4PRID

Crystal structure of tk3 tcr-hla-b*35:08-hpvg complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
202
structure length
202
Chain Sequence
EDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQDLGTSGSRLTFGEGTQLTVNPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Molecular Basis for the Interplay between T Cells, Viral Mutants, and Human Leukocyte Antigen Micropolymorphism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MHC class I antigen
total genus 43
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4priD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4priD02
4Y5XC 3MJ9L 2A73A 2OSLA 3PGDA 3O8XA 4X4ME 3MOAL 1N5AB 4LLQB 4R4BA 5GS2D 3RWIA 2V2TB 4LARL 4PLOB 1S7WA 2DKMA 4X6DB 4Z0BH 3VXNB 5L6YH 5ISZD 3MRBA 4U7SA 4APQB 5C71A 3ZTJH 1JF1B 1K3IA 3VRJA 5IJVA 1YMMD 3AS0A 4FQXD 3HMWL 1R3LA 4QT5B 4D9LH 35C8H 5DMKB 2RR3A 5C0JB 3E2HB 4WGVB 4WWID 1UM5H 5BZDA 3TJEH 4OB5L 1K2DA 2X1PA 4PP1D 5E7FA 5FOJA 5JA9A 3BP5B 2XPGA 3MRPA 2OQJA 5ID1A 5K9OB 4IIQB 1QTYT 4NQEB 3RJDA 3VXQB 3AGVA 1Q9KA 3RWCB 2LTQB 3D18B 4U1MB 5TQ0H 5INCB 3KYOA 4B41A 4G6ML 3W9DB 4RWHA 5HBBA 4TRPH 4Z7VF 4ODSH 5I1KL 3ULUC 2ZG3A 3SKOB 5CMAA 4BH8A 3EYFA 3WFDH 5HVFB 3GKWH 1A1NA 4JFEB 4HCRH 5EN2A 3QQNA 4NQDA 3PWPE 1AXTL 1WEJH 1RK0B 2GY5A 1X7QB 5IVXE 5C09E 4IM8A 3SGEH 3QIUC 5IKCA 1ZA3A 1PEWA 5ESAA 2Z31C 5IFJB 4OM1H 5HJ3B 3ZTNL 3EGSB 1X5YA 5IEHB 1KXQE 1JPST 3I50L 3MNZA 1I1YB 4JDVB 2HTKC 4NQEE 1LO5A 4GBXD 4PBVC 3WS6A 1NEUA 1TTFA 1A3LH 1IKNA 5K33A 4XXCA 43CAA 5KN5A 4UTBH 2YUXA 4Z7UF 3VGAC 3T1FA 1C5DB 3EGSA 4NKMB 3WUZA 3I9GL 2JJVA 4OLVL 4X80H 4OCWH 4OCRH 3VFSA 4HUNB 2BJML 1DBAL 3QDJB 3X11A 3L5XH 5DD0L 4F37K 3S96B 3H9SE 2IFFH 2H32B 3IDJB 3MODL 2ZUQB 4U3XA 3BEVB 4H88H 3KPMA 2VYRE 4A6YB 5AWNL 3U83A 4OM0H 5ILTL 3FOMB 3AM8C 3QNXA 3VJ6A 1RUML 5D7LA 1F02I 5DZLA 5MI0C 2DB8A 1KXVC 5GPRA 1MAML 3OR7B 3A67L 2BVUA 3KWWB 4DKEH 2LFGA 2V17L 3W9DA 1L4IA 5CILL 3QUMA 1QD0A 4OSUH 5DRZA 5INCA 1ZT1A 5JHLL 1I8KB 4MD0B 3QYCA 3BP5A 3MRMA 4FQJH 5EOCL 4KTDL 4P59L 1S5IL 3MLUL 5GS1C 3EYOB 4XPFH 3QBTB 2VXSH 4IMLA 3O2VH 2P46B 2JCCA 4KI5C 2XN9E 2VMFA 3I6GA 4F7EB 5GRUH 5F6HJ 1V7NL 1CVSC 4Y0GA 4J4PA 5GSVB 1E4XL 1BFSA 1PLGH 4QY8B 3NFNA 3GDBA 2I60H 4HIEA 5D1ZB 1T22A 3VFNB 4HUWB 1CVRA 4DN4L 4QHLB 4HC1A 5HGHA 3MJ9A 4G9FD 5C0FA 1J05A 1MCWM 3IGAB 1REIA 1U91B 4PRIE 3S4SB 2P5ED 5CIPB 4JGJA 2ARWA 1ETZA 4R7NA 4U6TA 3RUGA 1AD9A 4NO2B 4XP9H 4ZOCA 4M6AA 3VWKC 3D85A 4OLUH 2W0PA 3FL7A 5MP6H 2F53B 3RNKA 3S8WA 3DUSB 4PJCF 1ACYH 3GRWH 4G7VH 4S1SH 1YY8A 3LKRB 3SDAA 3VRLF 5BV7H 2WQ8A 2I9TB 1WZ1H 4QCIB 4WHDA 1UZ6E 3VXTB 2MPAL 4HT1H 1JPSL 1U8MA 4NM8H 3V0VB 5SV3A 3IFOA 4NJAL 4BH7A 1EZVX 1QLEL 4UUJA 3MYZA 3MA7B 2CRIA 3LKPB 1Z0NA 5DD6A 4UQ2A 3RWEA 1DBJH 1VB9A 3P0GB 1BIHA 2XICA 3WEXB 3BRFA 1M71B 5DHYA 4KY1L 1S3KH 1KPRA 1NL0L 4JREC 3LB6C 1DN0A 5LVEA 3SDAB 1K5NB 1FFNB 1A7PL 2QSQA 4KJQC 3KS0J 3WD5H 4GRLB 5C3TA 3Q6FA 4NQDD 2GJ6E 4NKOA 1JHTB 15C8L 2VDNL 3CSYB 3I02B 1J9CT 4OI9A 2GTWA 3T2NL 5A2KH 4LLWB 4Z95H 4PREB 3NZHL 3S34L 4NBZB 5ITFA 3IXTA 2AS5M 3MOQA 1MVUA 1UKTA 4XPBH 3QFJD 5GISL 1J05B 1T4KB 4EDXB 1YMME 4QHLA 4TSBH 5TF1H 2P4AB 1B6DA 3CVHL 4HIEB 5D1ZA 2XXCB 4XPAH 1ZEAL 3IJHB 3L95A 3QZWG 4QHMA 1QPPA 5MENE 3S35L 3NMEA 3C2AH 4Y4KD 4HS3B 1JL8A 2PR4H 2PYEA 1IAMA 1RFDL 1U3HD 5E8PB 4MJ5B 1JZ7A 1MAJA 1WISA 2X9YA 1P1ZA 2Q7YB 3IS1X 5GGQH 4JN1L 1NCDL 1HWGB 1ROWA 4ZOBA 5EU7C 4NWUL 3AFLA 1E6JL 4AEHH 3SHSA 2B5IB 5I6XB 5D1XD 4F7MA 4JO2H 4PB0L 1F00I 4QXWA 4X6FB 4FFVD 2VERN 2XY2A 5GIRB 4M5YL 1FNSL 5T3ZL 2EKSA 3G5YB 4GQ9L 1U2CA 1KTLB 1QUNA 1HILA 5BS0D 2PO6A 2IH3B 5CJQH 3UYPA 2DIBA 4C83A 5IIEA 4K7PX 2JIXB 4GKOA 4PB0H 4Y19D 5H35B 4CL7A 5HYIA 3VI3E 5CBAA 3QWRD 1ZVSB 4LHUA 1T21A 2NYYC 3E8UL 2WAHA 1J7VR 3NCCB 5ETUB 3T2PA 5BQ7A 2ZUTA 1A1MA 1C12B 4PJXE 3VXUE 4XAWH 3RP1A 5HYJE 1CGVA 5JQHC 3MLXL 1SEQH 5CFHA 1AHWB 4CVWA 1OGAD 1MCHA 1C16A 2HMID 4XBPA 1U3HA 1S9XB 3OX8B 2CRZA 4MD5B 2RBLA 2QQKH 1CF8L 1SJHB 2B4CL 3FB5A 3MV9A 5L6YL 2FX8L 3BE1H 2X1QA 4XRCA 1UCBH 5HTSA 3UZQA 3WMSA 1NAMB 4DAGL 1H5BB 2D9QB 3ZO0A 1OQOA 4PRIA 3BMWA 4FQHB 4X9IA 3WSQL 1H3VA 5FGRA 5EO0B 3O3AB 1DN2A 2FBJH 3SKJH 4Z7OF 3WUWB 2LU4A 3SE4A 3VD3A 4JE4B 4Y4FA 2QQLH 4S1RL 3DBXA 2A83B 5GRWA 2VE6B 2WMPA 3NH7L 4Z7WA 4HXBH 1B88A 2DLEA 4NZTL 1K6QH 3PWVB 3PHSA 4WU7B 4ZFOL 2C1PA 3BGMB 4DFHA 2XZQL 3BPOB 4P5KA 4WHYG 2D0FA 2D31B 3BEWB 3G6JA 3B9AA 1HH9B 4NO0B 1DQDL 3I2CL 3PL6D 1MREL 3E6HB 2R9HD 5IB3B 4Y88A 4P5TB 3MLRH 4MQXD 2BSSA 4QRPD 5E2WH 4H88L 4YAQB 1KJVB 1C7TA 4PGJA 5IW1B 4OLXH 4JANB 4YXLL 2Z92B 4UQ3B 1JHKH 5SWZE 4F7TB 4ODVH 1FH5L 1FFPB 4RWYH 3RPIB 5D7KD 2HKFL 3FOLA 4XNYH 5JHDD 4JM4H 4QF1A 4K7PY 2EDWA 5C70A 4W4OA 1QLFB 2UVFA 3HAEB 3GSXB 1JNJA 3I6KA 1RFDH 1XF5A 1J8HE 3S37X 1MVUB 2DQJH 1BBJB 3MUZ1 3QULA 3BH9B 1JUFB 3MMEB 3QJHB 3ZKMD 3DVNA 1U3YA 4ZXBB 2HG5B 1KJ3H 2OL3B 1CFVH 2YBRB 4YHIB 4YO0B 2IALA 1RU9H 3MRQA 1BVZA 3GBML 4PGCA 1DE4B 5FOBA 1TDQA 1VADB 2RFXB 3EO1B 1MAKA 5HI5D 4N5EC 4R0LC 4IRSC 1PG7W 3ET9F 3H42L 3OSKA 3BRGC 3LKOA 2HKFH 5ENWB 4FZ8H 4Z7UB 1J0KA 1UKQA 2O5ZH 1FFOA 5FYJU 1Y18B 2VABA 5T5FL 1LEIA 