JOEA 3GSUA 4OUUB 3V6FB 4RISH 3BP4B 4KJYA 2X1OA 3WS6C 4PIRF 1PGRB 1UKSA 1QBAA 3FB6A 4DGIL 3KNBB 4WWKA 4XXCA 2NLJB 5D7KE 4U1JA 1SBSH 1AR2A 1I1AA 4JRYD 1S7TB 2HJLB 1AQDA 3JWNC 4XNYL 2YSSB 3M8OH 4PJ9A 5ABDE 5EU6D 4XCFH 5JZ7C 3UPAA 1K8DA 5JPMB 2VLRA 3L3OA 3ZE1E 2Z31B 3EOTL 2LAGB 1UQSA 4FFZL 5IVZA 5IW6A 4M7LL 4XRCB 5ICZB 4R2GB 4JDTH 4P49A 3O3AB 1ZV5A 1FNGB 3GMOA 4HJGB 3ZE0E 4CVWA 5T3XL 4NO2A 4G6JL 4M1CD 2J4WL 2ZKHL 3GSVA 3WXVL 1BLNB 4F9PA 1CDJA 3PHOA 4U1LB 1TMCB 3KJ6H 4YC2B 1KB9K 3QUKB 4HK0B 1HSBA 1X9QA 2XRAL 3L5WA 4KKCC 3KPOB 4OV6F 4L8DB 4JFED 3ES6A 5HI5D 3CPLB 4O2EA 2EKSA 3D3VE 1IC4L 3MRJA 3SKJH 4OUOA 3O2WL 4LBEA 1JVKA 3VXRE 5I1DA 1ZGLB 3VE0B 3FONA 1MCRA 3OZ9L 4FNLH 4EUPB 4MXVE 2XPGA 2AV1B 1DQLH 1UKTA 3S37X 1X3DA 3RA7L 3KLAA 4JRXA 3QUZC 4U1KA 3LAFA 5IFJB 2P7TA 4XGZA 5CP3H 2VRAA 1YMMB 5C3TA 1ZGLM 1XF2A 3X3GL 5DJ2B 2GJ6A 1QPXA 8CGTA 5TE4H 1JNHB 3LEVH 3OKMB 1OT2A 1QRNB 1UEMA 3IJHA 5IG7A 4IBLT 4PGDB 2DN7A 4ZTOL 4D0DA 1J8HB 2AQ2A 3QDGA 2NZ9C 1S9VA 1KTRL 4EQ2A 1RAMA 1J1OL 2BY0A 3KLHC 4QXWA 1F8TL 3NN8B 2CR6A 3MUHL 5E8DH 2E9BA 6FABH 5TQ2L 4Z0XA 3BX7C 4PJ9D 2BSRB 5I71C 1NMCB 4LSRH 2E7HA 3T0BA 2VN7A 3FN0H 4IMLB 3NVQA 3ECBB 3RZCB 3SJVB 3O0RL 2OTWB 2O93L 1FRGL 1D6VH 2PYFA 1DN0B 3BPOC 2AABH 5C6WH 4KTEL 2XWBA 1DVFC 2WK2A 1O5DT 4NQTA 3LHPH 5EFIA 3PGFL 4XP4L 3ARGB 3QEQB 1JI1A 3BH8B 3RJQB 1RZKC 2XZCL 3MV11 3NPZB 4LIQH 3IXAB 2IG2L 4WW1A 5HPOA 4JZNB 4PRBB 5KG9A 3D5OF 3V79C 4HKZB 1HXYB 3BHBA 5DK0B 4QHUA 1CDGA 1Q9LA 4X7DC 3WHE1 2BOBA 4APQD 1C12B 3CDYA 4C83A 4PJAA 5J7CC 4FQ2H 2A6IA 4PJDF 3LD8B 1VDGA 1CGTA 4HF5H 2HT2D 3HPLA 3VMPA 3PJSA 3DX8B 