4PRID

Crystal structure of tk3 tcr-hla-b*35:08-hpvg complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
202
structure length
202
Chain Sequence
b'EDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQDLGTSGSRLTFGEGTQLTVNPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
molecule tags Immune system
source organism Homo sapiens
publication title A Molecular Basis for the Interplay between T Cells, Viral Mutants, and Human Leukocyte Antigen Micropolymorphism.
pubmed doi rcsb
total genus 43
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4priD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4priD02
5C0EB 3L5XH 4F9PC 2DTSA 4C58B 3FRUB 1BAFH 1FSKB 3D2UA 5MERB 2Q8BL 4GXUM 4OV5B 3QNZB 2A0LD 3ESUF 4D0BB 1A64A 1BREA 1GGBL 1QLRA 3FO0L 3GSOA 2JIXA 4KTYA 2I9TB 3HA0A 3KG5A 3SE4A 3WIFA 5EUKB 4MD5A 1G6RA 4XX1G 5I17A 3C09B 2YWZA 4POZD 2UUDH 4NKIH 1HSAB 1XEDA 3S3JA 4KZEL 3B4NA 5L9DL 2EXYC 1NUFA 2HRPL 5AEAA 5TDOB 3MLXL 1MCDA 1HH9B 3IDXL 4KZDH 1BFOB 3MA9H 5E5RB 2NY7L 4DGVL 1HHIB 2BSRA 3JUZA 4ETQB 4IOFC 4JB9L 2ITDB 3G5YB 4RFEA 5I1GH 4HS6A 4MLIA 4U0RC 3MNZB 5F72S 4FG6D 1J11A 2VL5A 5K93A 4EN3C 3ARDA 3CVHH 1K8DB 3BZEB 2YD3A 2R9HD 3EHBD 3F12B 1BBDL 4PJEB 5KVEL 4KJPD 4TN9A 3P30L 5E94B 3T3MF 3TBVB 1MLCA 3OGOE 1MJ8H 2MSPA 1R5WB 5HVFB 2XN9A 2Y36H 1BP3B 1QUNA 5IB5A 2R0WL 5DYOB 4XWOD 5HHQA 4XB8A 2KUTA 5EU5B 3MNVA 5JUEL 2NX5D 1ACYL 3B9EA 1GZPB 3QWOB 3GM0A 3ZYOA 2I24N 2HH0L 3C5JA 2DQJL 4GKOA 4MNHB 4AEHH 2FL5A 3C2AL 5H35B 3MBED 4S2SB 5IMLB 2MHAA 2LFGA 3UX9B 3EOAA 3QHTC 1C5BL 3MZTA 4M6OH 3VMOA 5FYJU 4MWFA 2OTUB 3IDGA 4Y5YA 5FO7A 4AZ8A 2WM0A 4QRRA 2A6JA 1FDLH 4Z78B 3F7YB 2WANA 4PRPB 2CKBB 2R0ZL 4XXCA 1NBZB 2DI9A 4GG6A 5C0CE 3CC5A 1NCDL 4MNQB 4HUUB 2HT4D 4BZ1H 3SBWC 3DARA 1DQMH 4PR5B 1UJ3B 1GIGL 1EMTH 2D4DA 4PBWD 4NN7B 3B9DA 1YMHB 3DX7B 3RHWK 5DS8B 3D2UB 3HHRB 5KVMC 4JQXA 1P4IL 5D1XD 1KJVA 4YWGH 5EBLB 2FX9H 1LEKB 4JDVB 1D5MB 2EE3A 5CWSA 5GRVK 3QEUB 4JHZA 3QCTL 4ONFH 4PJHB 2HN7A 32C2B 3PWUA 4ZUSA 3BP7B 1MFDH 3OAZK 3L6FA 4APQA 2BXYA 4GMSH 4WO4B 4YUEL 3WBDA 3VXUE 5GSVB 4HSQA 5F1NB 4IRJB 4P57B 4QF1B 4XWOC 3NIFE 4XP9H 3KPNA 2KKQA 4PJ9D 1T0PB 4LU5L 4JHAH 2BVQA 2YUWA 5FOBB 3TN0C 1ZA6A 2EO1A 3SE8H 1N26A 3HE7C 5BW7A 2ZCHH 4H1LB 1JIBA 4Q6IC 5EO1B 1LQSR 1JF6A 4JJ5A 5CSBA 2FL5B 5I8OH 4PG9B 3P4OA 2IANE 1AI1L 4ZAKA 1AD9B 2ZOLB 5GRJL 4N0RA 1GZPA 2EECA 4P4KC 4M8VA 4NQSA 4PJDE 3VXSD 4GKSA 5F3HB 1OD7A 5LVEA 3IAGC 4DW2L 5LWYH 5DD1L 1DQDL 4U7SA 2R8SH 4JDZB 2PR4H 3S35L 3UTZB 1CK0L 1HIMH 2OJZL 1H3UA 5IW6B 1MCRA 2WZPD 3KPLB 1YECL 4HMEA 5E56A 5AZ2H 4AEIL 2FJHB 4HJGA 5DJ6A 1S9WB 2DQIL 3MOQA 4JFFE 4ODVL 3O41B 3EGSB 5KS9A 4PJEA 4MA1B 3EW3B 2H2SC 5HHOA 3V2AR 2H26B 1MCOL 4MD4A 3FO1A 1RZJL 1A3LH 3FO1B 1OQOA 2BSRB 4H0HB 4LLYB 1EDQA 2KBGA 2YOCA 1WIUA 2K7PA 1HH9A 4WJ5B 3REVB 1PQZA 4PRHB 5CAYB 1GSMA 1HEZA 4V2CB 4RMWA 1A7OH 1DQQA 3FT4B 1I1RA 2ITCA 3VFUB 3O3EB 2PTUA 3V5HB 4XZUB 2V2TA 1Q0YL 2VDKL 3KPMA 2R1YB 3N1PC 3G04A 5DUPL 5TFSH 3KJ6L 3BPCB 2QL1A 3LQAL 4WHCA 7CGTA 5T1MA 4WO4C 1H8OA 5TE6L 1HXMB 2EH7H 2YK1H 3D2UD 4HKXB 3U7AA 1E6OL 1H5BA 3SCMB 1CU4L 2AJSH 5C07B 4UDTB 4ZOBA 1FNGB 1RQ5A 3UPRB 3ISWA 1ZKAA 5DJCA 3V4UL 3RX7A 4CW1A 2F5AH 5GGUA 2GITB 3L3KA 4ONHB 4QHKJ 3MLSH 3W2DL 2PO6D 5IW3A 3NZ8A 5C8JB 3TH3T 2JCCF 4YHKH 4GBXB 4HKZA 4HDIA 4JPIA 1YECH 4JN2A 3H9HA 4DGYH 5JHLL 2CPCA 5B3JF 1K4CB 2CDEA 4LIQE 4JDTH 4Y1AA 4PJHA 1NL0H 3F6LA 4GRWF 2PR4L 2B7DT 1DUZB 2HFEA 3MV7D 5FK9A 2ARJA 2VJXA 2YKLH 4R0LC 5GISL 5CEZH 3CXHJ 1X3DA 3H42L 3N1QC 3ZKXC 4JFFA 4ODXB 1MVUA 2I60H 3MRGA 3J8F7 4R0LB 1HHKB 2BY2A 4OZIE 3HTLX 5FKPA 2AK4E 4WHYG 4JFHD 4U6HA 3BFOA 1EEZA 4OLWL 5GGTH 1A7PL 3CZFB 2H2PC 2P5WD 1QFWL 2C3GA 5EU6E 4LEXL 4W70A 3GSVA 2A6IB 5C6TL 3D3VE 4ZUVB 2ICWJ 5DGRA 1S8DB 3NIDE 4HHAB 2OQJA 1RK0B 3MRJB 4XCEB 3X13B 25C8L 1P4LB 5F6HI 5HYSA 4OCLC 5BXFA 3OJDA 4MA3B 4HWBL 1X5ZA 3MRDA 2GIYA 2R0KH 4KMTH 5JHDE 4KKLC 2V5YA 2IAND 1M6OA 1HH6A 4L4VE 1TPXC 5D2NA 4K9EL 4JFDA 1IRAY 5DMGD 4B7LA 4LCCC 1JPFA 1WITA 4YHPB 4ZYKA 5CJOH 5D9SA 5KANG 5B3JE 4YDIL 3WDJA 3I6KA 3MUZ1 3M1BA 1MCWW 3EGSA 4U1NB 1AP2A 3DGGA 4M8QA 1S9WA 3VGEA 3QUMA 1KJ2B 5KOVC 1ZHKB 5H94B 3EHBC 2H45A 5DZOA 2DL9A 3QDGE 3LRHA 1KT2A 1QFUL 1LE5A 1NAML 1X5YA 1CE6B 2DLFH 4NZJA 3UEZA 4I3SL 3WS3A 5J11C 1YN7B 3O2VL 2GFBB 3OTTA 4LNRB 2NPLX 5MHSE 3STLA 4MD0A 1J12A 1JPST 1EHLL 4PJCE 5IIEA 4V1DB 4WI9A 4PJDB 3P4OB 4HIXH 4UT9H 5HI3C 3UAJC 3L5JA 4YE4L 2IQAA 2NY2D 4DZ8B 4EI6A 1O7VA 4L5FH 2QQKL 1OM3L 3O6KH 1D6VH 3C5ZD 2VLKB 1VPOH 4BUHA 2GAZA 2IFFH 4NPYA 2RGSA 5LGHL 3LKNB 2HH0H 1HCFX 5DR5H 1MAML 4JFPB 4F8TA 1I3GH 5C0CD 4K3GA 5C71A 2M2DA 3UDWC 2R4SL 2UWEA 2D3VA 1SEBA 1T7WA 4JN1H 1CDJA 4OKVB 4QEGA 4GSDH 5DRWB 5CSGA 4JDVA 3AS2A 4GAFB 5SWZA 1K5NB 2B0SH 4LPWA 1K2DA 1PG7H 4HPOH 4P2YA 4JY6B 2ZWLT 4F7PA 3FOMA 4I4WB 1NGPH 1FYTD 3MRLA 2PW2A 2YPVL 1G9NH 4GQ9H 4GXVL 3CDFA 4I0PD 1FN4A 3QT2A 4LAJH 5MI0B 5JHDA 4ZXBB 1X4ZA 2Z31A 2V6HA 4YBQC 2GTZB 2P47B 3QQ4A 4HUUA 3MA9L 3U7WL 2W65A 5I8CA 2HRPH 3C9NA 5DVMA 5JDJA 4LLUA 4NKIL 5F7DB 3TP4A 2OJEA 3GEWB 3TO2A 4P2QB 4RFNB 2ERJC 3O9WA 3LKNA 4J6RL 3CXDL 