3LV3A 4I9WE 4KTDH 1L0XA 4EN3D 1YEKH 2VOTA 3UPRB 1HHIB 1IT9L 2V7NB 4BM7A 1S7TB 1D5IH 3L6FB 3CD4A 5E08L 2KZWA 1ZTXH 1W0WA 2HWZH 2DDQL 5DJXA 4ZFOB 1KCRH 2ZCLL 5E6IB 3BP7A 4NKDA 2JJWA 1ZAGA 1D6EB 2HH0L 2ID5A 4NJAH 2WIMA 4S1RH 3HC4L 4YDKL 3D9AL 3EOTH 3U4EB 4P9HH 1Q72L 1JGLL 2A6JB 2J8UF 1Z5LA 3RX5A 4MA3B 4KJPD 1G6VK 5IV2A 3GSVB 1CTNA 3Q5YA 4Y1AA 4ZO8A 1CLOH 1WCBB 4LIQH 5HYJA 1MI5A 1TQCC 1JGLH 5T1LA 5BJTB 4U31A 1L7TH 1NCTA 5C9JB 5K9KA 5CSBA 3IRPX 1LP9F 2DQHL 5C2BH 4IRSB 2BOCA 5IVXF 1CFNB 2OMBA 4JPVL 4PJ9B 3CFJA 1DE4A 5ACMA 3X3GL 4MXWL 5C8JA 2BHUA 3MACH 1EFXB 3WNLA 5MERA 3VWJB 4NBYB 1FORL 2DLIA 1ZK9A 4HV8B 3BD3A 5IBLC 1H15A 1ZHLB 4S2SA 1X5JA 1T5WB 3ARUA 5CINH 4OD3L 5A3IC 3UYRL 4JY6B 2FLRT 3IDUA 3KYNB 1FAIL 1Q0XL 1HIML 3VFOB 1I8KA 2NY7H 4MD0A 4GJTB 3MRLB 1E4WH 4P9MH 3EO9H 3I3BA 1RJYB 4Y89A 1OP5K 4XNZC 5AEAA 2IAMC 3FHAA 1FBIH 5D2LB 5EA0L 5GGTA 3MFFB 4OLEA 1C5CH 1KEGL 4D3CH 2W38A 4JM2B 1G6RL 5E2TH 3MOBH 4QWWC 5EO9A 5IOPA 1E4WL 5EORH 3ULUE 3G04A 3MNWA 2XTJE 3N06B 1DBML 1NBYB 4MSWA 5D5MA 3BEVA 4ELMB 3F8UB 3ECBB 3VXPA 3OAYH 4WHTA 4XPHH 4F7PA 2IAMA 5F9OH 2NY0B 1RJYA 3KDMA 4KROD 3DXAE 3B2VH 2YPKA 4NDMB 1NBZB 2AXGA 2VDQL 1JHLL 4M7ZC 1A7BA 4PFEA 5CLTA 1GOGA 4OGXL 2ENSA 3U9PH 3TYGL 1KJMA 3I84A 4JFED 3HE6C 4GW5A 5F9JA 4U3HA 1D5BB 5E7BA 4UTAL 3VG0H 3QA3A 2ZNWA 3RKDC 1VEOA 1Z9OA 2P8MB 3X14A 3EYVB 2R23A 1T0MB 2VNCA 1VPOL 3WFHB 2P1YA 2BP3A 1U95A 1KFAL 2AJYH 4XRCB 2FHCA 2OCFD 4FQ1L 3BZDA 4P46A 2QKIA 1Y0LA 4A2LA 2F53D 3PIQA 4UILH 4GT7A 3P0YL 4E41E 4GAYA 4UNTA 1OCWL 2JJSC 1U0QA 2C9AA 3O6FA 2EICA 2YC1A 5DF0A 2BDNL 4WFED 1QRKA 2ORBL 4D0DB 1AGDA 4XHJC 3SDDD 3NZ8A 2D7TH 2DBLL 1DVFB 1CGWA 1U8PA 1KPVB 1OT1A 1QRNE 1XGUA 3CUPA 5J9PA 2QR0A 1N0LA 5I8KL 5BQ7B 1W8OA 4ODSL 4QRPB 5CEYA 4LPWA 2D7MA 5SX4I 1YEDB 2GY7B 2YPLE 5E4EB 4TVPD 2QBWA 2N7AA 3D39A 3GMNB 2OI9C 5E08H 3ILQC 2GJ6A 2HYMA 1YN6A 1EVTC 3JBG7 5CP3H 4QHKJ 4G7YH 2DS4A 1JPSH 2Z31A 4L4VD 3K8MA 5KSAC 3PGCB 1NSNH 4E42A 1R5IB 5L2KB 1I1CA 2XN9B 3HLAB 4OZHB 5GRVL 4KMQA 2UWEA 4UNUA 1G7HA 3G9AB 1CU4L 4J3VA 3SGJA 1L7IL 4FA8A 1CFSA 5EU5B 4FQIL 1QSZA 3ZKXB 2RCSL 1EIBA 1Z0MA 4LIQL 1P1ZB 5TPWH 4K8RD 1ERNA 4ZUUB 4U1SB 4MAYD 2IALB 1RVFL 3O4LA 1I7UA 1VFAB 3EYQD 3IETB 2WQRA 5J1TC 4PRDB 1GGBL 2HVKB 3BGFB 4W81A 4OD1L 2NMSA 3BVNA 3HI6L 5FGCB 4HFWB 2FIKA 5B38A 4P9HC 1QSVA 3SCMC 4MB4A 2F19L 1FNSH 3LY6A 4RA3A 5ITBH 3ZKNC 1JNHA 4PLJD 4XMPL 1KLUA 3M8OH 1FYTD 5T33H 2ZSWA 4KK8C 2GK2A 5TGBA 4DZBA 1MREH 4HG4J 4XNXH 2X4NA 1DBBH 1I7UB 1VFAA 1SEBA 4ELME 4N90D 2G60H 1JRHH 1RD6A 1U2HA 2VDPH 5DRNB 3DYPA 8FABB 3QXUA 1TCRA 4JFDD 3IDMA 1N6VA 2CQVA 2WBKA 5J56B 4OLXL 1FFNA 5DT1H 2A38A 2LE9A 3PL6C 1LQSR 3E2HC 4R7DA 1HEZB 2IQAB 1YNTB 3D48R 4Y19B 5IFAH 4EVNB 1VGKA 1KJ2A 3QDGB 1PKQB 1GGBH 2FGZA 3RY6A 1KT2A 2GAZA 4PJ5D 5DA4A 5J7CC 2O61B 4HBCH 2ZPKH 3H42H 5FYLL 5ID0A 1KB5A 5C0BB 1JPGA 2O93L 4YR6B 1HDMA 2APTA 3TNMB 3RIFF 4ZOEA 3GJEB 4Y4FC 3SQOL 4F3FB 2BJMH 1KJ3L 3LRSB 4LSQL 4OCWL 1SBSH 2G5BA 4OF7A 1YPZB 2HTKD 15C8H 3IKCA 2A6DA 3FT4A 5HYSB 4NN5C 4G8GA 5JPNB 2OI9B 3LKNB 3V4VL 1CE6B 3EIFA 5I75B 4HIJB 3VRIB 2XZZA 3RNKB 1M7DA 4F15C 5I1CL 4YDJB 2DWEB 3D85B 3O6MH 3X12A 3WIFA 1QLRB 1UGNA 1I1AC 2VDOL 4IJ3C 3REVA 2GSIA 1CGUA 2NY4D 3TNNA 2BNRA 3LCYA 3OKEB 5C0AD 5CJQL 3C5ZC 3OKDA 2R4SL 3MROA 1PSKH 1AQKL 4KWUA 4Z5RA 4EI5C 1MQ8A 4G9DB 1A1MB 1EZVY 3KXFD 2I26N 3EJYD 1YC8A 1JF5A 4I0PD 3KPLB 1HXMA 5BV7L 3U7WH 5E2UL 3FB8B 3SO5A 2VN4A 5CEZH 3P4NB 3MXWL 1FGVL 1N64H 3BXNA 4ISVA 1T1YA 2VKXA 2ERJB 2XA8L 1RZGB 1P6AB 2YSSA 3HUJF 4DKFH 1MLCB 3AS1A 4W68A 1GPOL 2IMNA 3AY4C 1LILA 1OP3K 1MJJA 2J8UA 3QEGL 1TJHH 4NZJA 3FMGH 1UXWB 3EFDL 3OXSB 5JUEH 3VD5A 2CK0H 1RUKH 4L5FH 4LDEB 3RWFA 4PLKD 1TETH 3FT3B 1EO5A 4MJ4A 1JGUH 1XZ0B 5FGCE 2K1MA 4WUUD 4OLZL 4HK3J 1WTLA 3OGCA 3EDDA 2F15A 3W39A 1NAKH 3PE9A 4GSDH 1EMTH 5CD5C 4E41A 3CX5J 1NCBH 2DMCA 3IS0X 5LGHH 1XGTA 5KSAA 3ZL4L 3GSOB 3QIBC 1AXSA 4L1HA 1QBLL 2XRAH 3CFCH 1YMMB 1E28B 3FT2A 4ZDHA 3GMOB 4UV4L 1MWAA 4PJIA 4P2QD 3MCG1 3V0WH 3PWLB 2WANA 1BFTA 2FR4A 4R2GB 4YDJA 3LDBC 1NLBL 3EDKA 4XP1H 5IFJA 5ECJE 4PJAA 2DDQH 4WIQA 1T0NA 1PLGL 5KJRH 5ILTH 1YYLL 4CW1A 1QFUH 4PLKC 3QNZB 4YFLI 3WFBL 5H94A 5D5MF 3ULVH 1UM4H 1QRND 1WZMA 3JV0A 3WNOA 2E8ZA 1NCBL 2GITB 3BIBX 3C5ZA 4OZFH 3ME0A 1NC4D 2NY5C 3V52H 4CVUA 4CNIB 1OAKL 4WW2F 4U0RC 1JPGB 5GHWH 1FN4A 3G6JE 1L7TL 2HT2D 2EDBA 2FB4H 3U0TA 3WJLA 4NN7B 1MHHB 1J1XH 3FB6A 4PR5B 3KLAA 4RGNE 1LO3L 2ADFH 4FFWD 3H9YA 4YJZL 1RZIA 3DXAA 2ENYA 1HZHH 1LO3H 4ODHH 3T2OA 4RFNC 1ZGLA 3ZE2F 4MHHI 4FN0A 1UYWL 4D9QE 3NACL 5EU3B 1MI5D 4MNHA 2B5IC 3C8KA 2HTLC 3DPBA 1JI2A 5E2UH 3SE4C 3JVGC 2FYYB 1P53A 3VXOA 4PRPA 5EBWA 3KYAA 4ELKA 3AREC 1J0JA 4KRLB 5DHVA 2VL4A 3F5WB 1FO0B 4L29B 4LMQI 5CHNA 1DR9A 3UTOA 1FZOA 1AGCA 3NFNB 3TEUA 5HDLA 5HVWA 4QEGA 5KSVA 3MJGX 4GG6A 3CH1A 4NKIH 2XKNB 3N1GC 4QTHA 1IGTB 4X7TA 1AKJD 5D7IF 5DO2D 3FO2A 3CMOH 2N4IA 1F8TH 4Y4HB 5DMIL 3TGXA 1L9NA 4MAUH 1HSAB 3TP4A 2H32H 3VI4F 1UQSA 3P9LA 5E8NB 5TFSL 2IANA 1FCCA 1W2KT 5IEKB 5EOCH 1DDHB 1WIUA 2HTLD 4Z7VB 4F7CA 1EAPA 4CJ0A 4MVBC 1KG0B 5IBTH 3UAJD 2EDNA 3BP4B 1EEYB 3D2UB 