2Y06H 4XBGA 1HHIA 1OD7A 1PKOA 3RIFK 4YK4C 4U3HA 1JPGA 2ARWA 2F5AH 4LCIL 4EN3B 3WNNA 4X0KA 1TETH 1EK3A 2I24N 3WFCH 4QRRB 4YHML 1MCOH 4Y1AD 3TN0C 1BOGB 4XI5D 3QIWC 2DQGH 4LF3B 3T4YB 2ZUQC 2D9QB 1YC8A 2DD8L 3EHBC 4OZIA 1Q38A 3GRWH 3KPSD 5DD6B 3VXOB 3GSQB 3GBNL 1T0PB 1AGFB 1LP9E 3QWQB 1U42A 3MNVB 1NGPH 2Q8BL 4NNXA 4PLJC 2J8UE 2VE6A 4NFDA 5AYUL 1LWRA 5HVGB 2WP3O 3BW9B 4EXPX 5C92A 4Y4KD 5B8CC 2Z0BA 1MFNA 4TTDC 1U8IA 1VSCA 2VKXA 5HGDA 1E4XL 2EDTA 3TBWB 2YMXL 3CCHA 4M7JL 2CJUH 4DQOH 5HHOA 4XP6H 5HI3D 1OAQL 1BZ9A 3STBA 1N2RA 3CVIL 4AL8H 4LFHG 4FTVA 2XTJD 3SE9H 1U3JA 3VXUB 3RWFB 4ZODA 3MA9L 4JFOA 4HWEL 4PUBH 1FLRH 2DKSA 1DLFL 2DJUA 4AIOA 5FM5O 4W81A 2SEBA 2JLLA 5E7FA 1E4KA 2RIKA 3MOAH 4LK4A 3RTQD 3BKJL 43CAA 4NRXB 5DD3L 3ZKMC 5C07E 2O61A 5J89A 5E8PB 4YDJB 4HAGA 1HSAB 3ALWA 2R2EA 4PJHE 3X3FL 1HI6B 1YUHA 3KLSA 4QXTA 3U9PL 4N9GA 3DHJA 4PRHA 4ELME 5HHVH 3ZKSD 4I18C 3VXNA 1NC4B 3BZFB 2J88H 3T2PA 5FXCH 3S4SG 4BFEA 1ERNA 1R3HB 15C8H 2B5IB 3N85L 4YFEA 2PW1A 3AB0B 3IT8D 4PRAB 2Y1VA 5IB5A 3E0GA 1H3WM 1HHKA 3RWHB 3N1GC 3WNKA 1QO3B 1L0XA 3D2UA 4KGJA 5BOPA 4L8BB 3EO1B 2BJML 1C16B 1UC6A 4MA1B 5AUMA 1MCJA 1EAPA 4LGSB 3SGEH 4NQSA 2BNRD 4L4JA 1C7SA 1NL0L 4XNQA 4J3VA 3UTSA 3DURB 4ISVB 2PTTB 3BT2L 5CGYD 1R3LA 2VDQH 4Y19E 5K59F 1HE7A 4R0LA 4HUWB 4WW2F 4DUWA 1NCAL 1QLRA 1EFXD 4DOHB 5JDSA 4JQVA 3G5YA 1X4YA 2V7HA 4NDMB 5B39G 3GNML 3TZVA 3IRPX 5GRVK 2DIBA 2WWKO 2P8PB 4LCYB 4TVPL 1D9KB 2X1QA 4HCRA 1NFKA 3TH2T 1EGJA 2XQBH 1C5CL 4MA8L 4XNXL 3UPCA 4B5EA 2QL1A 1QSED 3PHQA 3MSPA 5E08H 1AXTH 1RUKH 1E6OL 4X83A 1BZ7B 1TFHA 1WCBB 2WINB 2IADA 4Z7VA 1NCBL 1G7IB 