1IGCL 5DJYB 5C09A 1UCBL 1UB5B 2AAVA 3EOAB 1XCTB 1QBLL 4NJ9L 3HKFA 4TQEH 2BOBB 4BZ2H 4DKFL 4PGEB 3LN4A 2FYYB 3DX9B 3K4ZA 1G7IB 2NY6C 3ZE0F 5CP7A 3BW9A 4LDLB 5F7LB 5DTFB 1HHHB 3VH8A 1JK8B 4RGMC 4NT6A 1IM9B 5IEKA 1RK1B 3P77B 4MB3A 4YHNA 4RDQG 4N0UB 5IBTL 4XP1H 2UY6A 3BXNA 1EX0A 2A9MH 2VWEE 4RAUA 4WTZG 4X6FB 3ZKNC 5GHWL 1VFAA 5KJRH 1A9BB 1MCNA 2J6EH 4JZNA 4XNYL 5E24E 5J6GB 3VXUB 4PJEE 4PJFF 3P0GB 5L8JB 1WTLA 1P6AB 4YHZL 4YDIH 1P9MA 1VB9A 5T33L 3BZEA 4XVJL 4PJXB 1QA9A 1D5IH 4M5YH 4PTUA 3MBXH 1RZJC 3ARBA 3HE7A 4HBCL 4OFKA 3VI4F 5GZOD 1WT5A 3KPSD 5CILL 1GOFA 2YC1B 2CQVA 1JWMB 2Q7YA 4NQDD 3SEPA 4R26L 3C60A 3FOLA 3D25A 4GG6E 3QH3B 4WTWA 3I02A 4LBEB 3HZYB 5DMJB 5CEZE 2DQTL 3LHPL 1CS6A 5E9DE 5CBAA 2DICA 2NTSP 3GB7B 3H9ZA 4W6YB 3MQIA 3AFLA 3QQ4B 2PO6B 2Z31B 3QCUL 1C16B 2XPGA 4EDWH 4WHYH 2EDEA 2VKXA 5JOFB 1XH3A 3OF6D 1ZT1B 4XH2A 3RWCB 3MRLB 2CO6B 4OCNC 5MEQA 4JFFB 5FGCE 4OZGB 1IAKA 1B6UA 2EZ0C 4KVCL 4YQXH 5TDPB 2BXZA 4KQ4L 1CF8L 3GKWL 4JRXE 3SCMD 3SDDB 2FECL 4HUXB 2AI0L 3MODL 1A7QH 4ZPVA 1N6UA 5KTEH 2BRRL 1JTPA 3S5LB 2E5EA 4OKVA 3G5VB 5CKGA 3RX8A 2DQHL 2HVJA 3W81A 1F11B 1KB5B 4DZBA 3HAEG 1ROWA 1Z5LA 3EO1B 2VISA 4H88H 4M6ML 3BZFA 4I0PC 2F54B 4YIQB 3DVGB 5SX5K 4FFWC 1U3HB 4XWGH 4TSAL 3PWVA 3AM8C 5DHXB 1TTGA 3STZB 5IGXH 3STBA 4QTIL 2EKJA 3CFCL 1JTTA 3O9WD 3QQNA 4HGKC 2EDKA 2GY5A 4PJHE 4PRAA 5JO5B 4JFQB 4NFDA 3U82B 3NOIA 4P23B 2DMBA 2V5SA 3LS5H 3T4AA 1HQRA 4TUKL 4NHUB 1FG9C 4OJFH 4UU9B 2C1OA 2D2OA 4Y4FC 5AD0A 1DBAH 3QSKB 5IKCA 3B9AA 1DN2A 3B83A 1CL7H 4YO0B 4NHCH 3O6FB 1FFPA 4WU7A 3T0DA 2V9RA 4XC1L 3E6FB 4GKZA 4JY4A 5L7XL 2V17H 3O4OC 5D70L 2AEQH 2RQ8A 5CBAB 3BX7C 1AJ7L 3EYQC 4LMQI 3AS3A 4P9HC 2B4CH 2Y7QB 5BS0B 1AP2B 3ARVA 4QWWD 1DVFC 4Z7VF 2VQ1B 4X5WA 4JCLA 3SGJA 3WJLA 3HMWL 5B39B 3EYVA 3FO2B 1T0MA 1MSPA 1EBAA 5HI5C 3L3OB 4A2MA 3QUXC 1FH5L 1JVKA 5DJ0B 4LRIC 2ICWI 3WIHL 1IGIH 3SQOL 1CFNB 1UQSB 1F3DH 3WHXA 3WIIL 5DVLA 5D5MF 2V9TA 4IEFB 4DCQA 4MA3A 4X98B 2QR0B 5I75B 3B43A 1I7RA 4JR9L 1QG3A 1A4JA 5LQBL 3IFNH 5BS0A 2A6IA 3RP1A 1N3NA 5E8EB 1P7QB 4QRUA 5I71C 4FMKA 5IHZA 1J8HE 1MHHA 1NC4D 2AJZB 4N90E 3VD3A 1J87A 1GC1C 1AQKH 4LRIA 2NYYD 3MRPA 2C7UA 1RU9L 4KRPC 3GSQA 1INDH 1NBYA 1T1WA 3Q5TA 2P5EB 2OTWA 2P42B 4LCIL 4BYHA 1QFPA 5I1AA 1EFXB 2PYEB 5GRJH 3S6CA 2F8OA 2H1PL 5ESQB 4DGIH 5HPOA 5EO0A 3PUCA 1UCTA 1X5AA 4M1CC 1J1PL 2EDWA 3UROR 1IE5A 1AC6A 5IW1B 2C1PA 2YEZA 5B22A 4LSUL 3QDGA 2F74B 5DD5L 5LGJB 5F1KC 5JIPA 3TNNA 1XF4A 1TNMA 2ZP0T 5I1DB 4NQXA 1U3HA 4P57A 4G6JH 1KPRA 2ID5A 2ICES 3WDHA 2IANA 3D9AL 1NGXA 3HI6H 4OAWB 1E27B 3O45B 3KYKL 4UAOC 4X6BB 4PJIF 1KCUH 4IRJC 1AGCB 2GK0B 3WIIH 5CJXC 5K59F 4BSWB 2Y6SC 2F5AL 4KHXL 3WIHH 4U3HA 3VFOA 1Q1JL 1J8KA 1BOGB 5TQ0H 4M00A 4TVPE 3LB6C 4PJIB 5AYUH 3NGBB 2OZ4L 5JIKA 1RV6X 5M7QA 3PGFL 1LMKA 2R4RL 5DO2D 2OR9H 4X4XB 2VDNH 4IRZL 4HF5H 3T0XA 5CINH 5JR1L 1TZHA 4ZUTB 4NNYA 2BVTA 3OHXB 1I85A 1LO3H 4K07A 43CAA 1T3FB 3QO0B 5DJAA 5FHBL 1AY1H 1N0XL 4U0QB 4CVUA 5BS0D 4MAYA 3G6JA 4P2OB 5JOFA 2XICA 1ZLVK 4L3CA 1KC5H 3OL2A 4OQTH 1JYNA 1QSVA 2V9QA 2OL3B 3JV4B 3U46B 2OR7A 1P2CB 3K0WA 1YDPA 3DXAE 1CD1A 3GB7A 4LCUA 4NQCE 4O5LH 1A7RH 1JNNH 1UENA 3HFML 4I2XB 1NKRA 3MACH 3GKZA 1BJ1J 1H3PH 1NSNH 4OZGE 3MRQB 1AFVL 1VKXB 2DQUH 2C4FU 1S5IL 2BCKB 4DEPC 5JQ6H 2V5MA 1I1AB 3OMZA 4UV4H 5L6YL 1MI5A 3U83A 1I85C 1I9IL 1AHWC 3ZE1F 3UYOD 4ZUUA 3MCG1 3DYOA 1IGML 1URLA 4HS3A 3GSUB 1LK3H 3TH2T 4YX2H 3U36A 3EDDA 3SGDI 3WO3B 5DJ6B 1L7IH 5JUEH 4MAUL 4X6EA 1W0YT 4GMTL 4ODWA 1YEFH 1KT2B 5IHUL 1YJDL 1I9JH 4ODWB 3MRBB 4Z7QF 3ARXA 4WWID 1CG9B 1KV3A 2AJUH 2VXVH 3R1GL 1SJEA 3IRZA 2N4IA 2HJKA 1NCAL 2OSLB 2OZ4A 4AK1A 1NBQA 1BFVL 3KPOB 4HWEL 5IP4A 4M5ZL 1MJJB 4JAMB 3BPLC 3MCLH 3Q6FB 2AQ3A 1AXSA 3MNZA 2D31A 2XFXB 1CTNA 4KROC 2H8PA 3IGAA 3QIWC 3OJDB 5DDHB 1CR9L 4FQXD 2VLKD 4IMLB 3MLXH 1BIIB 3LHPH 2HFFB 1CFSB 4HX1A 5T1DH 2UWEF 2EDLA 3EUUA 1K3IA 4HIEA 1A7RL 4YC2C 1P2CA 1YDPB 4KV5F 3W11C 2OK0H 4OZIF 2IADA 3TZVA 4XPHL 1LEKA 1F8TL 4P0DA 3VGGA 4D0BA 2BSED 4M5YL 4PP1C 3TVMB 4MGXA 4D9LH 4I5BA 5L88H 1IILE 1A1NA 3QQ9D 4OCWH 3HZMB 5KVGH 5DWUH 2OZ4H 1T6WA 1Z3GL 2CDFB 1FZOA 1MFAL 4CU8A 4Y88A 1RVFH 3PP4L 3OX8A 1QRNE 2C9AA 1QBAA 3BMVA 4P5TC 2GYSA 2I26N 2QADC 4JPIB 5D1QD 1NBZA 3KPTA 4UB0L 1HYSC 2FJGB 2BNRB 4XGZA 1K8IA 3S7GA 4C4KT 3F7YA 4Z7QE 1A14L 3JBG7 3O4LD 4ONHA 1BBJA 4ZG1A 4X9FA 5E2VL 2QQLH 1KLUA 3QDMD 5DEFA 2XKNB 3LD8B 4Z18A 4GLRI 3AREB 5HVHB 1OP3H 3KVQA 4ZXBC 3HI5H 5GGQH 4PJGF 3MSPA 4ZOAA 4PJFE 3ZKMD 1MJJA 2BVPA 1LE9A 5DFWH 3IDNB 1IARB 1TZIB 3X3FH 1MCJA 3ZDZF 1FVCB 3ZDYF 3F8UB 2P49B 1ED3B 3I3DA 5GQBA 1ZS8B 4HQQH 3WS6A 2HWZL 1ORQB 3G9VA 5IVZB 2GCYA 3ARFB 3JUYA 5H94A 2VXUH 3MJ8A 1JZ8A 3BRDA 3D0LA 1JGEA 3QIWB 2JJTA 5EU4B 2MMXA 5GGRB 5ACMA 2F54E 1XGTA 5H2BA 1AO7D 5HGDB 1LWRA 3OPZH 5K9KA 1DLFL 2PF6A 2PYFA 2EC9T 3VFRA 3EYOA 4W6XB 3GJFK 4ODTH 5I1KH 4X4MA 1N7ML 4UDUB 1U6AH 4QRRD 1OT2A 5CIPA 3K8LA 4A6YH 2B4CL 5EO9B 4JKWA 4NGHH 4XPTL 1WFOA 4H1LG 4IRSA 4KROD 4N90D 1X5IA 1VPOL 2R9HC 2Z91B 1J8HD 1IL1A 1EEZB 2QQKH 4PRIB 1OM3H 4NRYB 4GKNA 4X99A 3MCLL 4R2GB 4XBGA 4XVSH 3ZKQD 1F2QA 4TVPL 2QADB 2FWOA 3X11A 