2F9BT 3IXAA 4RGNC 1FV1B 1YY9C 4L4TE 1MCSA 1A6WL 1XH3A 2DQJL 2UZIH 4S10A 4N8VB 4OF3A 4TSCL 4GSDL 2CLVA 1IGJB 3MRKB 4P5MB 3VGGA 1F4WH 1OGAE 3IFNH 2Y7QA 5C0CD 3QPXH 2QL1A 4S11A 5LBSH 1F90H 2EZ0C 3SDXB 2AXHA 3PNWA 4PJCE 1G9ML 1ZT7A 4AEIL 4P46D 5B22A 4TNVK 3HE7A 3GMQB 5CIPH 1HYSD 4I4WA 4OCYH 3QWOA 4POZC 4GO6B 2W9EH 1ZHKA 1KB9K 3HR6A 1R3JA 2VLJB 4U1HA 3NZ8B 4M48H 2UYLB 4RBPK 4XI5D 5D9SB 2B1HL 1AGBA 5F7EL 1WBYA 2DQEH 2HJKA 4OZFG 3ZT7A 4CDHA 3G08B 4H8WH 5E5RB 4LDLB 4G8IA 3AVEA 3SJVA 1U8JA 1D5IL 2GW5A 3GJFA 5F7UA 3IFLL 2OK0H 4U1NA 5FO9A 1D9KD 4J6RL 4N1HB 1LO2H 4HCRA 4PPTA 3V4PH 5E94A 3FQRA 2E9WA 4K2UL 5A40E 5F70A 3E8UH 5TDPA 5IMLB 1XR9A 1KGCE 1DLFL 4N1CA 4ETQB 2R1YA 1TJGL 3QT2A 3HG1A 4WTWA 1I4FA 4M61B 4NO5A 4S1QL 1GGUA 3HPLB 3C60A 1UZ8A 3U6RB 1SYVA 3C5SB 2VLRA 5K9QG 4PJ7A 3QUKA 2FHBA 2R9HC 3X13B 1K8DB 4LQFH 4HZAA 2VDOH 5JZ7D 3T09A 2FX7H 1F4YL 5DK3A 1QVOA 2X4PB 4KRPD 5I8CA 3F62A 4G8IB 4F8TA 4EIGB 4ZTOL 2DWDA 2ZSVA 3N1PC 5KOVC 3V5HB 1MFCL 1JFQL 1TQCB 1IM3B 1ZMYA 4LDOB 4Y2DA 3SDXA 2UYLA 5DJ2B 3D3VA 3C5JA 2K7QA 5E8OA 4JPKH 3ECBA 2YZ8A 5DD5L 3VXPB 3T3MF 1QR1A 4JFOB 3UYOD 5C0IA 4MHHG 2CMRH 1TPXC 4HUXB 1BQHB 4JFFE 2PO6B 1CIDA 1T3FB 1HI6B 3T0XA 3O6LL 3SPVA 3G5YA 3PGFL 4C56A 1CK0H 3VFWB 3REWB 3IXAB 3B9EA 2MNUA 4TSBL 4AM0A 3MBXL 2EO9A 1FO0L 3SEPA 4O2EA 3S9DB 1NUNB 3QXWA 5FM5O 2R2CA 1OAYL 5JORA 1DDHA 4UDTA 4Z7VA 1NCWH 1HKLH 2E7HA 4Q6IA 5I1AA 3WKML 1Q8MA 3TT1H 4X6EA 1EEUA 2H6PA 2CJUL 2YWYA 3D0VB 4JPWH 3HNSL 4KTEL 3O9WA 4S2SB 3D39D 4Z78A 3LZFH 3V95A 4DJMA 1NMAH 4PRNA 3QPXL 4W6YB 1B90A 5FFLA 2ZCHL 2ZOLB 5KSVB 1KCLA 1KENH 1QA9A 1FL3B 4G6MH 4NC2B 4YIQA 4PG2C 3LN9A 1EO8H 3DHJA 1EV2E 2CDFA 1NDGA 5FKPB 2AEQL 2R2HB 3RVWC 1P7HL 3ARXA 1KFAH 3DETD 3QDMD 3V4UL 1PD6A 2OX5A 2VQ1B 3DO3A 4LGSB 2H26A 1OP9A 1T5XB 1WWBX 3DRTA 3TCLA 3EOYG 1JJUA 2F19H 5D1XC 2J7LA 2LVEA 2NY5L 3EJZC 1I9RL 1BZQK 3I02A 4DGYL 4FMKA 3VFMA 4WFGD 4HS6A 4G8FB 1T6WA 2CDGA 4WCYL 4OZGF 3ARYA 3C8KB 1H8SA 4R90H 3C6SA 2N56A 2VKWA 4P2QB 3KS0H 5IR1A 4TOYH 4X4XA 3R8BB 3LN4B 3TBWA 4HS6B 2QHLA 3QFJE 4JRYB 4LKCB 4YPGA 3UTZB 2HT3C 5EU7E 2E8YA 3RWEB 3TVMD 1QFOA 4WI3A 1GSMA 5IBUG 5D1QB 4NPYA 4UUJB 5HGDB 3TPKA 1JNLH 1C5BH 2VQ1A 5I2IA 4Z7WF 1MFBL 1Y18A 3U0TB 5LGJA 4NHCH 2VXVH 4JFDA 4O2FA 5TQ0L 1JIBA 5DR5H 4HJ0D 4G6KH 4JPIA 2V7HA 2LU3A 4I2XE 3L3OB 4U6HA 5KOMC 1G6RH 4ENEC 1DQJB 2K9UA 4J8RB 3QRGH 4AG4H 5C08B 1NMBL 2OS7A 3QNZA 3MRHB 1IAKB 3HI5H 4TTDD 3PDDA 4PRNB 1FSKC 4JFEE 4XBEL 2DQDH 4KJWD 1A4KA 4Z78B 3CFEB 3NAAL 1TXKA 3K4AA 5JXAH 4YHIA 2MCPH 2Q7NA 1VFBA 2FLBT 1JGEB 2A9ML 4U6YB 3BZEB 2NXYB 2H6PB 4EJ1C 1IC4L 3MMEA 1RZKL 1KCVL 1SHMA 4OI7A 5T5NF 1UB5A 4QNPF 4WTZG 5C07D 1G7HB 1YEJH 2VWEE 3GHEH 1WTGT 4I0CC 5E70A 1GGIH 5CCKL 2WLZA 4NIKB 1HN1A 1XGTB 1I8MB 2F58H 4DUWA 5DC4B 3ROOB 2E7MA 1FRGH 5C2BL 1LDSA 4WENB 5D7IE 3DO7A 2ZG1A 4MNQE 1MRDH 2IBGA 1FFPA 3RPIA 3U9UA 2VDMH 4X0KA 3V6FB 1W0VA 1UJ3B 4KGLA 1XGQB 2R0ZH 5F9WB 4P4KA 2H2PC 4QHUA 5DTFA 3CVIH 3RX8A 4DZ8B 3L9RA 1DQQA 1JNNL 1LP9B 5IJKC 4YNYA 2WBJD 1L0YA 4MCZB 1XGPA 2H8PB 2FJHB 4JFPB 3SOBH 2B1AH 1U9KA 1AC0A 4XHQA 1P7KA 3TT1L 3UO1H 2D7NA 3BGMA 5HYJD 4HUKB 1M7IA 4JRXE 4A6YL 1FIGH 1ZV5A 5CCKH 5CKAA 4XI5C 5E6ZA 5IHBA 4CGTA 4QTIL 4XPTL 3HPLA 5SWSD 1NC4B 4JZOB 2YA2A 5KSBB 1L6ZA 2Z9TA 1Q1JL 4LLUA 4LLAA 5TF0A 1WWCA 3B6SA 1U8OB 4XB8A 3WFHA 2XG5A 4K7FB 2W60B 5DUML 1EPFA 1MNUH 1U8KB 2OBGA 2XXMB 5C07A 1R3KA 3LIZL 4MDJB 1A1OB 4G6AD 5FA4A 1C7SA 3U4BH 3RZWA 3VG0L 5B4MD 1QBML 4G43B 4LSRH 2NY3B 2VDLL 4LCWA 5KVFL 3WNKA 4BSJA 4UT6H 3CDCA 4MD5A 5HPOA 1MCPH 3PQYB 4AL8L 1MOEA 3QO1A 4M8QB 3L5XL 5DD0H 2BNQE 2FWOA 3MXVH 3FJTA 1INQB 3VGFA 4N1EA 2R0WH 1GZQB 3AB0C 3PV6A 4D0CA 2H8PA 4K71C 1UENA 2JCCE 2ZOKA 2FL5B 1KLGB 4TNWK 4PS4L 3L9RB 2R29H 5IMMA 4QRQB 3L5JA 1DFBH 3BUTA 1JVKA 2EE2A 3ZDZF 5DUMH 4N9GA 3LHPL 3MRKA 4P4KB 1I7TA 3Q0HA 1DBMH 3WFEL 2NY0C 3ROLB 4NP4L 4F3FA 1QHOA 5JNYA 3TBVA 1E6OH 4YHYC 5ALCL 3JV6A 3SKOA 1ZWIB 3NTCL 4UOW1 3ULVE 2X4OB 3OL2A 1KG0A 3NAAH 3DO7B 1MEXL 2FJGA 3FAXA 5HHNA 5JXAL 3LRSA 2EE9A 2HAZA 3OPZL 5I2IB 1P6FA 4PJEA 2VISB 2FO4A 5AD0B 1XAUA 2OQJB 5ID1B 4PJ5E 5CKGA 1G7QA 4U33A 2W91A 4OFPA 4EVNA 3QRGL 4P23A 4IMKC 3P40A 4X6BA 1MHPH 5JXEA 4JZNB 5DFWH 8FABA 1OAYH 3RWGA 1VGKB 1ZTXL 3WCYA 3CFBA 5FM8A 3Q6GH 4Y16D 3VA6A 1VGEH 2PYEB 5D4QA 1MHPL 4H0GA 1A02N 4GAGH 2FSEB 5KZCD 1MRFH 1F3RB 3O8XB 5B3JE 4HC1H 1XR8A 4KHTL 1S7QB 3HRZA 5CJXA 5ELIA 3MTRA 1QFWH 1GGIL 4APQD 2A6IB 1RJZA 1CLOL 5E6YA 3BIKA 4UMGA 3IDNB 4FNLL 2YUVA 2YPVL 4YXKH 5HHXH 5HGDA 4JG1L 2A6JA 4NCC1 1QFPA 1W72B 1Z2KA 3G9VA 1DANU 3VMPA 3WE6B 2VDML 2FIRT 1H3TA 4WFFE 5D96C 1AD0B 2XQBL 5C08E 5ICXA 1AC6A 4JRXB 3SGDI 1CZ8L 1AXIB 4I0PA 1D5XA 5J6GB 2HLAA 3PHQA 1A6VL 2FZ3A 2VDRH 5BXFB 3K7UA 1MHHA 1PEZA 3MJ7A 5ADOL 1P7QA 4HX1B 4JG0L 1A3QA 2YWZA 4UIMA 4Y16C 1JYNA 3IB4A 1T2QH 1RMFH 3SKUD 1MCDA 2PYFA 2DN7A 5C0GB 3ELAT 3TO4A 3SDXE 5I1IH 4X7SH 5DJ6A 2IEPA 1BD2E 5GS3A 4BZ1L 4HJ0C 4W70A 4GAFB 3LZFL 3GMNA 4LHJB 5FYJH 5I8EA 3D39B 4PGBA 5K93A 3UP1A 3DOSA 3QQ4A 5FKPA 1SQ2N 4P0DA 2A1WL 3QI9D 3RGVD 3O41A 1BQHA 5TDOA 1FL3A 4PUBH 4F8QA 2NW2B 5ISZA 2LAAA 2YPLD 1YNKH 