1DBBH 4WWID 2EIZB 3P11L 4F7PB 2J5LB 4YDLB 1NQBA 1QSFD 1F3DJ 1PZ5A 4YPGB 3PQYA 1LEKA 1KB5A 2PTVA 5EU7C 4XX1G 4LCCB 1L7IH 4DGIH 5DRWA 3WLWC 2BSTA 4UUJA 4CW1B 5H35B 3LKSA 4PGCA 1PZUB 2QQNL 1P2CA 1NUNB 4M1CC 1U3YA 5D6DA 5I15H 2ZUYA 1KJ3L 1IGYB 4JRYE 4EVNB 1NLBL 3FB5B 1R5WA 4YHPA 4QRQA 1Y18A 4ZTPL 3VFTA 5EU6E 3DECA 3EOTH 1TCMA 3DHMA 4M7LH 5C8JB 4Z7OE 3BJLA 2BOCA 2APVA 4P5KA 1OY3B 1K4DA 1ZTXL 4MSWB 4DCQB 2BCKA 4LVHB 2EECA 3G6JE 3GHEH 5FYKL 3NH7H 5EU7E 1HCVA 5EOCJ 5T3XH 2DI7A 4NHCH 1R5IB 5ALBL 1YN6A 3MUZ1 3UTSD 3CH1B 5C0AA 4ZUWA 4GXUN 1S9KC 1LO3L 3TM6A 4FQIH 1VFOA 3KWWB 4U6TA 4FN0A 4LKCB 3LKOA 4NRYA 5FCUH 3OSKA 4WW2B 1HHHA 4M1DL 2V7NA 2XNAB 2AJ3A 3K2UL 5HGAA 4JFEE 4MXWH 1FO0A 5E70A 4PJ5A 3QDMB 2L4OA 1TZIA 3OZ9H 4KK5D 3FQTA 1XH3B 4LSQH 1S7XA 3WBDA 4W4NA 4R7DB 4X6DA 3QWOB 4HIIB 1KJMA 1NCCH 4XXCC 1T4KB 3VWJA 4S1QL 4LCWD 3DV6B 3TNNA 3KPMA 1FE8L 2GEEA 3LN9A 4BFIA 4JFHD 4PJ9C 1J87A 1J0KA 4MX7A 3JWDH 2YBRB 3BPNC 2R4SL 3PE9A 2FL5B 3IJSA 4S0TD 3TIDB 4NQDE 5F6HJ 3MREB 2V9QA 3EYFB 3VFPA 3TYFB 2MQ0A 1BD2A 4NO3A 2LFGA 1OPGH 1ORQA 1QLFA 2CXKA 2X4OB 3I50L 4M00A 4MA7L 5D1ZA 1A9EB 4JEGB 3IAGC 1NAKH 4UTAH 1JHLL 1R5VB 3MODH 1N3NB 4I5BA 5BVPH 3B3IA 1J1OH 4KK9C 4K9EL 4MB5A 1TIUA 5EIIA 1FZKB 4WO4D 4IRJD 3BKYL 5CSZA 4XPTH 5TQ2H 4F9PC 4OJFL 4AM0A 3OKEA 4GKNA 4APQC 2HA1A 5ID0A 1J1XL 1EHXA 1QYGL 3TVMA 1FBIH 2HT2C 4WDIB 1YEJL 1S7VB 3QPXH 3R8QA 1MAML 1U8KB 1VHPA 3UP1A 1A64A 1OW0C 1FL5B 1HHGB 5EZJA 1F6FB 4LPTA 1YDPB 1CFQB 1QTYT 1A6AB 5DHYB 5EZLB 4XI5C 5HYSA 3DXAB 3FO9B 3BGFC 3RUGA 3DUUA 1ZEAL 3T8XB 1A3LL 2VZUA 2AK4A 1TCRB 2R1WB 5DLMH 4MJ6B 1IAKB 2OP4H 4XAWH 