4L9DA 3MRFA 4ODXA 4RFOL 2O5ZH 1LEIB 5FYJH 2VITB 1A3RL 2A6KA 1SM3L 1J1OH 4I77H 5F7FA 4MAYC 4BA8A 5DQJB 1AGDA 3GI8L 1QFUH 4H1LA 1MWAL 5CD3A 5T1KB 5JPNB 4QTIH 4F8QA 1NKOA 5HJ3A 4D9QE 4NC1C 3TN0B 1WC7B 1RHFA 2ZZUT 2EDJA 2F54A 2XIDA 1KG0B 4PJ5A 1Z5LB 4UBDD 4F7CB 1INEH 2BVUA 3RIFF 4JREB 3AY4A 1O7SA 4YGVA 4M6AA 4MXVE 1PKOA 4ZOEA 3IFPB 3TBYB 4MCYB 2AI0H 3MODH 4XP4L 2A6KB 5IB3B 2XOTA 5J89A 4F33A 4W4OC 3ZZ1A 3MRRB 1NLDH 2ZCLL 1U2CA 2NCMA 3BP6B 1SYSB 3HUJE 4L4TD 4Y4KA 4FQCL 4WW1B 4GAJH 2NY4C 3QULA 1IC1A 2YPLA 3BH9A 1ZT7B 2LU7A 4KFZC 1W0VB 3VRJB 1PEZA 1AGBB 4JM4H 3O3AB 5KSUA 1A9EB 5LXGL 1Y0LA 3GO1L 3ULVE 1EEYB 3VRIA 4ZNEA 4Z78A 4R26H 2EDHA 2I5YL 4QRSB 4I18B 2YKLL 3ZT6A 1XZ0A 4NO5B 1V3LA 4M62H 2VUYA 1C5CH 1VGKB 4ZSOB 4HH9A 1D6EA 3EYOB 1TTUA 2OI9C 2I27N 4BFGA 5JIIA 3RWFB 3U0TB 4V1DD 3LZFL 4TRPL 3VXRD 1Q9WA 1T2XA 4JZNB 1IGJA 2FJFB 4LARH 5D1XB 1HXYB 3OKOB 3DWTA 1PSKL 5IB5B 2LVCA 1FJ1A 2V5RA 4HMDA 4RNRA 5ESVB 1WCBB 4X5LA 2XRAL 4BFIA 1YUHB 2G60L 2H1PH 5E94A 5KS9E 5T1LD 1T04A 1NDGA 1YNTB 1VHPA 2FBJL 4W4NA 1L4IA 1I1YA 3GSUA 3QFJD 5ISZD 3U6RA 2GSIB 3IRPX 1B2WL 1U91A 5DK3A 1PAMA 4YK4B 4JFQA 1UCBH 3H9SA 3ARGC 1AGFB 4PV9B 3ROLB 5BJTA 2R0KL 4KMTL 3G6AB 2XZCH 3K3QA 3TN0D 1LP9F 4ODHH 1N64L 3KYAA 3RY6C 4LVOB 4QTHA 2AXFB 3EO1A 1ES0B 5AG9A 3MR9A 4OIBA 4HLZH 4KJWC 3UJTH 1BZ7B 4OIAA 1NCNA 3S3PA 5I8EA 2PTTA 4JO3L 5IV2B 1RZJH 5JDSA 3ZE1E 5HYQB 4MQ7B 5FOJA 1MCSA 3LMJH 3EZ8A 3NIFF 5DLML 4NNPH 1BPVA 3RAJH 2AJYH 4QXWA 3DGCR 4KK5D 5ENWA 4JFYB 3SDDD 5C0IA 4J3VA 3MJ9A 3HLAB 4KK5C 4FZ8L 2W0PA 2AJVL 3L95B 3OJ2C 3EOTL 3P9LA 4CU7A 3HR6A 4JPVL 4EBQL 4ZO7A 1PW3A 3QWQB 1OAZH 1RZ7L 3KLHD 2GT9B 1GHFH 3U0PA 3I02B 4LBEA 4LGPB 3DBXA 4QGTA 2XRAH 2WBKA 2ENSA 5LGJA 1HYSD 1I3UA 1D6VL 4ZS7H 4OBRA 1R5VA 4D9RD 3V0AC 4YEFA 2AK1H 4JRYE 4Q9BA 3VFNB 4QLRA 5D4QA 3ORJA 1GGIL 3WMSA 2YZ8A 4RZCB 4UOW0 4YDKL 3X12B 4FQ2H 4LHQB 3HFMH 1NGYB 4X8XA 4XAKE 5CJ5A 1WFUA 5DUBB 1JZ6A 3L5WB 3PIQB 4G8GE 3TPUA 3HC3H 1MFDL 1WCBA 3WXVH 1MHHB 4N0UA 4FQXA 4MXQC 4X6EB 1CE1L 1EIBA 3O6MH 4CDHA 2ZSWB 2AQ2A 4CMMA 4J3XA 4DKDC 2NY2C 43C9A 1FZJB 3DVNB 5A16B 1PD6A 4OLEA 3D3VA 3VXRA 3BSZH 4JM4L 2BOBA 4PUBL 5GS1B 3ZL4H 5EB9A 1HQ4A 4OLUH 2GUOA 1TCRA 4PRDB 4NKQB 4BSJA 4LSVL 4FNLH 4B41A 4QHLA 3MXWL 2DKSA 4EQ2A 3MLVL 3DO7B 4YDKH 5I17B 4BELD 4HGWA 1P7QD 2VLLB 4F7TA 3GBNL 4WWKC 4Y4HA 3SOBH 2ZNXA 4P4RB 3QXTA 4RBPH 1H3TA 3HB3C 3PP3K 3ZE2F 4PBXA 2GJZB 3ZTJG 5FKPB 1JPGB 3QNYB 2VABA 1KF9B 2X4UA 1J0ZA 4DGIL 2E7MA 1U8LA 3CFEA 3EFDH 3WO4B 3FT3A 3BQUD 1CXKA 3BQUB 1S9YA 1XF2B 4PLJD 3E8UH 5CZXD 3IXAB 3S4SG 1U0QA 1IEBA 1SEQH 5A2JH 2JLLA 3VDCA 3UZQA 2Y36L 1KJ3H 5DQDH 3FQXA 3PABB 4JGUA 1L0QA 1SM3H 5CD5D 4U0RB 2X1WL 2UWEB 3X3GL 2P8MA 1U93A 3O3DB 5I1EH 5F88B 3W9EA 5D7IA 5LGKA 5F88A 1D5ZB 5ISZB 5DJDB 1MY5A 1YPZF 5C3TA 5J12B 3C87A 2CSPA 3TNNB 5MEOB 5FO8A 2XZQH 1AIFA 3ET9F 3PWPE 2DQFA 3CFDA 4QHUA 4Y2DB 3FMGH 1J86A 4JPKL 1G7HA 2NW2A 4DEPB 3IDXH 4KZDL 4IMKA 5TDPA 5C07A 5ADOH 3T77B 3ULVL 1OTUC 3FAWA 4EDXB 3SQBA 3SKNB 1AC0A 1U6AL 2X4UB 3BRGC 1SJXA 3K74B 3MRHA 4OBSA 1ZLWH 3LKPB 3SDCC 5E5MA 2YPLE 5D5MA 5JLZA 1GIGH 4L4TA 1FPTL 4PPTA 4JM2B 3ULSB 2FBOJ 1NFIA 4OUOA 4G9FE 1HSBA 4OGYL 4HIIB 3JV6A 2JE8A 4NKMA 5LJYH 4O2CB 1MNUH 2OX5A 2QR0A 2B8OT 4HV8A 3EJJX 4HFWB 4J3UA 5B4MC 3IU4H 4WGWB 3WUWB 5HGAB 1YZZA 5FGBC 1MCFA 4OF8A 4HC1A 1JE6A 4R7NB 3FT2A 1C5BH 3SY0A 5KAQG 1BFSA 1MCOH 4NJAL 3CFCH 4LVHC 4L3EA 5D7KE 3ZMRA 2VYRE 2FX7L 3LS4H 1UT9A 1SY6A 3X13A 5HI3D 2ZSVB 4M48L 1XIWB 5I74B 1CLOL 5F7UA 1K4DA 1V5JA 3O4OB 4HHAA 2VSCA 4YC2B 3BWUC 1Z0NA 5IB2A 4WY7H 1CBVL 3SBWA 2QLVB 2FRGP 2OJZH 3H9SD 3Q48A 4RAUB 4X6FA 1KTLB 3NAAL 3QA3A 4U6HB 5E2VH 5CEZD 3ZO0A 4Y4FB 4WI2A 1NMAL 4PB9L 1MJUL 4YHML 5D2LB 2Z0BA 4DVRH 2YXFA 3L7FB 4NT6B 1U8HA 3MLWH 5BV7C 1TZIA 3UC0L 5AD0B 4XPGL 3TIEA 1A5FH 2DMKA 5IEHA 3HUJF 3ECBB 3GO1H 2DLFL 3TVMC 3VFNA 2WINB 3BKCH 3R0NA 3DXAA 5J56B 3CFDB 4QHUB 1ZGLB 3SDAB 5KSAB 3AREA 4LDEB 3KNBB 4WI6A 5KG9A 2V2WA 1RZKC 3T65A 5DC4B 4U3CA 4P2OD 4ETYA 5CEYB 4S0SD 1BD2E 4NRZA 2XV6B 5GRZA 4KU1A 2EDRA 4X6CA 5IVXA 1F11A 1KB5A 1D3CA 1RZKH 2O61A 3CPLB 3NVQA 5EUOF 3VWKA 1KELL 3G08B 4WV1C 5J3HD 2WV3A 3G5VA 3VFVB 32C2A 1KOAA 2GITA 1IM3B 5D1QA 3QZWA 2HVKB 1H3GA 4UQ2B 3RTQA 1I8MB 3QEQB 4AG4L 3BI9X 5EOCL 1GC1H 4TSBL 2VC2H 5F8RC 5T33H 1N8ZA 2W0KA 5IG7A 3MV8B 4F7MB 1EBPA 3PDDA 2FO1A 1I1AD 2VABB 4KDTA 1A02N 3NCJH 1CGYA 1OAUL 3GJEB 1UJ3A 2ZKHL 1YY8A 4JZOB 4LSDA 4MJ4A 4HMCA 1RJCA 5HDBF 1MH5B 3PQYA 5I66A 1ZVSA 1RZ8A 3UC0H 3OXRB 2DBLH 5DFVD 1JNLL 4JFPA 5HVWA 5HYSG 1OL0A 2DI8A 4J7RA 3VWJA 2A6JB 3J7HA 4OV6F 3PGDA 1T4KA 2K9UA 4JVPA 1OT1A 3N85L 4YHMH 5D7JC 4Y5YB 5FO7B 1YEIH 4KTDL 1FIGL 4JQIH 1K9TA 4PV9A 4KGJA 1J88A 5INDA 2NY5H 2Q1EA 2OL3L 1ADQH 5KS9F 4EUPG 3TIDB 1NDGB 1YNTA 2P24A 4NFBA 4OLXL 3IU3B 1YMME 2GQHA 4X83A 3CU7A 4P4KA 1F58H 5D96C 4A6YL 1A9BA 2GFBA 1CD8A 1CCZA 1YN7A 4Z0XA 3BJ91 2R0WH 4AG4H 3KYNA 2NTFB 3GUTB 4PS4L 3VWJC 4L29B 3DMMD 3LDBB 5SWSA 3AB0B 4I48B 4MX7B 1Z9OA 4L29A 2YRLA 3ELAT 5JA8B 3L5WA 3PIQA 4HK3J 3IU4L 3BYYA 5EBWA 4ZPTB 4X5XB 4ONGH 5FDWA 2YPLD 5FGRA 3WJJC 4IBLT 1H5BC 2F19L 3I2CL 4YBLB 3FN9A 