3FO1B 4Y7MA 3E6FB 2YK1L 5F8QC 3HG1E 1ZT4B 3OMZA 1LHZA 1CE1H 1NKRA 3V79C 2XNAB 3L7EB 3D69B 4KI1A 5GQBA 2UZYB 4XP5H 3TA3B 4HULB 3GMOA 1K85A 4P3WA 2E7CA 2NY4C 2FB4L 4QXGH 3MRNB 3S36L 4D0CB 2NY6B 2OL3H 1T7XA 3JWDC 3ZE1E 1JK8B 1EXUA 5GSRA 4N8CH 4R8WL 1B0WA 3X13A 4RDQF 2I07B 2JELL 4HK0A 4OZIA 3MOAH 2R4RL 4ZYKA 4ODVL 3SPVB 4C56B 4HUUA 3BPNC 5IW1A 3IDXL 1X4ZA 2X89D 3EJYC 5SWQA 5I71B 5C0IB 4FTVD 2IGFL 2PF6A 1U93A 3O11B 5F71A 1O7VA 3OG6B 4PJHA 4V1DB 4DGVL 1ND0A 4ZS7H 1RULH 5J3HD 4LSPL 3MBEC 4LLUB 2CJUH 4HMDA 3DVFA 1IAOA 3FRPA 4HSQA 2D31A 3G6JB 4S0SD 2QSTA 3JWDL 4JAMA 1TNNA 4XAKE 4F2MB 4JY4B 4WU7A 2EDFA 1S7UA 1X9QA 1G9EA 4XNQB 3ARBC 1ZLWH 1KTDB 4IRJC 1VPOH 1G7JA 4IRJB 4ACPA 4MQXC 5HHMD 1Y6NR 2QTEA 3G04B 2EEAA 3MBEA 5I74B 2FH8A 4U49A 3O3DA 5JHDB 5T3ZD 5DD5H 4L9LB 2QQNL 3JV4A 3DX6A 3MJ8B 5ITBL 2EH8H 5F7EH 2I07A 2CIIA 1HH6B 2D0HA 3GRWA 3EYQC 1MHEA 5J6HB 3O6KL 1A7QL 5KVDL 4CVXA 1XCTA 1N6QH 2BVEA 1G7LB 4N8PA 3I6LE 1PDKA 2VXVL 1EERB 1NPUA 3MFFA 1A14H 1ORSA 1A7RL 4NQVB 3OB8A 3PWJA 1BVKA 1YMHB 1CGYA 3AC0A 4MA8H 5HYSG 3VFOA 3P30H 2IANB 1ZHKB 3TH4T 1OAQL 2PXYC 2CIKB 3TBSA 3U7YL 3LOWA 4CMHC 4KK6C 3CFJB 4C57C 2CKNA 1MQKH 1A7OL 2IFGA 3KYKL 2XQYK 3S6CA 2FJFA 2W1NA 1HZHL 1JWUA 1R5WB 4FHBD 4NYLA 5IBTL 1UXSB 1CICC 3JTTB 4K2UH 1GIGL 1LP9E 3MYJA 1DQMH 5EN2B 4RISH 1BEYH 3BGAA 4NNXB 5E2TL 4YX2H 3QIWA 5H35A 1IQWL 3ZLQC 4U0QB 2ICES 2DAVA 1AGCB 1Q38A 1I9IH 3DGGB 3CPLA 2BSRA 5K9KB 3U4BL 1OAXL 4BYHA 4MAUL 2ZWLT 4WI7A 5DHVB 3VD9A 2H3NA 4OCNC 2J6EA 1FAIH 1Q0XH 5BW7C 2Y9RT 5I8EB 5HPMB 1YJDC 2O61A 5DYOB 4R4FH 5CGMA 5H2BA 3S98A 1EEZB 4KI5D 4OCYL 3RPKA 3VXQA 1V05A 1A3RL 4ZXBD 4FABL 4G9FA 3HC0B 3GIZL 5CJ8A 2HRPH 3UTTA 1CFBA 1UM4L 3MLVH 1OSPH 3BD5A 5CSZA 4ODTL 1D6EA 2L7JA 2CH8A 1UH4A 2DICA 1TZHB 5D6CB 4XNMB 4J2XA 1IGTA 5HHPA 4J3TA 3VRJB 4LGRB 4M6NL 2I25N 4X4ZA 1D5XB 1A0QH 4QHMB 1TQBC 1FNGA 4FQXC 1XEDA 3ZE1F 1FFRA 5H2BB 1PX4A 4JPWL 1S7TA 1X5KA 1RJZB 3F58H 1R24B 3OB0K 4U1JB 5CHNB 2ESVE 3PGDB 1MCFA 2F54B 3HI1B 4GBXA 5I16A 3CCHA 4I5BA 3RGHA 2NY3D 1E4KC 1U8NB 2YD4A 2FSEA 3F58L 1SY6A 3ARFA 1MUJA 3QHZL 4LP5A 1J1XL 5E9DE 2K7PA 5C7XL 3EW3B 4GKSB 4FFYH 2GJ6D 3VFUA 5B3JF 3RVXD 4XBGB 4YDVA 1XF2B 1RZIB 4LCCC 1EA9C 3GI9H 4PJXB 5F8RC 3RKPA 2DIJA 5ESQB 2OTWA 3TT3H 3R0MA 3MA9H 2NY2C 5T3XH 3HZYB 3CFBB 5E24E 1JFQH 1S5HA 1H3UA 5D7JA 2H9GB 4JKPL 3KYMA 3P73B 2FR4B 3ARPA 2ICEB 4L4VB 5JUEL 4X6BB 5DC0A 3A6CL 1ODAA 1VEMA 1MPAH 3N1QC 4RCAA 5GGRB 1F8TL 3ARQA 2Z31B 1SYSA 4G80B 3EDJA 3BPNB 2XWTB 2A6KB 1YYLH 4LPVA 5IB2B 3F6IA 5GS2H 4ODXB 5J6HA 4JVUA 2R8SH 4QF1B 5T5NG 4AIZB 2ZUXA 3TIDB 3REWA 3KPRB 5D70H 3CFCL 5J3HC 2NY7L 3VFRB 4K7PL 4TULH 4WWKC 2EXWD 4AY0A 1OGAA 4L3AA 4XPFL 4QWWD 3MNVA 4I13B 5HHOE 1HOCA 4HIXH 2AJ3B 4QRPE 1V5JA 4TUJB 2IADB 1RI8A 4H25A 2V2XB 3U2SB 1P5UA 3RZCC 4BKLB 2Z8VC 3E6HA 5IB3A 1N59A 2A74B 3LEYH 4WUUB 3CLFH 1DUYB 2H41A 3MV11 3FFDB 1FQ9C 4LEOB 3GZKA 3IGAA 1INQA 1BGXH 1HINL 5MI0B 5F3BA 1QVOB 1QPXA 4NRYB 1FZKB 1RZGA 2FDBP 5EUKA 4V1DA 3F7RA 1A1OA 3ZHKA 4NQCA 4ZAKD 4AEIH 1MVFA 1RZ8A 2IGFH 2EIZA 5CP7A 3OKOA 2M8XA 2VLRB 4HDIA 5HYQB 3CVIL 1JWSB 1V7NH 5DMYA 4ZSOE 5TDNA 1B0RB 1XF3A 3OZ9L 1JPTL 4LPXA 4TVPH 5IW6B 1TQBB 2JCCB 3UJTH 4G9DA 3RWHB 1OAUL 3C5ZD 4N0FB 2Y6SD 5FGBC 4OZIB 4YBQC 4NN7C 1M7IB 5DJYA 2BY2A 1FVDB 2J88L 4KHXL 3G6AA 3GMMA 1NCAL 4YHKH 5IF0B 1AHWA 5EZIH 1EGJH 3F7QA 4PJDA 4GW1A 1DUYA 3VGBA 3O2WH 4HF5H 3KWWA 1U3HB 3G08A 3M1BB 1HE7A 1MLCA 2ERJC 5E1AB 1BF2A 5D7LB 2WP3O 5I9QC 5I15L 4XP1L 1NAKL 2KH2B 1NBYA 3BXNB 3H9ZA 3P4NA 3MNWB 4AQ1B 4K8RH 3D3VE 4NN6B 5EU6B 2E6PA 3KPRA 4ZAKC 3O41B 2EDJA 4XXCC 5D2LA 2X4UB 1KCSH 3MJ6A 4C54A 4PRHB 3ZMRA 5TJWK 2DI7A 3QDHA 5T1LD 1WBZA 3FCTA 3HPJB 1F5WA 2YS4A 2OZ4A 1KTLA 4OGXH 3DMMA 3VI4E 5F72S 1P2CA 1ED3A 2PW2A 2UZXB 4NFBA 3WXVL 3PWUB 1I8MA 3EZ8A 4JO3H 1UJTA 4JVWA 4JQIL 4I77L 3NPSC 3QCVH 1MFCH 4L5FL 2H9GA 3ARRA 3IVKB 4FMFA 4OB5H 2MJWA 3HZYA 2BOCB 1HEZA 2IQAA 3PHQB 5IKCB 1IGMH 1IEBB 4MJIE 3MRHA 2VZTA 2H45A 5I8OL 5TPWL 2Q7YA 2ZPKL 3QUXD 4DEPB 4BFGA 5KVDH 2DQIH 5JXED 1SEBB 4O9HL 4V2BA 4HS3A 3BESR 3GSNB 4KKCD 4B7IA 1LE9B 3B9KB 3L3HA 4JZJA 3B9KC 4MA3A 5F1NA 5I66A 5DJAA 5D1QA 3L3OA 1Q9LA 1KN4H 4MCYB 4U1JA 4XCCH 3KPRE 4JFDB 1S7QA 3HRZB 4O2FB 4NKOB 5SX4H 4UINH 1RZKC 4JGMA 3KLSA 4X99B 1U8HA 4POZD 3I2CH 3AAZA 4XNXL 4LLWA 1K2DB 1E27B 5AAMA 4BSWB 4MA1C 4Z0XB 3TJHD 1UADC 1I3RB 4ZO7A 3HAEH 3M8OL 2X4RA 4XP4H 2B1HH 1WAAE 4L4TB 3OBAA 1INEH 1JZ5A 2P7TB 2FATH 3CSPA 4AJ0A 2CLZA 4HXBL 2QEJA 4QRTA 2Q76A 5ICZA 1QSEE 2RGSA 2F8XC 4JQVA 1AGFA 3DRTB 5L8JB 1U8HB 3SJVD 3P11H 4N0UE 2YPVH 4YXKL 4NT6B 2DRUA 1U3ZA 4MMXC 3WSQH 4KK8D 1MFNA 1A8JH 3DMMC 3TCLB 2GSGB 1L7IH 1A6UL 2VH5L 1A6WH 4HKJA 4W6WB 4LSVL 3TZVA 4ZFZA 4LPYA 4X4MA 5KSUA 3IFOB 5E5MA 2HH0H 4H1LH 2WZPD 5E5UB 4DWHA 3O6LH 3MRQB 4MQTB 1F4XL 5E8DL 3WHXB 3WDHA 3B5GA 1WT5C 2F53A 2HP4A 3OG4B 4AZ8A 1MCKA 2VDKL 3FRUB 3KG5A 4H1LB 1CFTB 1SJEB 4XHJD 1KLGA 4XTRC 2OTUA 1S9KC 5FUZL 3MLXH 2NQCA 1U8IA 2DM7A 4GRWB 4NFDA 5E1HB 5GGSA 1FC1A 3TWCL 1GZQA 4HPOH 2AJVH 5DZOA 4LVNC 1DQLH 2CO7B 3L3KB 3AXLA 5F7FA 3BKJL 5GZNC 3IU4L 5EU6D 3D0VA 4WFEE 5C0CA 4KI5E 1G7LA 