2VSDA 5AZ2H 4G9DB 1KG0B 4IDJL 4JQIL 3TH3T 3HFML 2C7UA 3FCTB 2CKBA 2B1AL 5JO5A 2B8OT 5C0RH 1C5BL 5IMMA 2A38A 3IRZA 1PYWA 1XIWD 4E42B 3EYVA 1DBJL 2NW3B 3DVNB 4YHMH 4YFDB 1U8JA 4Q0XL 3SY0B 3CFBA 2MCPH 3NPSC 1LK2A 1JV5A 2Q7YB 5JLZA 2YWYA 4Y1AE 1DQML 2ITCB 4HEPG 3KYOB 3W9DA 4ZFOA 4K23H 3QCUL 3KPSE 2XTJC 3RIAK 4MS8C 2NX5B 1RJLB 5KAQF 1KIQA 1JJUA 4U0QB 3G6DL 5D1ZD 5F1KC 4G8GA 2JELH 4JDVB 3UJIH 4HWZA 4QTHB 4NBXB 4OIAA 1WFTA 3NCEB 3RTQC 1GSMA 3DPBA 4ZG1A 4M7JH 1WZLA 3QHZL 1KLFA 2HFEB 5F1IB 5KS9F 2DL2A 2EXWD 3OR7A 2NY0B 5E2TL 4F7TA 1JWMA 2D0FA 4N0UB 2VL5B 4N0RA 3DV4A 4CVXA 3Q1SL 4JO4H 2XTJE 4RIRA 1UB5A 1AO7A 1L0QA 4L29A 4P2OB 4WFFD 3THML 3LIZL 1FNEA 4FQLL 2L0DA 5ILTH 4CADB 3HMXH 5IHUH 3DBXB 4YHLL 1JGDB 4I2XE 3K4DA 1T1XA 2EYSB 3TBVA 3ROOB 2ATKA 1ZLVH 3CSBA 4FRWA 1EXUB 3K80A 1KBGH 1I9RH 3PP4L 4PP2A 4OZGA 3V6ZA 3G5XB 2DQJL 3F7YA 3RKPA 1RJZB 4NQED 3EO9L 3PDOB 1TQBB 2WP3T 5E9DB 5JORA 3VXMD 1ZANL 2JB6B 3EYSL 2IBBA 4G5ZH 2ICEA 4OT1L 1HILB 3TBTB 4TUKH 2DWEB 4FFYH 1JPFA 6CGTA 3MRKA 4Z95H 2AEQH 1RUAH 3L7EA 1CXLA 1NH6A 3IFPA 1WBYA 4JY6B 4DKDC 1TJGL 3VRLE 1A6TB 1FSKB 4NM4L 3RWEB 2EDNA 4LSTL 5DUPL 1GGBH 5SWZA 3D0LA 5ERWA 3UDWC 4X6CF 1YJDL 1NCDL 3FQNB 5FECA 5IEKA 3CU7A 2BC4A 3W5MA 1AGDA 4LASL 4OUUA 4UT9L 3BP4A 2BNRE 5I8KH 3F58L 5CS7A 4RBPK 2YK1L 5F97E 2FLRT 1A5FL 3EDKA 3UJJH 3ZDXF 1K9TA 3CFIC 3BIKB 3KNBA 4DGYL 5KJRL 5IM7B 3SDDD 1D7FA 2NLJA 3LZFL 4Y5YB 5KS9B 2HJLA 1H3VA 5IT2H 4QTIL 1ZHNB 1YEDB 2YSSA 3GNMH 1PY9A 3B9AA 3OHXB 4MZ2A 3GMPB 4NRZB 2GFBB 4M6MH 1FYHB 2XFXB 1OM3L 2NCMA 2CO7B 2RJMA 3OKYA 5JPMA 4WV1A 2Z31A 3CDGB 4KTDL 5GGVY 4YEFA 4XRCA 