3JWOC 2F8VA 4D9LL 1OSPH 3NIDF 3VXSE 2B1AH 3AROA 1FG2A 4J23A 4OCSL 5MENE 1AE6H 5TQ2H 1CT8A 2XG5A 3MUY1 5GGVY 1BX2A 4OLVH 1KCVH 4AMKH 4EUPB 1KB5L 4L9LA 5D7LB 3V52H 1KIUA 2WBJB 1A7OL 4FQIH 2IH1B 4LSRL 5JR1H 1NCWH 1FFRA 3MCKB 1I3GL 3PGFH 5FGCB 5ITFA 4FTVE 4Z8FL 3TJHD 4NOBA 4LLMB 4OZHF 1N4XH 3PWUB 1UZ6F 2HN7B 2X4QB 4UT7L 5I16B 4J1UA 4PRIE 3GNML 4LL9A 4MDIA 5E1AB 4ZMAT 1DN0A 1FIGH 2QQLL 4HWZB 1EVUA 4K3HA 4KJQC 3RVUC 3VXOB 3HNTH 1RZFL 4DAGH 2AXHA 1CWVA 1U8MA 2FR4A 1B4JL 3TCLB 1A14H 2CMRH 4X6CF 5IVXF 1JFQH 3LKSB 3Q2CA 2DBLL 3SGEI 1AGEB 4KTEH 4JANB 1NGWA 2EIBA 1S9XB 4EVNB 3FHAA 4POZC 1RAMA 1ITCA 3VWKD 1ZLUK 4L4VB 1N5AB 2IAMC 5C2BL 4J3TA 5BVPL 4X8JB 2BC4A 2J4WL 3ESVF 5E8PA 1RUMH 4ZFZB 1LD9A 3D3VD 4JREC 4NBXB 1YC8A 2R2EB 4IRSD 2A73B 1QRND 4XRCA 4AQOA 5EOCH 3SDXB 3G6AA 4K94C 5HJ3B 4NM4H 3QDGB 1A4KA 5FA4B 3KPQA 1MI5E 5D2NC 1AGFA 3QEQD 2W9DH 5CBEA 4X0KA 5GJTL 4MJIE 4QOKD 2YUVA 4DZ8A 4CW1B 3CGTA 1BJ1H 3WV0A 2OK0L 1A6WL 1OCWH 4MNHA 3JVGC 4EXKA 3NH7H 1JZ3A 5E9DA 4OZFH 2Y5TB 4JKKA 1JWSB 3EYQD 2HRLA 2RHEA 4F57H 4GRLD 1PEWA 4Z95H 3BVNB 2C7UB 5L2KA 1KTDB 2X70A 1P7KA 4QT5B 4ZD3H 4B50A 3AXLB 3QA3B 2XN9B 5D5ME 5ESVA 4OD3H 3RNQB 3BYTA 4D3CH 3IDJB 5E70A 4MQTB 3CH8A 1L9MA 2IMNA 4MZ2A 1T0NB 4PGDA 3IETB 1JGDB 3DGGB 4M8QB 4XP6L 3RGHA 3M1BB 1I7UB 2J12B 3EFFA 4X98A 2Y6SD 3CLFL 3F7VB 5TQ0L 3BZ4B 5C9KA 1EA9C 4OGZA 3GSWA 1EMTL 3BWAB 1JP5A 3AS0A 3CFJA 2ZPKH 3UO1H 3BWAA 1HHIA 3R8QA 3WUWA 4EI5C 3OV6A 3S88H 4HFWA 1Q9KA 3D9AH 4WY7L 2NY4D 4ZS6C 1FDLL 1B4RA 3PG2A 3O41A 4ZUVA 2APBA 5FEBA 1G9NC 3U2SB 3W0WB 4U6XA 5H37H 3VXNA 2UYLB 2W91A 4LSTL 1NC2B 4X4YA 3MJ8B 2YPKA 4MVBC 4N5EC 4AM0B 2MQCA 1ORQA 2QQNH 2YPLB 2DJUA 4UV4L 3VFMB 1YYML 3G5ZB 1TENA 3IAPA 5J13B 5IGXL 1S5IH 4N0YH 4G6KH 1QZ1A 3QXUA 3DVIA 3CU1A 4DOHE 1T89A 4G9FB 1GHFL 5C92A 3HAEA 4LP5A 4APQD 2ADJA 1HZHL 2QSTA 4F3FA 4EBQH 5JNYA 3S88L 1UKQA 3T4AB 1MHCB 1C7TA 1NAMA 3I9GH 4RWHA 1UZ8B 4XCCL 1BBJB 4JGJA 3MV8D 4XHQA 2E7BA 3AB0C 4LLQB 4I0PB 3RFZC 1K85A 3PDOB 3INUH 1MF2H 4HK0A 1L6ZA 1Z9MA 4QXGH 5D7JA 1I75A 1MWAA 1FZKA 3KPRB 3AY4C 1IZKA 1F2XK 3IKKA 3D39A 1QVOB 1YQVL 1NAMB 2FSEA 3S36X 2JCCB 1F6AB 3NBNA 2YUXA 3AGVA 4KRNA 5HI4D 3IXAA 5FM8A 1RUPL 3G6JF 4P5TD 4RGOL 1HXMA 3NH7L 5E6ID 4GW5A 4KHTH 1YEJL 2ZG2A 3GHBL 4GW4A 3EJYD 1GYAA 1KJ2L 3VXOA 1A6ZB 4IS6A 5DHVH 4Z7UB 3VG0L 4GUPA 4TNWK 5D8JH 3ES6B 2PO6A 4YHOL 1EAPB 1Y18A 1I3RA 2YZ1A 5HYJA 1OAQH 4NUGL 1O0VA 3VXNB 5DVOA 3U2SA 4GG6B 1IEHA 4R4BA 4BH7B 1BAFL 5GS0D 3MGOA 5IESH 1UYWH 4IMLA 2RB8A 4I9WE 3ULVF 3BP5B 3TBTA 5BVPH 3FB8B 4MJIA 3E3QC 2FEDD 3DX6A 3JWOH 2LV4A 2BHUA 5D1QC 1F00I 5TE4H 1FYHB 4M7ZC 4LGSB 3VI3E 1AXSB 1KJ2H 5GS0C 3QEQE 3GJFA 4FP8H 1XGTB 5H2BB 2CRYA 1FNFA 4KHTL 4RFNC 4LK4A 1KULA 1RUPH 1Q9OB 2O5YH 5IWLA 5ANMA 4RRPA 1MCEA 2EDFA 3QDGD 4ELMA 4L8CA 4LCWB 3ARFA 4NUJB 5DHYA 1YQVH 4UIKH 5J1SC 1F97A 2DLHA 3QPXL 3TA3B 1IMHC 1TQBC 2VDMH 2FX9L 2HLAA 4Z5RA 2AEWA 1NGYA 3HCVB 1P69B 2D7MA 2FEDC 3P11L 4MAYD 4OFPA 4RMSA 3VFGH 5KSBB 4ELMF 3IDNA 3Q5OA 4U1IA 5J9PB 5CMAA 2GJ6B 4CKVX 5GGSB 4LCCA 4PP2B 3NFPA 4JQXC 5GPRA 2ED7A 2XKNA 1YPZE 1JYXA 3FFCA 3MOBL 1H0DA 3BQUC 3ARYA 4RGND 3VDAA 1NFKA 5K9QI 5K9OA 4F9LA 4UILL 3BDXA 5TDOA 2W07A 5CLWA 3GJFH 2DTML 3U0PB 4PJ5E 5DD6B 2BVOB 2V5TA 1G7LB 4YAQB 3JWNC 2ATKA 5C08E 1KIRA 4L8SC 2B0SL 4N0YL 2G60H 3WKMH 3QQ9C 4LCUB 1YYLH 5I8CB 2QSVA 2WWMC 5MP6L 2FGZA 3ES6A 4M6OL 1YY8B 1DZBA 2HP4A 2X4NA 3PGCA 5KSAC 4LVHB 1FZOB 3G6JB 4OT1L 1F42A 4P2OA 1BQLH 3LQZB 4I0CC 5K33A 2OXHA 5CZVH 3FL7A 4IOFD 1N8ZB 1TETL 2YD7A 4D8PB 2NXZD 3JWDC 3VI3F 2AABL 2W0LA 1ZSDB 2VDPL 3D18A 1NUDA 5CGTA 2UZYB 4PJ9A 3MA7A 2LTQC 1G0DA 3O3BB 1NAKH 3O4LA 1QVOA 4U6VH 1NCTA 4D0DA 5BZWB 5KZCD 3VFVA 1ZV5A 4MNQA 5C7XH 4PV8B 3IVKB 5KN5A 3GKWH 3K1DA 1RIUL 4HIEB 1KPRB 2VXSH 1MRCL 1WGOA 1BIHA 3HUJA 5AWNH 3MV11 4NWTL 4AL8L 1IGFL 4J4PC 3NPSC 5C09D 4JG0H 1UGNA 2V2WB 3IDGB 3T65B 4TQEL 4YHLH 4MCZB 4JKMA 3MJ9H 1J10A 1ODAA 3HNVH 4NRXB 2IQAB 4PJ9C 3OKLB 2Y07H 4JRXA 3FN0H 3HC4L 2MJWA 4O9HL 3GMNB 5GGVH 4JAMA 3WNNA 2VLME 3JXAA 1EV2E 2ADIA 4KJYA 2DIBA 3QI9B 2DLTA 2UZXB 1IM9D 2QEJA 4G8EA 3WS3B 4LVOC 2AXGB 3FQTA 2VIRA 3QUYB 1WZ1L 2NY4B 1FE8H 4O4YL 5F70A 2XQYK 4YPGB 4NUJA 4DUXA 1FORH 2D03H 4UQ3B 1QLEH 2H6PA 2FECI 1TZGH 3GMPB 1MCKA 4U05A 2JCCE 3TEUA 2VE6B 5IHZB 3RPIB 2QKIB 3RBSA 1BD2D 4IHOB 4R2GD 1F3DJ 2JKXA 4KI5C 1N0LA 3DUSA 5DEGB 2MCPH 4NIKB 1UACL 3IF1B 4XNYH 1UZ6E 1QFWH 1H9VA 5EZLB 4WNQA 4MMXC 1PKQB 4G9DB 5C3LD 5IBUG 5ELIA 4BFEA 2UVFA 1I8LC 3JWOL 5TDNA 1X5FA 3SE9L 1U3HC 3F7VA 2XN9D 4XPGH 4X9IA 4W4OA 5GRYA 3TWCH 4NO2A 4N9GA 3VRIB 1UWGL 4X80H 5FCUH 1W0WA 2Y7QA 4DQOH 3LIZL 1B4JH 2A83B 5EUKA 4X7CC 3WN5B 4JFXB 3K7UA 1ZT7A 3GNMH 1NAKL 5D5MB 3KYMA 1GAFL 1MIEL 3BUTA 5D2LE 1G9MH 1Q38A 1GRWA 5DJAB 3LIZH 3CXDH 4MB5A 1CVRA 5F1IA 5IT2H 4LASL 4NGHL 4XPTH 3FRUA 3QUML 1JWSA 1QQDB 3EOBB 3LV3A 5CZVL 4OTXH 5GRVL 2M26A 1GGUA 4ONOA 4LOUC 2E7LA 5DFTA 5C09E 1EHAA 1KCVL 1OB1A 1U95B 2IALA 3C6LA 3MV7A 5MP6H 5TF1H 4APQC 1FZKB 4HKBA 4YGVB 1U58A 1UACH 4JKLA 4F7CA 4OGAC 1MAJA 1MF2L 1CIDA 4OCWL 3V0WH 1JL8A 3LSOB 3BT2H 2IQ9H 3HS0B 3HRPA 3EZJB 3FO9B 5L88L 2X05A 