1Y6MR 2OZ4L 5HHVH 4IBLT 4MA1B 2FECL 1SMOA 3GGWB 4IS6A 3CK0H 3TLRA 3LIZH 4L9LA 2NYYD 4QRPA 5CEYB 4IRJD 2W60A 4M93C 3VXSD 3MV7A 5CINL 1DFBL 4FOMA 2HFGL 4OLWL 1FZMA 4GXUM 3WKNA 5EORL 2YD6A 4NRXB 3ALXA 4I18C 5L7XL 4Y5YA 4OFYA 3GBNH 1LE5A 3Q1SL 3QJFB 1AI1H 2VSDA 1NAML 2R0WL 5H8DA 4YHOL 4LHUG 5IBLD 5HGBA 4NZUL 1Z9LA 2EYTA 2I5YH 3VJ6B 3TO2B 4ZFGH 1FJ1A 3ARGC 3QUKB 3JUZA 5I73C 3T1WA 3F12B 3TBYA 4KQ3L 4JFXA 4JJHA 3HG1B 5DJYB 2EDYA 4ZFGL 4U1GC 4ISVB 2OM5A 3RWHA 4KTYA 4OCXL 3O2VL 2A2QT 3MO1B 1UVQA 2X1XR 3V6FA 4NOBA 5I1JL 1JWSA 5JW4N 4J3SA 5C0ND 4QHKI 1OP3H 4OIIL 1RZ8B 1PGRB 4BZ2L 2M26A 1WBYB 4EBQH 1KN2H 5DQJA 4J23A 2EEBA 3DVIA 4HWBH 4U1NB 2V6HA 2Z8SA 3KYNA 4B0MM 1T1WA 4YHMH 1KBGL 2F74B 3D3VD 2F5BH 1J8HA 2VLLA 1EVUA 1DBKH 5D71H 5ERWB 1VFBB 2Q3AA 3BZEA 2Z8WC 2AXFB 3HC4H 4ZG1A 1L9MA 3GMRB 5FO7A 4Q9RH 4WHTB 4G9FE 1LO0L 2FBJL 3SKJL 2UUDK 3V6OA 4KVNL 1EHLL 1KBGH 2ORBH 4WRLA 2DL9A 1GGTA 3TVMC 2DTML 1INDH 4IRSA 3OKMB 4JO4L 2Z91B 1IAKA 1RK0A 4FG6C 1R6VA 4BH8B 4E0RB 4GMTH 5BRZD 4HQQL 3BSZH 4ESKA 3VU2A 5F7NC 3X3FL 4IOIB 1A1NB 3HNTH 4JFEA 4OIIH 1BF8A 3U9PL 5KTEL 4HT1L 2JJTA 3KPOA 4G42B 2BMKA 5JZ7C 4YGAB 3X3GH 3HE6D 5T5FH 4IRSD 1HSAA 5F9DC 1ES0B 3H3BC 4E5XB 4C59B 1UM6H 3ARTA 1I9EA 5DMKA 2A9MH 4UT7L 1HHJB 2AW2A 1KT2B 5GGUA 5AZ2L 2XZAL 1WITA 1CLYH 2Y36L 4K7PH 4TULL 1EUTA 2WUCL 4XCNB 2AJSH 2OTWB 1QO3B 3RWIB 3FN0L 4XNZB 4Q97A 3GBLA 4D3CL 1WWAX 4YDKH 3QG7H 1FBIL 1TCRB 3Q1SH 4LIQE 5HHVL 4RNRB 3L3DB 3O6KH 1A7NH 1FVEB 1KELL 1MH5B 4MJ2A 5IMOA 1BWMA 1BAFL 3WS3B 2HWZL 2VABB 2MMXA 3OTTA 1N5AA 4LLQA 4R4BB 3CXHJ 3S36X 1MHCB 4HUVB 1IBGH 3CXDL 1QSFD 1MCBA 3W5NA 5JDJA 4PRPB 1FL6A 1J5OH 2JB6B 3ULSB 5IQ7L 4X7EC 4X6CA 1B2WH 1UWXK 3LEXA 4LCUA 1J86A 3JVGA 3GMLB 5LXGH 4LASL 4XWOD 5F88A 3VW3L 2APWA 2PTTA 2DTMH 1YDPA 2J4WL 1RHFA 3DSNA 5DJXB 1FNGB 3GNMH 2N1KA 4UV7L 1WBXA 2O5ZL 3QXDB 2I24N 3TJHC 3BPCB 3VD4A 2C1OB 3MUGB 1KTRL 4BFEA 3BH9A 3B8YA 2NZ9C 4RGND 1ZSDB 1EJ6A 5FYJD 3KLDA 1JV5A 3MGTA 2XI9A 2AJXH 4YHNA 4ZS6D 1XCQB 4FXGB 3L5WB 2Y72A 5JIPA 5M94B 3UROR 3VG9C 1U8MB 2XG4A 2YUWA 5ICYB 1PBYA 4AM0B 3SKMA 4JGUA 5TE6H 1XIWC 2ZCLH 5DS8A 4XP4L 4HK3N 3TVMB 1B9ZA 5IESL 4L8SB 4U1KA 3KXFB 5B8CB 1CICB 4GKZA 1F13A 4HWUA 4ZNCD 1OGTB 4KQ4H 1R3HB 1EJOH 5HY9B 3ARBD 4LP4A 3I85A 4ZTOH 1FHGA 3VCLB 3MV9D 4OBRA 1XF5B 4MCYA 2L0DA 4XBEH 2C1PB 3MV8A 3CC5A 5E2WL 4D0BA 2YC1B 5A2FA 1NCUA 5F1NB 3DBXB 4GRWF 3O4OC 3QEHB 1S9WA 3SDDA 5I74C 4OLWH 3SDCA 3OXRB 2PCPB 5KSAB 2R15A 5A16B 2VB5A 3O81A 2AABH 3CDGA 3MCLL 1MLBB 2MSPA 1N5YL 4Y16B 5EZJB 3MREB 3W39B 4XB7A 2K3TA 4UT9H 4KMTL 4N5ED 1NCDH 2HT3D 4TTDC 3LQZB 4KPHH 4JFXB 2EZ0D 3AU1B 1I7ZA 1SJHA 3FB5B 1OAUH 2WNGA 5KVMC 3BW9A 3WXVH 4DOHB 4K3GA 1PSKL 5F1IA 5JOEA 4K3EL 5T1KB 4MA8L 5HXMA 1IM9D 2PW2B 5KS9F 4QRUB 4WUUE 4OGAD 4KVCL 5CGTA 2AJVL 1ZHBB 3W0WA 2DJUA 4PV9B 2FJHA 4JFPA 4PJIE 3V6BR 1UM6L 1SVCP 1MJ7L 5DLMH 2ESVB 3HTLX 5HHOB 2MHAB 4JEGB 4WI8A 5GJSL 5C0EA 2XIDA 3LQAC 2X4UA 3HC3L 4KH2A 3KPPA 5LBSL 1VCAA 2P5WD 5HGAA 3O3AA 4DK6A 1F42A 5GRUL 4Z5RB 4TSAH 1EBPA 3CXHK 4PRPD 2PXYA 5EZOL 2QJDA 1M7XA 1SEQL 3LVEA 1CD1B 4X8XA 3E3QE 4TNVF 5EC2A 2GSIB 2FGWH 3BSZL 3L3IA 4OZFA 1IMHC 4XCCL 4G6JH 4DVRL 3M1BA 4ZNEA 1QLRA 1N8ZA 4ONHA 3E0GA 4P2RE 3BKCL 3T8XA 1TJIH 3VRIA 4GH7B 1WFUA 5IROA 4Z7UE 3MRNA 2NX5A 3B3IB 4MWFA 2DWEA 3QI9B 5FGBA 1P7QD 3CFEA 3QDGE 2VZUA 3D69A 5T1KD 2PNDA 5D8JL 5B8CC 2Y6SC 1OWWA 3E6FA 3OKYA 1B3JA 4X7SL 1EHAA 2DQGH 5DJ0A 4C83B 5IIEB 3BDBA 2IH3A 1KV3A 2P8LA 4HH9A 4WUKH 4K9EL 5SWZB 1H0DB 3RA7L 2J5LB 2V5RA 2BC4A 4WV1A 1MIEL 5HDQH 1UZ6F 5EBWB 5ID0B 4CRPA 5FAAA 5ITFB 5HYJB 2AERT 4NN5B 1T83A 4G8EB 4M7LH 4FFYL 4KROC 4MNHB 3SCMB 2DM2A 4X9FA 3HC3H 3DRQB 4PTTB 5TF1L 2XQYG 2CLZB 3BQUC 4LOUD 4LEXH 3CU7A 3KPQB 5DVOA 1JBJA 1KC5H 4ZQKB 1JF6A 5IJVB 1MFAL 4K8RL 2F54E 2BNQA 4H0HB 4P2QA 4HWBA 1MJ8H 2X4SA 3CFKB 4JN2B 2C3XA 4TUKL 5DRWA 1EAJA 1FPTL 4PR5A 4DZBB 4FQIH 5HDOA 4G6FB 1FZJB 2OSLB 4ODBD 4ZPTA 2DYPB 3FN3A 5KG9B 5FDWA 1NCCL 1C1EH 5IW3A 3WIIH 2IAMD 2A6KA 1I75A 3WE6A 4F9LA 3SDYL 5DD1L 4S1DD 1DLFH 3UTQA 3T65B 1OPGH 1U58B 2FIKB 3DETC 5B38B 3BVNB 2ARJQ 4HMCA 3CK0L 4GW4B 3RDTA 2AK4D 3O0RH 4U6XB 1JNHB 1YEEL 3H9SA 3SKNB 4FQLL 1A6AB 1UC6A 3FHQA 5L9DL 1YEFL 3S4SG 4U1SA 4FQCL 4HFWA 1AFVL 4FXKA 2XTLA 4I3SH 4Z7QF 2BXZA 4WWKB 5FA3B 4LLVA 1OL0A 4YHLL 2CLRB 1CD8A 1QFUL 2YXFA 5BRZE 1JZ2A 4FTVB 4BQ8A 2NY2D 4PJBF 5ACLA 5C7XH 1GOFA 5I8KH 1FNFA 2DF3A 4BJLA 5BS0E 3HUJA 3RNQA 5D93B 2WINB 2FRGP 3ARFB 4YEEA 3ARFC 1R5IA 3QR2A 4PJIB 3PWUA 4EN3C 2GJJA 2VR5A 1CXKA 4L9DA 2R1XA 1S7RB 4JPVH 1CLZH 4EOWH 5HGHB 1TZIA 4RMSA 1AQDB 3EOBA 3I9GH 4PRHA 4I3RL 2E9BA 1BD2A 1YN7B 4PS4H 1WFOA 2AJYL 1HCVA 3OZ9H 1QSFB 1BJMA 1CR9H 2AJUL 2B8OT 3IDGB 4JQVC 3O45B 2DI8A 5EIVA 5JNYB 2Z92A 4UQ3A 1OSPL 3W0WE 3MODH 1WSST 5ABDE 4M1DL 2DKSA 4P57B 4IMLB 3CJJA 1T7YA 2R8SL 3D9AH 3UTTB 1KB5H 1U6AH 2AEPH 2WSKA 5E2VL 3RZCA 1J1PL 3GSNH 1N7MH 2DWDB 3PQYD 3R4DA 4Z7NE 1AXTH 1WEJL 2P47B 4Q74A 4WO4D 2R0LH 5B4MC 2Z35A 3ZZ1A 3IT8D 5ANME 5IF0A 3GKWL 3O2DH 2IG2H 3NCJL 2X42A 1JHLH 5EO1A 1T89A 4Q9RL 1GZPA 2R2EA 3MLVL 4NM8L 1B4RA 5LCVL 5DEZA 1IQWH 5INDB 3C5SA 3OB0H 