4U7KA 5DD5L 4MA8H 4HG4K 5I8OL 2GJZB 1KEGL 2ID5A 2YKLH 3RBGA 1YPZF 3C5SB 3KPTA 5GQBA 2D31A 2APWA 4HJGA 1A14H 4Y8AA 1KPRB 1YEGH 4NWTL 5EOTB 5B21A 4GLRI 1BLNA 1Q1JL 2NTSP 4U1LA 4YXKL 5EC1A 5DHXB 4ZAKB 4JANB 2B1HL 2K7PA 32C2B 4HK0A 2QSCL 5CJOH 2KDGA 4J2XA 3KPOA 4K2UL 2V2TB 1QSFE 4L8DA 4LSSH 3CPLA 3SDCD 4WU5B 4QXUH 3NCFB 4CRPA 3UJTH 4UB0H 2PXYD 4LLYB 3IDMA 3WHE0 1N7MH 3BVNB 1F3JB 3ILPA 1A1OB 5CP7A 3QRGL 4O02H 4EUPA 1T0NB 2JJVA 2A1WH 1CU4H 4Y2OA 2AV1A 1EEZB 3HNTH 1NLBH 2OZ4H 2IPTL 4R0LC 3D69B 1IVLA 4JQVC 4WHTB 5IFJA 1IKNA 4O4YL 2WWKT 5LG1A 1JRHL 1M71B 1BFVH 1YMMA 4X6CB 5IMOB 1FP5A 1F4YL 2IMNA 4KK5C 5GS0D 1FL6B 5DJ2A 1K6QL 2ZZUT 4X9HA 4BSVB 5GRZA 1JNHA 5IVXF 1QRNA 4Q6YA 2J7LA 2F19L 5KSBE 1BGXH 3IU4H 4GUPB 4PGDA 3UTSE 5SX5K 2HVKA 2ED9A 1D5IL 5JHLL 1FL3A 3HCVB 5DRZB 2L7UA 2JJWA 4M1DH 3W5NA 3LCYA 3RNKB 2AI0L 2XOTA 4PR5B 4J8RB 2J12B 5FO7B 5DXWA 4IMLA 4DKFL 4ETQB 5MENB 3ECBA 3FFDB 4LU5H 1GGUA 2IQ9L 2UVFA 3SJVA 3MZTA 4TSBL 3CX5K 1OLLA 4Z7WF 3O9WA 2OTWA 2YWZA 2X4RB 3MRNB 1LILA 1DN0A 1YQVL 4MNQA 1YNLH 4WO4C 4L9LB 4IRJC 3QEQA 4UBDC 4LCWE 1X5FA 3BH8A 4D8PB 3IXAA 3S97C 1EO5A 4JZNA 4PRBA 3I6GB 3LB6D 5I74C 4HKZA 1HXYA 2D3VA 4EBQH 4NKDB 2ORBL 2R4SH 1VB9A 1WAAF 5F6IC 5IV2A 5DK0A 2ICCA 4XMKH 5J6HB 4KKAC 1CXFA 3I50H 5CZVL 2YA1A 3MGAA 1V5JA 1T5XA 3NIGF 4N68A 2EKJA 3MNWA 4ZNEA 4D9LL 4KJPC 2Q3AA 2NMSA 3DX8A 4EIZC 4FQJL 4O2CA 4J6RL 3PABB 1LNUB 4I13B 2EICA 1FAKT 3S34L 2R29L 4EN3A 2QEJA 4QRRA 2Q1EA 4BFBD 5T5NF 4XCEB 3P9WB 2ILLA 5JQ6H 3S4SB 3LOWA 5FKAB 4LF3A 3H3PH 3P3YA 3KG5A 4S1DD 2IAMD 3RJDA 3VXOA 5DD6A 3RZWA 3GSQA 5IR1B 1S5HB 4S1RL 5F9WB 4JO3H