4KGLA 2J5LC 4ZFZA 1RUKH 1HOCA 3OG6B 5GS2D 2PKDA 5B38B 1WZ1H 4UZGA 2C1PB 3VD4A 2A77H 1QBMH 3CK0H 2VOTA 3MC0A 2W9LA 1KEGL 1KXQE 1J0KA 1A6TA 4QRPA 4XXDB 4PRPE 3ULUD 2ADFH 1D5BB 4Q0XL 4G42B 1BVLB 5GRUH 4OSUH 1ADQL 1A7PH 4X4ZA 1BOYA 1M71A 1NEZB 2J2ZA 4U6TA 5KANI 1R24B 4ZSOE 1CVSC 1JCKA 2A83A 2MKWA 1DQQB 3FT4A 4K3DL 4NWTH 1M05B 2IJ0C 3MCKA 4R6UA 5AWNL 3RGVD 5F6HJ 1I4FB 2X4RA 3GMMB 5I30H 2X10A 4P3DA 5IK3B 1DVFD 3DV6A 2M8XA 1T1XB 4LIQL 1XAUA 4Y1AE 5EA0H 3WJJA 4JDTL 3IDMA 4OF7A 2IG2L 1YEGH 4HIJA 2FH6A 4FFWD 1RJZA 1UYWL 4NSKB 1HN1A 3VXTB 2YD6A 3ZDZE 5EU7C 4HUNB 1QKZH 2VLJB 3DLQR 4RSVA 3GMQB 1QEWB 4IHOA 2J1KA 3S4SA 3MLSL 5T3ZL 4X6DF 3IETA 4FS0A 4ZTPH 1YEDA 2J8UB 3ULSA 1DQJA 4P5MA 5IOPB 3WUZA 3AMLA 1RZGA 3UTSB 5DJ2A 2YWYA 1S78C 5EWIL 2Z31D 2DI7A 3BVNA 4P4KB 4ZFGL 3TCXA 1GXEA 5BV7H 2APXA 5T1DL 4WUUB 1AR2A 5E08L 1LE9B 1G7PB 3SKOB 4YNYB 4PY8J 1CR9H 2EDQA 2W60A 4PGJA 2VDOL 1S7XB 3NA9L 4JJ5B 3B9KA 3QJFB 1P53A 4M7LH 5EZOH 1ZLSL 4ZAKD 3ZL4L 4J3OC 2GJ6D 3FONB 2PXYA 4NC2B 1U2HA 3IXTB 4UNTA 3AREC 1CD9B 4QXGL 1D5XA 3O81A 3PNWB 3T3PE 3AC0A 3WEXA 4HUVA 4PRID 1G6VK 4BKLB 3GK8L 5M95B 1MELA 4F58L 4JLRB 5HI5D 5H37G 2R2EA 5B3NA 3E6HA 4M93C 1INQA 4C56E 2D0HA 5AYUL 1VSCA 5FF6B 4L8SB 5C07D 5CKAA 4XC3H 3CAFA 4YDLB 3G5XA 3DIFB 4L8DB 1YPZA 5HHOD 5TE7L 2EEBA 1U95A 5BZWA 1DQML 3S5LA 2AGJH 4ZXBA 3RL1A 5D7IF 1IEBB 4WDIB 2NY1C 5GRXG 5JOEA 3M17B 4XPAL 4I4WA 4LF3A 4JRYD 5C1MB 5DS8A 1LK3L 4XH2B 1K2DB 3VRLE 3RDTA 4XVTH 2GJZA 3DHJA 4I8DA 2WUBH 4B53A 4LPCA 2G5BB 4ZFOA 5GZNC 4JVUA 5L6YH 1YPZB 1J1PH 1SEBB 3EDFA 2ARJQ 2KL6A 4HK3N 4YXLH 1U8PB 1XGRA 1P1ZA 2CKBA 3MRCA 2IPTH 3B2VL 3MROB 4FABH 1CU4H 2AJSL 3F62A 4NRZB 1S78D 1F90H 1ORSA 4U4BA 5F7EL 4P2QD 3D69B 2HFFA 1ACYH 2CR3A 4FG6C 2NY3B 4WW2B 3CDGA 4HUVB 2X9WA 5K9OB 5DVKA 4XAWL 5ALBL 1DQTA 5D8JL 1XIWC 5I74C 1BX2B 1YEHH 5KSAA 1WTGT 2P8LB 3QFDA 5EFIA 4Y4FD 3DV4B 4LLVB 3Q6FA 3U6RB 1WIOA 4PJDA 5HHXL 5ANME 3PHQB 4GBXC 1XGUA 3N1GC 1RIHH 2A9NH 1LP9A 2OMBA 1JZ5A 3LMJL 4BJLA 1Y6NR 4FQXB 5DJ8A 2ZUUA 4U1HA 5E2UL 1T7VA 1T2QL 2NX5A 4HJJH 4HCRA 4P5MB 5IOPA 2XZQL 4OQTA 2AXGA 4LCWA 4YHNB 4R3SA 2VQUA 4Z7UF 5E8OB 2GK2A 4RZCA 3PHQA 2Y5EA 2P45B 1G7IA 1W72L 3QEGL 4PJ8C 1MCPH 4GXUN 4HUKB 3E1F1 1YEGL 5LBSL 4RAVA 4P2RD 2JF1A 2X7LB 3HPLB 4BH8A 3Q6GL 5EOTA 4QHMA 3S96A 4BK4A 3QPQD 3CUPA 3CH1B 3QCVL 4NHCL 2Z4QB 1P4LA 5HHMD 3BPOB 3FN3A 1S7VA 5DRNA 3LS5L 3TV3L 3BGMB 1PBYA 4N8CL 3MRNA 3P9LB 3V6OA 2EYTB 2HTLC 3FAXA 2FB4L 4D0DB 2NYYC 3MXVH 5JHDB 4L4TB 2X4TB 5E5MB 1QLRB 2ZKHH 3RZCB 4C4KO 2GY7B 5JQ6L 2JIXD 1B0RB 1NSNL 3LZFH 4ENED 4XCFH 1J9CT 2WLYA 3QFJE 2YA0A 4J12A 3CSYB 1FLRL 2ERJB 5JDSB 5L2KD 4BSWA 3QHZH 3N0PB 4F37K 3QCTH 4ONFL 4UTBH 5EIIB 4JCMA 1QO3B 3KLAA 3V6OC 4L8DA 1HOCB 4WENB 2CDEB 3MUHL 1FH5H 1MJ8L 1W2KT 1CF8H 5JORA 5TH2A 4HK0B 2EDTA 4LLDA 4X6CB 5DJDA 5IVXB 1IGTA 3UJIL 1D5ZA 4JHBA 5IMOB 4B7IA 4JLRA 1BWWA 3LPWA 1EZVY 3WEXB 1D5XB 3PNWA 2GAZB 4K3JL 5J8OA 1B88A 5ADPH 3HZVA 5TF1L 2NNAA 2VLRA 3SDAA 4K9EC 2OTPA 1VEOA 2YD5A 2W60B 3B3IA 1DSFL 4UDTA 4PJ7A 1X5JA 1N2RB 3MLYL 3S8WA 5T5NF 3ZT5A 1IEAB 3F65A 3MRFB 4X7SL 1Z6JT 1IC5H 2X4OA 3KXFE 5ETUB 4QHKI 4XP4H 2MOVA 5KBNC 4PB9H 3ULVD 1KJMA 3CFKB 3EO0B 3OG4B 4LSUH 1F4XL 3KYMB 4KK9C 5DJ2B 1VFUA 2BSSB 4ACPA 2VR5A 2G75B 5EIVA 4YDLC 4P5TB 4H20L 5F7KC 2JJSA 5C0CA 5D72H 1HWGB 4IRSB 5D1XA 2BP3A 3DECA 1Q9WB 3S4SB 3E3QE 2XQYG 1QEWA 3RUGA 4FQJH 1PQZB 2J6EL 5D6CA 3R8BB 3DI3B 4YHPA 4K7FB 4PRDA 2CXKA 3CFBB 2WP3O 2IG2H 1OF2B 4OCXL 2XWJB 3WHXB 3PE9A 1CFNA 1UQSA 4XP1L 1AKJD 4X6DB 4NZUH 1T1XA 4G9DA 4IOIA 1A7QL 5JZ7D 3MRDB 1S3KL 3PL6B 3IKCB 5I30L 1U8OB 2X1QA 2XZZA 5HYSB 4O2CA 5DC9B 3GMRA 4HIIA 3QDMA 4J3SA 4R4NC 1F6FB 4P2QE 3RU8L 5CLTA 3OAUH 1CXLA 4GUPB 1FFOA 1FE8L 4JKPH 2N7BA 3OF6A 4JB9H 1IGIL 2FIRT 1R3KB 3UJTL 1R3LA 1FFPB 4X9HA 4G42A 4YO0A 5JMOC 1IAOA 1CQKA 1VGEL 1YNKL 4PG2A 1UH2A 3ZTNH 3GIZH 2Y5TA 3V95A 4KZEH 2BERA 5SWSD 3OKMA 3H6JA 3QHFL 2UV3A 3KR3L 3T0AA 3BIKB 3OR6A 4X7DC 4NQVB 3FHQA 3C60D 4AH2B 1AO7E 3HNVL 4Y1AB 5E95B 4JRYB 2ZCKL 3RGVB 3TGXA 1K4CA 2YPVH 4AT6A 1MEXL 2Y72A 4XBPB 4PJ5B 3DVGA 3O3UN 4YHZH 5C07E 4KJQD 5F1NA 2F19H 1ZHBA 2LU4A 9CGTA 1OAKH 4OCRL 4EZMA 1XMWA 2YXMA 3KXFD 1AGDB 4U6VL 4OCXH 3MYJA 5MENA 3W5NA 5F21B 5DK0A 1FNGA 3UPRA 2Z8SA 3E8UL 3BQUA 4UIMA 4C83A 4XWGL 4YK4C 4TRPH 4LASH 4K7PH 4K2UH 1U8LB 4RGNC 1B0RA 4I5BB 5FYLH 4ZNEE 4RBPK 2F54D 2YN3A 4JFEB 1FBIH 4MA7H 5LGHH 2M1KA 3DSFH 2DBJA 2FATL 1DN0B 2NY6D 5HGGS 3RJQB 3JSSA 1JUFA 4HEME 5KW9H 4M1GH 2E27L 4Y4HB 1CBVH 1EFXD 1IGCH 1NCCL 1KIRB 2I5YH 1A6VL 2XNAA 5C0DA 3VXMA 5ILTH 1Q94A 1NCBL 3QIUB 4N9GB 4KVCH 3REVA 4F2MA 1WBXA 4WFHE 2WBJA 2VR9A 3W9DA 1Q9KB 3QUKB 5C0GB 1OLZA 3UP1A 1Q0XH 3O6FC 1XF3A 1RVFL 3NTCH 4QHMB 1UM6L 1NANI 3FFCB 3N1MC 1OAUH 1PKQA 1J8HA 3REWA 4K3JH 4WNQB 8FABB 2GSIA 3D3VB 3V6FB 5JHDD 1FZJA 4MVBD 1K6QH 3AS1A 1HWHB 4M6NL 4N8VG 1JZ2A 3MZGB 4K7PX 3ARED 1OARH 2FJHA 4HJGB 2CXGA 4Z5RB 35C8H 2CLRA 1UA6L 4XPHH 1WJ3A 1FORL 2D03L 1BVKA 1DTUA 3B5TA 3VI4E 4OF6A 5HHMB 3QIUC 2DJSA 2AEPL 3RKPA 3T3ME 4HBCH 4U1HB 1ZS8A 1B90A 2XKUA 3SJVE 1NBVL 5FCSH 3DRTA 1MAMH 4FFYH 2BVPB 2VH5L 4MA8H 5SWZE 