4R0LA 4KMTH 3ARED 3UBXI 1DEEB 2VTFA 1PYWA 2C4FT 3W11C 3BHBA 3WUWA 5D70L 2HFGH 4OLZH 1CTOA 3S96A 3QUXA 1MJUL 2HVJA 1T0MA 1RZFH 1ZANL 2AP2A 5AYQA 4HLZH 4QGYA 3Q2CA 3RBGA 4KKNA 3TESA 1BP3B 1CDJA 5DHVH 3ULUL 4NWTL 1A7RH 2WBJC 4AENB 4BZ1H 3IDXH 2HJKB 3QDJD 2OR9H 5CJOH 3VA2C 1AO7A 5J8OA 1CFVL 2A0LC 4DN4H 5IEHA 3IRZA 4JVPA 2XZAH 3RBSA 3H0TB 4NRZA 1UACL 3ARSA 3KPNB 3KPSA 1SJVA 3HN3A 3VFVA 4MSWB 5D5MB 2HJFA 1TFHA 3S37L 4G8GB 1ACZA 3O3EB 2Y06H 4XP9L 5JW5A 4EDWL 1HNFA 5DRXB 1TVBB 5KZCB 1HCFX 4ELMA 2BY3A 4X8JB 3IDIB 1FL5B 3THMH 2O5XH 1S5IH 3MRFB 3CLEH 3EYFB 5IVZA 1GCFA 4Q6YA 1HXYA 3U48A 2MHAA 4YXLH 4OM1L 1FV1A 3U30B 1HDMB 4XWOC 5IB4A 2VZ3A 1CN4A 3T3PF 1E4XH 4FQ2H 3FAWA 1CLCA 3BISA 4HV8A 1NC2B 3HHRB 3I3EA 5K9OA 2DLFL 4PY7A 3V5KB 3A0OA 5DJDA 1T5WA 3MX0A 5BVPL 5EZLB 1BREA 5C0CE 3O11A 1U93B 1CGTA 2XZQH 4PG9A 2EKJA 5ESQA 4ODTH 3VWJA 4X7TB 4POYA 5AUMA 4XCFH 3K2UH 1RMFL 3BDYL 3MLYL 5EBMB 3BYYA 4NO3B 5JO5A 1JTPA 4MZ3A 1QQDB 5E9DD 4MS8C 3KJ6L 3RL2A 5DJCB 3WDJA 3SGKC 2XWJA 5T1LB 5BJTA 3NN8B 3DIFA 1A9EA 3QO0A 1T4KA 3KYOB 5TQ2H 2OTUB 5GJSH 3HUJE 4MXQC 5C0AE 3P4OA 3PWPA 3J8F7 2R4RH 4NPYB 1ZGLB 3CGTA 2HVKA 3NTCH 1I3UA 1P69B 4B5EA 1GIGH 1H3PH 2GTWB 1BWWA 1AR1D 1PW3A 3FO1A 3I6LD 5DHXB 4ZUUA 3RVVC 3KXFA 5E5MB 3QDME 1OT2A 2CK2A 2UVEA 3S97C 2P5WA 1A3LL 1NKOA 5TDOB 5MHSD 3QUZC 2R1WB 5I17A 2B0SL 4M43H 1F4HA 3T4YB 1A4JB 4HFUL 2FCBA 2IBZY 1ZE3C 4ERSL 1OTSC 4KUZL 4E42B 3BAEH 2PTVA 5D2NB 4CNIA 5CJ5A 4JO1L 3SDDC 4UDUB 3W2DL 3BRDA 3V5DA 2VDLH 5HDBF 3FRPG 3OKNA 1M05B 1I3RA 5GGTH 1Z3GL 4EUPA 1HK6A 5I17B 1G6RB 4JHAL 2MQCA 2R0KL 3WJJA 3DVNB 3LB6D 3MZTA 5FOBB 2X70A 2XZCL 4LSTH 1DVFA 5C0RH 1BOYA 2W9EL 3ZSSA 3MLRL 2W0FA 5BZWA 1G7PA 2W0KA 4D0DA 4JFZL 3QEQB 5A2IH 4LBEA 3CLEL 1MF2L 3CX2A 3PWPB 4QTIH 3O9WB 4KKBD 3IDNA 5KW9H 3B9KA 3BP6A 3L3HB 2EEDA 2AGJL 4GAYB 4QXGL 3C2AL 4KXZI 2V5MA 5I1AB 4MXQD 1S8DA 4NZTH 3GSXA 2X9XA 4NC1E 1FVEA 2IPTH 2XQBH 2HT4D 2C7UB 5KANI 2R69H 2YRZA 5I30H 4YAQA 3DUUB 2DIAA 4GRMB 2R23B 1UKSA 2P5EA 1IEBA 2YPLB 2VUYA 2ESVD 2X4SB 3CFKA 2OJEA 2G75B 5DVNA 2WWKT 5C09B 5IVXB 4DGIH 4P5TA 4M00A 2QQQA 4JHAH 1QHPA 2P45B 3RWDA 2BZDA 4KRPB 3QFJA 5KVFH 2IH1A 3HFMH 4JZNA 2JJTC 1UG9A 5C6TL 1KTDA 2EDQA 4O02L 4CN4A 3IAGC 4HS8L 1K8IA 3EYOA 1ZA6A 5EZLA 3DMMB 1BM3H 1X44A 3V5KA 5CLWA 2FO4B 3OAYK 2DQFB 5FF6B 3B2VL 3JWOH 5IWLC 1JGVL 4P5KB 1J87A 3QUMB 4R3SA 2YSSB 2WK2A 1ND0B 3AREB 1J5OL 1G1YA 1IC1A 5JQ6L 3MLSH 1IGIH 2A77L 3F7VA 3V6ZA 2MCPL 1FIGL 3HS0B 5HHQA 2FO1A 1H5BA 1DJSA 3BWAB 5I18H 1I7TB 3QWQB 2APXA 2HJFB 3C87A 3BO8A 4XC1H 2J88H 3JXAA 1WT5A 3CVHA 1XR9B 4ZO9A 5L2JB 1CGSL 5F89A 3LPWA 3TIEB 2XFXA 2GT9B 3AS2A 2BNRB 2NR6C 3GMMB 4P99A 4C4KO 1CD9B 3DHMA 4YHZL 1I7RA 4YZFF 1BVLB 3TO4C 4XH2A 2YD1A 2CO6B 2J1KA 3B2UD 2AK4E 1CICD 1T89C 5IW6A 4NC0B 1CD1A 4N5UA 2RQ8A 3UPAA 1B4JL 1MWAH 4JLRB 1A2YB 3F6LA 2FD6H 3BN9D 5EH1A 5E9DB 5HHQB 1UVQB 3U1SL 1MCWW 1DEEA 2A6DB 1IKFL 1AIFA 1A47A 4K94H 5HYFA 5B39G 4LKXB 5C07B 3F7YA 3NGBC 1VACB 4OFYD 2ADGB 1KCKA 2G5BB 1YNLH 4OUOA 4U6VL 1A6UH 2VH5H 5IM7B 2CR3A 1QNZH 1ZEAH 3GJEA 5HHXL 3DMMD 4FNLH 4R0LB 1T0PB 4TQEH 2FX9H 4OTXL 1AP2B 3FZUC 1OY3B 4I0KA 1FVCA 1P7KB 1BQLL 2PKDA 4IOFC 3UMTA 4P9HL 3TFKD 3QQ9C 1QNZL 5JR1H 4G5ZH 5FCUH 4U1GB 4I3SL 5D71L 3K3QA 2R56H 1GJIA 5JMRA 5E8PA 4XVUD 3QUZB 4KI5F 1DQQB 5DA0B 1DSFL 5DR5L 2OP4L 1H3WM 2DD8H 5FUOL 4UIKL 3MRCB 5BV7C 3DXAD 3U1SH 3MV7B 3THML 4LPCA 5C2UB 1MCJA 3WD5L 4Y4HA 4KZEH 1F3JA 1GOHA 3GSUA 4P2YA 1M6OA 1WLHA 2B7DT 2IPKB 2AK4A 3MGOA 2GTZB 3S5LA 1S7RA 1NMCC 4KTEH 4ZOAA 1BD2B 1RK1A 2EE6A 3G5ZA 4H20H 5FXCH 5GS0H 2Q8AH 2WINA 1VA9A 5GGSY 2YA0A 1YEGL 4Z7UA 2GFBA 1JHTA 3CSYA 2W9LA 1ADQH 3BN9C 4ZAKA 3DUHA 3OAZK 4JDTH 4OD2B 4PJXA 5F7MC 3HZKA 5EU3A 5CS7A 1XF4B 3TV3H 4LLVB 4AK1A 2DQDL 3E1F1 4WDIA 4GG8A 3VFUB 2Y07H 3RWGB 4YHOH 1TZGH 1AI1L 5J57B 3TO4D 3LS5H 2HLFD 4POUB 1IGIL 1DVFC 2A77H 2OL3A 3TPUB 3DLQR 4KAQH 3NFSH 1RZKH 1U8QB 4PY8I 1DQJA 2J2ZA 3VDBA 2JK5B 3BDYH 5I16B 2YKLH 4PP2A 2VR9A 5TH2B 5SWSB 1I1FA 2AJZA 1X4XA 4LLMB 4X7CC 5E00B 3STBA 3G5ZB 4LLYB 1A4JA 1A22B 4MX7A 2GCYA 3BX7C 3Q3GB 1AKJA 1FZJA 1RUPL 5ANMA 5GGTL 3WFDL 3LKPA 5EDXA 1OTTC 1G7MA 2GTZA 1I85A 2QHRL 4J7RA 5JA8B 4QRRE 1AQKH 3K74B 1F6AA 3EHBD 4OZ4B 1V3LA 2BSTB 4FFVC 2BNRE 3WNNA 1MCIA 2H2SC 2QR0B 1YDPB 3FO9B 3C6SB 3RWJB 5L2KE 3LRGA 1E27A 4GXUN 4BSWA 3U0WL 4JJ5B 5EU6E 3NFSL 3RUGB 4URTB 4X6CB 3H7BB 1YEHL 4PJAB 3RAJL 2HFFA 4Z7OE 3HZMA 1OOAA 4D2NA 1CQKA 3VD7A 3QP3A 3MV7D 3QHFH 3V4UH 2N7BA 3BGFC 1D3CA 3MGAA 4HUWA 1KJ2L 5E99L 2NW3B 1KCVH 5A3ID 1LE9A 5AG9A 4PIRF 5CD3A 1AXSB 1A21A 3D39E 4KJQD 5FHAH 3ISWA 1FCGA 1ORQB 1J11A 2FJFB 2R0KH 1BZ9B 5FHBL 3V7AG 4CU6A 1HHHB 1VFUA 2CIKA 3TBSB 5D8JH 3VXMD 5JLZA 3LKSB 3U0PB 4QHNB 5K9JL 4JZOA 3KJ6H 1NC4A 1CDYA 4P2OC 4OLVH 4X80L 1GHFH 1KJMB 5I1DA 2H2SD 5C6WH 3VXSE 5HYEA 1IEAB 3OR7A 3BKCH 5IB4B 1F58H 4LVHC 3LRHA 4Q6IB 3OJ2C 1XIWB 4ONHB 2VJXA 2E3VA 2AABL 1OLLA 1ITBB 3VFGH 4JHWH 4AT6A 2CIIB 1CDGA 4JFYB 1RZJH 1FL5A 3IDIA 5L2JA 2XWBB 3PP3K 1CE1L 1KIRA 4QHUB 2OR8A 5JW5B 3MBEB 4R9HA 2M2DA 4HUXA 2AV7B 5F1SA 1UJ3A 3O3BB 2C3VA 1NMBH 3HS0A 4X0KB 1A2YA 5CD5D 