4FP8L 5EWIH 1PYWA 2CUIA 4LEOB 3MFFA 4R2GC 4N68A 3PHOB 4X0KB 1W8OA 5FHAL 4JY5L 3ARSA 4ETQA 3VD7A 1I3VA 4Z7NE 2A6DA 5C0JA 4WW2A 1RSFA 5FYJE 4QXTB 4L3ED 3QBTB 4WEBL 4Y89A 5IMOA 2W9EH 3MLWL 4KDWA 4DVRL 5E8PB 4WTZA 1A9EA 5C7XL 1G1CA 1XGYH 3S98A 1MUJB 4KVNH 2OP4L 4XX1E 1ZHLB 1NL0L 5E6ZA 2XA3A 3QI9D 4JRWA 2AERT 1OW0C 3MA7B 1MJ7L 4WHDA 1S9XA 4EVNA 5E6IC 4J6RH 3O2WL 1LO0H 1EVTC 1J1XH 3HZMA 4X4XA 3NPSB 1J0HA 4OZ4A 5E03A 3DX7A 4G8GB 4IRSC 2D7TH 4HKJA 2JCCA 3U7WH 3RTQB 2PTTB 2Z9TA 5IJKC 2Q6WA 3I50L 1RUQL 4WI8A 1ZHLA 1BZ7A 1WICA 1IT9H 3WKML 3OPZL 3PXJA 4TULH 1T22B 3BGMA 1MNUL 2ATKB 1U92A 3QG6A 3C8HA 1XGPA 2XTJE 5I1DA 3TN0A 1JF1A 5I73B 2JJTC 3QUYC 1OGAA 1TNNA 5K9QG 1FPTH 2APFA 5EOTB 3S96B 1KC5L 3QYCA 3EYUL 1VENA 2PNDA 2YA1A 4JN1L 1AY1L 1N0XH 4XPFH 3VGBA 4DFHA 3VGHA 1NFDA 3B5GA 1EHNA 2J88H 3GMOA 3KPOA 4NC1E 1A7NH 1I1CA 3W39B 2Z92B 4I18C 1HZHH 2R4RH 4G9FA 1KLGA 2DAVA 4XMPL 4MD0B 2IPTL 4ZDHA 3TJEL 4ALAH 2C5DC 4ZPTA 3QXVA 1BEYH 4E42A 1PX3A 4JFFD 2DLIA 2DF3A 1HCVA 1UB6A 4UTAH 2E6PA 2E8YA 3H3PH 1H8NA 4FQHB 4ELMB 4L8CB 5E8DH 3PXHA 5D93C 2O5XH 5TPWH 1F3JB 5ID0B 3BRFA 4OTXL 3FB6A 4CU6A 1BD2B 1A21A 2HTLD 4W6WB 3PWLB 5C0BA 3OKNB 4XMKL 4PY7A 2P48B 4UB0H 1GZQA 3THMH 1GAFH 1MIEH 1CK0H 2DWEA 5INDB 5MEPB 2OP4H 2AGJL 1J0IA 3S36L 2PYFB 1FNEA 5FYKE 1IAII 1DQDH 4QRPD 3QUKA 3GDBA 4P3DB 3CLFH 4A6YA 3CVIH 2X4RB 3GMMA 4RRPG 3EFFB 5F9WB 3TJEH 2PW1B 4NWUH 3NFNA 3UBXA 5EUOB 1RZ8B 5FGSA 4POUB 2V2XA 3NA4A 5J6HB 4Y19B 3EOTH 4NUGH 3A6BL 1AXTL 3L5IA 5C0CB 1P5UA 1U42A 2BVEA 3OKEB 4Z7UA 4D9QD 3AXLA 2BX5A 4BSVB 5SX5H 1DEEA 3P9WB 1B0GB 5CGYD 3V8CA 4HWBH 4LHJB 3CMGA 3MPCA 5GJSH 4IOSD 2ESVA 2ORBL 3B8SA 3MRRA 4NNPL 4MXVF 2FEEL 1AD0A 1WZLA 3CJJA 1IFHH 4D9RE 5IJVB 4Y1AD 1TZGL 4PLKD 3NCBB 3VJ6B 2Y06H 4UQ2A 2DQFB 4Y2DA 5DMGC 2HVKA 3NABL 4FXKA 4O4YH 4MCYA 2ZUSA 2SEBB 2GK0A 4DN4L 1N6QH 4GFTB 1NFDF 3WLBA 1RJYB 5IUSA 1S7QA 4KDVA 4KKLD 4HZLA 4Y4HC 5HHOE 2FNBA 1UH3A 2NW3A 3QFJB 4CNIB 1X6NA 4UI2A 2FJGA 3BD5A 3O6ML 4FQPA 2J4WH 2LVEA 2F74A 1OAYH 3L3KB 3MJ9L 3GSRB 2BNUB 2Q87A 4KVNL 2NZ9C 3I3BA 4X6CE 5IVXE 3DUUA 4DGYL 5JHLH 1DBML 4P46D 3LV3B 1EFXA 3QUZB 1JFQL 2XWBA 2NXYC 3TCLA 4HKXA 1NCCH 3D85A 3RZCD 1T1ZA 1B0GA 5D2LA 5HGBA 3KJ4B 4N1CA 5F3BB 1RULL 4R8WH 2X4TA 3ARUA 2NY2B 1MFCH 2NLJB 1JHLL 3RZCC 4WEMB 5I16A 3ILPB 3H7LA 3BN3B 2NXZC 2AJXH 3V4UH 2UYLA 4LARL 3W0WA 4Y19A 4WI3A 3VFTA 3HZYA 3UYRH 2EC9U 4ERSH 1T7ZA 2EH7L 1MQKL 4EOWH 1BQLL 1RZIB 2J88L 1KYOJ 3TZVC 1ZK9A 4FZ8H 4FFZL 2DD8H 4ZFFB 4JFZH 1IC4H 4BH8B 3LH2H 3FQNA 2DWEB 2EYRB 2NY0B 3RVXD 1RUKL 3DV6B 5EZLA 1MFEL 3UJJL 3VCLB 5TQ2L 1MREH 1OARL 2EE2A 2X4SB 2DYPD 3DVNA 1EH9A 1HSBB 5HD8D 3PWLA 3CVHL 2FD6L 1DBBH 2X1PA 4UQ3A 2VXUL 3IDJA 1D9KD 3QCUH 1TQCB 1BGXH 3NTCL 1RJLA 1JMXA 4I3RH 3RTQD 3KYKH 1FVCA 4GAGL 1T21A 3JWDH 1JK8A 2UZIH 1VACB 2R0ZH 4NCC1 4KRLB 1FO0H 2DIAA 3CCHA 1OGTB 2BMKB 2CDGA 5C08B 1NFDB 1G7HB 2XTLA 2HFGH 3IDIA 1WEJH 1QFOA 2VLRB 1MHEB 5T1KD 4QRQB 1VFBA 3NGBC 4ZODA 2BVQB 4IMKC 4O2EA 4N8VB 4AEHL 2O5YL 3MRQA 1VKXA 2YBRB 1ORSB 4LLUB 2W1NA 4LCIH 4NKOB 4LLDB 5GHWH 3OZ9L 1CFTA 4NO3B 3RWIA 3EDEA 4EKXA 1I8IA 1MWAH 4JY5H 4TNWF 5DRZB 3TO4B 2HTKC 2JJUA 3RDTD 2BOCB 1N59A 1OAKL 5EC1B 4R90H 2RJMA 3F58H 3GGWA 1QQDA 3EOBA 4P3WA 2GKIA 2QSCL 1W72A 1YMMB 5KVGL 1LO4L 1CN4A 4GMSL 4BZ2L 1Q9LA 3IYLW 4M7LT 4NN5C 2L4OA 4NCDA 4PGZA 4K8RH 2HG5A 4KI5F 4K71B 1E4WH 1G7MA 2A74B 3O45A 4NO3A 1IC5L 1FL3B 3RWIB 4XNMB 1JYWA 2VXTH 1NGXB 2BZDA 2MNUA 1DBKH 5J57B 3DI2B 4LP4A 4WFED 4NQCD 3M8OH 1OLLA 1FV1B 2WUCH 2EO9A 4QRRB 3C5ZB 3WNOA 3HC0B 1BQUA 5EZJB 1SVCP 5C0JB 4GOSA 1KB5H 4EN3A 2IAMB 5LAXA 2PXYD 4H8WH 4OLZL 3WJLC 3S37H 3PHOA 2X7LA 1OW0A 2D31B 2XFXA 3HPLA 3IDYC 4PP2A 3SO3B 3WNLA 3WE6B 5SWSE 3DXAB 4KH2A 5FYKL 3BESR 2CDGB 5C08A 1V7NL 4TTDC 3BMWA 5DI8B 3D85D 1QR1B 1OGTA 2BHYA 4KI1A 2OSLA 3I2CH 5E2JA 2OTWB 1X5KA 2VXSL 5ILTL 1SJEB 2QKIA 1KGCD 2VE6A 1ZGLP 1T1YB 4WWKB 1RMFL 4Y5XB 4O58H 3QDAA 3FFCE 1E4XH 3KGRA 3L3DB 4TOYH 3HE6C 4NZUL 5HBBA 3K2UH 4FFVD 5DJ8B 3C8DA 5DUBA 4F7EB 5TJWK 4O00A 1ZHKA 2R69L 2F53A 3ROOB 5JXEA 3HI1B 2DQJH 4HUMB 5DTFA 1VEPA 1K4DB 4S1DC 5DR5L 4G5ZL 1IC7L 2X4SA 3X17A 4WCYL 2X89A 1H3XA 2NY1B 3CXHK 2BNRD 3R06A 1QOKA 5EFIB 2DQHH 4K8RD 1CFVH 1XF5B 3BPNB 1J1OL 4I77L 4YE4H 3QIBB 4OCRH 1UWEH 3RY6A 3W9DB 4I18A 1OPGL 1WBXB 3DMMC 3SCMC 1EHLH 1JNLH 1A0QH 1S8DA 2YN5A 1G9EA 3T1FB 2VZUA 4GRWB 3DMMB 5KN5B 1FL3A 4XMLH 4OI9A 4O5LL 4UILH 1MVFA 3O3AA 5FYKH 2EYSB 2GSGB 2RFXA 1JUFB 2Q20A 4Z7WF 3RDTB 4PJ9B 5FB8B 1TDQA 2EZ0D 2R29L 2CIIA 4K8RC 3QUZA 1SYVB 5JPMB 2E6JA 3IJHA 5DK0B 1KACB 2MQ0A 2KQMA 4A2LA 2HFEB 4JPKH 4DKEL 1S7TB 5MHSD 3SKMA 1QD0A 3LKRB 4UIKL 3SGDH 4E41B 1PLGL 5L2JA 1XR9A 3VGFA 4CVXA 2XTJD 4Q97A 1TIUA 4OUUA 1DANT 1FGNH 2DS4A 4J8RA 1G7LA 3B2UC 4YAQA 1PDKA 4GW1B 4U1JA 2MPAL 3VXQB 3T0EE 4G6JL 3KPPA 5CEYA 5C08D 4IIQC 4AT6B 4OZIB 2HT3D 2QSQA 5FIEA 4Y5XC 5JPNA 4M1DL 1JBJA 4M1CD 3MXVL 1I7ZB 4KXZI 5DQ9A 1JGLL 2FX8L 2GJ6A 3EYFB 3OGCB 3KLSA 2AJ3B 1RIVL 1NMBL 1IAIM 3BZDA 1LEIA 4PB0H 5ACZB 2JK5A 4P49A 1EO8L 1ZEAL 3L3HB 2EE9A 1EEUA 1TJIL 4ORGA 5DJXA 4ZUWA 5GS0H 1JPGA 3QNYA 1C1EH 1LDPL 3VFWA 4GKNB 4KKBC 5TGBA 5IF0B 3DTXB 2VXQH 4JFXA 1EHXA 4QGYA 2ITCB 3VFUA 4KTEL 2VLLA 5IBLD 1OY3B 2EDOA 3P2TA 1PZUB 4NQDE 2VB5A 3V4PH 3QAZB 1U8OA 4ODSH 4QY8A 3IKCA 4FNLL 1RJZB 1DSFH 3RKDC 4FZEH 1U8JA 4L4JA 1FAIL 4Z7VE 3RNKB 1T66D 5ITBL 4Q6IB 3FT2B 4OI7A 4KKNA 3ZHLA 1RZIA 5DEGA 3EYVB 3TFKD 1NC2D 1RIHL 2YK1L 2A9NL 2CR6A 1JNNL 2DQDH 2HT2D 3TO4C 1JGDA 4DTGL 5A2KH 3QIWA 1UM5H 2GEEA 3D0LB 1AJ7H 3UJJH 5KSUB 4Q9RL 3ALXA 3T3PF 2WBJC 1BJ8A 3TPUB 3LEXA 5L0QC 1NH6A 5L2KB 1FVDA 5EUOE 3BP6A 1AKJA 4FA8A 3QISA 2H32A 5EU7E 4RMQA 2C1OB 3E2HC 4OJFL 1AD9A 2ZOLA 4IJ3C 5CEXB 1V3KA 2VZTA 1G0YR 2ARJB 4EI5A 4HG4K 5J12C 2VUOA 1F3RB 4Z7UE 1RUQH 1ND0A 2BNUA 1AIFB 5DEFB 1LO5A 5HHNA 3T08A 2OI9B 3HZVB 1KLUB 4PS4H 1LK2B 5C09B 4JVWA 4KPHL 3O9WB 4I13B 1ONQA 3KPNB 1NLBH 3GRWA 1S7UA 3UTPE 1D9KB 3SDCD 3QG6B 1Z9SA 2DQIH 3PV6A 5I1EL 3C9NB 1OAZL 4NN6B 1M7XA 3BO8B 1VADB 1WK0A 2W65B 2C26A 4JFDE 1MFNA 1OB1B 2QTEA 2VZ3A 3C6LB 1N5AA 5HYFA 1A1MA 1I1FB 5C0AB 1CQYA 2LAAA 3WNMA 3SKMB 4HKJB 2R8SL 4JFYA 3KPSE 1KUMA 1MCIA 2MTPA 4D8PA 4MZ3A 3QUXA 5CSZA 4X7EC 4HXBH 1CD0A 1CLCA 4PJ7F 5T1MB 4EJ1C 3LRSB 4NO0A 3MV01 3U9UB 3BEWB 3WL9A 2XPGB 5IQ9B 5ICYB 2AKRA 2Z91A 4DN4H 3WN5A 4XZUA 1G6RH 1ZWIA 3MV9B 4LHUB 4OFIA 3G6DL 4Q0XH 4YR6A 4MA8L 4HGWB 1MPAL 5AUMB 3MXWH 4JR9H 4J2XA 3NFSH 4GG8A 4TSBH 1CFSA 4HX1B 3VA2C 2Z4QA 2GJ6E 3KLDA 2B5IB 2OTUA 4XB7A 1CGTA 4Q6YA 5I15L 2WW8A 3KPSA 2NY1D 5JW4M 5MEPA 1YEHL 4KKAD 5GJTH 4ZNCD 1JV5B 1GZQB 5ALBH 35C8L 1FYTE 5FHBH 5GRWA 4Z7VA 1OTSC 1UG9A 4PJXA 3C5JB 1C5DA 5IB1B 1U8IB 5J9PA 2IQ9L 3DUSB 5E1HB 1T04B 4XNXL 2D7QA 2D4FA 1KPVB 1JGEB 2Q3ZA 1MRFL 4MHHG 4R96A 5SX4I 3EAKA 3S36H 4JHWH 3QO1A 3UTSE 2P8PB 3GUTA 4RX4D 3OKOA 5DK2B 2BSTB 2R1XA 4OLYH 3V4PL 3HE6A 4U1NA 2WP3T 1DBAL 4RA0C 4PJGA 4JPWH 1K8DA 5JXEC 1MJUH 5HVHC 3HNTL 3REWB 5F7WC 3ZKMC 3PV7A 1JPTL 5HHPB 1I1AA 2FATH 1ZA6B 2CLZA 4MJID 1UJTA 1QSEB 5FUOH 4Y16D 3DBXB 4G5ZH 2H3NB 1FO0A 1FV1A 4X9BA 1M7DA 4M48H 3PQYE 4I2XA 1JPSL 2P5WE 4BH7A 1CGXA 2XWTA 4WV1A 1JNJA 4M3JA 4PV8A 2APTA 4XPFL 1QBML 4HWUA 3BH9B 3VU2A 1VEMA 4U1MB 2CDFA 4QHNA 5IFHH 3QO0A 3O8XB 3QNZA 4FQCH 4KRPB 2CJUL 1YMMA 3DYMA 3NIGE 2JELH 5D7SH 3AMKA 3GGWB 4LKCA 2LABA 2FR4B 4ELKB 4RMVA 1BOGA 2CK0H 4PJAB 3NPZB 1PY9A 2FSEB 5E99H 4JFED 5C0RL 2QADD 5I1GL 4LLMA 2ZUVA 5GS2H 2QHRH 2YR3A 4H25A 4LSQH 2I25N 2WMPA 5FYLD 5I19H 2VDRL 4UT6H 1IQDA 2I9LA 1QKZL 4FFVC 2R2CA 1D9KA 1SY6L 4LLQA 4PIRF 5GGVL 2R29H 3O2WH 3Q1SL 1PKQE 4MWFB 2FO4A 1CLYH 1QR4A 2YD8A 4JKPL 5BJTB 4M9PA 2DM2A 3TJHC 4NNXB 1S9VA 5HI4C 1K3ZA 3GI8H 4YHLL 5IW1A 4NN5B 4L4VD 3SPVB 4G8IB 1J18A 4Y2DC 4EI5B 5ERWB 1FC1A 3VGAC 1DVFB 2Q8BH 3U4EB 3MRIA 3V7AE 3VGDA 4YXHH 4O51B 3OB0H 4U31A 5CD5C 1TQBB 5FXCH 4WFFD 3X3GH 3QXAA 2X09A 5I8OL 2FX8H 2R1WB 3BD3A 5SWSB 2YD4A 4I0KA 1T03L 3IAQA 5IM7A 2NTFA 3GSXA 3NCJL 1BM3L 4Q58C 5EIQA 4CN1A 2N56A 1QLFB 3EKCA 5I71B 5BRZA 1T20A 5I1LB 5CIPB 4DCQB 3VCLA 3FCTB 1J8HB 8FABA 1BLNB 3K2UL 3FRPA 2DM4A 3MV7E 1IGYB 3CMOH 3IDUA 4MJIB 2BY1A 1WAAF 4TVSa 4X7SH 4F2MB 1QPXA 3TA3C 3MLVH 4H26B 5LKNA 4FQLL 4DWHA 3QIUA 4L1HA 3RVTC 1EJ6A 1QLFA 1EEQA 5BO1L 1QFWM 4WFEE 5C0FA 3HNSL 4LHUG 2GCYB 6FABL 3WCYA 3WS6C 1AQDA 1AO7B 1KSRA 2EDNA 1BVLA 4ZUWB 3RA7H 3T2NL 2E9JA 5HYIA 5HSFA 2NMSA 2CKBL 4HH8A 3NACH 15C8H 1TCMA 2ZUWA 4NQDB 1DEDA 3ARFD 4PJIA 2CUMA 4K8RL 4WW2C 1NGQL 3MJ7B 4QOKA 3D39B 3ULUC 3HC3L 4P2RA 3G08A 1Q72H 3H9YA 3VWKB 5JIHA 4CJ1A 4OAWA 1MQKH 5FYLE 3MBEC 3V5KB 1EGJA 3FO9A 2RR3A 1RUAL 4ZO6A 3ZE0E 3V5KA 2IBZY 3O3DA 4M7JH 4GS7B 4LFHG 2J8UF 2XQBL 4ZS7L 4F9PA 1RULH 4R8WL 4WFFE 1ZAGA 2CUHA 3U48A 5DJCB 1TMCB 3QP3A 4O58L 1R3IH 2VL4A 4KI5D 5JNYB 4U2YA 5IJVA 2O5ZL 3ARDC 4MDJA 4MJ6A 1S9YB 1IAKB 4MQXC 2CH8A 1DBMH 1WLHA 1R6VA 1ZT1A 5F6IC 5KVFL 4HWZA 3BPCA 1EFQA 4K71C 4Y4FA 1AHWB 5F44A 2DWDB 1KTLA 5DT1H 4NZTH 4NQEB 3Q1SH 2FHCA 4PREB 5J3HC 1FVEB 3U79A 3C6LD 5CHNA 2PYEE 4LSPH 5EUOA 3JWDL 3ULVH 1KTKE 4Y5VA 4G6MH 3HG1D 5F93C 4RISL 2YC1A 4JO3H 3BIAX 4PJAE 2KZ1B 5HHPA 1TITA 2X89D 1DP0A 2JB5L 5IVOA 2Y06L 3GSWB 4XTRC 5I8KL 3T8XA 1U8JB 5E6YA 3JTSB 4M7KL 5J13C 5B39A 5BRZB 4DN3L 1QHOA 4WFHD 3HE6B 3UTTB 3MV9D 4R90L 4X5XA 1F3JA 1PY4A 4J3WA 4GO6B 4F7EA 2ZUQB 1UB6B 1IKNA 4WFGD 5IROA 3S9DB 1MFBL 3BJLA 3RWJB 3QIBD 2HWZH 4MQSB 2ICWA 3KWWA 3KYNB 4WWKA 2X70B 4LFHD 2HJLA 3QXAB 1L7IL 3L3HA 4DW2H 4EXPX 5LWYL 4EDXA 5IESL 5C2UB 1LP9B 3QUYD 5FM5O 4NWUL 1N2RA 4RGMB 4G6KL 5E2TL 1U8IA 5DUML 4ZAKB 5ERWA 3TYFA 4XVUC 3TYGH 4H1LH 2QQNL 2KPNA 1JN6B 5EBMA 3JVGA 3DYPA 4LQFL 1CDYA 5MEND 4XVTL 2YSSB 3MUGA 3OQ3B 5DJYA 1NGQH 1X44A 1ZANH 4R97C 3STZA 3LN5B 5CP3A 3B6SA 2F15A 3VWJD 4GG8B 4G6FD 1KN2H 3QWRD 4HWNA 3MX0A 3TT3H 1P6FA 4IRJA 4AYFA 1U8KA 1S7SB 5I76B 4PTTA 3UTSD 4GAGH 1CD1B 3HZKA 4QYOA 4Q9QL 4HBQA 1NAMH 4WO4D 2HYMA 1WBYB 3KLAB 2I9TA 4LCWE 3ZYJA 2AKRB 4L4VA 5BMFL 2JIXB 5BW7C 4JZJB 1S7TA 1NGWB 3D1MC 4G8GA 2A1WL 3PWJA 4NQUA 1CDUA 1T3FA 3BSZL 4LKXA 3MNWB 2FD6H 2PCPA 4OZ4B 1L9NA 3O9WC 2B1HH 1R0AH 4RDQF 2P5WA 3FQRA 4BUGA 3QUXB 5MEQB 4IRZH 1JZ4A 5FA3A 3U9PL 2Z8WC 4TUOB 5B21A 2R56H 2A1WH 2HJFB 3O6LH 2PO6C 4JE4B 5IV2A 2NX5E 4D94A 5DRWA 4JM2C 4XHJD 1G1YA 4BQ6A 4GT7A 5I1HH 4NZRL 4KXZH 1IFHL 