3KPSD 3RI5K 5ALCH 4PV9A 4PJFF 4HGKC 5K9JH 3AREA 2AEPL 5IHLB 2EIBA 1DVFD 3EJZD 3D85D 4LVEA 2X44D 4NQSA 5D96B 5IQ9B 3WFEH 4AENA 5ALBH 4AT6B 4F33B 3DSFH 1X5HA 4AH2B 4NHUB 1B4JH 1JZ4A 1U8LB 4ZNEE 5DVLA 3S88L 1EHXA 3VXRA 5FK9A 4QRUA 2ZKHH 1JGEA 1LO5B 3DV6B 4O00A 5F89B 4HMEA 1NGXB 4JG0H 1S7XB 3BW9B 1CD0A 4RMVA 4WFFD 3LH2H 5IHUL 3VGAB 4APQC 1EHNA 1A5FL 4M1GL 5ACZB 1NEZB 2XKUA 2JTDA 3MCLH 3RVXC 1CGSH 1MLBA 5CZXC 4JFFA 5D6DC 5GSRB 1VERA 1M4KA 7FABL 5J13C 5I1HH 3OKKB 1HKFA 5BW7A 3UJIH 4CMHB 2ZUSA 4OCMC 3C6LC 1D9KC 5LGJB 1U36A 3TBTA 3D0LB 4PUBL 1BOGB 2Q8BL 3AY4A 3V8CA 3VCLA 2E7LA 1FG9C 3L5HA 4RQQB 5I15H 3QAZC 4GUPB 4L8BB 4M1CD 4R97C 2V5TA 1XMWA 3KLHC 4U1MA 1XGRB 4P57A 4U1IA 2CUHA 3QUML 1EJOL 2AJ3A 2YZ1A 1FDLL 3OJDA 4ZFOA 1G9MC 4KXZH 1PG7L 5D7IA 2VLME 1QSFA 2XY1A 3IFNL 5HI4C 1NCNA 2Y06L 3VXNA 4MNQA 5J89A 2FECI 2VWEC 3QUMH 3GIZH 2P5EB 2BSTA 4YUEL 1QOKA 3UPRA 2X40A 4YFLF 2D2OA 3IJSA 4ODXA 4X6DA 2GUOA 3LV3B 1ZVYA 1QACA 3W81A 1JV5B 1IAII 4G80A 4KKCC 3MA7A 5DSCB 3I75B 1RHHA 2WUCH 1WC7B 4R4NC 4RGOL 4LEXL 3LD8B 4Z6AT 4Z8FH 1AY1L 3MJ7B 4LLMA 2AJUH 2Z31D 4L4VA 1IZKA 2FH6A 2B4CH 2R1WA 1HHGA 1TLKA 2F5AL 1UB6A 3VGHA 1F3DH 3PXJA 2HLAB 4KPHL 4YIQB 3TC9A 4ZD3H 3QG6A 5E99H 1VADA 1PZ5A 2RFXA 1EFXD 1AGEA 2UV3A 2ED7A 1KLFA 4PRID 4KKLC 3LEXB 3PHOA 2HFEB 4JM2F 2WW8A 3RVTD 5E95B 4H1LG 5F9OL 4ZFZB 3KNBB 1FZOB 1WC7A 2B39A 4OD2A 1MJ7H 3M07A 1U58A 2O26U 2JLLA 3BKYH 4UDUA 3UTQB 5BS0A 4XCEA 2YK1H 4HIHA 3QQ3A 3ESVF 2CRYA 1XR8B 2QSCL 4M4PA 4PV8B 4HUVA 4NJ9L 4P3CH 1DL7H 2XA3A 1LO4H 1IL1A 4TVPE 4KMLB 3UEZA 3B5HA 3U36B 4UV4H 3OJDB 5FHBH 3GSUB 4M9OA 1ITCA 1F4WL 4PTTA 5E0QA 3PL6B 1MCRA 1RUAL 4Y5XA 3SDYH 1GL4B 5AZ2H 4EBQL 2EH7H 3C08H 2MQ0A 4I2XB 3NACH 1P4LA 1MCQA 4HGWA 3OR6A 1U3HC 4LSUL 4E5XA 1FN4B 1NFDB 3D2UD 2MWCA 4ZS6C 2YD3A 4WW2A 5HPMA 1BLNB 2VE6A 4JY5H 4U3CA 4JZJB 3MV8E 5FECA 5DK0A 4PLNC 4PJBB 5ACZA 2VAAB 4NO5B 5HVHC 4QRQA 1LMKA 2IFFL 1A5FH 4M1GH 2APBA 3GMRA 5FO7B 3O3EA 1JWUB 1R5WA 5IBUB 3GMPB 1NEZA 4RZCA 1CXHA 2J4WH 2WIIB 5I75C 4XCYB 4ZUWB 2VDNH 5DJZA 4R8WH 1UA6H 1J1OH 4UB0L 4P4KD 3FQNA 4HKXA 4S1DC 1J8HB 3DSFL 5F7WC 4HWZB 4RFOH 5CILH 1MFEH 4I9WD 4RAUB 3L3IB 4HWBL 1TENA 3DTXA 1I1YA 3HB3C 3IKKA 3CX5K 1EBAA 3RTQC 3SGJC 3WN5B 2MKLC 1DTUA 1KGCD 5IB1B 4KZDL 4U7KA 3P9WB 5T1DL 2P5EE 3QUYB 3QG7L 4OM0L 2NXZD 4JM2D 2HVJB 2BNRD 1T04A 4FZEH 4PJ7E 3ZDXE 1CS6A 1BM3L 4WTXA 5HHOA 3FONB 2WUBH 2AV7A 4PJBA 1FYHB 3ARGA 2E27H 1N3NB 1JYWA 1X5XA 2ZUUA 2J8UE 1ZHBA 4NRZB 3EFDH 2EKSB 5HGBB 1YNLL 3OXSA 4RISL 1FORH 1IVLA 2VC2L 4TRPL 5FYKH 4NZRH 1AR1C 4PGDB 1NFDA 4KJPC 2VDKH 3B9DA 5I1EL 1I7ZB 2QSVA 2YD7A 1TETL 2YD9A 5TE6L 3T2QA 4GXVH 1QRNB 1S7SB 5ADOH 4YWGL 5GS1B 1FRGL 4N0FA 4NZDA 2NX5E 3HMWH 4K23H 2X10A 2Z8RA 4R96A 3HMXA 1CDHA 2KZ1B 1EFXA 5HYQA 1U41A 4YHZH 2J12B 2WBJB 4XGZA 4K55A 4RMQA 5INDA 3ROOA 3QCUL 3V0WL 2B4CC 3T0ED 3WN5C 3DECA 3L3KA 4LNVA 1MRCL 1URLA 3FQXA 3QUYD 1RPQA 5I1KH 4N0CC 4HIHB 1QFWL 4J3XA 1U8IB 4JDZA 3PABA 4LGPB 3PDGA 5DVKA 1CFTA 3AXLB 1FLTX 5EIIB 4LLDB 3ULVL 3QEQA 1G0YR 1T20B 1TITA 4NNPH 1XF1A 4H8WL 1CE6A 2AAVA 3FQTA 4JO4H 2X70B 2R0LL 2GHWB 4HKJB 1K6QL 3O45A 2C4XA 4FXKB 4RDQG 1NMAL 3ZKMC 4OF8A 4XAKD 4F58L 3QCUH 1OHQA 1WQVT 4Q9BA 4C4KT 4C58B 1R5VB 3LKQB 4OQTA 2HKHH 3ABZA 5IGXL 3PWNA 4DUVA 5CEZE 4TQEL 2XRAL 3T65A 4DQOL 3MJ9H 1ZGLP 1AKJB 1KB5B 4LRIA 2J3SA 1NGQL 3P0YH 3S3PA 1WFNA 2UZIL 1DLHA 4TSCH 3PXHA 2G9HA 3KYMB 5CJBA 4JHBA 2NY0D 3AM8A 2YN3A 3EJJX 3L3JB 1GAFL 5DEGB 1FIEA 1CI5A 2IQ9L 3C6LA 6FABH 4JRYD 4X5LA 4YC2C 2VLJE 3ZTNH 2DQCL 1RV6X 1LD9B 4CMMB 3GUTB 2P48B 3F65A 4PRHD 2YBRA 4GLRI 3H9SB 4G8EA 4JFHD 1KIPB 4CN6A 5T33L 1INDL 4BQCA 1TJHL 5TGBB 1JUFA 3VXSA 4ZDHB 4O2CA 3GNML 5JW3L 2F54A 1Z3GH 4HH8A 1KB9J 3T0EA 5LXGL 3CMGA 5I66B 4PG2A 1E0OB 1ZLWK 1MIMH 4IDJH 3RL2B 4FQXA 1BZ7B 5D72L 1ZHNB 2ICWI 4Q9QH 3FFCE 3OGCB 3INUL 1YEIL 3MLWH 4P5TC 3RTQA 1TJGH 2VXUL 5F7DA 2ILLA 1I8IB 1D6VH 1E6JH 4AEHL 4ERSH 4GKNB 1H3XA 1N2RA 4Q2ZB 4S0TD 5I30L 2QADC 4Y4HC 4XNUH 4MWFB 2FEDC 1YPZF 3QEUB 2DTSA 3GB7A 3QUZA 3WLWD 2CRMA 1UXWA 5FYLD 5F96H 2BMKB 5DYOA 3HPJA 5L8LB 2AJSL 3K8LA 5KW9L 1YJDL 3ULUD 1E4JA 3KJ4B 4ZSOB 5C0BD 1QYGL 5IG7B 1P2CB 2NR6D 3ZDZE 4HS8H 4RGNB 1H3PL 2BRRH 5IHZB 1IZJA 1SM3H 2YD8A 4XP6H 2X4OA 4XXDA 3TYFA 4LCWE 4TVSa 3QXTA 1PX3A 4TNWF 1YN6B 2E5EA 3NIFF 4NQDE 1T03H 3RHWK 5DLML 3P9MA 3ROLA 4PJCA 2BNQD 1IKFH 2VDQH 2E9IA 1AO7D 2NY5H 4JLRA 4MVBD 4ODWA 3MYJB 3U30C 4KVCH 3CIQA 1U92A 1TNMA 1G9NC 5E1AA 1XGUB 3CUPB 2F74A 2AVGA 5DD3H 4N0RA 3EAKA 1LEKB 4O58H 4OFVA 4CVZA 2EYRB 3WHE1 2AEIT 1YECL 2BCKA 4PJEF 3GHEL 4UILL 1KIQA 1KNOB 2VSCA 3FQNB 1AO7B 4M7JL 3BYTA 5DI8A 4X98A 4GW1B 5BVJB 1FC2D 1C5CL 3ZE0F 4XCYA 4BQ6A 4NUJB 5D1ZD 4FFZH 3PQYE 2APFA 5TDNB 2IPUK 2ZP0T 4YHML 4Y16A 5EZJA 3F7VB 5CP7B 4OV6F 2RCSH 4OUUA 3OQ3B 4WI2A 4HPOL 4K7FA 2COQA 2EDEA 4M6OL 3UBXA 3NCBB 4UZGA 3BHBB 4ENED 1RIUL 1FJ1B 1NFDE 2JIXA 1CXFA 3VWKB 1PFCA 1OB1A 4XXDB 3TYFB 4PJ9D 2VZVA 1CGXA 1NBQA 4NRYA 1QP1A 1MWAL 5D1QD 3GI9L 3UXFA 3ZT6A 3LEYL 2CK0L 4DFIA 3KDMB 4B50A 3H7BA 2XPGB 4OIAA 5DUBB 1R3HA 3C60D 4HQQH 1QZ1A 3FO9A 4F7PB 4KJYA 4LVNB 3QEUA 3N50A 4L8CA 