4MNQD 2F5BH 1TQCC 4K23H 1FCCA 4CAGA 1LEGA 1S7WA 3NCYS 4PJCA 3QXWA 3UYRL 3FOLB 4JM2F 4N0FA 1YMMD 1BZ9A 5BVJA 3CH1A 4NPYB 1KEMH 2CLZB 3BKJH 4FN0A 3SDAD 3ULUH 1ZGLA 2D7PA 2DOCA 3H3BC 3UTQA 5CCKH 3B9KB 3QJFA 3TYGL 1P9MC 2J7LA 4U49A 4YNYA 4V1DA 3OR7B 2AV7B 2ZUYA 1FRGL 2YUZA 3P4NB 3QWOA 4XT1C 3T0WA 1CIUA 1DQLH 2YS4A 4YPJA 3HI1A 1T21B 2ZSWA 1RU9H 1X4XA 4ZAKC 4BFIB 1U8QB 3QZWG 4NCC2 1NEUA 3BXNB 1YEFL 3GSNH 5AG8A 4MAUH 4MJ5A 1T1YA 4O02L 4Y5XA 3B9VA 5BCAA 2NXZB 4QWWC 3SN6N 1DBJH 3ARTA 3GMQA 1A4JB 3ARPA 1EZVX 3I6KB 1FSKC 4RGOH 3IJYA 3RKDD 3IS1X 2R39A 2AV7A 1YY9C 1YQ2A 3DX9A 2DDQL 3ARDB 1G7QA 2K1MA 4Z7VB 5CCKL 2EYRA 1BMGA 1CLZH 3BHBB 2Z8RA 2AK4B 2EIEA 4FQ1H 3MO1A 4RX4A 1P84K 4ZOCA 2CGRL 3D87B 4S1SL 3FB8A 1BFOA 1OGAE 3KPRD 3CDGB 4KK8D 4QY8B 4KKCC 4P9MH 4Y5VB 3FQWA 4G6ML 4OD1L 3RL2A 3QG7H 3IS0X 2G2RB 1HKLL 3OXRA 1HI6A 1Q94B 2GT9A 2IGFH 5C0DB 3GSVB 5HHXH 1KBGL 4G7YH 5GGRY 3ZKSD 4QRTB 2HMID 2A77L 3KJ6H 3LQAH 2AEQL 4WGVB 4CDGC 2CRZA 2D7OA 4WIQA 3GSOB 5IF0A 4F15C 5J0BA 5JLZB 3GJEA 3I9GL 5L7XH 3PL6C 4KUZL 5DHVB 3O6FA 3GIVB 3SDCB 1CICD 3OHXA 4BQ8A 4R0LA 5EORH 2DQDL 5FA3B 2BDNH 2JK5B 2DQGH 2BNQA 4FABL 3KXFB 4DVBB 3DUUB 4YXLL 2NW2B 1RUML 1WV7T 3S34L 1EXUB 1Q1JH 5IB3A 4BFBD 4MXWH 3LPFA 3DHMA 2ZUXA 1UM6H 1JPTH 4BZ1L 4ZTOL 2D7TL 1WBYA 4U1SB 4FZEL 2F8XC 3CPLA 4YBQD 4ODSL 1BQHG 5HYJD 5CS7A 2AXFA 4YIQA 1KN2L 3RWGA 3BZFB 3VE0B 4HT1H 3OAYK 4NQXB 1FCGA 4V1DE 2E27H 2Y4SA 3SE4C 3TF7C 4IIQA 1S7QB 5KG9B 3ROLA 5T1KA 3H9SB 1MRDH 2GTWB 1I9EA 4FXKB 4JHWL 2VWEC 4PJ8D 5DQJA 3WFEH 4Z7WB 5GS0L 3DSFL 5DMKA 4R4FL 5GIRB 3TFKC 3N9GH 4MS8D 4DK6A 2PTVA 2VSDA 1XF2A 2W9EL 3FRPG 1NMBH 1NBYB 2NR6C 2V7NA 1NJ9B 5LXGH 3SDCA 2JJVA 1FNSH 4G9FD 3G5ZA 2B39A 1YC7A 4AMKL 1KPUB 5HHVL 2EKSB 5IROC 2RFXB 3OWEA 4FTVD 3LKOA 3RVTD 4ZD3L 2RBLA 2VDOH 3NA9H 2VRAA 1P7QA 3ME0A 4QRUB 5GSRA 2B1AL 3A6OA 3QDMB 5KVEH 1HI6B 5HDLA 2E3VA 4DUWA 4BQCA 4NO2B 4A6YB 4YLQT 4UDUA 5I8KH 1WQVT 2LQRA 3N06B 2OLDA 4X6DA 1D6EB 1IBGH 3DSNA 4KV5E 4HCRL 1FC2D 3EJZD 3MYZA 1KELH 3FCTA 4NM4L 2P5ED 3AAZA 3DUHA 1MCLA 5A16A 4LSPL 4OFVA 2VQ1A 4X5WB 3RJDA 4JZJC 3LQAC 1MIMH 4P9HL 3WFDH 2ICEB 4PGCA 4IDJH 4Q2ZB 5D70H 3CLEL 1L0XA 5IVZA 3P0YH 2OR8A 3DTXA 4HIHA 3LKPA 2BHZA 1LNUA 2VIRB 3QUYA 4WU7B 1A47A 4HWBA 5IBTH 2XZAL 5LCVH 3BKYH 5DZLA 1BFVH 3QI9A 4GKSB 5F3HA 5EULV 1ZTXL 3X12A 4QRPE 1MRCH 2XTJB 4M03A 3T77A 4WEBH 3MMEA 1GL4B 4YXHL 3W0WE 2FHFA 4NBYB 4P46A 1R3IL 3B3IB 5LCVL 5FUZL 4RMUA 5FV2A 3ARQA 5IHUH 4OGAD 4HUWA 3TT1L 1S9VB 3QPQC 4ZFOL 3CNKA 1QSEE 1F02I 5KSVB 4OZIA 2WSKA 4IDJL 5EDXA 1F45A 4LNVA 4PJGE 2Y9RT 3VE0A 5ALCL 1KG0A 3UBXI 1TJGL 1IQDB 2I9LB 3LSOA 2OMNA 2CLVA 2IFGA 3DRQA 1NQBA 5I19L 3HAEH 3X14A 3QXDB 2NZIA 1B0WA 1U93B 3CSBA 3WDIA 1YNLL 5EIIA 5CD3B 1I9IH 1CZ8L 4JFOB 4QCIA 5C0RH 1D7FA 1U36A 4PJAA 3SDDA 5EBLA 5IB4B 1Q9LB 3K8KA 1KJVB 3C2SA 3H7BB 5ENWB 1RZKL 1LO2H 1AGEA 3QJHA 4XI5C 3MOAH 1I1AC 5HY9B 1T7YA 3FT3B 1A1NB 4TUJA 3AU1B 4F7PB 2ESVD 2ESVB 5F1IB 3RWCA 2PCPB 1YMHA 1MCCA 4H0GA 2WK2A 4QHNB 1QRNA 4XBEH 5I8EB 4JQVC 1E28B 5D7JD 4JEGB 2HA1A 3EO9H 5DVNA 4RWYL 4FXLA 5H8DA 5D96B 5DFVC 3UMTA 3BKCL 5CIPH 3GBML 4QRTA 1LO3L 3I84A 4F15B 1KXVC 1QSFA 4XAKD 3X3FL 5J1AB 5D6DA 4PRHA 5ADOL 1TJGH 2W38A 1YNKH 4I3GA 4QHLB 4PJDF 3DJ9A 1BIIA 1A6VH 3UYPA 3FQUA 5FUOL 3TBWB 1UC6A 2E9WA 3IGAB 3CMOL 2Q7YB 4MYWB 4KHXH 2F58H 1IGYA 4NQEE 3SGKC 2IPKB 1YN6A 3QRGH 4UBDC 1UXSB 1PYWB 2P1YA 3FTGB 1H15B 1LO4H 4XCNB 4IM8A 4PY7B 5DF0A 2JB6B 3IJYB 3K8MA 4XXCC 5GGRA 4X80L 1ZEAH 4YFEA 3STLB 1HHGA 2F53B 3ROOA 5EBWB 5EU5A 3JZ7A 4FQQA 3SE9H 1MQ8A 1JGLH 4LQ1A 3T0VA 4M1DH 5IR1B 4Z0XB 5E7BA 2O26U 5DMIL 2XT1B 2Z92A 4HS3B 5F6IB 5GS3A 2A2QT 4ZS6D 1JV5A 5EO1A 2EEDA 4NRXA 1F4WL 4KUZH 1ZT4B 2F58L 2A0LC 2VZVA 1MCPL 3BKMH 1KNOA 3HMXH 5BVJB 3MGOB 1WVZA 2FCBA 4U1LB 4YBLC 3NFSL 3MLYH 4PJCB 4WRLA 2Q86B 3HUJB 1WAAE 2XNAB 4GS7C 3GHEH 4XNMA 5IHBA 1G7MB 2A74A 5J06A 4P4KD 4EIZC 1OAXH 2FLRT 5J7CC 1T2QH 3MUJA 5CWSB 3WL9B 4WUKH 1CLZL 5EG6C 5IMMA 1T1ZB 3V79C 4JG0L 1BJMA 4XMLL 4Y4KB 2X40A 4NNYB 3O11B 4AL8H 4HPYH 1GJIA 5CJQH 4YZFF 4Z76A 5HY9A 4OZFG 4MDJB 4MJ6B 4FHBD 4NQCA 3QEQA 3SJVD 3I6LE 3D39E 1IC4L 1KJ3L 3C6SA 3G6JE 4GMTH 4P3CH 5BOZG 2D0FA 3H9HB 1JGVH 2HT4C 1EJOL 5EZIH 2XWTB 4P59H 4WV1B 4CL7A 4FQ2L 5T1LB 2MWCA 2WBWB 4XCFL 2HKFL 1B9ZA 4ZQKA 4R7DB 3CX5K 2YBRA 2BJMH 4NN6C 5GGSY 2AJXL 5JW5A 3SKUD 5HDQH 4WTXA 5SV3A 2F9BT 4RMRA 1ND0B 2WUBL 3NFPB 2MHAB 1G7JA 4L4TE 3MFFB 3WFCH 4R97B 3BE1L 5E2WH 3TA3D 2G9HA 1HHJB 3Q0HA 1G7PA 3SKOA 5CGMA 1EO5A 5C0ND 5IIEB 4GRLA 3MGAA 2WNGA 3IB4A 4PJGB 5KSBA 5IJKA 3OKKB 4G43A 3X11B 2XA8L 1FVDB 2R1XB 1RFDH 3QNXA 3I75A 5EPMB 1R3LB 4X99B 3MRBA 4CN6A 3R4DA 5D2NE 4OQTL 2AJZA 5DHYB 4AM0A 2V2TB 3T4YB 4H8WL 3V5HA 3NCFB 1ZMYA 5J6HA 2FJFA 5I0ZA 1CGSL 2FZ3B 3SDYL 3GMRB 1MCQA 4GJTB 5CJOL 5F9JA 1L7TL 2WLZA 3VXTA 2ESVE 3GJFB 5I9QB 4G80B 1AH1A 1F4AA 1QFWI 4S1SH 2VAAB 3FQNB 4PD4J 2APVA 1N6QL 4HH9B 1IBGL 2J8OA 5DZNA 2VAAA 1BLNA 1MCWM 3BGFB 5ID1B 5F9OL 1FZMB 4F57L 1I4FA 4XNUL 3U1SL 3OKNA 1DUYA 3F5WA 4I2XE 2FZ3A 4M43H 4ODHL 3VFTB 5GSRB 1Y0LB 4OM0L 5E6IB 2WWKT 5BQ7B 3K81A 3GSXB 5GGTL 4M61A 3FFCD 2XG4A