3UTPE 5SWQB 3QFJB 3A6BL 4Y2DD 1B0GA 4M6ML 5A2JH 4P2RD 5EBLB 2PCPA 1S7WB 3RJQB 2G75A 4W4NA 2V2TA 3VE0B 3MV9E 3SDDB 3IDGA 2JJUA 2KUTA 5T3XD 4JQIH 3Q3GA 1WWWX 5ANMB 4P4RA 4YE4L 4XPGL 2VITB 4AIXA 3QQ3B 1G7PB 5EU4A 3SDAD 4OV5A 3P73A 3RHWF 1TVDA 4L3CA 3IYLW 5C0NC 2Y23A 1MIML 1JZ3A 1S3KL 3VXRD 2LV4A 1BIIA 5L88H 1KN4L 5CGYC 3UTSB 1PQZA 4Z7WE 3SO3B 3HKFA 3P0VH 4WJ5B 4V1DE 1SVZA 4GRLA 3IAPA 2Y5TA 1D9KA 1MUJB 2AQ1A 1F6FB 3TVMA 1IC7L 2ARJB 2SEBB 4LCUB 1I1AD 3T08A 1MELA 1MCOH 3SKMB 5GRJL 3VXOB 1YUHA 1RHHB 4PJFE 4ORGB 3HR5A 3SKNA 1IC5L 1XCQA 1AGFB 4FXGA 2YRPA 3MCKB 4QRSB 1RK1B 2YN5A 4QOKB 4NSKA 5GISH 4UQ2B 2LQRA 2Y36H 4FQ1H 4PJGE 4YWGH 4ZTPL 3L3DA 5C07E 1MRDL 1ZKAA 3IDYB 1ACYL 2IPKA 1KCRL 4XNMA 2EDOA 1R5VA 2YUZA 2BVYA 1IQDB 2R2BA 4P3DB 3BP7B 4NKDB 5I76B 1FYTA 3NCYS 1I1RA 2EO1A 5DRWB 4WW1B 3TA3D 4DQOH 1WGOA 4UI2A 1CLZL 1OLZA 1JGUL 4QCIA 4HEME 2P5WB 4DAGH 4M7KH 4PRAA 4U1IB 5C6PB 3KJ4C 3NA9L 3DX9B 1BFOB 1KPUA 3NCMA 1HIMH 1F11A 3BPOC 5FV2A 4YK4C 4YLQT 5FKAB 3ES6A 3ARDB 4LQFL 1QQDA 3S4SA 3TWCH 3SCMD 2G60L 5BOPA 5IMOB 1LK3L 7CGTA 2DQCH 1AFVH 4JFFB 2PYEE 4RNRA 3WO3B 4NNXA 2XWJB 2H3NB 4UBDC 3JSSA 3O9WC 4IHOA 4UINL 1C08A 4QNPE 2XN9D 2NY6C 3MRDA 2AXFA 3DX8A 3QCTL 2BX5A 1EX0A 3KVQA 2JKXA 1HHKA 2RIKA 2JB5L 5ESVB 3IU3A 4XVUC 2C4FU 4JFFD 3QULB 4QXUH 3RY6C 5DQDL 1YYMH 4EOWL 3MRMB 5E56A 3I6KB 2YPKB 4NDMA 2VITA 1Q0YL 2AQ3A 4I18B 4TPRL 4CKVX 5E2VH 4R2GD 3I3DA 1CU4H 3AMLA 3EOAB 3LMJH 4F7TA 4XVTH 4RBPH 4EXPX 4PTUB 4TUOB 4M1DH 3AB0B 1T3FA 1UJ3C 3DX7B 3QEGH 4DK3A 3BWAA 1D5ZA 4A6YA 3MRJA 1YJDH 1WJ3A 3ARZA 3MPCA 4LCCA 2PO6D 5IOPB 4L8CB 3H0TA 3X3FH 1N6UA 3I50H 4JM4L 3RIAF 3T3PE 2UY7A 3O3UN 1RURH 4OQ1A 3ZDYE 3O4OB 1T1WB 3DNKA 3NABL 1XIWA 3DV4B 3NH7H 1QEWB 3MUY1 1OF2B 4W6XB 5DQJB 3ARFD 5D6DA 1ZA6B 1D7FA 5KJRL 2D7TL 2DBLH 4Q9QL 1HYSC 3FFCD 3DROA 1T66C 1XF3B 3GIVB 1MJ8L 2ITCA 3X17A 2WIIA 4FQ2L 3VXMA 1I9JL 5H37H 3PV7A 5DK2A 1KIUA 1ZA3B 4L3EA 1C08B 3NCYP 2B20A 2E6JA 1T1XA 4LHUD 4NQCD 3B6SB 5ADPL 2PTUA 3REVB 3LQAH 4CADB 2XOTA 3FN9A 2D7QA 4PRHE 3KXFE 5HDBE 1S9YA 1DBJL 4WUUA 3WIFB 4EDWH 5IV2B 1Q9OB 2P24B 3CXDH 3O8XC 3NGBB 1GZPB 4LK4A 4Y4KB 5EFIA 4WW2B 3TZVD 2F5AH 2IADA 4ALAH 4GLRH 1J1PH 3CH8A 2AEWA 4JZJC 3OR6B 1CG9A 1P4LB 2DQGL 2NW2A 2GEEA 5ISZB 2Z0BA 1CF8H 3MRPB 5DJ8B 4GBXC 3IKCB 2BY0A 1BGXL 4D8PB 1ZT4A 2MTPA 2QQNH 4U7MA 1T21B 3DI2B 5I76A 4FS0A 3VWJC 5KSUB 3VH8B 2NXYC 1A7OH 4KU1A 1TZIB 1H8OA 3R06A 1IC7H 3CSGA 1XH3B 2GSGA 3C08L 2CDEA 2VO5A 3QQ4B 3DVGA 5EUOB 4KGJA 4NCC2 4M7JH 3U7WL 3FQUB 3UZEA 3C8DA 2F8VA 3FO0L 5L88L 3QRFM 1OSZB 2AI0H 3HUJB 3RNQB 1CDCA 2GI7A 2JK5A 2R1XB 4LPUA 5BXFA 4P2OD 1CIUA 5CBEB 3TPUA 3EO9L 1DEDA 4E9LA 2ZCKL 1JN6B 1Y6KR 2DI9A 3FQWA 5DRNA 1IFHL 4GG8B 4LVHB 4PJ5B 1HNGA 3UTSA 4LRNH 4ONFL 3FB7B 4QOKE 3OJVC 4HD9A 3LPFA 3JZ7A 3R8QA 2LTQC 4J8RA 5B21A 4EN3A 5I1GH 3QIWC 3N85L 4Y4KC 1HINH 5D7SH 1HHGB 2V7HB 3O2DA 4JPIB 2BRRL 1F4XH 2BDNH 1R24A 2V2WA 3NCFB 5CZVH 3VGEA 4P4RB 3IXTB 4XC3H 1S78D 3T04D 2XYCA 1K3ZA 1FNLA 3GSNA 1J8KA 2Q87A 4L4JA 4MNGB 2VLKA 1GC1C 5AUMB 5LKNA 1F4AA 1N5YH 1Q9WB 4HKZB 4Q9CA 1JWMA 1YNKL 3MRCA 4M8VA 3B83A 4P23B 5T3ZE 1LO4L 2BNQB 1WZLA 2LVCA 4RMUA 4Q6IC 1X5AA 1JMZA 1X5GA 3AAZB 5GRJH 1T83C 4WI9A 4ZQKA 3BT2H 1OSZA 4XZUB 5DHYB 2VISA 4O5LL 5L2KA 3BEWA 1J10A 1XGRA 5FYJL 1J18A 3DRQA 5EUOA 5IVOA 1RUPH 1IM9B 1ES0A 4ODUA 3H8NA 1S9VA 5LAXB 3U82B 4Y4FB 2HN7B 4Y5VB 2QLVB 1YEEH 4HKBA 1SBBA 1JRHL 1ZS8B 2VDPL 3EDFA 1ZLVK 4KY1H 3UBXB 2CDFB 4GRWE 3F7YB 4KFZC 4XPTH 5GZND 1FNEB 5BRZA 4V2CB 4EQ2A 2P44B 1QA9B 2X05A 1GGCH 1KPVA 4C55A 2NX5B 1F3DJ 1YY8B 1DUZA 2NXZC 3GK8L 1P5VA 3WHE0 5IFHH 1T7WA 4LL9A 3ORJA 4G6FD 2RHEA 3JTSA 5CAYB 1JE6A 3BQUB 3L5IA 1QSFE 2Y25A 4X98B 5BVJA 2CXGA 4Z8FL 3RI5F 5A43C 3HB3D 3RTQD 4XH2B 2BNUB 1X5FA 4XBPB 4JDZB 4GG6E 3PV6B 3PP4L 2KKQA 5I1IL 4P46B 2V9QA 5D2LE 3GSRA 2HFTA 3T0EE 2WWKO 5E03A 3W9EA 1CXIA 4UT6L 1ZLSH 1J0ZA 1KEML 4N0UB 3CDYA 4GOSA 1R3KB 3GSQA 4OZFB 4D9RE 4UTBL 4XTRD 4R2GC 1B0RA 1LVEA 1NGYB 2ATPB 3P0VL 2PXYB 3PP3H 4ONGL 4RRPA 4IIQC 5F9JB 2VL5A 1H8NA 3QXAB 2IF7A 3EBAA 5EUKB 4XNUL 3BJ91 3CNKA 4JB9H 4OZHF 5F6HI 1X5ZA 4ONFH 4M02A 5IG7A 5F6IC 4PGEA 4JFYA 4OF5A 1MFDH 5FF6A 3F12A 3TBYB 3P77B 4MB5A 1R3IH 4Y5VC 1W72L 2EC9U 5D7KE 5DQDH 2X89A 4HXAH 5D72H 4PJEE 4OTXH 4NN6C 2QADD 1EUUA 1OAXH 1YZZA 1CWVA 4OKVB 1N3NA 4WU5A 2NY1B 1UZ8B 3RL1B 2VL5B 3L3GB 4YBLC 1IAIM 2E6QA 4QHNA 3VFRA 1NGPL 1RIVL 2NTSP 1NDMB 3SDCB 1GC1L 5IMLA 2VXUH 4KK6D 4P2QE 4OFIA 4NQED 4BUGA 1BQUA 5E94B 3CDGB 3VFSB 4ZPVA 3RGVA 1ZVHA 1XGQA 3ZE0E 6CGTA 5F3HA 4KK5C 1V3MA 4IDJL 1XT5A 3MRIB 3UAJC 1BHGA 3MV8B 4MQSB 3TN0B 3HRPA 4D94A 3TNNB 4XMPH 1A9BB 4B53A 3FFDA 3ZYZA 1VFOA 2D0GA 5KVEL 5I19H 4FQQB 3KPSE 4U1HB 4OFDA 4NQTA 4UTAH 2QQKL 4YHPB 3P4MA 4M6OH 3SY0B 5AZEL 2H1PH 1EFQA 5HY9A 8CGTA 4PP1C 5TQ2L 2GK0A 3L3JA 1FE8L 4YPJA 3HCVA 4GKZB 5B8CA 3B4NA 1Q72H 3TIDA 3QIUD 1KPRB 3QCTH 4P5MA 3RU8L 3JWNC 5HD8D 1A6AA 1G7IA 3MLSL 3AROA 5IB5A 4M6NH 1BLNA 3T77B 1G7MB 4HAFA 4YR6A 4U0RB 2GKIA 1IM9A 4P2RA 4LVOB 3UBXG 3WYRA 5MEQB 3V2AR 1ZLUH 2C1OA 2PUQT 3MUGA 4J3OC 4BZ2H 4LLYA 2P43B 2AKRB 1QG3A 3LN4A 4IIQA 4NQEA 4U2YA